3L3DA

Crystal structure of hla-b*4402 in complex with the f3a mutant of a self-peptide derived from dpa*0201
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3dA01
2E5EA 2Z91A 1ERNA 1FZJA 3DGGA 4L3EA 3RHWK 1XCTA 1KJMB 1FL6A 2PUQT 4JZOB 3RL2A 2OR7A 4YEEA 3CVHB 3GNML 3QIUA 1G7MB 1L4IA 2X44D 3FQNA 4HKJA 2GEEA 2P24B 1KCUL 4K8RD 2VL5B 4QXUL 4NNPL 3L5WB 4X98A 4NPYB 1S5HA 3BDBA 4KXZH 2BNQE 1MCCA 1RJZB 4JRYB 4YPJA 1RZFH 3NFSL 4ZUWA 1U92A 4NO5B 5IB3A 5I71C 3MRHB 1UC6A 4GG6E 3MV11 4ZFGH 2VLJD 2AJXL 3TO4B 2DBLL 2LAAA 4I18C 4IHOA 4L4JA 4H25B 4UOJA 5DQDL 4Y89A 3MYJB 3U7WH 1XF3A 3X13B 5HGHB 3TVMD 5FHAL 4PJ9A 1MH5B 1R6VA 1ACYL 4RDQF 1BWWA 3AUVA 4N9GB 1R5VA 5I8OH 4GW1A 2D7QA 1VEPA 1UG9A 4OCXL 4U6YB 4XBEL 4BH8B 5LXGH 1F4YH 4YXKL 1Q1JH 3I2CH 4FRWA 4L3ED 1WWWX 1FL5B 4JFEB 2EO1A 2V5SA 1TVBB 1CD1A 3V9FA 2HJKA 4E41A 3WNOA 5KOVC 1GGUA 1N5AA 3PF2A 3QCUH 1N6VA 4LCCA 2W1NA 3KXFA 4HZLA 3X12B 1IAIL 1I9JH 1K5NB 4C57C 4CVWA 4P5KB 5DA4A 5GGVH 2HRPH 1OSPH 2XQBH 4OGXL 4S2SB 1KGCE 1NSNL 4X7SL 4R7DB 3S6CA 5GIRB 1UVQA 1MAJA 1CFNB 3DV6A 2C3VB 3L3HA 4GBXC 2M1KA 2DQEH 5KSAD 1I8KB 5GGUB 5I1JL 1CXHA 4PJ9D 3LS5H 2ICWI 4PRPD 3U4EB 3KGRA 4RFEB 1F42A 2DM4A 3I6LD 4POZC 4XXCC 3RWCB 3S34L 5I71B 1FJ1A 4YHKH 3CVIL 3JWOL 2UVFA 5IESL 3B83A 3VI4F 4TSCL 4R26H 4I18B 5CILL 3UROR 3W0WE 1FDLH 2BJMH 1YJDC 2GW5A 1EK3A 5FV1L 1PSKL 2BSED 3ROLB 4JQIH 2XNAB 3OHXA 3K2MC 5IEHA 4APQD 5DR5H 3PABA 4JO2L 5KVEH 1HINL 3STLA 4U1MA 4M1DL 1M6OA 2AJVH 1W2KT 4MD5B 4U1IB 5TQ2L 4HPOL 2I5YH 4NIKB 4U3HA 2Z92A 3ES6A 4OZ4A 1UB5A 3TBTB 4NQED 4MNHB 2NXZD 1NUDA 1IT9H 4PJ5A 2CXKA 5IFHL 4MQ7B 2X4SB 2JK5B 1Q9WB 4WUUE 5ITFB 1DUYA 3PDOB 2X09A 2NX5E 4G9DA 2OMNA 3TF7A 4PJIA 2EIZA 3VGBA 2VTFA 4RMWA 1ZS8A 4HUXA 1ED3B 1LDPL 1J1PH 2ZUUA 2VQTA 1Q0XL 3T0XA 1A3RL 4CN6A 3ARDC 1G0XA 5ICYB 4DGYL 2AAVA 3P0YH 4QKXB 1PYWA 2FIRT 4ZO6A 4GKSB 1NGPH 4LAJH 3LN5B 4MDJA 1P53A 4RA0C 5GZOC 3KPRD 2EDXA 5IVXB 1YEKH 3ULVH 1JWMA 3HMXL 1BF2A 4ZUSA 3OB0H 2QQQA 4H0IA 2DQUH 1KPVA 5I9QC 4GBXB 1MCPL 4PDCE 3KPSE 4MCYA 2VLKD 1OAZL 2IBBA 1JHKH 1KN4H 5E8DH 4Q9CA 5C9JA 5JORA 1LD9A 4PV8A 5IEKA 4ALAH 3VXPA 4NM8H 4TVPL 4GAJH 1F3DH 1X4YA 4GXVL 3WJLA 5IOPA 4WY7L 5IQ9A 1ZT4B 4HC1H 5EU6E 2DRUA 4S0TD 4RSVA 4U49A 1HHGB 1MWAL 3O3EA 3ARYA 4PJ5D 5CEYA 4C56E 2HKHL 3B8YA 1UXWA 4PUBL 5DVOA 5GSRA 1R0AL 1C8PA 4HQQH 3TYGL 5D6CA 3UDWA 4WDIB 2YZ1A 1PQZA 3UTZB 2A77L 1FV1B 1NEZA 2B20A 3LKQB 2GCYB 4FZEL 4UB0L 5DRWB 4RGOL 3VXME 1XIWA 5H35B 3RBGA 3OV6A 1NFDB 3TGXA 3RUGE 3ZHDA 1D5BB 4K7PH 4LSPH 4P2QE 4U6VH 4JY4B 4PTUB 4QXGH 2UZIL 3A0OA 2CUHA 4UNTA 1PKOA 1XF4A 3VDCA 4CL7A 3PQYB 4OGAD 4DUXA 3SJVE 4OF6A 3HAEB 1JPTL 1ADQA 3O6KL 3BWAA 1QQDA 3VDAA 2VC2L 1FBIH 3DYMA 1F3JA 3EYFA 5EUOA 2J88L 4PJEE 2ZOLB 2VN4A 1JE6A 3ARDB 3MFFB 4HEME 5K93A 1MCSA 2I9LB 1EJOH 1KB5L 5I18L 2DKMA 4MNGE 2X4OB 4HDIA 2AP2A 1Q8MA 1W0VB 4Z7UA 1FLRL 4KK9D 3EO0A 3SY0B 4EI5A 1G6RH 1FVEA 4XWGL 5I9QB 2X10A 4XPTH 1X5JA 2BMKB 5EO1A 2AEPH 4ODXB 2R0ZH 2R4SL 4R90L 3GJEA 4GW4A 4MD0A 3QIUC 3VWKA 2FEDD 1ZLUH 3HZVA 1R5WA 4MA1C 2OXHA 2B2XL 3FCTB 5GJTL 5JIHA 5SX4I 3VFRB 3LY6A 1ZT1B 1JZ7A 1BVKA 1I8MB 1L8JA 2IFGA 1U42A 3PP4L 4K94H 3QDHA 1OGAA 2C4FU 5I0DA 3QZWB 1A6AA 2VJXA 1T22B 4GSDH 3U2SA 4MWFA 4P4KA 5F89A 5GS2D 1HHIA 2R9HC 4TUJB 2X4NA 1UWXK 5HYJE 2A6KB 2P5EA 3J8F7 4RZCA 4FG6C 5CEXA 3SKNB 1A7PL 3V52H 2DIBA 3BO8B 3EJZC 5HYSG 2ESVB 3PJSA 1J1OH 2X1WL 2X4PB 4YHPB 3IU3A 3Q5TA 1P4LA 2O93L 1HYRC 4O2CA 1TJGH 1XGUB 5J3HD 2CDGA 1JNNL 5H94A 1HZHH 1DQJA 2EH7L 4J23A 4J2XA 2DQHH 4N9OB 4QRRD 2DM2A 1IBGL 1AQKL 3RY4A 4P5MA 4YHMH 1IVLA 3SDCA 2WY3A 4DCQA 4FFWC 4JO3L 3BX7C 4H1LB 2AEQL 1NMCC 3T04D 1CE1L 5TPWH 3S36H 4LSSH 3VWKD 4XC1H 1N5YH 4LCCC 5F88A 4N0UB 4ZO7A 2Z91B 3GJFH 2MWCA 5L2KE 1FZJB 1YUHA 2OL3A 3DGGB 5F96L 2P4AB 1DE4A 4IOFC 4X83A 4YUEH 1FL6B 3RL2B 5FUCC 5SV4A 3QIUB 5ECJE 5C08A 4UIKL 4DN3H 4YNYA 2Y7QB 3OXSA 3FQNB 2YK1L 1QSVA 3FQXA 4MA1B 3VFWA 1Q38A 4QF1A 2AXFA 4NBYB 2DQDH 4X98B 4O4YL 1S5HB 4UZGA 3WLWC 4LVNB 4YAQA 2HFFA 3QDAA 3U0PA 2VR9A 2R1WA 3HI5L 3QA3A 2JJSA 1U92B 3UTOA 3WO4C 2B8OT 5IB3B 3UJTL 4KUCD 4Y19A 3RDTD 4HKZA 1A7QH 2BNRA 2Q3ZA 3GNMH 2YD7A 1NGWA 3UPCA 3M45A 4IHOB 3ZL4L 3CSBA 4P2CG 4KV5E 1LWRA 1KCUH 1IGJA 4NNPH 1XF3B 2CQVA 3AAZA 3BUTA 2R56L 1RQ5A 2BSSA 5ILTH 2V5MA 1NCCL 1QBBA 1PBYA 3FB8A 2BNUA 4GW1B 4ERSL 4ELMF 4P23D 4Q9RL 2DTSA 2EYRA 5EIIA 4OCMC 3C08L 1FCGA 2I60L 5BW7A 2DWEA 5C3LD 5JPNA 3DVNA 1UH2A 5D1XA 2DBLH 4JG1H 4ZOCA 2HJKB 2ATKA 4E41B 3ZKNC 2WWKT 3UBXG 1NMCB 4V3DB 1N5AB 1GL4B 3TF7C 4LASL 5C0AD 1RZKC 2EYSA 4AEEA 4HV8B 4WO4A 1ACYH 4LCCB 3KJ6H 4QRPE 4EUPH 3KXFB 3UTSA 2YHGA 4CRPA 2FEEL 1ZSDA 1XMWA 4OCXH 1ES0A 4FMKA 5LQBH 4XBEH 1CFSA 4NRZA 4YXKH 5T1LD 2OJEA 3AGVA 2Z8RA 1U2HA 2BNRD 3TA3D 4KPHL 1UVQB 2YXFA 2ZCLL 43CAA 3OKMA 3DV6B 3L3HB 2L7JA 5FGCB 5IMLA 3L5HA 5KVDL 3L7FA 3IDMA 4J6RL 2BNQA 2X6MA 1N59A 4JDTL 2VIRA 3LKOA 3WO4B 4RWYL 1DCLA 1RZJL 4PY8J 3TC9A 3WJLC 3C5JA 3QUML 1OARL 5HGDA 3ZDYE 1FJ1B 3WXWL 3X14B 3ZKMD 4XPGL 4GG6A 1VESA 4OGXH 3TFKD 1T7XA 3VFMA 3T1WA 5GS0H 1NSNH 3TPUE 4MZ3A 4P59H 4YBQC 3WFCL 2A38A 4K2UL 1NFKA 3OHXB 3UDWC 5IEHB 3D2UA 4JLRA 3PABB 3QDJD 4WFEE 3TCXA 3STLB 3B9AA 5I1JH 1XIWC 3QULB 5HHPA 1MCNA 5DUML 3UTSD 3D0LA 2Z92B 3S34H 3ES6B 4OZ4B 1UB5B 2A6DB 2VRAA 4RBPK 2BVEA 1EMTL 2CLRB 2H6PB 3VD9A 4MNQD 1NGZA 4PJ5B 4PJAF 4Z7OE 4TSCH 4LPCA 4JHBA 5CILH 4ZYKB 5FDWA 1DUYB 5DEGA 3MXWL 4KY1H 2B1AL 4G9DB 5EBGA 1W72L 1TZGL 4PJIB 5CLTA 2EIZB 3DX8A 1CICA 3LQAL 4HUXB 4U7SA 3GSRA 4JO2H 1NAMA 4S1SL 4M1DH 5ENWA 2VUYA 1J8HA 5DHYA 4YQXL 1PYWB 5F7LB 2FECL 1JNHB 1WQVT 4MDJB 3RZCD 2L4OA 3JV4A 5HI4C 5IFHH 2MPAL 4YFDB 1JWMB 3MRIA 3LKNB 5DI8A 4ZUSB 1DLFL 1LO0L 4AQOA 1NQBA 4EI5C 1F4XL 1KPVB 4MCYB 4PYHA 3B9DA 1X5HA 1NC2B 3CDGA 5C9JB 5JORB 4CKVX 4PV8B 1RV6X 4D0DA 1JGUL 1Q0XH 1IC1A 3VXPB 1CBVH 4Z76A 2DI7A 1A3RH 5E6YA 4KTDH 4NO0D 3A67L 5IOPB 4DGYH 3EW3B 5IQ9B 4G9FA 3FL7A 3O3EB 5FYKE 5H2BA 1H3UA 3FB7A 3K0WA 1A64A 4G8IB 4HCRA 4PP2A 3HMXH 1J9CT 1GJIA 1UXWB 3W0WA 5FUOL 2V5TA 1JVKA 1QFWL 5GSRB 5D6CB 1MCPH 3QG6A 4JRXE 4WI2A 1PQZB 3JWDH 1OAZH 1NEZB 2HAZA 4CUCA 3C5ZD 4U1SA 1XIWB 3FFCD 5FV2A 3MFGB 4P4KC 4TVPH 4ENED 3NCBB 4G6AC 1CR9H 1T7VA 1F58L 1J8HD 1NMBL 1MWAH 1XF4B 2APXA 2YPLD 3BMWA 3AS3A 5HI3C 4WUUA 3CLFL 3KR3L 1CGXA 5T5FL 3I85A 2NX5A 2HKHH 3WNNA 1NC4A 3BWAB 4HIXH 1QQDB 3MRFA 3CSYA 1I3RA 3TYGH 1J0IA 1EAJA 2A77H 4FZEH 4WTZG 3SDCC 3EYFB 5EUOB 4QHKJ 4HK3N 3QXAA 2UUDK 2ZCHL 3NA4A 3GRWA 1U8LA 1CGVA 3IXAA 1M05A 3FT3A 4HUVA 4HDIB 2UZIH 1UADC 9CGTA 5EWIL 3BDXA 4G9FD 4Z7UB 3EO0B 1JPTH 4EI5B 5A3IC 1FVEB 3UJIL 2VABA 4BSVA 5EO1B 2VC2H 3KPSA 2F5AL 3JV0A 3GJEB 2P46B 5D71H 3FQRA 2AK1L 4GW4B 2J88H 1EV2E 2HT3C 1HHHB 3JTSA 5HGAA 1R5WB 1MAKA 5HYFA 2C7UA 3V8CA 4XVUC 1KB5H 4KKAD 5I18H 5EU6A 4WRLA 3NN8A 4O2EA 4WVRA 1BVKB 2ERJC 4MB3A 3H9SE 3DTXA 4H8WC 4NQCD 5L9DL 4C56A 2JJSC 5IHBA 4JKPL 2L0DA 3DSNA 3MREA 3N50A 4XWGH 1OGAB 1FE8L 5CKGA 3U2SB 4PLJD 1AD9A 3SDAA 4V3EB 2R4SH 4MWFB 1IC4H 2PTUA 4P4KB 4W6YB 1HHIB 5F89B 3VXMA 2X4NB 3VE0A 2P5EB 1T83C 4RZCB 2X89D 5CEXB 4KKLD 3RUGA 4BFEA 1P4BL 2B2XH 4P2QA 3PJSB 1A6WL 1OP3K 5GJTH 3IU3B 1IM3A 1P4LB 4O2CB 2CDGB 4JKLA 5H94B 1QRNE 3TWCL 3W5MA 3QIWA 4Z7QF 3TNMA 3MUHL 3PP4H 1HWHB 4P5MB 5BW7C 4BJLA 3SDCB 2EIBA 3TLRA 4DCQB 1XF1A 3U48A 1ORSA 5D1XC 4NHUB 4PJEA 3U7YL 3MLVL 4F9PA 2BY0A 3MLSL 1X5YA 4FHBD 4MNGA 4WO4C 1KIUA 1FLTX 5F88B 1NMAH 3NH7L 5IB2A 3F12A 1YUHB 2OL3B 1XEDA 4Y5XA 1DE4B 1Y6KR 1IBGH 2I07B 4P2RE 3CU7A 5C08B 4KDVA 4Z7WE 5SWSD 4YNYB 3O4OC 3OXSB 1RIHL 2XWTA 4JO3H 3SDAD 2AEQH 3FQXB 4OV5B 4HLZG 8FABA 2JB6A 3SGDI 3VFWB 4KROD 3VXMD 2EC9T 4QF1B 2AXFB 2IGFL 1CE1H 3BQUC 4O58L 4YAQB 4RRPG 4KI5E 1QFOA 2HFFB 2P49B 4NC1E 2ERJB 2ZJSL 4P2QD 3U0PB 3ERYA 1EZVY 2R1WB 1ZLSL 4LIQH 5IHLB 8CGTA 4Y19B 5HHOE 4XP1H 4HKZB 4M4PA 1EVUA 2H32H 1ZA6A 2P45B 5EBWA 3ISWA 1X9QA 3TEUA 5HYJA 2YK1H 4F7TA 3WD5L 2NY4D 1IGJB 3MC0A 4O4YH 4JANA 3WFEL 5GHWL 2BSSB 2HVKA 4I0KA 3DVGA 3FB8B 5J1SC 1KJ2A 2XTJE 3IAPA 4PJHA 3VMOA 1YMMD 1DN2A 3HI5H 4OFPA 4U0RC 1OD9A 5EIIB 3RVUC 2HTKD 5I1IH 2VDQH 1PLGL 4LVOC 1NDMA 1H3PH 5JPNB 5K59E 5D1XB 2FGWL 3BH8A 1ORQA 4ZODA 3ZL4H 3BP6A 1R3LA 2OTPA 3JV6A 1G9NH 1GAFL 4PP1C 3AREA 2EYSB 3MV8E 1D5XA 1CICC 1UKQA 3SDXF 3LCYA 4WO4B 1QPXA 4L29A 2Q6WA 1ZSDB 4ERSH 4NKMA 2DQJH 1ES0B 5L2KA 2RHEA 1LEKB 2XYCA 1CFSB 4NRZB 3O3BB 2I60H 3Q5OA 4Z8FL 2F9BT 2OJEB 3CVHL 4GRMA 1UZ6F 3O4OB 1JPST 43CAB 1AD0A 3HAEG 3TESA 2CR3A 3O6LL 3VFGL 3OKMB 1N3NA 4LASH 5D7LE 3PL6A 3BQUB 3G6AA 1FRGL 2YN5A 5IMLB 1CE6A 4PJXE 5F7HA 5FGSA 2OP4L 1DBBH 3IDMB 3L7FB 2BNQB 1VCAA 5DEFA 4L9LA 4CMMA 2VIRB 3LKOB 1QLEL 1YECL 4NCC2 3W81A 3C5JB 5HHNA 5IUSA 2NTSP 4GG6B 2FH8A 2O61A 2IWGA 2R2BA 4Q6YA 2BOBA 2HLFC 2UY7A 3VFMB 5IJVB 4KPHH 2ZCLH 1KTLA 5TJWK 1JZ8A 1HYSC 2HTLC 1I8IA 2H3NA 2VISA 3D2UB 2HT2C 1RUAL 2FO1A 4TTDD 1FVCA 4J6RH 2XPGA 1DQDL 1A6ZA 5HHPB 4YIQB 4U0RB 4M00A 3D0LB 5BVPL 1RZJH 1KTDB 3QUMH 1OARH 5KJRH 3WXWH 5L2KD 1MREL 1NGZB 1SEBA 4PBVC 4FP8H 4PJFE 3HI1A 1PKQE 4FQ1L 5FDWB 4C4KO 1G1YA 3MUY1 4Y4KA 5J0BA 5MERB 3QH3A 3DX8B 1CICB 4Y16A 5IVXF 3IKKA 3QZWG 3D3VA 3GSRB 2YD9A 3QI9A 1NAMB 3O2DA 1A14L 4QRPA 3IJHA 5IF0A 2D2OA 3IF1B 5L8JB 1MCOL 5DHYB 4L8DA 3G6DH 1EMTH 3GKWL 2OZ4L 3VFOA 2QJDA 4U31A 2V2WA 1T7ZA 3MXWH 5DI8B 5FECA 1W72H 2F19L 1RD6A 1TZGH 3FAXA 3MGOA 4WV1A 4J3VA 3LQAH 3EFFB 2FLRT 3NCJL 3TBYA 3CDGB 4S1SH 4D0DB 3IFNL 3U4BL 4H1LG 3B5HA 2EKJA 1NFDF 2JIXD 4I13B 2RR3A 5H2BB 3FB7B 4PP2B 4M61A 5BZWB 2MPAH 6CGTA 3TPUA 1LO0H 3W0WB 5DZLA 3MV01 1F4XH 2X1QA 4GRLA 3L7EA 4O02L 1KNOA 3PXJA 2LVCA 3MNWA 1QKZL 3QG6B 1V3LA 5IB5A 3SDAC 2DI9A 3D3VD 2EZ0C 1JGUH 3QI9D 1KB9K 3K4ZA 5D9SA 3A67H 3BIAX 3SGJA 4BH7A 2MQCA 5HHMD 5BS0D 3NVQA 2PR4L 1P7HL 1CFVL 3Q5YA 4ACPA 1MI5E 3GDBA 2PO6A 3LPWA 4WUUB 2NX5B 2SEBA 3QIWC 5FUOH 1NC4B 3GSQA 3MRFB 1QFWH 3CSYB 1I3RB 4DKFH 4LEXL 3QXAB 3OKOA 2EE2A 4M93C 4UT6L 2GSIB 3BI9X 5DMGD 5DLML 2IPUG 1IILE 1JTPA 1ZT7B 3IXAB 1KF9B 3V6FA 1M05B 3VXUE 3FT3B 5ISZA 4M6NH 1F58H 3OR6A 5HD8D 1NMBH 4NQXA 5DD5H 4OFYA 5T5FH 3QRGL 1TJIL 4Y5XC 1JRHI 2VABB 4BSVB 1S78D 1A9EA 2IAMD 3SCMA 3KPSB 5CMAA 1ZHLA 3FQRB 3KLAA 4GRLD 5L6YH 3CIQA 1OVZA 4G7YL 1CL7H 1PZ5A 2ZCHH 3JTSB 4OLUL 2EICA 2P8PA 4LF3A 5FO8A 2C7UB 5D2LF 5EU6B 3UTQA 3NN8B 5EWIH 3HS0A 3T0WA 5EZJA 1T7WA 4O2EB 3EKCA 1XGQB 4PBXA 5DURD 2R29L 3DTXB 3BWUC 3PGDA 1YJDL 3V4UL 1EPFA 3OPZL 4C56B 1O7SA 2PO6D 5JW4N 4R2GD 3MREB 3DURB 1B0WA 3SDAB 2F5AH 1IE5A 5DA0B 3BZFA 2AK1H 3VXMB 1WBXB 3MACL 4Z9KB 1EEZA 2OCFD 1CFQA 3RUGB 2FBOJ 4OLVH 4P2QB 4HFWA 4P3DA 1U8NA 4OQTL 5J6HA 1SBBA 4PJDA 4NBXB 1IM3B 1HHJA 4G43A 4IRZL 5ISZD 4HK0A 4V2CB 1QO3B 3QIWB 5L9DH 3SJVB 3TNMB 4JKPH 1A7BA 4IRJD 4OFYD 2D03L 4L1HA 5DHVH 1FE8H 1I3UA 4PY7A 3OJVC 5KZCD 1ORSB 4M93B 2E9BA 4OCSL 4PJEB 4XCCL 1INQA 4UU9A 5D1QD 4Y5YA 2XICA 3AREC 1P4BH 4ZS7H 3FO0L 3QCTL 4MNGB 5CGYD 4Z7VF 5JHDD 1J8KA 2J4WL 1NBYB 1U8KA 3RBSA 3TWCH 3F12B 3KS0J 2F74A 4Y5XB 2XZAH 5GRUH 4XZUA 3K4DA 4M6OL 3ZTNL 4CU7A 1VFOA 5I1AA 5CGTA 4LLYA 4G7VL 1FAIL 4F8TA 3HCVA 3WNPA 4G3YL 5IW1A 1TVDA 1KLFA 2XWTB 8FABB 2JB6B 3PL6C 5B38A 3MLSH 3LD8C 1LEGB 1IKFL 4ZPTA 4NQUA 5D1ZA 3Q48A 4ODVH 2DTML 3WNKA 4GKZA 3AS2A 4L9LC 4X80H 1AGDA 3NH7H 3H9SA 1U8QA 4EIZC 5GRJL 4XTRC 2Y4SA 2OR9L 3UZQA 4IJ3C 2ED8A 5C71A 1LK2A 1JTOA 1EGJL 3WEXA 3S88H 1OOAA 1ZA6B 4F37F 3OB0K 1SVZA 4RAVA 2ADJA 3T0EE 1RIHH 5HYJB 4F7TB 1MAML 3U79A 2VLRD 3WJJA 4MXQA 3GMNA 1B0GA 4F15C 4JANB 4LHUA 4PRBA 5IBLD 2HVKB 4O58H 1J7VR 1JF1A 1ZANL 3DVGB 1KJ2B 2ZJSH 1ZLSH 4RMSA 1QRNA 4DAGL 1X5XA 4L5FL 3HB3C 2IEPA 2FJFB 4LSTL 4P2OD 3Q2CA 5C0CA 1I7UA 3MV9D 4QLRA 1MEXL 3BH8B 1ORQB 1SVCP 5FYJU 1QFWM 5F72S 1IGIL 2IC2A 3BP6B 1R3LB 3JV6B 4ZQKA 3WD5H 4LVHC 3AREB 4Y4KC 5L8KB 1D5XB 1DANU 1N64L 4Y16C 2W07A 3VGHA 3WFEH 5GHWH 5FK9B 1NEZG 4XCFL 4L29B 1F45A 1KCKA 4EXKA 1U9KA 2VXTL 4NKMB 1YN7A 5L2KB 2VERN 4F57H 3R0MA 4FQQA 4YXHL 4P0DA 1PLGH 2P5WE 1INDH 1WT5A 5F8RC 4NBZB 2HLAA 4BQ8A 4P2RA 2FGWH 1QPPA 2UY6A 4Z7WA 5IKCB 3OJMB 2NMSA 1AD0B 1GAFH 1N3NB 1PEWA 1E6OL 3PL6B 3TJHA 3G6AB 3LD8B 4WV1C 2GK0B 2X4TA 1AO7E 1I75A 1CE6B 3EFDL 5DEFB 2J2ZA 4L9LB 4LHUD 4CMMB 4OZFA 2FATL 3L3JA 4U2ZA 2EXWC 2VKXA 5TDNA 3PHOA 4U1JB 3KJ4C 4NGHL 4IJ3B 5GGRY 2C26A 2WAHA 5HHNB 5HD8C 1XGYL 2E9IA 2O61B 4LQFL 4XB8A 3CVHH 2R2BB 2BOBB 4WI4A 4Y2DA 5C0CD 5T3XH 2X05A 3O6LH 4JJHA 3VFGH 4JPWL 4Q74A 4F15B 1I8IB 3EZJB 1FRGH 2A6JA 4GRLC 4PJIF 2VISB 5D8JH 4PRNA 1XR9A 1FVCB 1T66D 1ZLUK 1YDPA 2XPGB 5EB9A 5KS9E 2VITA 1A6ZB 1KYOJ 1QLEH 1YECH 5E8EA 3LRGA 2HFGL 2QR0A 1D6EA 3SGJC 2E8ZA 3BJLA 1SEBB 1ZGLM 3QUZD 3HI1B 4PJBE 5I74C 2PO6C 2X40A 4M7KL 4LVHB 4Y4KB 3QH3B 1T1XB 4DFHA 3VI4E 4Y16B 4M03A 3MV8A 4ZDHB 1WUNT 4GXUN 3G5YA 3LHPL 1TIUA 1RUAH 4Z18A 4QRPB 3IJHB 1DSFL 5IF0B 1DQDH 3UZEA 3HRPA 5FGRA 3UO1L 4L8DB 3T3ME 2W59A 5BVPH 3HC3H 2P7TA 3DXAD 4K3DL 4OSUH 1WWCA 1MREH 5HYQB 3QWOA 3VFOB 4KJQC 2K7QA 2ARJA 2EYTA 2DYPA 1MHPL 3NMEA 4J8RB 1PAMA 5FECB 4OFKA 2VDOL 4Y2DD 3MGOB 2AABH 4P2YA 4WV1B 2NY3C 5D7LA 1OAKL 4PLNC 2Z8WC 4DTGL 3H7LA 4V1DE 1JUFA 3TBYB 3SCMC 4PJXA 4RGND 2ZNWA 3KJ4B 4P4RB 2W0KA 1MCOH 3R8QA 5CIPA 3LEYL 4MQSB 2XTJD 3GKWH 2OZ4H 3T0BA 5HJ3A 1A7NL 1KUMA 1BGXL 3GJFK 4R8WL 4N0FA 4M61B 2WQRA 1KXVC 4L9DA 3TPUB 2F19H 1WTLA 2F8VA 5DVLA 1MNUL 4K3JL 3VRLE 5LAXB 4GRLB 3L7EB 1KNOB 1TMCA 3MNWB 4DVRL 2D0GA 5IB5B 4OZIF 4FQIH 4RFNC 1M4KA 1TTGA 3LKPB 3IFNH 3U4BH 1GGIH 2WW8A 5D9SB 5EUOF 4Z78A 2X42A 3CC5A 5JMOC 3ULVD 1T1YA 4BH7B 1WTGT 1FQ9C 2QSCH 4Y4HD 3V8OA 4OZHE 5I74B 1KJ3L 1T89C 1B9ZA 4PJFA 2BVOA 2PO6B 1PKQA 3BP4A 3BN3B 2DYPD 2SEBB 3GSQB 1MY5A 2YUXA 1RZKL 2FX8L 4O02H 1QKZH 4XVTL 1P69B 2D7NA 4JFDD 1RK0A 2OK0H 4H20L 2AV7A 3OKOB 2KZWA 4LRIA 5B4MC 1R5IA 2NZ9C 4Y5YC 1N4XL 5IBLC 2C4XA 3V6FB 3F6LA 3LIZL 3OR6B 3EYUL 3RI5K 2PR4H 2A2QT 4GAGL 2ARWA 4AJ0A 1GH7A 4NQXB 4TQEH 3MLXH 4LSQH 4IRSC 1P5UA 3VG9C 4HLZH 2NY3B 5I17A 5K9JL 1DR9A 4XT1C 1A9EB 3SCMB 3P77A 1ZHLB 3KLAB 4MA7L 1N6QH 3PWPE 4N90E 1U91A 4LEXH 3U82B 4MJ4A 4UT6H 5DLMH 1PZ5B 3I3EA 2P8PB 4LF3B 1YNTB 5FO8B 1BJ1J 2IPKA 3QQ9C 4LP4A 5I1HH 5D1ZC 5T1MB 5EZJB 3NTCH 1AR2A 3PGDB 4NO2A 1HH6A 5I76A 4HWZA 2BY2A 3LOWA 1TJIH 4DN4L 3B5GA 4JRXB 4RFNB 5IFAL 3BZFB 2XZQL 4NJ9L 5E6IA 1EEZB 1CDYA 1QFPA 2BVUA 5I8EA 5DRNB 2OTWA 3WJJC 4HFWB 4MXQC 4P3DB 1HNFA 1U8NB 5J6HB 5DFTA 1NANI 4LAQH 2XY1A 4OGYL 1HHJB 3OF6A 4G43B 1MI5A 3MRMA 4HK0B 3ZE0E 3NCEB 3ARFD 2R29H 3TZVA 5DJAA 2FDBP 1YJDH 3V4UH 2EXYD 3OPZH 5DRXA 1ADQL 2Y6SD 2GITB 4WI6A 3ZLQC 4PY7B 4OIBA 1A1MA 1RHFA 3GJFA 1INQB 4LGRB 2ZUSA 4Y5YB 3CK0H 5CJXA 3SBWA 1L7IL 4BELD 4OQTH 4QNPF 3S35X 4RIRB 3P73A 1D6VL 1LO5A 1R3HA 4IRSB 5E56A 4Z0XB 1KEML 3VG9B 1X5KA 3HAEH 4XZUB 4WI3A 1IM9D 2D03H 3ARGA 1WT5C 4LLYB 5DMKA 3HCVB 1IJ9A 5IW1B 4PFEA 3KS0H 4OCSH 2VKWA 3LH2L 4X9BA 4OCNC 1BZ7A 1DBJL 2LVEA 3QEHB 5B38B 3TJHC 3OGCA 2CO6B 5D1ZB 4ZPTB 5EA0H 3E8UL 3FO0H 4GKZB 3REVB 3RVVD 4KTEL 1MCEA 1X6NA 4KI5C 4NC1C 3B9VA 3OF6D 3H9SB 1U8QB 5INCA 5CAYB 5F7UA 4KKBC 3EYQC 5I8CA 5CEZE 3TZVD 3ZTNH 1LK2B 4EKXA 1BFTA 3WEXB 4AENA 3T1FA 4G7VH 4OCLC 1JV5B 1HDMA 1ZHBA 1EX0A 3MJ9L 4RAVB 2ADJB 3V0AC 2BVTA 3LSOA 4Y2DC 5TE7L 3W39A 3LEXA 4LFHD 4CVZA 4LLUA 4YK4C 2J8OA 3D6GA 3GMNB 5IW6A 1A7RH 4PRBB 1IEBA 1IKFH 1ZV5A 2DTMH 1JF1B 1NBVL 4YC2C 3RNQA 3T08A 4N0CA 2XTJC 1YMHA 4KFZC 3FB5A 1QRNB 2E7HA 3CLEL 3J7HA 4JJ5B 4DW2H 2OR9H 4J4PA 5IJKA 2J8UE 1EGJH 3AROA 3MRBA 3S9DB 1D9KA 5I66A 2Q7NA 2V6HA 4ZQKB 5ESQA 4PGEA 1MAMH 4M6AA 3NIFE 4PG2A 4XMPL 1DBML 4HMCA 3QDME 3GSWA 1ZANH 5IMKA 1RZIA 4NNXA 1EXUA 3H42L 4P46A 3OKDA 3CPLA 3PV6A 1T4KA 4J3XA 4LSRL 1YN7B 4PGJA 4DAGH 4FQQB 1LQSR 4L5FH 2OL3L 5GGVY 4GO6B 4AQ1B 5E95B 4LSTH 4ESKA 2HLAB 1G1CA 4P2RB 4PD4J 4GG6F 1FFQA 4H88L 4Z7WB 2WIIA 4IOIA 1IGIH 3VD4A 4H1LH 3TH3T 2XZCH 3CD4A 2C4FT 4R4BA 1ZLWH 5TF1L 3X3FL 2V2TA 2X4TB 2Z8VC 1CDCA 1FYTD 3T0DA 5C6WH 5EOCL 4X7EC 5LBSH 2E8YA 4NFBA 4OZFB 3O3UN 3L3JB 5AYUH 5TDNB 3PHOB 4H8WL 3V5HA 4JFFE 1EUUA 3QO0A 2VDML 4S1DD 5HHOB 3VCLA 2HJFA 5BO1L 2Q87A 5C6PB 4FQ2L 2BSTA 4ZOAA 4JFQA 3RKPA 5IIEA 4Y2DB 5EOCJ 5B39G 3T0EA 5GGTL 4QYOA 4YK4B 1E6OH 4PJ8D 1RZ7L 3BKYL 1Z0NA 2A6JB 3EYOB 4KHXL 4XWOD 3SDDD 4YC2B 3EFDH 1QSFD 4PRNB 5EN2A 3RX8A 3GUTA 3NA9L 1YDPB 2FATH 2VITB 2XTJB 2QEJA 2CSPA 3QDGD 1EZVX 5E8EB 2QR0B 4KJYA 2F53A 1D6EB 3RVWD 4GLRI 4C59B 1NUNB 2A9ML 4MXWL 5BOZG 5DMJB 1XGYH 4ZXBD 4MGXA 3VW3H 4ZD3L 4XAKE 2YD2A 5E0QA 1IFHL 4OKDA 4LNRA 4JPWH 3MV8B 4OGZA 4CU8A 4OUUA 1S3KH 3G5YB 4BK4A 3T4YA 3LEVL 1LMKA 4LRIC 1EO8L 4JFYA 5GS0D 5K9KA 2FJHA 2F15A 4MYWB 2P7TB 2AQ1A 2OJZL 2XFXA 2QADC 5FO7A 2ARJB 4E9LA 1ZTXL 2PYFA 3FHAA 4FQXD 4DGVL 1P4IH 4N8VA 1G84A 5L0QC 4PJAE 3BGMA 5D7LB 1YEDA 3V4VL 1CQKA 2VDRL 4CVUA 1JUFB 1AO7A 3VXRE 2R8SL 4PJXB 5DFVD 1I3GH 1Q72L 4H26A 3ARRA 4Y7MA 3S37X 2MCPH 1DL7L 2HG5B 5ALBL 5B3JE 3UO1H 4M62L 5CIPB 3S96B 2E9JA 5DMYA 5CP7A 4HF5H 5HJ3B 4NWUL 2IQ9L 2F53D 4K3DH 4YBLC 4R4ND 4N0FB 3MUJA 1MHPH 4HWBL 4QTIL 1IGYA 1TQCC 3U0TA 1FN4A 1YEJL 5DD0H 2VDOH 4YDVA 1OAKH 1TMCB 3JUYA 4DTGH 1MWAA 4JE4B 3OAZH 2ADFL 1MVFA 2Q76A 3W9DA 4ORGA 5D7IF 2MHAA 4QO1A 2E6QA 2GJ6A 2VDNL 4K7PY 5E6IC 5KS9A 5M95B 4Z78B 1TJHL 4TRPL 5LGKA 1MY7A 3LEYH 1T1YB 1WIOA 3BD4A 4LKXA 1ZA3A 3ARBD 4Z5RA 3GI8L 1CD8A 1BGXH 4PJFB 5C0DA 4R8WH 2BVOB 1C08A 2MCG1 1PKQB 4PJBA 1F97A 4BYHA 2B0SH 2Q1EA 1F90L 1MNUH 1OY3B 2QBWA 4K3JH 1FZKA 5F1KC 5I1EL 4X9HA 2M26A 3IYLW 5F97E 1JI1A 1YY9C 1H0DB 2AV7B 3BHBA 3EGSA 4MHHI 2ILLA 1IAKA 3RGVA 4LPYA 5C2BL 2NY7L 5CJXC 4WCYH 3SBWC 2AQ2A 4YHLL 1NCNA 2QADB 1JGEA 3QAZC 1VDGA 1KJ3H 2OYPA 4OTXL 1WITA 5C0BA 1VACB 4DQOH 1QLRA 3VXSA 4F3FA 4HGMA 3D87B 3MGTA 5L0QB 1WZLA 4TVPD 4LCYA 1RZKH 1REIA 1E6JL 2FX8H 3DOSA 5SWZA 1WF5A 3T8XA 4JKWA 4MAUL 3P77B 3ARGC 4XVTH 4V1DA 1MJJB 2WP3O 4H20H 1U91B 4QOKD 4QGYA 4L3CA 1E4WL 5FM5O 3NIDF 4KK8C 4MQXD 1N4XH 1WZMA 3HMWL 2IPKB 2GJ6D 2IH3B 1S9XA 3O2WL 4IS6A 3LIZH 4OLXL 3EYUH 2KZ1B 3RUGF 4YBLB 4GAGH 2XKNA 4HCRL 1TZIA 1TQCB 2X9XA 2EO9A 4NO2B 5E6ZA 1HH6B 4OBRA 3TBSA 5I76B 4HWZB 5CSBA 1BJ1H 2X4RA 2D9QB 5JIKA 5K9JH 4CW1A 5H8DA 1ZHKA 3TBWA 1G9EA 4HXAH 4HS3A 3DX6A 5IB1A 4XC3H 1OAYH 5E6IB 1S7VA 5I8EB 2OTWB 5GZND 3FZUC 4U3XA 2Y23A 5TDOA 4PJEF 2P8LA 5DO2D 1T04A 3GFUA 1GRWA 1V3MA 4JO1H 2OI9A 4KDTA 4OZHA 3AS1A 1MI5B 2ZUTA 4PLKD 4KRLB 1N6UA 4RFOL 3B9KA 4N0CC 3OKKA 5DRXB 1OQXA 1NLDL 2F54E 5C0BD 2XG5A 4DN4H 3VXSD 3QQ4A 4J4PC 4UQ3A 5IJKC 2GT9A 3WDIA 5SWZD 1F2XK 2XZQH 4NJ9H 1D9KC 4B7IA 5IK3A 3GRWL 3GBNH 4HFUL 4IIQA 4PG2C 3QAZB 3VXUB 2YBRA 1AGEA 4OGYH 4GS7C 3P73B 3S3SA 4YDJA 1LO5B 1R3HB 1QTYT 4P46C 1CLCA 5AG9A 4G8GD 4FQHA 4IMLA 3LKRA 4LLVA 1ADQH 1G0YR 4TN9A 4AIXA 1BLNA 3ARGB 3MZGB 1SYSB 2D9CA 5DMKB 1KOAA 4Z7QE 3HNSL 3MJ7A 3WL9A 3GBLA 3PWPA 1NEUA 1BZ7B 1FZMB 3IGAA 1L7IH 3SKMB 3N1PC 3OGCB 5D4QA 2V2XB 4MDIA 1X44A 5HI5D 1MCDA 4GUPA 3FB6A 4I9WE 5DJCA 5A1AA 2IG2L 3LMJH 3R4DA 5IBUB 1H8OA 5INCB 1KEMH 2OM5A 5IBTL 1UM4H 5I8CB 3B9KD 1IAII 3R06A 1UJTA 4Y1AD 4HWEL 3T1FB 1OT1A 1HDMB 1ZHBB 5DD1H 1KXQE 3W39B 3LEXB 4NOFA 3LH2H 4CVZB 3T0EC 4LLUB 4Y4FD 1DBJH 1N0XL 3V4PH 5IW6B 3ZT6A 4J12A 1IEBB 2IFFL 3MRKA 3JWOC 3E8UH 1HKLL 4JG0L 4KTEH 1S9YA 3RNQB 4OLEA 1YMHB 3FB5B 3OJDA 3BSZL 4ORZC 1DQQA 5MEOA 2IH1A 4JQVA 4UV4L 2CMRH 3WNLA 3TJEL 2ZG1A 1LVEA 4Z6AT 4OZGE 3MRBB 4JDZA 1JGLL 3DUHA 3H9YA 1D9KB 5I66B 3TV3L 2A0LD 3NCYP 1IZKA 5ESQB 5TE7H 4PGEB 3PUCA 3H0TA 5AZEL 2D4DA 4GS7B 3LS4L 1NBVH 3GSWB 3OAUL 4NNXB 4P46B 1EXUB 5FA3A 3MJ8A 2I27N 3OKDB 3CPLB 3PV6B 4E42A 1T4KB 2DM7A 3KYAA 1QRKA 4LEOA 1FZOA 3BEVA 2VH5L 3N85L 5CWSA 4GAFB 2RCSL 5C9KA 1A02N 4XPAL 3WYRA 2WIIB 4IOIB 3R1GH 4KZDH 1QHPA 4R4BB 4HGWA 4PJ7F 2V2TB 1H3WM 2GHWB 1YYML 1DBMH 2EIEA 4KV5F 1AIFA 2VNCA 3AC0A 3WCYA 4KK5D 3H42H 4K3EL 4FTVD 3SDXE 4HD9A 3V5HB 4ETYA 3BZDA 3TT1L 2OL3H 3QO0B 4JPVL 4XP4L 2HJFB 3VCLB 3ARPA 1AXIB 5A40E 2Y36H 2BSTB 4M7LL 3MBEC 5IIEB 5EZIL 1GIGL 2BVQA 4H88H 4PBWD 3GB7A 5JA9A 3I02A 3T0EB 4QYOB 4CAGA 4NZUH 1UZ6E 1IAMA 2MKLC 4KGLA 1N7ML 3P11L 5EN2B 1NBZA 2ICES 5EOCH 3GUTB 1KJ2L 1VPOH 1OTSD 4H8WH 1ZVSA 4KJYB 1NL0H 7FABL 3NIGE 4C83A 2VDMH 3RKDD 3O8XA 4XBGA 5BO1H 4FQ2H 1CLYL 2GK2A 5E70A 4LNRB 3F7VA 2X7LB 1RZ7H 3BKYH 4X8JA 3PXHA 4OLZL 4OUUB 5I2IA 1A9BA 4KHXH 3WKNA 4F7CA 4I2XA 4HKBA 4LLMA 3KDMB 1U58A 3L3IA 1MOEA 5EO0B 1U3HA 3AFLA 1BQHA 3WHE0 3NPZB 3CU1A 1DUZA 3RGVC 2FJHB 5K9KB 2A9MH 4MXWH 4NQVA 3BRFA 2P5WB 3H3PL 2XFXB 1CDUA 5FO7B 4PYGA 2CKBA 1WEJH 2PYFB 4QHMA 3RTQD 5F6HJ 1MPAH 1IFHH 2GY5A 1CTNA 4N8VB 3WIFA 5CLWA 1YEDB 1FFRA 2YRPA 4L4TE 1AO7B 4JDVA 4JEGB 4H26B 5ICZA 1GGBL 4WI8A 3LEVH 4WHTA 4MLSA 5IROA 2WZPD 4JFFA 4XHJC 3QP3A 3Q0HA 4L4VE 5CP7B 2F58L 1OTUC 2OJZH 3MBEB 1GGCH 3U0TB 2PF6A 3I9GH 1IGYB 4DGVH 5I16A 1FN4B 4Z7OF 2UWEF 4YDVB 5FXCH 1FNLA 1YQVL 3V4VH 4CGTA 2V17L 2VDRH 4Z0BL 3FJTA 2R8SH 2DICA 3W9DB 4ORGB 5A2FA 3D85D 1Q72H 2MHAB 3RJQB 4Z95L 5KS9B 1DL7H 2QLVB 3P4LA 3JVGA 5HI5C 5J11C 1ZA3B 5DK2A 4NWUH 4M7JL 2IQ9H 5DF0A 2V9RA 4JB9H 3RU8L 2OI9C 5C0DB 1C08B 4ZFZB 4KDTC 4PJBB 1JHLH 4QTIH 1JZ3A 4NUJA 1TETL 4RA3A 1YEJH 5K9OA 1FZKB 4MB4A 2J8HA 2YWYA 4NQDD 4CVXA 4S1RH 1NDGA 3V0WL 2H1PL 3WNMA 1J86A 3O2DL 3BHBB 3EGSB 2P42B 5JQHC 2IANE 1FNHA 2VDNH 1IAKB 1L6XA 3RGVB 1TJHH 1BPVA 2X70A 2Q3AA 4K3HA 4IIQC 3QQNA 1JGEB 4W68A 4BZ2H 3GI8H 1QSEE 3QQ3A 2D7PA 4F3FB 1KT2A 3P4NA 3MGTB 3HR5A 1F90H 2W0PA 4LCYB 1JPGA 4PJAA 4DZ8A 3T8XB 5I1EH 5LKNA 4PPTA 4V1DB 3VXRA 1NAMH 5E03A 2W65A 1LK3L 4L3CB 3F7PC 5EORL 3E1F1 5C2BH 2FCBA 1MCWM 1S9XB 4YHLH 4IS6B 2RFXA 4MJIE 1U3ZA 3I3BA 1TZIB 1N26A 4OD3H 2XXCB 3LKSB 5JPMA 1GC1C 5C07D 3S4SA 3TBSB 1HOCA 2X4RB 1N0LA 3ORJA 3TN0A 1UCBL 1E6JH 4CW1B 1ZHKB 3TBWB 4HBQA 1UWGL 4HS3B 3C9NA 3DX6B 4FXLA 2HP4A 4G6FD 4KJWD 5IB1B 5L8LB 1T03L 3HKFA 1MFCL 4V2BA 3OJ2C 4P49A 1S7VB 1VFAB 2W60A 2VWEE 1DVFD 5J11B 5C09E 4PGBA 4FFZL 5TDOB 3HMWH 2CLZA 2P8LB 1K2DA 4D9LH 5CJ8A 3O2WH 2EC9U 4KK5C 1JNLH 2OI9B 4OZHB 4HCRH 2YUZA 3P30L 5D2LE 4MX7A 2NY5C 1A8JH 2P44B 3OKKB 3MXVL 5F3BA 3QQ4B 3L9RA 2EDWA 4JQVC 2GFBA 4UQ3B 4X99A 2GT9B 4Z7NF 4HIHA 1OHQA 3FT2A 3SE8L 2GJZA 3VXRD 3GM0A 4YHYC 4QHUA 2VLMD 2PKDA 5T1KD 4IIQB 2YBRB 2LFGA 1AGEB 1TNNA 2AV1A 2ZSWA 3B9EA 4GQ9L 4F8QA 4YDJB 4K9EC 4NKDA 4O00A 2EDKA 1SJVA 3QPXL 3SQOH 3CJJA 4IM8A 4RFOH 4FQHB 4IMLB 2ZPKL 1LNUA 3LKRB 4LLVB 5EPMA 2IQAA 2JLLA 1SBSL 2W0FA 3UYOD 1CIDA 1HILA 1NLDH 2LV4A 2X2YA 3BESR 1BLNB 2UZXB 1JP5A 4O51A 1JJUA 2NR6D 3QEUA 3MJ7B 3MOAL 3WL9B 3BP7A 1YA5A 3PWPB 4HT1L 2VOTA 4XPHH 25C8L 2XTLA 3GRWH 2AS5M 4HFUH 4MDIB 1EDQA 4LP5A 4XVJL 4GUPB 3FB6B 5FYKL 5JXAL 3ZYZA 4KJPC 1RMFL 3QHFL 4Z7VE 1B4RA 3IFOA 3HI6L 3R06B 5JHLH 5AAMA 3S7GA 2YUVA 1I9IL 1FC2D 2HYMA 1A6VL 2J3SA 4UBDD 3QUXD 2Q86A 3MRKB 3SGKA 3D25A 2YA0A 4PY8I 3O6FC 1S9YB 3O3DA 3I75B 2IG2H 4J3OC 1I8LA 3OJDB 5DC9B 3B2UC 5IBTH 1DQQB 4KHTL 5MEOB 2IH1B 3F58L 4TUOA 2F54A 4EBQL 3BAEH 1S9VB 3V6OA 4TUKL 3O8XC 4JDZB 1S7XA 4RAHA 4HWEH 3QUKA 4X0KA 5DYOA 1BD2E 1CU4L 4YHYB 2RQ8A 2LAGB 1N0XH 1FC1A 4Z7WF 4AM0A 5DS8A 2IFFH 1GPOL 2DMCA 2IADA 5FA3B 2WBWB 1HIML 3MJ8B 4JG0H 4DKAA 4E42B 1KIQB 3MV7D 1U3HC 3O11A 2DQFA 3WS6A 4WFGD 3FTGA 3BVNA 4XRCA 3BSZH 1OTTD 4LEOB 4WWKA 1X4ZA 5FKAA 5HDLA 1T1WA 3BEVB 4WW1A 1C12A 2N4IA 3ZYOA 2Z31D 5C2UB 3TV3H 2GI7A 1SJHA 3OSKA 4PJGE 4X6CE 1HCVA 1OF2A 3KWWA 3P0VL 5BRZE 5F7YC 3LS4H 1AIFB 3N0PB 3OAUH 2OBGA 4CN4A 5JUEL 3L95A 3DO7A 2D7TL 5IROC 1KCSL 3AMKA 4NZDA 3N85H 2VH5H 2G2RA 3E6HA 2RCSH 4DEPC 4FXKA 2C9AA 4XPAH 2BVQB 3GB7B 3I02B 1EHLL 2FECI 1A2YA 1KG0A 4NO5A 2EDFA 3MLRL 3O6FB 2XACC 2ZCKH 1NBZB 4WTZA 2D3VA 4K3EH 2RAMA 4OI9A 1ZVSB 5D5MF 3VFPA 4H25A 1RUKH 1KSRA 3TT1H 3JVGC 3MYJA 4AMKL 4C83B 1KEGL 3X13A 3O8XB 4XP4H 3U9PL 2J8UB 4W4NA 1BQLL 5J06A 4OZGA 4XNXL 2WBJA 2B7DT 1GIGH 4PGCA 1KTKE 3F7VB 3NZHL 4X8JB 2DLFH 5I2IB 1P1ZA 1A9BB 3UYPA 5F7EL 3KPPA 3VRJA 4HKBB 4LLMB 5JDJA 3E2HC 1N7MH 3QDMB 1U58B 2C3GA 3L3IB 3FQUA 1KJ2H 1JZ4A 1KIPB 1U3HB 1BQHB 4PJXF 5TE4L 3JZ7A 5T3XD 2APFA 7FABH 3UX9B 1AC0A 4NQVB 3RVTD 2NXYC 1OW0A 2CKBB 3W2DL 2BSRA 3NABL 4KAQL 3F7RA 4ZUTA 5E99H 1Q94A 4M43L 3GSUA 4JRYD 1W8NA 4QHKI 3WIFB 5CGMA 2E27L 2JJWA 1LILA 1BEYL 1F6FB 4JDVB 5ICZB 2VXSL 4QWWC 3TO4D 3SDXA 3STZA 5FO9A 4JFFB 4ONGL 3MMEA 3H3PH 5KANG 4DEPB 4M9OA 5E2UH 4ZTOL 5FHBL 2ICEA 5IM7B 5I16B 4KWUA 2H26A 4RFEA 1BP3B 3RWCA 1PY9A 2NR6C 4OF0A 3H9ZA 3TN0C 3CSGA 2NNAA 1BIHA 4FOMA 3LZFH 1GGBH 5DWUL 4JFED 5CZXD 1DANT 4Q0XH 1U8HA 4JN2A 2NYYD 3W9EB 1Z2KA 2F58H 1EHXA 5DK2B 3WSQL 1U8OA 4UUJA 5BJTA 4NUJB 4QTHA 3O0RH 2MKWA 5IBUG 5K9OB 1IGCL 4OF3A 4LVEA 5TE6L 4LMQI 4I0PA 1YQVH 1VADA 4CVXB 3E2HB 2HMIC 4Q2ZA 1NDGB 1K3ZA 2ED9A 1CF8L 4JCMA 3UBXI 2NY6C 1Q9WA 4Z95H 3IT8D 4Y2OA 4LNVA 5CUSH 4M8QA 1H9VA 2B1HL 2YD3A 3L3KA 3S35L 2YOCA 2X70B 4OZIE 3INUH 3MRQA 2IJ0C 2NXYB 4K3GA 5JMRA 1BVZA 4MCZA 5ESVB 5C0RL 4M7JH 4RRPA 4UTBH 4AIZA 1F6AA 3ABZA 3QQ3B 4O2FB 4PB0L 3RU8H 4HW6A 3KNBB 1EBPA 4N0YL 2FGZA 5IB4A 1KT2B 3RGHA 4JFOA 3HR5B 4OI7A 3BMVA 1JPGB 4PJAB 4DZ8B 5F3HB 4L4TA 3VXRB 3V0WH 4KUZL 2H1PH 3O2DH 2BXYA 2W65B 1YEIL 3CNKA 1OCWL 3X3GL 2RFXB 4GBXA 1PVHA 4L4VA 5I1GL 4ONHA 3MODL 2KQMA 4N68A 5IQ7L 4BFIA 2DJUA 3GM8A 5JPMB 3WFBL 1T5WA 3S4SB 1HOCB 4XXCA 2JJUA 4UDTA 3TN0B 3U4AA 1S7SA 3P4MA 5ADPL 1WIUA 3C9NB 2DLHA 1LK3H 4XP9L 1ZLWK 4C55A 4Q7DA 5HHXL 5DK3A 5EORH 4PGBB 1NPUA 3KYNA 2CLZB 1K2DB 4YBHA 1AXSA 4OCRL 1R3KA 1MQ8A 3HE6A 1MRCL 3SGKC 1CD9B 4YXLL 3EOBA 1J5OL 4NNYA 4X6DE 4MX7B 4XCNB 1I8LC 3RPIA 4AT6A 1E4XL 5KVMC 5EDXA 5F3BB 4J3WA 1UCBH 5IMMB 3L9RB 4PTUA 4JFHE 1PFCA 4JGJA 1NH6A 2GFBB 5CBAA 4X99B 1UWGH 3V7AE 4HIHB 3U0WH 1T03H 1I7ZA 4OD1L 2NY6B 5JQ6L 1MFCH 1YNKL 3FT2B 3UTPD 2GJZB 2IANA 4CDGC 1NFIA 5EZOL 2DAVA 4RAUA 4FFZH 1MLCA 4UT9H 2HVJA 2ZSWB 5CD5C 1LDSA 4UDUA 3MLZL 4NKDB 5T3ZL 3TIDA 1QSEA 4GBXD 3P30H 4NHUE 1LNUB 5EPMB 2IQAB 3WS6C 1WSST 2W0FB 1HILB 1T0PB 3MXVH 4WWKC 4O51B 4POZD 4ELKB 5DMIL 3RY6A 3FONA 1KYOK 3QEUB 3PWVA 3BP7B 2IPUK 1NKOA 3DI3B 3JUZA 3SE8H 2DMBA 3QSKB 5FKPA 1CDGA 2DD8L 1H3GA 4MJIA 4GQ9H 4G59A 4M5YL 5L7XL 4ZG1A 3THML 3ZE1F 3HE6D 2NY2C 2QQKL 3QPXH 5JOFA 2ZPKH 4F37K 5T33L 3EYVA 3IFOB 4EVNA 1OLZA 5E2VL 1T5XA 2FBJH 3HPJA 4H0HB 1I3VA 1ZT1A 3MOAH 1BBDL 3I3DA 4HT1H 4A2MA 3BFOA 1DZBA 25C8H 4NZRL 4B5EA 1A3LL 5C09A 5JW4Q 3PQYD 2Q86B 4M1GL 4XP6H 3D25B 5CBEB 5JXAH 3FAWA 3O3DB 4CU6A 2H41A 3C6LA 5D7JA 4A6YA 5D2LA 1RMFH 3QHFH 2X5PA 4XMLL 4UILL 5F9OL 1BAFH 1Q0YL 4TUOB 2F54B 3ARDD 2I24N 5DJZA 5BMFL 4HIEB 1I1AA 2X4PA 3K3QA 2EEBA 1S7XB 3QUKB 4X0KB 1SQ2N 5DYOB 2FD6H 2WBJC 3ARQA 5GZOD 5EC1A 3HE7A 3VFVA 2ZUYA 4OV6F 5DS8B 4LCWE 5DT1L 2IADB 5CZXC 2D7OA 4H0GA 5C0FA 1BWMA 3GGWA 3O11B 2DQFB 1YPZE 3FTGB 3BVNB 4XRCB 3QRFM 4WWKB 1J10A 3K8KA 5FKAB 4KHTH 3F58H 4WW1B 4I48A 4TUKH 3KVQA 5GS1A 1OW0C 4UT7L 1B0RA 4X6BA 1WBZA 4N0UA 1SJHB 1NCTA 3N1FC 1CU4H 1DBKH 4ODUA 5EOQL 4DGIL 2MJWA 1OF2B 3KWWB 3S37L 2YD4A 4D3CL 4M5ZL 1GPOH 1OAUL 2O5YL 2QQNL 1RJYA 5C09D 3D1MC 2R2CA 3WXVL 2NY2B 3NGBC 2Y7QA 4N8PA 3L95B 3DO7B 5F9WC 4Z7VA 3C6LD 2P8MA 2G2RB 3E6HB 3WS3A 4FXKB 3P9MA 5TGBA 2ESVD 4D9QD 3DIFA 1VFMA 2DQIL 3TIEA 2Q20A 2CIKA 1A2YB 1KG0B 3ILPA 4HUMB 3VJ6A 2J6EA 1NBQA 1VFBB 4XCYA 3P0VH 5IGXL 1J0JA 3HE7D 4K7FA 2H2SC 1NANH 5JUEH 2X1PA 3VFPB 4LLWB 4DUWA 2D7TH 1J88A 2APVA 2B5IC 3ARXA 1UH4A 1MLBA 4OZGB 2WBJB 3OKEA 4Q58C 1FG9C 3SO3C 3U6RA 4PGCB 1R3IL 1EHLH 4HEPG 5JLZA 1BD2A 1CGUA 1MIMH 1N2RA 4YWGL 1AI1L 4JPKL 3ZSSA 4L8BA 5SWQA 1P1ZB 3KPPB 3VRJB 4I0PC 3MLRH 1AGCA 3IDXH 1BFVH 5KVGL 1GZQA 1U36A 1FORL 3FQUB 3IFPA 4MSWB 3LRSA 3QIUD 1OSZA 1G7QB 2K1MA 4TSAH 3RIAK 4HV8A 1KEGH 1LEIA 4RGMC 3HTLX 4FQPA 2BSRB 3MRRA 1BQLH 2JF1A 2QL1A 4HGKC 4C4KT 4ZUTB 1QZ1A 3E0GA 1Q94B 3B8SA 3GSUB 4PJGA 4X6CA 5FM5M 4XB7A 3FMGL 5F7EH 5BRZA 4Y5VA 3NGBB 1WV7T 1P6AB 5F9WB 1G9ML 3CH1A 3SDXB 1U8IA 5TE4H 3STZB 4YHZL 2R9HD 5FO9B 3SO5A 4DUVA 5KS9F 3U30C 4QRQB 4FG6D 3MMEB 3CMGA 1FGVL 3EJZD 3W2DH 3NABH 3VD5A 2ICEB 2H26B 1X3DA 4PJBF 3IVKB 4FZ8L 4OT1L 1WIPA 2E27H 4JKKA 3X14A 2NNAB 4S1QH 1BEYH 4P48A 2VXSH 4OM1H 4OZFH 3HLAB 4FFWD 1U8HB 2AEIT 4JN2B 4KK6C 1X7QA 5CSGA 1CQYA 4E41D 2B5IB 1RULH 4ONGH 1JZ2A 3HE6C 4G6ML 4Y0GA 5JOPD 1WCBA 3T3MF 1FPTL 1U8OB 4BSJA 5IP4A 4WIQA 4ZTOH 4UUJB 5BJTB 5FHBH 3SO3B 3QULA 2ID5A 4QTHB 2UV3A 3KXFD 4XP5L 3VH8G 1II4E 3WO3B 1QP1A 1KLGA 2A6DA 2H6PA 2CLRA 1ZLVH 4I0PB 3OGOE 1VADB 4Q2ZB 4IOFD 2Y07L 2OTUA 3SKJH 1TZHA 4ZYKA 5DWUH 5JXEA 5BRZD 4M8QB 1P2CA 2Z4QA 1F2QA 3L3KB 3ULUE 3MRQB 5D7IE 3HG1E 4RGMB 3ZE2E 4MCZB 2OSLB 1BM3H 4AIZB 1F6AB 1C5BL 3WSQH 7CGTA 3WLWD 2JB5H 3GEWB 5IB4B 4ZSOB 4AEHL 4JFOB 5I19L 3GMLA 4WFHE 4XAWL 1IGCH 3FFDA 4ZTPL 1RZ8A 1JNHA 4EQ3A 4L4TB 3RY6C 1A22B 1CF8H 1ROWA 3V5DA 3DNKA 3VRLF 3BPCA 4BFBD 1DTUA 2R1XB 1L7TL 1E28A 2I25N 1ND0B 3LKNA 4XXDA 2B1HH 5FUZL 3U30B 1WZKA 5GGSA 3A6BL 4L4VB 1MUJA 4ONHB 1FNEA 5C0RH 1NC2A 4PB0H 3ZMRA 4BFIB 2XI9A 1F6LL 1T5WB 4N0YH 1WCQA 3QEQE 3MJGX 5ADOL 3CFIC 4OZHF 4UDTB 3FO9A 1S7SB 3P4MB 4ODHH 4MB5A 4P5TA 4POUB 4XI5D 1EBAA 1MJUL 1Y0LA 4G8IA 5E08L 4S0UC 4KUZH 3SOBH 2UVEA 5FM8A 1YEIH 2VQ1B 4M9PA 4AYFA 1G7IA 1OCWH 4PD4K 3ZKND 3KYNB 5CIPH 2VWEC 1AXSB 1R3KB 3HE6B 2N7AA 2DM3A 5I1GH 3NIDE 2CJUL 4GLRH 3MODH 3BYYA 3EOBB 5IQ7H 3ULSA 4NNYB 1U6AL 3WFBH 5D7JC 3C6LC 2C1OB 1ZAGA 3RPIB 4AT6B 2VZ3A 4WW2A 5ADPH 1AKJA 5HPMA 5CBAB 2FH6A 1I1AC 1I7ZB 4DJMA 1HCFX 4YZFF 3HZMA 1IRAY 5F70A 4XP9H 2IANB 5HHXH 1NFIB 2PYEE 3BIKA 3MRLA 4RAUB 1MLCB 3HE7C 4OZIA 3ZKXC 4OCRH 4NUGL 2HVJB 1MRCH 5L88L 15C8L 4UDUB 4QCIA 1G7JA 1J0YA 4LDEB 3TIDB 1QSEB 3N1GC 2H2PC 5FOBB 4NRYA 1NC2D 3LAFA 1E4XH 2HH0L 3ZKSD 3FONB 3PWVB 2Z0BA 3CDCA 2AI0L 2VSDA 5GS1C 3IFLL 4P5TD 5C3TA 5JQ6H 1YNKH 2Z93A 1DFBL 4MVBA 5FKPB 4CNIA 5EZOH 5LVEA 4WI9A 2PCPA 4YBQD 1H3TA 1Q9LA 4MJIB 4M6ML 3MLZH 3IS1X 4YH6A 3CFCL 5JW5A 1BQHG 1HHHA 5JOFB 4LPTA 1XIWD 3EYVB 4EVNB 3ZE0F 5FF6B 1WFOA 5E1AA 4MAYA 1T5XB 3HPJB 5CZKA 5DMIH 4LVNC 4CADA 4QHLA 1A6UL 1MCRA 1Z6JT 5BV7C 3CXHK 1V05A 2H9GA 1XFPA 1MVUA 5C09B 5JDSA 1LO2H 5A43C 4I3SL 3EDKA 1YEEL 3BE1L 1JYVA 4M5YH 5L7XH 3THMH 3GMOB 3BKMH 3MJ9A 3BGFC 2FB4L 3OG4B 2QQKH 5D7JB 3C6LB 4A6YB 5D7SH 5D2LB 2Y06L 1K6QL 4X6DA 5J1TC 1LO4L 4XPFL 1TCMA 3H7BA 5GRWA 1E27A 5DJZB 5E2VH 1CGYA 1I1AB 3WFZA 1BBDH 1JFQL 4OF7A 1KELH 2EE6A 4NN6C 5ICXA 5HI4D 5EC1B 4NZRH 3HE7B 3VFVB 4X5WA 3D5OF 3ZKXB 4M1GH 1EIBA 4EI5D 3BW9A 4NYLA 2AJUL 4XBPA 3D39E 5C0FB 1RIVH 3GGWB 4NHUA 4HAFA 2V7NA 2IMNA 4XMLH 5F9OH 1Q0YH 2APTA 1IKNA 5EFIA 4I48B 3BISA 5GS1B 5FYLE 3TNNA 1B0RB 4X6BB 1WBZB 5BXFA 4LHJB 2R0LL 1Z9MA 2NQCA 2CK0L 5D72H 5E8OA 3SEPA 1I1YA 4ODUB 5EIVA 2DL9A 2FHBA 1T2JA 1V3KA 2I07A 1HSAA 5DT1H 1RJYB 5J6GA 3MCKA 1OGAD 4Y5VC 1L0YA 2G60L 2V9QA 1T1ZB 3GO1H 1GC1L 3RWHA 4EI6A 2HN7A 4OB5H 4CJ1A 4OV5A 3G9VA 1KPRB 4P4KD 4Z7VB 1YC8A 1WLHA 2P5ED 2P8MB 3FRPA 2Y9RT 4G6AD 5D7KE 3CAFA 3WS3B 3P9MB 4UT7H 5FYJE 5TGBB 3DIFB 1J05A 4KRMB 5BV7B 3TIEB 2J8UF 2CIKB 3V6ZB 1KN2L 3ILPB 4MJ6A 5HI3D 3UMTA 3VJ6B 5EOQH 4RMTA 4DGIH 1F4WL 4XCYB 4PG9A 4D3CH 5J9PA 1OAUH 2O5YH 1ULVA 4K7FB 2QQNH 3BGFB 4XX1E 3NIFF 3WXVH 4PJ7E 1T83A 3SDCD 5GGTA 2NY5L 4WU5A 1VGKA 2AK4E 4QXUH 5GJSL 3O41A 4PLOB 3VD7A 5A2JH 3C6SA 3O3AA 1MLBB 4GRWH 4FFVC 3OKEB 1B4JL 5FOJA 2FYYA 4NC2B 4NN6B 3S4SG 3U6RB 4HUUA 3NFSH 1BD2B 5JLZB 3RWFB 4HWNA 1N2RB 4XI5C 4L8BB 5SWQB 4PS4L 5A3ID 3UYRL 1AGCB 2E6JA 5IGXH 4LCWA 2AJXH 1GZQB 4K9EL 3IFPB 1SEQL 5DSCA 3LV3A 5J12C 1ZE3C 5JXEC 3LRSB 1QNZL 4DFIA 1OSZB 4PRHE 2HT3D 5DQDH 2FX7L 5C08D 3SE9L 3HA0A 1MIEL 5IMOA 3DETC 2PXYA 5FHAH 1LEIB 3WUWA 4XVUD 4X7TA 3ARWA 3MRRB 2NPLX 3ZSTA 1R3IH 2WM0A 2PW2B 3GK8L 2NW3A 2GQHA 2MMXA 1LEKA 1RZGA 2PW1A 4PJGB 4X6CB 4YWGH 1AI1H 4JPKH 3O3BA 3WLBA 5F44A 5BRZB 1WWBX 3HHRB 3P9WB 4Y5VB 5KVGH 3P40A 4Y19D 1FORH 5C6TL 4F2MB 5FDYA 3CH1B 1U8IB 5CKAA 3LVEA 3BQUA 1SY6L 5CEZL 5MEPB 1BQUA 1AR1C 1IAIH 4D9RE 3PIQB 5MENE 5DTFA 4JAMB 3V6BR 3FMGH 2BVPA 2VN7A 1A4JB 4P5TC 5AEAA 4HWBA 4IDJL 4N1HB 3ZTJG 4X7SH 5IJVA 1UKTA 4OFDA 2UYLA 5K9QG 1Q9OA 4YHZH 4OLYL 5D1XD 1X7QB 4JFXA 2IF7A 3WV0A 4B0MM 3EYSL 1WCBB 1FGVH 3EIFA 1JF6A 1TDQA 4WO4D 2XQYG 4E5XA 3I50L 4YIQA 4M1CC 5INDA 3DARA 4D8PA 4WW2C 3WIHL 1KLGB 1JHTA 1KTDA 2KUTA 1UA6L 3CVIH 3JWOH 1A6TA 5IESH 2OTUB 3GIZL 1TZHB 4F33A 5J12B 3MLTA 2UWEE 4ZUVA 1P2CB 2Z4QB 4KVNL 5MERA 4U3CA 1PSKH 5B3JF 1TPXC 3CZFA 4G6MH 2RIKA 3BQUD 1CWVA 3CZJA 5TQ0L 1HINH 2ADGA 1QBAA 2CKBL 1UJ3A 3SHSA 3S5LA 3IF1A 5TQ2H 3GMLB 4XP5H 2BNQD 4HPOH 4X4ZA 3MOBL 3FFDB 1WAAE 1T3FA 4JVPA 1RZ8B 2FR4A 1CXKA 4QT5A 4QRUA 3C60C 1DQTA 4UNUA 3V5DB 3BPCB 1FCCA 1E28B 4XXDB 1PX4A 4MVBC 1RY7B 3AXLB 2C3XA 5GGSB 5HY9A 3EFFA 4NDMB 1MUJB 35C8L 1FNEB 1LDPH 5ACMA 4G5ZL 1C5BH 2VLJE 2R2EA 3D2UD 3CUPB 3HC4L 5B21A 4AEHH 2JJVA 5I19H 3DPBA 3FO9B 4XAWH 3VU2A 4JR9L 4P5TB 4MAYC 3RVUD 1Y0LB 5BZWA 2H8PA 1L7TH 3CFDA 1S5IL 1G7IB 5FUZH 5DJYB 1H3XA 4PP1D 1X5FA 4XNYL 2FHCA 3QJFA 3CDYA 1CICD 4L3EE 2YWZA 3ULSB 4I0CC 5C8JB 4WW2B 4GXVH 1A21A 2V7HA 4WY7H 3FKUS 1AKJB 5HPMB 3RJDA 3CGTA 1MSPA 3BN9D 1BZQK 1UWEL 5E08H 3HZMB 2VO5A 4L1DA 3G6JE 4EXPX 1DEEB 3MRLB 3BIKB 1NLBL 1KGCD 4OZIB 1K4CB 4PUBH 5KBNC 1R0AH 1TPXB 5D7IA 3HG1A 3EO9L 4QCIB 1G7JB 2CJUH 4UB0H 4RGOH 5ID1A 5CJBA 1HE7A 2ZOKA 2GSIA 4NRYB 4CMHC 2Z8SA 1ZT7A 1OLLA 3EUUA 4FNLL 3Q6FA 1IKNC 1B3JA 3C60B 5CP3H 1OP5H 4GMTL 2NY1C 1FVDA 1BOYA 1U8MA 3DX7B 3Q6GL 3KLSA 5B39A 2Z93B 3VGDA 2HLFD 4CNIB 1V5JA 4PRPE 3O6KH 4Z7NE 3QUYA 1JYWA 2PCPB 3EDJA 1Q9LB 1MRFL 4NUGH 3W0WD 4ODSL 2HTLD 3RP1A 3V0VA 1HYSD 1WZ1L 5F71A 1AHWA 1OD7A 1T2QL 2HT2D 5JW5B 1DEDA 3QEQA 5IR1A 1IAIM 3ZDXF 5E1AB 2HH0H 3HN3A 4MAYB 2DDQL 1QA9A 1UH3A 4WENB 4QHLB 4CADB 2AI0H 2VSCA 1XGQA 3IFLH 1FLRH 3C87A 1DFBH 1HWGB 2H9GB 1MJ7L 1MVUB 4WUUD 3RWEA 5JDSB 2NX5D 3DURA 1IEAA 4NQEE 1NC4D 4R90H 5IT2L 3BUYA 1EVTC 4IMKA 3AVEA 3CFCH 1WBXA 1FYHB 4NOBA 4XNZC 4NT6A 4X6DB 4ZFGL 5CINL 4JRWA 2Z9TA 3H7BB 1E27B 2WLYA 2PN5A 5KSBB 2DLGA 1A6UH 3S3PA 1OQOA 3T65A 4URTB 1QO3A 5ICXB 3U7WL 3SJVA 2PYEA 1HK6A 4X5WB 1MFDL 1MCFA 4I3SH 4X5XA 3BW9B 4NYLB 1YEEH 1NCAL 3BE1H 4XBPB 5LXGL 2FB4H 3KPRE 3KPSD 4CMHB 2V7NB 2Y06H 3T77A 1LO4H 5IG7A 2GAZA 1A7PH 3WBDA 1MFBL 2J5LC 5EFIB 2PXYC 2NY1B 4I1NB 3E3QE 3MO1A 3TNNB 2VLKE 5BXFB 3UP1A 2ITDA 1JFQH 1JNNH 1NBYA 3ULVF 5EU6D 5F21B 3TT3L 5JW3L 5E8OB 2EH7H 1I1YB 1R3JB 3CFJB 4C56D 1AQKH 1HSAB 3NCMA 5J6GB 2AJUH 3MCKB 3QEGL 3ZT7A 3RWHB 3CCHB 4EI6B 2HN7B 2HRPL 2EZ0D 4IDLA 4J3SA 4QXWA 5HPOA 1LEGA 1GYAA 4MS8A 2WV3A 4TPRL 2XA8L 1J05B 3B5TA 4OZGF 3SDYL 1DDHA 2R0LH 4LOUC 4MJ6B 5F96H 4KRPC 3NAAL 3QIWD 4PG9B 1T6WA 5J9PB 3SJVD 3LS5L 2PYED 4TSBL 2VUOA 2G60H 4UIKH 4XNZB 1GC1H 4WU5B 2AKRA 3KYMA 1VGKB 1I4FA 1JK8A 3G5XA 3O41B 3C6SB 3O3AB 1Z9OA 2FYYB 2RB8A 4HUUB 2ZUVA 4KMLB 1KN2H 4U6HA 2FJFA 3UJTH 1F4WH 5IV2A 2AJVL 4LCWB 3EBAA 4XNUL 2I5YL 5DSCB 3LV3B 3WFHA 3N1QC 3D39A 2IBZX 2QV2A 2NY5H 1I9RL 1YPZB 2ZUWA 4EN3A 5IMOB 2J5LB 5ALCL 2PXYB 2EE3A 5CFHA 2R56H 3WUWB 5JZ7D 4P9ML 5FK9A 4X7TB 3MROB 5D5ME 1NCCH 3K81A 1B4JH 4MS8D 1UJ3C 4U2YA 3MRJA 4Q9RH 2NW3B 1RZGB 2PW1B 1E4JA 1J1PL 3BN9C 4PS4H 3WLBB 3C08H 3UYRH 5E2JA 4WI7A 5LJYH 2ADIA 4K9EH 1LP9E 1SEQH 1KCLA 5IKCA 1NGPL 2FX7H 1AGFA 4KGJA 3SE9H 5HDBF 1MIEH 1TQBC 1V7ML 5HYJD 2GK0A 5I75C 1PG7X 2LU3A 2C3WA 3NIGF 3PNWA 3DUSA 4U1JA 3O2VL 5DTFB 4KRPB 2ZSVA 1JCKA 2A74A 5E8DL 1H8SA 2BVPB 1W0WA 5E7BA 4ZS6C 2DKUA 2ICWA 4PJ7A 3OBAA 2UYLB 1Q9OB 4HC1L 4JFXB 3ILQC 5D6DA 4OFVA 2V9TA 2AK4A 1OWWA 5J89A 5GXBB 2FLBT 3ARED 4QRRE 5CEZH 5KVDH 1VEOA 3U7AA 4U1HB 3GKZA 4E5XB 4JDTH 3F7YA 1F3DJ 5INDB 4RWYH 4ZNEE 4D8PB 1CXIA 1JHTB 4NRXA 4WHCA 3DBXA 4XPGH 1A6TB 5BQ7A 3DYOA 3T09A 4F33B 1DJSA 1VKXA 3MLTB 5IVNA 4LSPL 4IDJH 4U6VL 4ZUVB 3LPFA 4NCC1 1T1XA 4OLYH 3WFCH 4PRHA 4N5UA 4TNVF 4X8XA 4K2UH 4ZDHA 3CZFB 3ULUC 2FWOA 3EYSH 3PL6D 2ZKHL 2ADGB 4HJGA 4X4YA 1UJ3B 3I6KA 3S5LB 4QHNA 3I50H 5DUMH 3S8WA 1FBIL 1GSMA 4BQCA 1T3FB 4PGZA 1HKFA 2FR4B 1UA6H 4QT5B 4QRUB 4XTRD 5T3ZE 5HYQA 1MF2L 4IEFB 1ACZA 4RNRA 3K8MA 2A73A 1EJ6A 4J8RA 5D2NE 1RI8A 1OP9A 2B1AH 4X4XB 4G6KL 4KVNH 4U6TA 1TQBB 1W8OA 4AEIL 1JIBA 3H3BC 5HY9B 3QUYC 5I75B 1OB1A 2CDEB 4UV7L 5TQ0H 1AHWC 2CKBH 3G5ZA 2R2EB 4P4RA 4LRNL 5DEZA 2AEPL 1JGDA 4YQXH 4K23L 2XXMB 1U3YA 3HB3D 5FA4A 1MJ8L 2BK8A 3DX9A 2VB5A 1JZ6A 2WP3T 3VXNA 4RMRA 2H8PB 3HZKA 4HG4J 3CFDB 4ODTL 1DLFH 4QEGA 2XA3A 4FA8A 5AUMA 2VZVA 3KPOA 4HSQA 2DIAA 4S10A 5LAXA 4Y4KD 3QJFB 4HS8L 4LGPB 1FNSL 4Y16D 4G5ZH 3T3PE 3N9GL 3QFJE 1T0MA 4IMKC 3LKPA 4K94L 4N5EA 3G9AB 3HC4H 2E3VA 4NN5B 4QRPD 3T2NL 2V7HB 4J7RA 3VWJA 5A16A 5C0AE 2YZ8A 3QXUA 3VI3E 5K33A 3UPRA 1VERA 4JM2A 2JKXA 4YR6A 2UWEA 3QWRA 3RIFF 3IU4L 1J1OL 1S5IH 3QPQC 3B2VL 4NKOA 2XWJB 1U2CA 3NFNB 3VFTA 1TJGL 4PJCE 5D7IB 3HG1B 3B4NA 1GVIA 5ID1B 3SN6N 2E7MA 2DQHL 2ZOKB 3BOVA 2BNRE 2NY0C 4U05A 3QYCA 1AP2A 2EXWD 3MUZ1 2JCCF 3Q6FB 2A1WL 2F8XC 1WAAA 2FRGP 1D5ZA 1UWEH 1FVDB 3QNYA 5CD3A 1U8MB 1QACA 5I1DA 5B39B 3CLFH 2R0WL 3KR3H 1JL8A 1EFXB 1NLBH 3QO1A 3QUYB 1N5YL 3V0VB 3EO9H 4YPGA 2XKUA 1AHWB 4HH9B 2VLJA 2NLJA 3O45A 4JPIA 2BHZA 4YUEL 5AYQA 4WFED 3QEQB 3EJYC 3ZKQD 1YNTA 5IR1B 5JZ7C 4FNLH 3JTCA 5C70A 1NGQL 3V95A 4YDLB 1QA9B 5T1MA 4MS8C 3QG7L 4FFYL 5JR1L 3TVMA 3X11A 3QDJE 3Q6GH 2CD0A 2EDYA 4WTXA 2B39A 4OKVA 3UTSE 3UJIH 3FQWA 3RWEB 1TENA 1OT2A 3NZ8A 1MRFH 2X1XR 1IEAB 4ODSH 4JRXA 1WZ1H 1MHCA 2GYSA 3BUYB 5CZVL 4MNQE 1IC5L 1T2QH 4UOW1 3HRZA 4NT6B 1B90A 4ZOBA 5DRNA 1A7QL 2YS4A 3ZE1E 3VGGA 1HXYA 1ONQA 2DDQH 1T89A 4XHQA 3NCYS 4KJQD 4HH8A 3T65B 2AGJL 2K7PA 4AEFA 4AL8L 3G6JA 2PYEB 4HULB 1MJ7H 5ILTL 4F7MA 4JZJC 4JN1L 3DHJA 5SX5H 4X5XB 2GITA 2NY3D 4FABL 5IT2H 3UEZA 3D0VA 3SCMD 2NY0B 4DZBA 3T77B 3SGEH 5CINH 5IG7B 2GAZB 4EJ1C 1UCTA 4EN3C 4JG1L 1A6WH 1OGTA 4RIRA 3QIBA 3VFNB 1I7RA 3MO1B 1ZEAL 4JGMA 4IRSA 2ITDB 2CPCA 4Z0XA 5KSAA 3KAAA 3LQMA 3ZT5A 5FYKD 1ZLVK 4PRPA 3KJ6L 3AMLA 4MA8L 1MFDH 3KLDA 1NCAH 5LQBL 2Z35B 3KHOA 3IDIB 4JRXD 3U7YH 2MSPA 3MLVH 5F6HI 3QEHA 4N1EA 1MFBH 2BY1A 1TNMA 2WUCL 3IJYA 3REVA 1BBJA 3G08A 3QWQB 4APQA 3PE9A 3FN9A 3ZTJH 3VRIA 3FFCE 1DDHB 4GQPH 4NQSA 3TT3H 5JW3H 2W38A 5KSUA 1QFUL 1CN4A 1KACB 1J8HE 1SHMA 4NQEA 4LPWA 4DWHA 3QEGH 1JV5A 3H2WA 1KCGC 2YPLE 4A6YL 2AKRB 3KYMB 1I4FB 5D6DC 4LU5L 1JK8B 3G5XB 5B4MD 2IGFH 2NZ9D 1YC7A 5GS0L 2DJ4A 5C0GA 4P59L 4TPRH 2WWMC 2XA8H 4GKNA 4X9IA 3LRHA 3QIBD 2P43B 5DK0B 3SDYH 4IRSD 4JZJB 4U6HB 4JJ5A 3NAAH 2DIJA 5IV2B 1F5WA 4TSBH 3MTRA 4PJGF 4X6CF 1SJEB 4UMGA 3QNZA 3WFHB 4G9FE 2HFTA 4XVSL 3D39B 5FCUL 3KPRA 4EN3B 1CGSL 5F7WC 2O26U 4KY1L 5E8PA 1D5MA 3QQ9D 1I7TB 4GMSL 5GISL 3E3QA 5D1ZD 1U3JA 2VLKA 4RMUA 3MRJB 1XZ0A 4X9GA 1PY4A 4M4RA 1RUQL 3EJJX 2I9TB 4R0LA 1KC5L 3H9SD 1J0HA 3HUJE 2ADIB 1UT9A 4XNUH 2OS7A 1FIGL 2XZZA 3BEWB 1I9RH 4P3CL 4NQCE 1AGFB 5ALCH 1P7KB 1IGML 3EHBC 4P9MH 4MJ5A 4MXQD 1C5CL 5DJ6A 2EEAA 3PNWB 3PHSA 3DUSB 5BV7L 4OUOA 2EDRA 2ZSVB 1G7HA 2VXQL 2A74B 4G8EB 5JW4R 1A1NA 1A7OL 2J6EL 1QRND 5AG8A 5SV3A 5HHOA 3VD3A 3WDHA 4Z8FH 1CBVL 1W0WB 1EHAA 4KTDL 4U1GC 2ICWB 4PJ7B 5J8OA 2VXVL 3ZDZE 5E2WL 5F1NA 5E5MA 2AK4B 1V7MH 4WFFE 3EYOA 1CVRA 2OP4H 4ISVB 1CFTA 4PR5A 4CJ0A 5HYEA 3F7YB 4N5EC 3O2VH 1TLKA 3JWDL 3RWJA 4NRXB 3VWJC 3DBXB 4MZ2A 3RVXC 5BQ7B 5HDOA 3N06B 1VKXB 3JWNC 3KLHC 1CR9L 3S98A 5C0NC 5CSZA 4JM2C 2H45A 1FFNA 1ZWIB 2YD8A 4P2RD 4UNVA 4PRHB 1AQDA 4OCWL 2CGRL 1RJCA 2FWOB 3TCLA 3TJHD 2KDGA 4HJGB 5D5MA 4X4YB 4PRIE 1K3IA 5DJ2A 3I6KB 4HIXL 4QHNB 5SWSE 4KI5D 4KZEL 1T0NA 4KKBD 3EYQD 1PG7W 1AE6L 4K8RC 4Z77A 5FM4A 4RNRB 1VEMA 2A73B 4FQ1H 3V7AG 3FN0L 5HHOD 1LP9A 3MNVA 5AAWA 1OB1B 2YRLA 2WBKA 4LDLB 2YD1A 1SMOA 2ZKHH 1A14H 3G5ZB 1NGXB 4I4WA 1FFPA 2HG5A 1CG9A 1JWSA 2D4FA 1JGDB 3S96A 5MENB 1EEYB 5D71L 4WW2F 5FA4B 1J1XL 3DX9B 4U1GB 1MF2H 4JREC 3VXNB 3TVMC 5DC0A 3HZKB 2BOCA 2ITCA 4B41A 3WHXA 2D31A 4G6KH 4NFCA 1YMME 5AUMB 3KPOB 4Q97A 4AEIH 4WJ5A 1FNFA 4U1LA 2W9DL 3B6SA 3NCJH 1QUNA 2OXGA 4QRRA 3GHEL 4UV7H 3MV8D 1RU9L 1T0MB 1HQ4A 4LRNH 1QR1A 1X6LA 4ZNEA 3VWJB 3FRPG 5A16B 4K23H 1IC4L 1MJ8H 3UPRB 2VZ1A 4JM2B 1P84J 3L3OA 4YR6B 2CXGA 2UWEB 4E0RA 4ZPVA 1WFNA 4OQ1A 4ODTH 5HHQA 1Z9LA 4NKOB 4R3SA 3VFTB 4U4BA 5DJ8A 1JZ5A 4HS8H 1FNSH 1G7PA 5T1DL 4U6XA 5D7LD 1EO5A 3KYKL 3N9GH 1CK0L 1H0DA 3QHZL 5LWYL 2EDDA 1AP2B 3T2NH 4R7NA 1GGTA 1D5ZB 4U0QB 3QNYB 1EUTA 3QIBC 5CD3B 1CFVH 3FOMA 5KG9B 1CVSC 5I1DB 2EDTA 1VACA 3K74B 5KSAC 1RFDL 5D2NA 5ACLA 3IU4H 3MGAA 3QO1B 3B2VH 4PJ9C 4YZFE 3WHE1 4PJHE 3QXDB 1AY1L 1NMAL 1M7IA 3PV7A 1S7TA 5HVHC 4YPGB 1AH1A 1MJJA 3RDTA 2AXJA 2VLJB 2NLJB 3O45B 4JPIB 4N0RA 1UENA 2BRQA 4R97C 2IH3A 2A1WH 4X6DF 1S7UA 3WUWG 4JREB 1L9MA 3TVMB 3X11B 3D69A 4W70A 5KSBF 4APQC 4RMVA 2R0WH 3W82A 3QRGH 2COQA 4OKVB 4U1KA 3FQWB 4P23A 2MQ0A 3NZ8B 4LIQL 1MHCB 4L8SA 2W9EL 2NXZC 4L3EB 1XCTB 3RFZC 3HRZB 1DBAL 1B6DA 3QFJA 3TBVA 4G7YH 4XP1L 4OLUH 2R0KL 2ZWLT 4MJ2A 3SQBA 5ETUA 3K4AA 4DKEL 1NGQH 1HXYB 1ONQB 5C0AA 2OQJA 5MI0C 5A2LH 4HKJB 3QG7H 4FFYH 5JR1H 4BA8A 1FG2A 2MFNA 2QADD 4YLQT 5T3ZD 2W92A 1Y6MR 1V3JA 3G6JB 2GUOA 2VDPL 5DUPL 4F7MB 2FHFA 5DQ9A 1K85A 1RJLA 4F7PA 4PJCA 4XNMA 3WDJA 3RWGA 4ZUWB 2CH8A