3L3JA

Crystal structure of hla-b*4402 in complex with the f3a/r5a double mutant of a self-peptide derived from dpa*0201
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3jA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3jA01
2GI7A 5TDPB 3B9EA 1YMME 4N1EA 2B5IB 4XMLH 4YUEH 2G75A 2GTZA 4TUJB 4O2EA 5AZ2H 4OD1L 3LRGA 1NGPL 4HJGB 3OXSA 3MV9D 2ENSA 4C4KO 3GIZH 4OLUL 2ORBL 1SY6H 1NUFA 1UEMA 1BBJA 2XG5A 3TYFA 4FTVB 4HIIA 3FFDA 3CH8A 3VFTB 4AT6A 3IXTA 2DQEH 3NAAH 3PWPB 2NY1D 1OAXL 3HS0A 1JGEA 1L6XA 5C6TH 2VQTA 1NCDL 3GSUB 3NFPA 5EU4B 1E4XH 1I7UA 4K3EL 4ALAH 4OLXL 3S88L 3AU1B 5EBWA 3SE4A 4IRSC 1QTYT 1OGAD 3IFLH 3UTQB 5DQDL 5B38A 5INCA 1ZHBA 4MD0A 4N8VA 2R69L 4XNQB 1YN7B 3TN0A 2R1WA 1UM4H 3U0PB 1KLUA 3T4AB 1P4BH 4G8IA 4APQC 2LQRA 5D2LF 1TZGL 4HUWA 4Y4HD 4I2XE 3ZTJH 1BIIA 2OS7A 4PP8C 1J12A 5CD5D 4KWUA 3BSZL 4NUJB 1S9XA 1JUFB 4KXZI 2Y06H 5IB3B 2LE9A 3FB8B 2F5BH 4JO3H 4TQEL 4D0CB 1I4FB 1K8DB 3RAJL 2GAZA 2A1WL 1NGQH 3PGDA 3EOYG 3CVHL 2A77L 3EYFA 1GOFA 2F54E 3FQWA 4LSQH 3MNWA 4WW1B 3IFOA 1YMMA 2GUOA 1RK1A 3L3KA 4NOBA 2ZNXA 5ANMB 5C07B 3TA3D 1KN4H 4F9PA 4XH2A 1FGVL 1KJVA 5IQ7H 1U91B 1QSED 1MRCL 1EUTA 2L7JA 4HHAB 3HMXH 3L3HB 2A6JA 5KSBE 1RQ5A 3D85D 4L4TB 3ZYOA 3WNLA 5C9JB 4LSSH 4D9LH 1QKZL 4JJHA 4L8DB 4X6BA 3REWB 5ID0A 3LKSB 5MI0C 1DBKH 2EZ0D 3BE1L 4DKFL 2EYTB 5GS0L 3U0TB 3U46A 5ACZA 2NY5H 5E8NA 4LLMA 4HH9A 3LKQB 5IROC 3TYGL 2GK2A 4G9FB 1CDJA 2DRUA 2YMXL 3ZHDA 3C5JB 4PJAB 5CD5C 5DQ9A 1A0QL 1QRNE 3BW9B 3QCUH 4IS6A 4G6ML 3FCTA 3T0AA 1LEIA 5EA0H 1BLNA 5EO9B 1X5GA 3KJ6H 3HFML 2HKHL 4RMRA 5DD1H 1PFCA 4M7JL 4P2RD 1LO4L 4WU7A 4I2XA 1JF1A 4H8WH 1RK0A 3BDYH 3EO9H 3LN4B 2BSED 3RP1A 1IJ9A 2AK4E 3WSQH 2EH7H 2YSSA 3L7FA 3CDCA 3VXSE 4HK3N 3MA7B 3TA3C 3MJ9A 2YUWA 4UTAH 2COQA 3GBLA 5EH1A 2XPGB 5I19H 3L1OH 5IV2B 3BH9A 3TIEA 4HWZB 2XWBA 3EYUL 2F54A 2Z35B 5JIPA 4YK4B 1IAOB 1MFDH 1CLCA 1X4XA 4G9DA 4I18A 3FQUB 3MREB 4QRUB 4F7MA 4XNMB 3MLVH 5DJCB 4ZPVB 4AG4L 3O2DA 2UZIH 4WTZA 1AGEB 4GSDL 3FB5A 3FOLB 4V1DD 3IB4A 2EZ0C 5HGBA 1EJOH 4UMGA 3D6GA 4OZGB 4PGBA 2HKFH 4DFIA 5KSBA 3TF7C 5D1QB 4UBDD 1KXVC 2XTLA 4J6RL 3TFKD 1A5FH 3MRFA 1G1YA 1UEYA 4XC1H 2X4OA 2JCCE 1T89C 5D8JL 2XI9A 1IMHC 1D5ZB 2EH8H 4DZBA 5BOZG 3T4YB 4B53A 1NFKA 5TE7H 4J4PD 2WANA 1TNMA 1BVZA 1DQJB 5FV2A 4LQ1A 1H15B 2WIIB 1II4E 5GRVL 4HS3A 3W82A 5JO5A 2PETA 5ERWB 4ELKB 3C5ZB 5KVFH 4YDKL 1H8SA 1A1NA 1QRNA 1XGRB 7FABH 5FYLH 3DUUB 4FTVD 4GG8B 1HWGB 5HVWA 5I8KH 4AL8L 3G5YA 2IPUK 3WS3A 4YQXL 2X70A 4PJEE 5A2FA 4FFZL 5EOCH 1CG9A 1L7TL 3Q3GA 3PWPD 4HKXA 5GISL 1CF8L 3ARUA 2XXMB 2PR4H 5I9QC 4JR9H 4JZOA 3UYPA 4IMKC 3ZO0A 4JO4H 3DX7B 2AK4A 4Z0XB 3G6DH 5CHNA 3QUZA 1I1AD 2DYPA 2H26B 3ESVF 4Q9BA 3VXSA 5E2WL 1TDQA 4I0PA 2VLME 5E95B 4FXLA 5CUSL 2WUCH 2I26N 5JOFA 2HVJA 1CVSC 3EOAA 3SE3C 1BVLB 4M4PA 3BMVA 1AJ7H 1Q1JL 3ILPA 3X14A 5B3JE 1I7ZB 4UBDC 4XVUD 2I9LA 2V9RA 3LN5A 3TFKC 3VFRB 3Q0HA 2WUBL 5HYSG 2FO4A 1A6UH 2PTUA 2Y5TA 5TH2B 2QQNH 1YJDH 3VFNB 3OKNA 1R5IB 1TETH 3A6OA 3CMGA 2B5IC 3JUZA 5I16A 2IAMB 4PJBE 4HULB 4J4PC 3HG1E 1EEQA 1RZKC 1NLDL 1AE6H 1JJUA 3MRQB 2EIZA 3W9DA 2HA1A 2JCCA 1QBMH 1D5IL 3CPLB 3KWWB 3U7WL 3U4AA 3WDHA 1HZHL 2X4RA 1LDSA 2A9NL 2HTKD 4RFNB 1DR9A 4GW4A 2PTTA 4GMSH 4DCQA 1UVQB 1XF3B 2C5DC 5C07D 2BSTA 3MUY1 3VXRB 1T21B 2BVOA 3X12A 1FORH 2DLFL 4F2MA 1JNNL 5C0AB 3WXVL 5F7WC 3QI9D 1MQKL 4YHIA 1X5HA 4G8FB 1RUML 1I1AC 1TVHA 4S1SL 3UPRA 4IIQA 3UCRA 3EW3B 4PJEA 4HK0A 1CDCA 4CNIB 1NBQA 3IU4H 4JHAH 5IEHA 5GGQL 3F5WB 2YK1L 4OM0H 3FB7B 3ARFA 5FYKD 4LSDA 4LDOB 4XHJD 4LGPB 2R9HD 1J05B 4J7RA 4M6OH 2Q6WA 43C9A 1QSZA 3E6HB 2DJ4A 4XVUC 5TQ2H 4CADA 4NQXA 5MEQB 2WLZA 3RGVB 3TNMB 2D0FA 3QFJB 3IKCB 4C83A 5IOPA 3WFHB 1C5BH 2EC9T 5C0GA 4HG4J 3U0WH 2IQ9L 1T3FA 3JTTA 4POZD 4PPTA 4TVSa 1F2QA 4YIQA 5HHQB 5IB2B 4DVBA 5H94B 1NFDB 1ZT1B 3CAFA 1RJCA 4HCRH 4OZ4A 3T0XA 1QVOB 5AAWA 4GAJL 4FQQB 2CGRH 4OLUH 3GJEB 4LRIC 2J8OA 1CFQB 2XKSA 3HE7B 3DVGB 4PJBA 2HT4D 4YNYA 3HG1A 1I8MB 4EQ2A 4KKCD 3OX8A 5T1LB 5IQ9B 1OAXH 4BKLA 2B7DT 3DHJA 3D5OF 2J7LA 1IC4L 2P42B 2NXZB 4K3EH 4JZNB 4OLXH 5C2BL 5FUZL 3S88H 5C86A 3QEHA 4PG9B 3LEVL 1R3IL 3CCHA 1SQ2N 3DNKA 5DQDH 2BVQA 3UZVB 4X9BA 4F15B 1AFVL 3GMRA 4JQIL 3DLQR 2R9HC 2R69H 6FABH 4YHOL 5D1QD 2UV3A 1EAPB 3K8MA 2Z8RA 4LAQL 4GRWH 5I73B 3GK8L 3PHQA 4PB9L 4DK3A 2XQYG 2XNAA 1ZWIB 4OLEA 3MJ9L 3AY4A 1NCWL 1TZGH 2VRAA 5KN5B 1VFOA 3CFCH 1KPUA 4NJ9L 3CK0L 4XMPL 1T22B 1UJ3A 5I0ZA 3BSZH 2OXGA 2PXYB 4POZC 5GQBA 4KTDL 1UM5L 3PGCB 1ITBB 4GJTB 1S7QB 4TQEH 1N3NA 3BD5A 2W9EL 4NT6A 1I9JL 3L3JB 3O2DL 3C5ZD 2PCPB 2BHZA 3CVHH 4F7EA 4ZNEE 3JTCA 1B0RB 1YYLH 2A77H 4ZUUB 2JJSC 4U6TA 3GSOB 2X9WA 3OPZL 2HT4C 3HZMA 5D2LB 4ZUSB 1CQKA 4WFGD 4YPGB 4ZFFB 4PYHA 4KKCC 1PG7X 4LMQI 4X4YB 1MRCH 1RZ8B 4Y5VB 3IDYB 5E2JA 4DQOH 1WCBB 1NEZB 2X42A 4YK4C 2X4QA 3NIFE 4D8PA 3S9DB 4GW1B 4JFPA 4CN6A 4YHPB 3M45A 3GJFB 2XN9D 5FKPA 1QKZH 3NPSB 3SQOL 1XF5A 3DYOA 3VU2A 4HMEA 2R23B 5D1QC 4DKFH 3RVUC 5GS0H 4C55A 1H3UA 3PL6D 4WGWB 2AKRB 4MS8D 1G6VK 3TYGH 5CBAB 2D3VA 2YD6A 2YMXH 3K8KA 4N0FA 1YN6A 5BVJA 1QFHA 1A0QH 2VUOA 3LS5L 3QNZA 2IAMD 1KULA 2C3VA 4G6MH 5BS0B 2OP4L 4JFED 3UAJD 3FFCB 2HKHH 3HFMH 4FQLL 5ADPL 3O6LH 4M7JH 1LO4H 4NQVB 3C5ZC 3JV4B 4JFFE 3UTSB 4HF5L 1A02N 5FYKU 3NA9L 3MGOA 4I5BA 5BRZB 1WCQA 3VXRD 4LGRB 3U6RA 3F12A 2BXYA 4YC2B 2GJJA 1NUNB 4P23A 1VFUA 3LQAL 4HGWA 4Y5YB 1G84A 4PJ5D 4YFDB 3QUKB 4H25A 3LKNA 2V2XB 4Q6YA 4MQXD 1ZE3C 4ZPTB 2B1AL 4ZNEA 3VFGL 3LPGA 4HBQA 3B9KA 3H3PL 3EYUH 4NKDB 1UQSA 3QCVL 1F3DH 4AG4H 3OAYH 5HYQA 3EDEA 1FNEA 2AXFA 4GSDH 4ZQKA 3V0AC 3RQ3A 1IL1B 2DAVA 5C09D 1GPOH 3O3DB 4G6FB 4L1HA 4Q9QL 1S7WB 4MB5A 4U6HB 3FHQA 5TE6L 1F42A 3DUSB 4J6RH 3RGVD 3P0YL 5FO8B 3QFJD 4MS8C 3DPBA 4O00A 4F33A 1QPPA 4ONHA 2J4WH 1EHAA 1Z9MA 1MAML 4U1HB 4YAQA 3AROA 4KRPD 5GRZA 4BK4A 5D8JH 3ES6B 2DL9A 2IAMC 3LDBB 4DTGL 2E7LC 1U8KB 2M2DA 1MREL 3UAJC 3T65A 1E4WL 4HAFA 1P4LA 5K9JL 3FAXA 2IMNA 2OJEA 2UZYB 2B4CL 1OVZA 2E9IA 4AQ1B 4PJIF 3EOBB 4NRYA 4JFHD 4RFNC 4YDKH 1D5XA 1E4XI 4XPHL 4K94H 4NZJA 4U7SA 1AGBB 2BZDA 4AL8H 3HE7D 1T5XA 4YQXH 1GGCL 4FFZH 1L7TH 4P2YA 2DQUL 4J1UA 5GISH 1CF8H 2GSIA 2LAAA 5T1LD 4J3SA 3RDTA 3GMMB 4JFFA 1CE6A 4MQXC 3BXNA 4R97B 3KPLA 4Z5RB 4JM2A 5LGHL 2NXZD 3NCJL 4Z77A 3GM0A 3R4DA 5K59E 4WI8A 1DN2A 1ZLWK 3L7EB 4UOW0 5E2WH 1EGJA 4OZIF 2VXTL 4P5MA 1BREA 2DLIA 4GMTL 4G7YH 3MOAL 4M7ZC 1MI5B 1Q1JH 3V8OA 3ZKMD 4LLUA 1H8OA 4WO4B 3RGVC 2W60B 1LEKB 1MJJB 1VEPA 2IBGA 5LGJB 2IPTL 4Y16B 3QHFL 4KRPC 4Q6IA 3JUYA 12E8H 5HVHB 4WTWA 4OZFB 2OL3B 4KUZL 1A6TB 2B20A 1EVUA 3F6LA 5KSAA 1IAKB 3KYOA 1NLDH 3WN5B 3IYLW 4JB9L 1D5IH 2VR5A 3U7WH 1HZHH 5I15L 5FFLA 3QUMB 2A9NH 2C1OB 3MODL 4M6NL 3HE7C 1CD1B 4FXKB 4D3CL 4Y2DD 5GGVL 3OKOA 3DURB 4HFWA 5SWSB 2DLFH 3QXAB 3WXVH 5DEFA 3MV7E 1PSKL 1CD9B 1LD9A 1UM6H 2NXZC 4MA8L 3FO0L 1RUMH 4S1SH 1W0VA 1FZOA 4LAJH 1K2DA 1G7JB 3MJ8A 3MRIA 2APFA 5EZIL 5F6HI 4QT5B 2YK1H 4F15C 4NSKB 1DQTA 4NKOA 1VADB 2AXGA 4L3AA 1KCLA 5D70L 3ZKMC 5I73C 4B0MM 3S5LA 1OP9A 3EFFB 2Q7YA 5BJTA 5E6IA 4ODXB 1OW0A 2C7UB 1JGDB 3KHQA 1XF2B 4JDTL 4JE4B 4TNWF 4TYUA 3TVMD 2PXYC 2IQ9H 1H0DA 3DJ9A 3CFKA 3EGSB 2A6KA 4E0RB 5F1OB 1R6VA 4LVEA 2AV7B 1WUNT 3JV0A 4GAJH 5BRZD 3PWNA 5DJDA 4KKAD 4MDJA 4QRRB 4U6VL 4IBLT 5IVOA 3DXAE 5SWQB 2VDRL 5DS8A 1JGUL 1WV7T 4Y2DC 1VSCA 5DD3L 4Y5VC 3PF2A 3IDYC 4UU9B 4EI5A 1K85A 4JM4H 1MJ7L 4EQ3A 1U0QA 3KPMB 1NC4B 1FNSL 5FUZH 3QDHA 3NPSC 3LEVH 4CDHA 1R3IH 2MJWA 3BP7B 5GRXG 1NUGA 5D1XB 1HHHA 1GZQA 1AFVH 4G6FD 4JQIH 3MV7A 4RAUA 3OKMB 4YHOH 1RVFL 4LAQH 1CL7L 3GK8H 4PB9H 1ZA6A 5C0FB 3H9SE 3MJ9H 4MA3A 1NCWH 3STZA 1F11A 4NJ9H 3CK0H 4P5KA 4XMPH 1JTOA 3MRJB 1OPGL 2R2CA 5BOPA 1LGVA 3VFMB 4J3WA 1P2CA 1A14L 3BEWA 4KTDH 5F96L 1UM5H 4LVNB 2Z9TA 4ZOCA 3IDXL 3FRUB 4Y19E 5DGRA 4OFYA 1W2KT 2VQ1B 3O2DH 5E4EB 5B21A 4C56B 2W65B 2Y1VA 4KK6D 4KKAC 2JB6A 3RL2A 5HHPA 4G6JL 1RJLA 4YC2C 4KJYA 1QFWM 4MXWL 2EIBA 3UEZA 3OPZH 5DFTA 5F88A 1I85C 3SDAB 2DM4A 2ZOLA 2DF3A 1BZ7A 4K2UL 4N8PA 5DF0A 2LTQC 1RFDL 1J11A 2LV4A 4PP1D 1FJ1A 3DXAA 5HJ3B 1TCRB 4QRPE 3W81A 1OAKH 3RA7L 5E8OB 1D6VH 4M93C 2YUZA 3NH7L 3B3IA 4XWOC 3SQOH 3DI2B 5IMMA 4NNYB 4G3YH 4WU5B 4PJHE 2E6PA 1R3JB 1IEAA 4XZUA 2CUHA 4QOKE 1XCTB 4PJXF 1IGFL 3H8NA 5J12C 5FECA 3CC5A 5C0DA 3ZTJG 1M1SA 1N59A 1F2XK 3D25A 3LDBC 4M8QB 1OAZL 1U3HB 3BFOA 3LS5H 1ACYL 1J10A 5I1AB 2GFBA 3MCLL 1CFSA 1S8DB 2P46B 5FUOH 2BFVL 3QEQA 4FQLH 4BZ2H 4LEOA 1EGJL 3H9SA 5ADPH 3F7PC 2ZG2A 1CBVL 1R3KA 4X5LA 4HF5H 1TTGA 2DQDL 3NA9H 4KK6C 2GT9B 2IBZY 2G2RA 1KYOJ 1JTTA 3O11B 2EDYA 2MKWA 5E99L 1Q9KA 5IVXF 4XCEB 5F6IB 4MZ3A 4Y19A 4ETYA 4QCIA 5GGSY 3LSOA 4R97C 4QF1A 1ONQB 5HGHA 2H2SD 2B1AH 1QQDA 3VFGH 5I17B 4PP1C 5C08E 3H3PH 2KZWA 3L3GA 3O6KL 3EJJX 3QCVH 4OAWA 2Z8WC 2APXA 5DC9B 3UTTD 4YBQC 1ZT4B 3EFDL 4Q9QH 5ICYB 3TEUA 4E41E 1I1RA 1TTUA 3BPLB 5TE6H 3P0YH 3VXMB 3MLSH 1QNZL 3S96A 1MAMH 4PJ7F 4Z7UE 5HVHC 5IW3A 1T0MB 3I6GB 3IETB 1FFNB 4PJHA 1MPAL 4NN5C 4DOHE 4ODUB 1MREH 4OD2B 1BZ9A 4QOKA 2W9LA 1E4WH 4X4ZA 3BRFA 4ZXBD 5K9JH 4NQDD 4WW2F 1XGUB 5IVZB 1M71B 2B4CH 3WN5C 1EX0A 2LVEA 2ZOKB 4K3JL 3U9PL 3BQUA 4XPHH 3H0TB 2FJGA 1C12B 3IGAA 5LAXB 3QYCA 1NCCL 1DL7L 3QFDB 2ARJQ 4R26L 1GGCH 2Z91B 5D2NC 4V2CB 5HPOA 2DQUH 5EBLB 3C9NB 4NQED 2H2SC 5DRWB 3FO9B 1T0PB 4PJFE 5LGHH 4Z7OF 3PJSA 3V0VA 1NC4D 5E8EA 1QR1B 3LVEA 3BKML 2KQMA 3ILQC 4XC3L 5D1XD 2VXTH 4X9IA 3TNNA 1GGTA 3RZCD 3MOAH 3MNVB 2CKBB 5C08A 3OGOE 2UWEF 2C26A 2OTUA 3KPRE 2NZIA 2CXGA 5I18H 2P5WE 2XFXA 2KBGA 4FG6C 2BNUB 3VRLE 4HS6A 2IPTH 3BEVB 2H3NA 3QHFH 5GHWL 4WEBL 5T1KB 3F7YA 1CTNA 2C4FT 4XP1L 3PHOB 1RMFL 2VUYA 3QDJE 4KUZH 4K8RD 4KH2A 1MCOL 1U8NB 4ZXBC 4HZLB 5HHMB 3STLA 4E41A 2WQRA 4QWWD 4C56D 1IM9B 3CZFB 2ZUTA 4OZIB 1G7IA 2MHAB 1NGZB 3BO8B 4ERSL 4JB9H 4Z7UA 2CMRL 3O2VL 5I15H 4YPJA 3N1PC 4BSJA 3MODH 4M6NH 4LASL 3QH3B 4D3CH 5GGVH 2XQYK 3SJVE 4KJWC 3LPWA 5E5UB 3V5HB 1YEEL 1PLGL 5DMKA 1CFNA 1MQ8A 5IUSA 1PSKH 5FKAA 4KPHL 5HHOE 4MA8H 4IOSD 1I8LC 4PG2C 1UZ6F 2A38A 5EZIH 1T1WB 3TO4A 3QPQD 5D1XC 1T1ZB 1NDMA 3HE6D 2X44D 4U1MA 3ULVH 3QIWB 3S4SA 5GZOD 2HFFA 3RZCC 4YFLI 5D70H 3I6KB 4PJFA 1AH1A 4OCNC 1CDUA 3ZMRA 4Y4KA 5EUKA 4Q74A 1Z0MA 5FDYA 1N6QH 1P5UA 1F13A 1T0NB 4D9QE 1R3LA 4JANA 4JDTH 1JPTL 3HI1A 2P48B 1FFRA 1ZVSB 1S9VB 4LVNC 1GGBH 3CU1A 4K8RC 4TSBL 3KPRA 1UENA 5KG9A 3GI9L 4YDIH 4QWWC 2WWMD 1GZPA 2GJ6E 2P5WA 4LBEB 3HPLA 4M7LT 4RMTA 1OF2B 3VFVA 2NR6D 4KGJA 1RPQA 1MFBL 3WE6B 3FQNA 4N1HB 4GO6B 1KCUL 5EUOE 2VDRH 4PV8A 3QDJA 3MR9B 2EYRB 1JGUH 3SDAC 3BZEB 3IDUA 5DD3H 4QRSB 5MENB 1BFVL 1QSVA 1CU4L 1I8KB 1DUZA 4QKXB 3UTPD 1A4JA 4RWYL 4X83A 3OJMB 1MLCA 4JLRA 5EBMB 1KG0A 1MJ7H 2JLLA 5EIIB 4EVNA 1RUQL 1FNSH 3QPQC 3S37X 4FXGB 3IDJB 5DRXA 3HE6C 2X6MA 4F80A 2E9WA 2KDGA 5CD3B 5GZOC 4D0DA 1HKFA 5JNYA 4MAYB 5HHOA 2V2TB 4L8BA 1U8LA 1NFIB 3VXMD 4PY8J 1U95A 3QUYD 3BP6A 5C0BE 1OTTD 3BDBA 2R8SL 5DJ6B 1BD2B 5DK0A 4Z9KB 5H37G 2ILLA 2CIIA 2HG5A 1A14H 1UKTA 4QY8B 2DQGL 4PJDF 5F96H 4NO5B 3IDXH 5C0IA 5EU3B 3DSFL 2Z31A 1WZLA 3B83A 4RGOL 2ED7A 4MXQD 2R0KH 1XR9B 4NUGL 4YXLL 1G7MA 4X5WB 4YDJB 3EYVA 1N4XL 1CS6A 3C8DA 1NBZA 5F6IC 3NCEB 4OIAA 4MXWH 4XP6L 2Y72A 5IM7B 2D03L 5IB5A 1U41A 2CLVB 1JPGB 2GJ6A 3WFBL 2WBJB 3W0WE 5GZND 1OWRM 5GGRA 5DEGB 1EFQA 4NO0B 4JQVA 1RFDH 1IQDA 3PWUA 4NM8L 1FVEA 3AMKA 3SPVB 5JHDB 3CVIL 4PYGA 5EUOA 3OHXB 3MNZB 4DGVH 3FTGB 4KI5D 3RA7H 1S7UA 3QO1A 2R56H 3NH7H 3V6ZB 1KCVL 2RR3A 4JRYE 3VXQA 3MGTB 4MGXA 3VD7A 2XOTA 3BPLC 3M17A 3TJHC 3JWNC 1IGFH 3RWEA 1FCGA 2BCKB 2V9QA 1OTTC 3RUGE 1MCDA 5T1KD 4Y1AB 5D1ZB 1P7QA 3MRBB 3RFZC 3NZ8A 1OAZH 3BGFB 1ZHKA 4U1KB 3INUL 1WVZA 1NJ9B 1ACYH 3MCLH 4X80L 4WFFD 5HHMD 2VXSL 4XXDB 3NFSL 1Q38A 2BFVH 1EGJH 5C0BA 2DS4A 3MBXL 4MXQC 4JDZB 1P9MC 3LHPL 4HT1L 1G9NC 5CZVL 3DV4B 4ZUWB 1FNGA 2DQDH 4JVUA 3D18B 1K4DB 3GMPA 4CMMB 3W5NA 3ZE0E 4LSVL 2ZSWA 3QXDB 4HX1A 5E99H 3VFUB 4PJXB 1HSBB 4RMSA 3EDFA 1TZHA 5GZNC 1JF5A 1HXYA 1G7LB 4PRBB 4RMVA 5K9QI 3QJFB 3ME0A 4URTB 4WUKH 1L7IL 1NAMA 4NN7B 1KGCE 3QCTL 3WYRA 3ZYZA 4LIQE 1DTUA 2HRLA 2UVFA 4GKZB 5D7IF 4LCYA 4U3CA 3MO1B 2VKWA 4NKQB 3W0WA 1U8OB 3EFDH 5E9DB 3IKKA 3K8LA 1L0QA 4HWBH 4JGJA 1FL5B 5TDNB 1J1PL 1B88A 1JHLL 2VR9A 3CUPB 1QNZH 4JRYA 4EDWL 2ICWI 5LXGL 1FZJA 3EAKA 5DURB 5IB4B 1MPAH 3CIQA 1HQ4B 3RUGA 4PP2B 3RWHA 3VI4E 4PGEB 4K3JH 3U9PH 1KLGA 2YZ8A 3TZVB 5GS2H 3O4OC 5IKCA 3MOQA 1JFMA 1NCCH 3G6JE 1Z5LA 1DL7H 5MEND 4R26H 1A9EA 2WP3T 1VEOA 4JAMB 3ZKXB 2DJSA 4PJ7B 4WHYH 1QLFB 3D0VB 1M7XA 4LCUA 1CGSL 1U92A 1JK8B 4YE4L 5ESQA 5F7FA 4G43A 3BKMH 5IVNA 3VFSB 4R4FL 2JELL 1MHEA 3OV6A 3QIWC 5IF0B 3O9WB 3RWCA 1HSAA 4MAYD 3EJZD 4BQ6A 2EIEA 4K3DH 4GG6E 4RBPK 5A3ID 4HUUA 3OXRA 2YZ1A 5AUMB 2VZOA 5GHWH 1J0KA 3L9RA 2VXQH 2BNQE 4WEBH 3WJLA 5JOPE 1RMFH 3P73A 2PW2B 3FN3A 4NFCA 1MCOH 2H32B 4KMLB 4ERSH 1M7DB 2CMRH 3V52L 3O2VH 1IKFL 2IMMA 1AY1L 2UWEB 3H7LA 3PNWA 1D5BA 4LASH 2EDOA 1YEIL 5IHZA 5DGQA 2WBJD 4L4JA 3P4NA 4P2QE 4NO0D 1YEEH 4JKWA 1PLGH 4UT6L 2R2HB 3HB3D 5SX4H 5C71A 2DDQH 1BM3L 4KPHH 4XGZA 1TZIA 4HIXH 5IJKA 4IOIA 3PABA 2FGWL 3VI3E 2ARWA 4HKBB 3G6JA 3MRMA 3MUHL 5EWIL 3O8XB 1FFOB 5DD6B 5J1AB 1MCPL 5ENWA 2F74B 4MAYC 3CX5K 3EJZC 4EIGB 1CGVA 3LV3A 2JIXA 5JORA 1HN1A 2H1PH 2C9AA 5A3IC 4RAVA 2IGFH 5D1ZD 3LQZA 2R2BB 3OKKA 2FR4A 1Z0NA 5J1TC 4G42A 2AEIT 1ETZB 1JPTH 3UTZA 1OGTA 2AEQL 4JPVL 3HI6L 3WIFB 3HZKA 5FEBA 5BV7C 3ARXA 4GG6A 4TSBH 1VGKA 1KNOA 1ZAGA 3GI9H 5A2LH 5F44A 4OTXL 3WHXB 3R1GL 4H5SB 1PGRB 2BNQA 3SDXF 2CLRA 1MFBH 1KCUH 5I30L 1BF8A 1X7QA 3GHBL 4X7EC 1Z6JT 4CVZA 2WBJC 4K07A 1J18A 4KUCD 1CU4H 4HFUH 4I13B 4P4RA 1EFXA 3HB3C 1IAII 2YEZA 4GRWF 2BNRE 3V95A 4NO2B 3BUTA 1D6EA 2V2WA 1RUQH 1TNNA 4Z7VF 2DWDA 3VXNB 1FV1B 1CI5A 1I1FB 3WNKA 4P2QA 1UB6B 5E9DD 4IHOA 1MCWM 2A6DB 5KJRL 1B2WL 4NRZA 1PY9A 1BFOA 5K9QG 1MFCL 2ADIB 4DZ8A 5D1ZC 4P57B 4M1GH 2R8SH 3BGFC 1KV3A 1EEUA 4MD4B 4PJ8A 5EPMB 3VXOA 3PV6B 1PBYA 2J6EL 4YHNB 1QSFE 1NAML 2DKSA 3QUXD 2JJWA 1RIUL 3DSFH 2R4RH 5EOTA 1AO7B 1Y0LA 1Q9WA 2EEBA 2ZUYA 3T0EE 4NKMB 4NUGH 4YXLH 3SY0A 3TZVD 1LE5B 1G0YR 1N4XH 5CGMA 2CH8A 4FZ8L 2NW2A 4WI7A 4XP6H 1XGYL 3LEXB 3MLPA 2VLRE 2D03H 2HLAB 1EAJA 4GRLD 5DEZA 1EZVY 1KT2B 3WFBH 3DO7A 3O2WL 2ZUXA 1BX2A 4PGDB 1EERB 3E6FB 1UH2A 1YEJL 3L5WB 4NM8H 4PJDB 3CVIH 3FKUS 4PRHB 5T1DL 2ADFL 3BN9D 4NQTA 1YY8B 2QHRL 3MACH 5IHUL 2FL5A 4KDTA 3UX9B 1KCVH 5DRZB 1RZIB 3TH3T 4F7PA 1HE7A 3VRJA 1DQML 1A47A 1UT9A 4ORGB 4MCYA 2QLVB 2BNRA 3UMTA 4YX2L 4LKXB 4NZUL 5KVDL 3UBXA 3AS3A 1X44A 3KPSB 2QKIB 4OZHB 2JJTA 2HVKB 2DM7A 3INUH 2G9HB 2IPKA 3LKOA 1DBJH 2GITA 2XWTA 5I1DB 3QUXC 3RPIB 2QTEA 3Q6GL 3QIUA 4ODWA 3GIVA 1U3ZA 1OARL 3OF6A 3MBXH 1WBZB 3LHPH 4ZS7L 4BA8A 1G1CA 3TZVC 3GJFK 4O2CB 5CZVH 5I1JL 1YC7A 4HWEL 4QHKJ 3QISA 2NTSP 4LSVH 2J8UB 1QSFA 3OR6B 4H26B 4HV8A 4ZO9A 3MSPA 2BOBB 4LIQL 3E1F1 3ZKXC 4NJAL 1R3HA 5E1HB 2MPAL 5L7XL 3IJYA 3T0EA 2E8YA 3G04B 4ZUVB 1KIQA 3DBXA 4M62L 1L7IH 4WIQA 2BERA 3QCTH 3BN9C 3O8XD 2FECL 3QEGL 1H5BA 3OGCA 2VLRA 3V7AG 1U42A 4TTDD 5HDOA 1HHGA 1OB1A 4N0UB 3OQ3B 3KAAA 3C60A 5I74B 1A7QH 1A6ZA 4F8QA 2BVPB 1I1CA 1KPVB 5EU6B 5IFJB 5I0DA 1J1PH 2P8LB 2IALB 3U9UA 3GSWB 1ZGLP 5MEPB 3IU3A 1JHLH 1LILA 3DMMA 3HUJF 4BUGA 3FHAA 4Z95L 1IC7L 4EDWH 4F37K 5LXGH 2FEDC 5E1AA 5TF1L 3QXTA 3T3PF 4XPAL 1JI1A 2NW3A 3U48A 3LKPA 2AV1B 5D7IB 4U31A 2CR6A 4HD9A 4ELME 3FO1A 4MD5B 2E3VA 4KRLB 4M61A 1J8HE 3MRCA 1N8ZB 2P8MA 1S7VB 3O3UN 5D6CA 5CJOL 3BP4B 2CSPA 4A6YA 1M05B 1B4JH 2Q86B 1QD0A 3QDGD 1QBLH 4K9EC 1CL7I 2YD8A 1N2RB 1CGSH 1KIRA 3N1MC 4YE4H 4FQHA 1KCSL 3O8XC 1B6UA 1SJVA 2CDFB 4R4FH 3EYSH 5DDHA 2JELH 4TTDC 5LJYH 1RZJL 3LRSB 3DUHA 2G5BA 2Y7QA 2BXZA 5F3HB 3ISWA 5FA4A 2BSRB 1JIBA 1T4KB 3G5VB 8CGTA 2W0FB 4RGMB 3GGWA 1KTRL 3MRDB 3NABL 2E7HA 1NBYA 1CT8B 2RJMA 4HPYL 1NANH 4MAUL 3PP4L 3MROB 3RX8A 5J6GA 1S9WA 4KAQL 2VC2H 3O41A 4Z8FL 1ORSB 2PW1B 4YO0B 5I8CA 2RB8A 1YA5A 1AO7D 2OTWB 2R0LL 1VACA 4F3FB 2BJMH 4IOFD 1RZ7L 5FM8A 2FWOA 1MUJB 2YPLB 4Q0XL 3V52H 1QFUL 1UWEL 5I1CL 1IKFH 2HAZA 1CZ8H 1AY1H 3RIFK 4HKJA 2H41A 2YPVH 1TCMA 2ADGB 4NWUL 1YEIH 3I3DA 2O5ZL 4NHUE 3BZ4B 1IGCL 3CXDL 4QXGL 5AYUH 5IG7A 3C09B 3MRRB 1IM3B 3GBNH 4UT6H 4ELMA 1XF1A 1BM3H 1J8HA 2EDJA 4RFOL 4LLYB 1BGXL 1P6FA 3QQ4B 2FGWH 5I76A 4KQ4H 4NO3B 3FT2A 5EWIH 1AHWB 3QEUB 4YGVB 2XA3A 1MCPH 4YBLB 1T83A 4XVTL 1N5YL 3RWFB 5L2KB 4OUOA 5TDOA 2O61B 2JJVA 2IFFL 4EZMA 3ULSA 4B41A 3KPSD 5F3BA 3N9GL 4AEIH 1V3MA 4NPYA 3HCVB 3Q5TA 3RWGB 1JHTB 2EE6A 3QULB 2AEQH 4JPVH 1ORQA 3WLWD 3HI6H 5GRUL 5IP4A 3NIDE 4RNRB 3QWRD 1ZGLA 3E3QC 4U1LB 5FCSH 2XYCA 5BQ7B 3QRFM 5DJXB 4X4ME 3GSXA 4OTXH 1XF4A 2X1XR 1OGAE 4JPWL 1LDPL 4FHBD 1K3IA 1V7ML 4JKKA 4XBPB 1TMCB 3KNBA 3BWAB 5KS9E 3MTRA 1PKOA 2O5XL 5I30H 3MRLA 5F97E 3NCMA 2X89D 3GHBH 4R96B 3QB7C 4OUUA 3MFGB 1NGXB 4S1DD 3O3EA 3JTSA 2VYRE 1CXHA 4JFOA 4EIZC 5A16B 4X9GA 2IH3A 4WDIB 9CGTA 3G08A 4WI6A 5GRYA 4I8DA 5I6XB 4QHUA 4EUPA 5HYSA 4NHUA 4APQA 4L9LA 3PWJA 4MSWA 3U4EA 2HT2D 3GMNB 3QDMB 1PZ5A 1RHHA 1KCRL 3OKLB 3SDXB 3I50L 5KJRH 4PY7B 4UAOC 2EE2A 4PRPB 1HHIB 4KRNA 5C7XH 1Z2KA 3F7VB 5EULV 2FJHB 3ARBB 1Q72L 5AD0B 2NY5C 5KSBF 4GRWB 5E7FA 1PKQE 2J6EH 4LLWB 1I8IA 2IFGA 4LSTL 3WD5L 3VW3L 1LK2B 5T5NG 1WSST 5ACLA 1Y18B 1L0XA 4UV4H 2V7HA 4K23L 3QNXB 1AD0B 1H3VA 3QNYB 3KR3L 3RWDB 3KXFD 1NAKH 2YPKA 4FZ8H 5KTEL 1G7PA 2R2EB 1XGYH 3N0PB 4WTXA 4S1DC 4X4MA 3CVHB 5ETUB 1OGAA 2VSCA 1MFNA 1X3DA 4E5XA 1FC2D 3KHOA 2GK0A 2W9DL 4RZCA 1YEJH 4QO1A 4XBEL 3FO2A 5KS9A 3FAWA 1MHCB 2YRZA 4LSPH 4GFTB 4ZDHB 2ADFH 3N85L 4JKLA 5BW7C 2QHRH 3R06B 1BFSA 2EDRA 4MDIB 5DZNA 5IHUH 2HT2C 4Y4HA 4MNQE 1QHPA 3UDWC 1JZ6A 3VCLB 1DQMH 5JZ7D 3RY6C 4G8GE 3QHZL 4GW5B 4YX2H 3C2AL 1A1MB 3P9LB 1F6AA 3FN9A 4NZUH 1PEZA 5KVDH 4A6YL 1BJMA 3T08A 3OAZK 1U6AH 5KVGL 4FFEX 3IAGC 4YZFE 5F1IB 3ZT6A 4BFGA 3RTQA 3T8XA 2R4SH 3GEWB 4I3RL 5FO9A 1OARH 1F97A 3MV8B 3RI5K 4TVPD 4ZS7H 2YPLD 2ITCA 1F6FB 1IILE 4V1DE 4BM7A 4HWEH 1PKQA 1S7SA 3FONA 3D85A 5ESAA 3SDDD 1HOCB 5ADOL 1VB9A 4LIQH 5F7HA 2JCCF 4NJAH 2IC2A 3QPXL 4MMXC 5IW6B 2FLRT 5L7XH 4ODSL 4KMQA 1XMWA 4M62H 4HG4K 3TF7A 4OI8A 3QEGH 4BQ8A 4BH8A 4UINL 5JLZB 4I1NB 2YBRA 5L2KD 5JZ7C 2P5EB 1QBAA 4FABL 3NN8B 4FOMA 3CFDB 1ZA3B 4OB5L 4PJEF 1NC2B 2APVA 4GRMA 1FVCB 3TPKA 4JKPL 1X5AA 4QRQB 4QHNA 3PWPE 4HLZH 1U8IB 3CX2A 1X6LA 1C1EL 4XCFL 1BOGB 3JVGC 4MNQA 1F4XL 4Z95H 1Q0XL 2AXJA 1WBXB 1FYTB 4NP4L 4BSVA 5TF1H 2ATPA 3B9AA 4G8GA 1CXLA 2FBOJ 5CLTA 3CDFA 3W39B 4Z7WE 1LEGB 2X1QA 3V6OC 3NVQA 2EDDA 2X4NB 5B3JF 3AS1A 5SX5K 3DVNB 4OCRL 1WF5A 1AGFA 4TPRL 3N50A 1RJZA 3SDDC 1W0YT 3HPJA 1LO5A 2MSPA 5F9DC 5C8JB 5CJOH 3C09C 3HUJB 5JMOC 4KK8D 2CO6B 4PGJA 3D0LB 4NNXB 2CDGB 1C5DA 4V1DA 3DX9A 4PJBF 1KCSH 1AHWC 3VH8A 1EZVX 3V6FA 3QDMD 4LRNL 4YBLC 3TFKA 4X4XA 4LARL 5KW9L 2A9MH 4NRXA 4R0LA 2VITB 1RZJH 4JN2B 2G75B 1TQCB 4JJ5B 4PRPD 2GTZB 4FRWA 3RL1B 4O2EB 4X99A 1EUUA 3NCFB 5ANME 4N0YL 3ARQA 3JBG7 3ARBD 4J4PA 3KLDA 5FGBC 1CLOL 3NABH 3EIFA 3T1FB 3TYFB 1SJXA 4HIIB 3FFDB 4HPYH 4MAUH 1TQBB 4AT6B 4FTVA 1FZKA 4KAQH 4Z8FH 4AIZA 5KSUB 3HS0B 3PWPA 1L8JA 1JGEB 1IGIL 1RZ7H 3NFPB 2ED8A 1A7NL 5CSGA 5FYKE 1I7UB 4YHML 4Q0XH 1QO3A 3SCMB 5I1CH 3S5LG 5EBWB 3BOVA 5CILH 1I1AA 4NWUH 2O5ZH 4Z7WA 5B38B 4CVXB 1IGCH 1Y6MR 5INCB 4ORZC 1ZHBB 3CXDH 4PD4J 4QXGH 3GSNA 3L3DA 4MD0B 4N8VB 3TN0B 2R1WB 5JW4M 1YN7A 3HR6A 4B7IA 2YN5A 3U0PA 5I6XC 2ERJB 5IMKB 4RFOH 3T4AA 1JCKA 1BGXH 1RSFA 4HUWB 4EJ1C 2NNAA 2ATKA 5C70A 1BIIB 4ZFGL 1INDL 2WIMA 1GHFH 5DUPL 4HGKC 4QNPF 1S9XB 3F7QA 4XVTH 4NUJA 3E2HB 5EG6C 2VLLA 1N5YH 5IB3A 2B39A 2IFFH 4UB0H 2GAZB 1L4IA 3PGDB 3ARBC 1WIUA 3EYFB 3N9GH 3WUWG 4BZYA 1UCTA 1E4JA 1AC6A 3FQWB 4GAYA 4P4KA 3IFOB 1YMMB 2GUOB 3L3KB 1VHPA 5IB1B 1IVLA 5GRUH 3BHBB 4XH2B 3RGHA 1T1XA 4LRIA 1KJVB 2N4IA 4L8SC 5ANMA 2X41A 3T0VA 1AIFA 1LDPH 2ICEA 3RNKA 3TGXA 1T5WB 2WQ8A 3QI9A 2EO9A 5GJTL 4ZS6C 1ZLWH 3L3HA 2VXVL 2O5XH 1JFQL 4EKXA 1NMCB 5L9DH 4UV7L 2ZWLT 4OCMC 1T6VN 3THML 3FQXA 4X6BB 1A6VL 4GBXA 2FD6H 3ARSA 1A7BA 4UIKH 3REWA 2X2YA 1FIGL 3U46B 3SGDH 5ACZB 2BVTA 2EYTA 1MCBA 1JPSH 3BKYL 4HH9B 4LLMB 5JPMB 4ZAKD 3WXWL 2DLEA 1AQKL 4HUMB 5DQ9B 4N1CA 4CL7A 1JYVA 2P5ED 4IS6B 3MRHA 1LEIB 3I50H 1NC2D 1TFHA 3TH4T 1T66D 1DANT 3EDKA 4WU7B 2X1PA 4I2XB 1JF1B 3AFLA 4JO1L 1RK0B 1N0XH 4WFGE 2IADA 2V5TA 1Q72H 3D39E 5MERA 2YSSB 3QO0A 1I3RA 5JW4R 3NIFF 4KHTL 1MCWW 2NMSA 1Q9OA 4LSTH 3SKUD 1N6VA 4K7FB 4WHDA 3WD5H 3VW3H 3DVFA 2XN9E 3BH9B 3TIEB 5T3ZD 2DB8A 15C8L 4KJPD 2IQAA 2F54B 4K23H 1J8KA 3MRKA 2Q1EA 4TUKH 2VZVA 4G9DB 5FHBL 3DTXA 3EO1B 5KTEH 3MREA 3HNVL 5DJCA 4ZPVA 3FB5B 2X5PA 3NFNA 4FQIL 5HGBB 3RX5A 1C16A 5I1EH 2P49B 4PGBB 5KSBB 3IDIA 2W9DH 4UQ2A 4LCWE 4GT7A 4DN4H 5F9WB 5D1QA 3MRFB 2I07A 3O6FD 4JFEE 4ZAKC 2MNUA 3GKZA 2X4OB 5ID1A 1IC5L 4ODBD 1MCHA 3QIBD 1H8NA 5HYFA 1CDHA 4JM2F 1LP9E 4E9LA 4I48A 2BRQA 3IT8D 1GGIL 1BAFH 5FUCC 3S3JA 1T66C 4ZMAT 2M26A 3QHZH 3C2AH 3VXRE 2BHUA 4ONFL 1P4IL 2ZCHL 1B0WA 2OR9L 1WC7A 4A6YH 4PLNC 4PJ5E 1A1NB 1N5AB 3C5ZA 2PYFA 4KV5E 5KVGH 3G5YB 3WS3B 3DUUA 1K3ZA 2M1KA 5F1KC 1CG9B 3Q3GB 1S5HA 4HKXB 3NBNA 1U9KA 5EO0A 3UC0L 4I3RH 4JZOB 1JN6A 4KJPC 2CPCA 3D39A 5EZOL 3QUZB 3SCMD 3DX7A 5L0QB 2DYPB 4Z0XA 5D6DC 5C09E 1WEJL 3BZFA 4X6FA 3VXSB 2H26A 4I0PB 5CGTA 5F93C 2ZCKL 3AREB 3ET9F 5JOFB 1A2YA 2HVJB 4K94C 3TN0D 2XN9A 3QPXH 3ILPB 4PJGE 1KN2L 1RURL 4ODSH 2I9LB 4U1NB 3ZLQC 1DQDL 3MGAA 4NYLA 5E6ZA 2FO4B 3PL6A 1G7HA 4MNGE 1KJMA 2Y5TB 1GC1C 1ZXQA 3QIBC 3RIAK 3T04D 3OKNB 4UINH 5I16B 2E7MA 4JFHE 4MHHI 4X6EA 4FABH 1A21A 2Z4QA 1YUHA 4LCWA 4U49A 1YNKL 3U4BL 3HZYB 2DWEB 4JFEA 4OD3L 4JKPH 3G9AB 3R8QA 2JCCB 3GSNL 4DJMA 4XCFH 1C1EH 2X4RB 3X11B 3CPLA 1F4XH 1LP9A 1TQBC 4GW4B 2PTTB 4NP4H 4DCQB 2FZ3A 1RAMA 2BSTB 5K59F 5F7YC 2BVOB 1UVQA 1XF3A 4JO2L 3VXRA 1F58H 1OWWA 4F2MB 2EDFA 1AXTL 2V5SA 1AR2A 2OQJA 3DX6A 2C1PA 3I84A 2CQVA 3K4AA 3MLYL 4PJ5A 5L6YL 1HWHB 5D7JD 3PHSA 4YHIB 3SCMC 1TVHB 3HTLX 4IIQB 2DJUA 4OCRH 3WNMA 5IEHB 1Z9LA 4TPRH 3V6BR 1DBBL 3K3QA 3SO5A 3SKMA 3F5WA 3TN0C 3ARFB 3AGVA 3FB7A 2F5AL 43C9B 4CADB 4NQXB 4M7KL 5HHVL 3L3OA 5C09A 4AIXA 3PXJA 3BPNB 1SYSB 3KVQA 4C83B 5JXED 2EICA 3P77A 5F1NA 4M00A 5IOPB 3RGVA 1S7RB 2F8XC 4LRNH 5C0GB 5TQ0L 3MOBL 1WJ3A 4LARH 3WFHA 5KW9H 1L0YA 4PJGA 1T3FB 3E2HC 4YLQT 1AC0A 5CMAB 1K9TA 4MB4A 1LMKA 4OZ4B 4Q9RL 3FMGH 4U1IA 3A6CL 4N0YH 4MNGA 3HC4L 4GKOA 3MRNA 5TPWL 4RQQA 4HGMA 2XZCL 5FYKL 3DARA 4Y2OA 3MLUH 4PJBB 3BP5B 1CFQA 4GS7B 4YNYB 3HG1B 4N0CD 4OCYL 4JFYB 2DQTL 4BKLB 5T1LA 5DUBB 4YDLB 1A7NH 4J12A 3S4SG 3K4ZA 4YHMH 1NMCC 2VE6A 1HCFX 5JIKA 4Y4FD 2AJYL 3QR2A 4UDTA 5F9OL 2BVQB 4JY6A 5GGSA 1WZKA 4OFKA 4DKEL 3GMRB 4WI9A 3PHQB 1WLHA 2XNAB 3TBYA 4KXZH 3REVA 1KPUB 5JXEC 4TN9A 4JFZL 4ZFGH 3MC0A 1INDH 3QXWA 5DUPH 3SOBL 5JDJA 4UT7L 4P49A 4XCNA 3L95A 1T6WA 1KYOK 3EZJB 4CJ0A 1L9MA 3L3JA 4F7EB 2AJUL 1UG9A 1JZ7A 1QFOA 4EXPX 5GS1B 4PTTA 3QQ3A 4XAKE 3HZMB 4FQCL 4AJ0A 1O5DT 5CEYA 1IE5A 4YBHA 4N0CC 1JZ8A 4Y2DA 1Q94B 2HJLA 3VFPA 2DYPD 2F19L 2X4QB 1WCBA 5GJTH 1OD7A 2Z8SA 4JFPB 2J12B 3UZEA 3VXSD 2VN4A 1FNLA 2VXVH 3V5DA 3PDOA 3IFNL 1T1YB 1C08A 4P0DA 1JFQH 1ERNA 3ARED 4Y4FC 5FKPB 3AS2A 4UV7H 3GJFA 3RJQB 3THMH 4G8EB 4NQUA 1A6VH 1XF5B 3PV7A 1KTLB 4LPTA 2APTA 5F21B 3NCCB 1FIGH 1PDKA 5F9WC 5HI5D 2VR4A 1NMAL 5EC1A 4OLWL 2XICA 3WXWH 4N0FB 5DRNA 5GGRY 1KPRA 5BVJB 5CBAA 3Q5YA 1AQKH 3AVEA 4ZNCD 3TVMA 4UZGA 5CSZA 1OT2A 3ROOA 2HN7A 5HI4D 2EXYD 3SGJA 2D0HA 5FO7A 4JO1H 2VWEC 4LP4A 5CS7A 4O9HH 1LQVA 2IPUG 3SHSA 4LCCC 4OGXL 3U6RB 3CNKA 4KHTH 5C1MB 3F12B 4FQ1L 4P23B 3MBEB 1U93A 4KDWA 5F7DA 4HGWB 4MHHG 1MCFA 5F1SA 4XPFL 4H25B 3LKNB 2Q87A 5T1MA 5DMGD 1I85A 5DJYB 2RAMA 4HIEA 5L0QC 3B9KB 15C8H 2NYYD 4PJHF 4I0PC 2G5RA 3A0OA 4AMKL 1A8JH 1CGTA 4EBQH 4KI1A 5CP7B 1UQSB 2XIDA 3AREC 5FHBH 1X4YA 4NKDA 2WP3O 4M6ML 3ARFD 5HYQB 3HNVH 3CSPA 1FNEB 2DTML 3MLZL 4ZQKB 1YEGL 4FQIH 4Y8DC 2OJZL 1KENL 4BFBD 4HZAA 1IL1A 2VLMD 1S7WA 2EDHA 4RX4D 3DUSA 5FO8A 3DHMA 3QQ9D 5J9PA 1IC5H 3EDDA 4YAQB 5HDQL 2V9TA 4ZOBA 4WNQB 3KGRA 3MXVL 3P11L 3ES6A 1GGIH 3NA4A 3QXUA 1PQZB 4MA1B 1QLEH 4WV1B 5HI4C 3T65B 1U8KA 2OJEB 2DI7A 1RY7B 2EXYC 1MIML 4ONFH 1P4IH 1MCKA 2ZCHH 2XWJA 2OR9H 5D2NE 4NZTL 5FCUL 1D5XB 1OAQL 3EOBA 1ZHLA 4Y8AA 2FJFA 1TLKA 3G5XA 4NWTL 5EO1B 2ZG3A 1T5XB 1XGPA 4WFHE 4JGMA 3HG1D 2OR8A 4WEMB 3WS6C 2JK5A 3VFOA 2K7QA 4J1UB 1NPUA 2GSIB 4KDVA 5DMGC 3UC0H 3BXNB 3GMMA 4JM2B 4I4WA 2YD4A 5EZOH 4IIQC 4Z5RA 3UTTE 1G0DA 5FYJD 3FL7A 3GM8A 2B4CC 4GUPA 1ZLVK 2ZCKH 5M94B 5DJ8B 3P40A 3ARFC 3SO3B 4P5MB 1R24A 1KN2H 4LLUB 1EH9A 1TIUA 1RURH 1MRDL 3JV6A 5C0JA 3BPNC 5DLML 4DKDC 5CKGA 4RWHA 3RWIA 1DQDH 2FRGP 1LEKA 1DE4A 2BVUA 3QQ9C 4NQDE 5LGJA 1JZ4A 3KPOB 1FZMB 4Q6IB 4WHTA 3DO3A 4M03A 2FNBA 1WAAE 4OKDA 5KSAB 4OZFA 5EFIA 2NLJA 1YNKH 3KYOB 1IAKA 4OD3H 3ULVD 2Q3AA 3OG6B 5EZLA 3DYMA 1ADQA 4GAFB 4OCWL 3GSNH 4NQEE 3WN5A 4PJFF 3ECBA 5F8QC 1PZUB 4WHCA 2C1OA 1CICD 5DVNA 5DR5L 3OKOB 4JO2H 3UBXI 3LZFL 4HFWB 2AGJL 3KYNA 1AXTH 4JEGB 1FFPB 3IVKA 5D2NA 5DEFB 1KIPB 4YDLC 2I9TB 1F5WA 1ZOXA 3MLYH 3S35L 4HXBH 1W0VB 1K2DB 3MJ8B 3MRIB 4S1RL 3NGBB 1UACL 3VRLF 1DBBH 1URLA 3ARTA 3O3AB 5HBBA 3VXTA 3LB6D 1Q0YL 4QT5A 1A4KA 2AXGB 4LLAA 5ESVB 2F5AH 3S5LB 3UTTA 4M7KH 3TBWA 5HHVH 1UYWL 1CE1L 2Q7YB 1YNLL 2LU7A 5BJTB 5E6IB 1RIHL 5F71A 4XP5L 3MV01 4C56E 5CJQH 4AIOA 1T2JA 1H0DB 1JGVL 3ESUF 2DICA 1D9KD 5LGKA 2VDQL 8FABA 2A6KB 3VGGA 4KC3B 1XR8A 2ITDB 3EGSA 5C6PB 4UNTA 1Y6KR 4E0RA 3MFFA 4Q9RH 3GO1H 3A6CH 4N5ED 3ULVC 3MLRL 1Y6NR 4ZXBA 4NQDA 2NZ9C 2AV7A 3PWNB 4HLJA 4PREA 1QLRB 5DJDB 4MDJB 5GS1C 5TPWH 4H1LB 5JIIA 5L8JB 2A83A 3UJIH 5DS8B 4ZSOE 5FYKH 1WAAA 3MBED 4N0RA 4JZJC 3FQTB 6CGTA 1GOGA 4OCYH 4ZTOL 1GXEA 2NX5D 4UUJA 4EI5B 2IAND 4TSAL 5E8PA 2DQTH 4NQEA 3C6LD 4UU9A 1YECH 4G6KL 4ESKA 3A67L 3MCG1 1FPTH 3ALPA 4N90D 1I8LA 4PG2A 2AJYH 1LO2L 1F3JB 4LHJB 3QHTC 3WV0A 1UCBH 3LB6C 1FQ9C 1HHHB 1GZQB 4ZUTB 4DKEH 5D1XA 3MV7B 1QFWI 4LPVA 4W81A 4X6CB 4U6XB 1SBBA 2HJFA 3MLWL 3GMOA 1UA6L 1ZA6B 1LWRA 3RZCA 5IJVB 4MA3B 3STZB 1EV2E 5HYIA 4NNPL 3QA3B 1J5OL 4JFZH 5DJZA 3SBWC 5DI8B 5HY9B 1UKQA 3MRJA 1P2CB 3BEWB 1D9KC 3D3VD 1MVFA 5EUOF 3Q5OA 1HDMA 3SOBH 4UT7H 4N5EC 5JDSA 1TVDA 2AJUH 5BXFA 1NCTA 4C56A 2W65A 1DUYA 2JB6B 3RL2B 5HHPB 3U7AA 1RJLB 4KJYB 3MBEC 1SMAA 3JZ7A 3OL2A 4O5LL 4W6XB 4FQCH 2ZOLB 1B0GA 5MEOA 3B8YA 5ALBL 1O7VA 3B9KC 3R0NA 3KS0H 1FJ1B 2F19H 1VPOL 3DXAB 5CEZE 4ZSOA 4P3WA 1TCRA 2GSGA 2UY6A 1FGNL 3P2TA 4ETQA 5EN2A 1CGUA 3CH1A 4XNZB 5J6HA 5IMMB 2EKJA 3HE6A 1A1OA 1SMOA 4RBPH 2YUVA 5DA4A 1IEAB 1PVHA 1INEL 2FX7H 3IJHB 3MRPA 1NMAH 5FECB 3CC5B 4WFED 5C0DB 3RVWC 4R90L 4Z7NE 1N59B 4X6DB 2ZJSL 5F89A 1EK3A 4L3ED 1ZVYA 4M1DL 1ES0A 1QFPA 2AABL 2GFBB 3AM8C 3OAUL 4MA1C 4WV1C 2DMKA 2EDQA 1IZKA 1P69B 1S8DA 3H9SB 1ZEAL 4IRSD 4QYOA 1R3KB 3EO0A 4MJ6A 5KSVA 2G2RB 4KRMB 3E8UH 2GT9A 1Q9KB 1OSZA 2VDMH 4OGXH 2MWCA 4FQ1H 4Y19B 4Y7MA 1JPFA 2DQHL 4DWHA 4XPFH 1MJUL 4KI5E 4QF1B 4J8RB 4JM2C 1OOAA 3HC3L 1QQDB 1ONQA 2EIDA 2NXYB 1IGJA 1KSRA 4RGND 5I17A 2OBGA 3L3GB 4AMKH 4HUKB 3QXVA 3SO3C 4DUWA 1DEDA 3RUGF 4M6MH 1FFQA 1N6UA 1ADQL 1V3JA 3UBXG 2DTMH 3MLZH 1YEGH 5GJSL 5LKNA 3O3BA 2D31A 2OJZH 4OF0A 4QRPB 4WFFE 2Q76A 5FM4A 1AP2A 3QUYA 3S96B 3T09A 5HDQH 4L8CB 3J8F7 1KELL 3MXVH 4DUXA 2OXHA 3I6GA 3ZE0F 4NFBA 1BZ9B 1BQHB 5D5ME 4FQXD 3MCKB 1MWAH 4M6AA 2XV6B 3IXAB 1AGDB 2JE8A 3T2QA 5FCUH 4NZTH 3BQUB 1OAQH 1A3QA 1ULVA 3IGAB 4NWTH 4P9ML 4AQOA 1C12A 1GVIA 1YEFH 3QFDA 1DZBA 4NBXB 4R7NB 3CSYA 5DQJB 5HDLA 4EI5D 5D7SL 4DN3L 4ZFZA 1JWUB 4RGNC 5DRWA 3PJSB 1IT9L 3NGBC 3V0VB 1MAJA 3MRGA 5E8EB 1OHQA 3VFWA 3RHWK 1RZFL 5F7KC 1BOYA 1FE8L 2Y4SA 3RKPA 4OT1L 1A3RH 2RFXA 2NCMA 3RNQA 5CINL 5C08B 4M3JA 1MRDH 2OTUB 1J0HA 2CKBA 4LPYA 4GKNA 5E6IC 5DLMH 4Z76A 1QP1A 1ZHNA 2D4FA 2XFXB 4PJ9B 4HS6B 5JUEH 1T04B 2AJZB 2H3NB 3VI4F 2ESVD 1CCZA 2VLJD 3F7YB 4Z7QF 3V4UH 4RSVA 3UYOD 2IJ0C 2QSTA 3AXLB 3Q48A 4OFYD 3G6JF 3U30B 3BIKB 1FRGL 3LOWA 1JWMA 4FQXC 4HZLA 4CW1B 5MENE 1YEDA 2V7NA 2VDNH 1ZLUK 4Z7UB 4OCWH 4F58L 2MHAA 1NGZA 3BO8A 3P4LA 2FDBP 1GGUA 4AENB 4DOHB 1CXKA 2ICWA 2R0WH 2P24A 5IFAH 5DR5H 5D5MA 3BKCL 3TT3L 3LZFH 3QH3A 4S11A 2AGJH 4FFVD 3V7AE 3TPUB 4EI5C 5DVKA 1CFNB 3TT1L 3WEXB 4QXWA 3SEPA 3V5HA 5FKAB 4HAGA 3S35H 4Y89A 1OCWL 4GG6F 1A7PL 4NC1C 3LRHA 3TO4B 4S1RH 3ZDZF 4LDLB 1AD9A 1UACH 4OF7A 1NDMB 2W0LA 4K8RL 3CFJA 4U1MB 1Q0YH 3S4SB 2HFFB 5C3TA 4PJFB 1MCLA 1U58A 4Y4KB 5EUKB 3T0WA 2CDEA 1UYWH 4EI6A 1RIHH 4XP5H 1R3LB 4JANB 2YD3A 4QHLA 3W9EB 1NKOA 2CKNA 3VXUD 2HFEA 1GOHA 1TVBA 2VDQH 2VZSA 2BY0A 3KPRB 3MPCA 5CJBA 3OZ9L 5KG9B 5HD8D 2IEPA 4DEPB 1GZPB 2P5WB 5D93B 3HPLB 2J1KA 3GJFH 3MLRH 4LBEA 3FQNB 2AS5M 2FIKA 3TBTA 3WE6A 3QDJB 3CFBB 3VI3F 1IAMA 1NCUA 2OMNA 3BZEA 5DFVD 4FFVC 1H3PL 1DUZB 5MENA 5JA8B 4ZTOH 5J56B 3HI5L 3BDXA 1KG0B 2BVEA 3SGEI 1QYGH 4QTHA 4G6KH 1IC1A 3JWOL 3WJJA 1A6PA 4EVNB 3QG6A 5EIIA 1JRHL 4XNZC 3SJVB 5DRXB 1DJSA 1KXQE 5CKAA 3H3BC 1L6ZA 4U7KA 4FXGA 3TWCL 4AZ8A 2VDPL 2E5EA 2EYSB 4D0DB 5JNYB 3M8OH 5HHOB 3V0WL 4L8BB 4QRPD 3U7YL 4XWGL 3TO2B 1UA6H 1U95B 2EDKA 3BP6B 1NFIA 5DFWH 4F9LC 1JGLL 2WNGA 5DK0B 4NNPH 5AZEL 4MWFA 1J5OH 2CIIB 4LF3A 2WM0A 3EOTH 2YD1A 4X9HA 3HAEA 4F7TA 5DD0L 5C0IB 5A2KH 4QY8A 1MEXL 3DRQA 3MLXL 5HD8C 1UXSA 4GH7B 1KCKA 2Z31B 5HXMA 1XR9A 5EORH 3EYVB 2JTDA 4LSUL 1NBZB 5CEZL 4O5LH 5CLWA 5DFVC 5IM7A 4EUPG 5HGDA 2QJDA 1AQDA 4ZYKB 5ALBH 2QEJA 1Q8MA 5EB9A 3F7RA 2WBJA 4PJCE 3PWUB 1FVEB 2DMBA 1FN4B 4NO0A 1VPOH 5E9DE 5EUOB 5KZCB 3N1QC 3BT2L 3FTGA 1FGNH 5EZJB 2RCSL 3OR7A 4U2ZA 1IEBB 3LS4L 3KJ4B 5LG1A 1T20B 1BVKA 4CVUA 3M17B 3IDGB 1EHXA 5IMLA 1INEH 5B39A 3RWEB 3D2UB 4PJ9D 3TC9A 2NY3B 2HRPL 5C0RL 4Z78A 4R90H 3CFEA 4PRAA 1JE6A 3NZ8B 5I8OL 2ZJSH 5D1ZA 1DN0A 1ZHKB 1FG9C 4M1DH 4H0HB 2AABH 3OAUH 1UADC 1KUMA 4L4TD 1NJ9A 1P5VA 3S34L 3TH2T 4LP5A 4EEEA 3VG9B 5C0BB 1RZGA 1ZEAH 1T7XA 1FNGB 4JDZA 5JIHA 4L1DA 4ZUWA 5C0ND 5JQHC 2ZSWB 2FH6A 5ITFA 5JHLL 2CKBL 3QXDA 1TZHB 5K9KB 1R0AL 4G9FD 2DQHH 1U8QA 5A40E 5H37H 2OZ4A 1HXYB 1VEMA 3HC3H 1TJGL 3IFPA 4O02L 1HH6A 4OZFH 5TFSL 1IKNA 4OD1H 4LCYB 3RBGA 3W0WB 1FAKT 1NGPH 1ADQH 3V5KA 3LH2L 2OTPA 4X8XA 4QNPE 4PJCA 5GJSH 3W5MA 2ORBH 3MV11 1U8OA 1O0VA 5E9DA 5IBUG 4PJ9C 5ILTL 3B6SA 2FB4L 3VA6A 1FL5A 3WFEL 3NCYP 2AK1L 1HXMB 1KELH 1D7FA 4R8WL 1NCDH 4UQ3A 3U30C 2GY5A 5IB4A 1PX3A 1EEZA 3U79A 2EC9U 3TBSA 3QUXA 1UC6A 3MJGX 3RWHB 4X5XA 3MUJA 3PWVA 3U83A 4RCAA 4R4ND 5C0NC 1QA9B 5IKCB 4P9MH 3RVUD 2I5YL 1Z5LB 4PRIB 3G6AA 5CBEA 4D0BA 3ARGB 3ZE2E 3IS0X 1V7NL 4KZEL 1R5VA 4JKMA 2MQ3A 4GRLA 4LCUB 4DN3H 4U6YB 3TIDA 3D0VA 5E7BA 1Z9OA 1IT9H 5B22A 5ESQB 4G43B 2MMXA 3SJVD 1RZFH 5GSRA 5H8DA 1FE8H 1OTUC 2Z93A 3MLTA 1MHEB 1KJ2A 3RAJH 4OT1H 3GB7A 2A1WH 3RWCB 2GTWB 5IF0A 2D4DA 2GEEA 5CINH 1KBGL 2BMKA 2AJVL 3ZDXE 4HUUB 3OXRB 2QSQA 1U8JB 4JFXA 5IW1B 1FGVH 4GKSA 1SEBB 4ELMF 5IMOB 3P73B 1K5NA 2ARJB 3GRWA 4J3UA 3F8UB 5D93C 2PW2A 2XXCB 2Z31D 1FRGH 5GGTA 4LVHB 3SKNA 2DQFA 2GW5A 3PGFL 4N9GA 4R4NC 4F58H 2J8HA 1XZ0A 4JRXB 2H9GA 3BE1H 3QDGE 2YN3A 1FLTX 1D5BB 3FT4A 1ZLSL 5IHZB 1P84J 3OJDA 4S0SD 4YHYB 1L9NA 3BKCH 3J7HA 3TT3H 4G80A 3VH8G 3P4NB 1DFBL 1GJIA 5D7LB 3VD4A 5HYJB 4IMLA 4YWGL 5F9JA 1EXUA 2AXHA 3TT1H 1YDPA 4XGZB 1QACA 1TZIB 2R2HA 3IAQA 3OB8A 3QJHB 1OCWH 4IOIB 4WCYL 1A7PH 3MRMB 3BWUC 5DHVA 5IEKA 4HKBA 5BV7L 1KOAA 1JWSA 4K8RH 3CDGB 5ENWB 2YOCA 1FFOA 3O8XA 2CIKA 2CXKA 4DAGL 5FOBA 3MYJA 5DYOA 1RV6X 3LV3B 2JIXB 4HPOL 1I7TA 5JORB 3D2UD 2PTVA 5BMFL 2NY3D 4RAVB 3FN0L 5F7LB 4WY7L 3OAZH 4JN1L 5C0AD 3OKKB 3E3QE 3U36B 2R2BA 3UTZB 4ZG1A 1AO7E 1OGTB 5B8CB 2G60L 3ARDA 3PP3K 5J7CC 4XXCC 4GG6B 1UWXK 1VGKB 2Z31C 1KNOB 3OZ9H 4HH8A 1HHKA 4HIJA 4MNHA 2WV3A 3IDMA 2BNQB 4LHUB 4H88L 1FL6A 3EBAA 4NIKB 2DKMA 4DW2L 3DI3B 3GMQA 4FMFA 1IAIL 1C7TA 4KTEL 1AGCB 4CVZB 2XQBL 1H3PH 4P4RB 3WIIL 4MLSA 2CD0A 1EFXB 3HI5H 3Q2CA 2YEZB 2NY0B 4X9FA 3QDGA 4P5TB 1D6EB 3JWOH 2V2WB 2DWDB 4CU6A 4W4NA 3KJ4C 5DMYA 3TWCH 2Y5EA 4P2QB 2AEWA 5E2TL 2VDPH 4IHOB 2VISA 4NRZB 3N06B 3U7YH 1DLHA 3NIDF 4XWGH 2NY3C 1VENA 4DZ8B 1H3TA 2FYYA 1JGLH 2OZ4L 3G5ZA 2UUDK 1WWBX 2FCBA 4PJ8B 4X7TA 1LE9B 4MD4A 4J2XA 3IRPX 2ZSVB 5KS9F 3DVIA 3CFIC 2BC4A 3VG9C 1EA9C 2J8UE 5DD0H 3B9VA 1MEXH 3MLXH 5CUSH 3E3QA 1Y0LB 1Q9WB 3SY0B 1AO7A 3F58L 4LSUH 4PRID 4RIRA 5CEZH 2NW2B 1KXTB 3ARGD 4I9WD 4TUOA 1PD6A 3C6SA 4PRDA 3FOMA 5EU5B 3WKML 3IAPA 4JQXC 3TCLA 3LEXA 1G9EA 2WUBH 3DO7B 2XG4A 1BX2B 1KT2A 3LIZL 2PXYD 5GIRB 1SM3L 4N5UA 4PGDA 2X7LA 2ZUVA 3L5WA 5DT1L 4UIMA 3BT2H 1YY8A 1WIPA 2RCSH 5IGXL 1A22B 3LS4H 1EEYB 3VRJB 2SEBA 2BNRB 3O4LE 4UNVA 4GXUM 2HRPH 2D7QA 5LBSL 5DD5L 4E42A 4LKXA 5C0RH 1BJ1J 1JNNH 3BX7C 3RWJA 5I8OH 4DGIL 4PLJD 2IPKB 4P2OA 3LKOB 1MQKH 2GITB 1PEWA 2X1OA 3S34H 3BVNA 3QIUB 4ODWB 5I1DA 3KXFE 3RPIA 1KJ2L 5GGQH 3QWRA 4NM4L 4JRXD 4UDUB 4PFEA 4O2CA 1T2XA 5JQ6L 5F70A 5IFHL 5JHLH 4HV8B 4RDQG 3ARGC 2J8UA 3OR6A 1R0AH 1DP0A 5D7LD 2BOBA 4IRJA 5HYJD 1R3HB 3K81A 4KHXL 2X89A 1VFBA 4OGYL 4F7CB 3IJYB 3T0EB 4HUVA 3BAEL 2AQ1A 1DLFL 3KYMB 1ACZA 3ORJA 4O02H 3DBXB 5BS0D 3FFCD 1OLZA 3GRWL 4ZUVA 5TFSH 1H5BB 1ED3A 4P46A 4AYFA 3OGCB 5GGTL 2VLRB 3UTSD 3L3IA 5BW7A 3LH2H 1HHGB 2JIXD 5DHYB 1OB1B 4PGZA 2J3SA 5MP6L 3C60B 2DIAA 1TXKA 3NIGF 4YZFF 1A6ZB 1M7IA 1FO0A 1KTKE 4L4VB 5ILTH 1VFAA 3RY6A 1QRKA 2FB4H 3U9UB 1KPVA 4P3DB 3WFEH 3BRDA 1G6RA 1K4CA 4OCXL 3WUWA 5MEPA 5IBLD 3WDIA 3PG2A 4PLJC 2AK1H 2I24N 2DI8A 4TVPE 3P9WB 4R8WH 2N56A 3O4LA 1IC4H 4YDVA 3S6CA 4K9EL 2NW3B 5L88L 1IQWL 1IFHL 3LKPB 5C2BH 4M9OA 2OI9A 3GSRB 4OJFL 4XP9L 1ND0B 2OMBA 4LHUD 2CK2A 4XWOD 2RBLA 3FO1B 4EN3A 4OIBA 4M61B 3SQBA 4QRTA 3MRCB 4MD5A 1GSMA 4YHYC 2I5YH 3HNSL 4GXVL 4PD4K 5D6CB 4XNUL 3QEQE 3KXFA 3DIFA 1MH5B 1C5CL 2DOCA 1V7NH 3KLAA 4A6YB 4KZEH 3BP4A 4AM0A 2H8PA 4ACPA 5CEXB 5IJKC 4LPWA 1KIRB 4P5TD 3BRGC 5L2KE 1S9KC 3IDNA 2W9EH 1RHFA 1I9JH 1HIML 2CDFA 5DJ2A 2DLGA 5FA3A 3P3YA 3ARVA 1C7SA 4ODHL 1KBGH 2Y7QB 4Z18A 4BFIB 1G7QA 5FA4B 3ZKSD 4YUEL 2OM5A 1JBJA 4Y5YC 3QT2A 5FGRA 5ICZB 4Z7WF 1T4KA 3G5VA 3GGWB 1E4KA 2W0FA 4RA0C 4PJ8D 5B8CC 1DQQA 1NBYB 3GIZL 3VXPA 5IBLC 3SDCA 4FZEL 1SBSL 3JVGA 5J6GB 5E70A 3LQMA 4X98B 4WJ5B 5I8CB 1VACB 1ORSA 4XCYA 4P9HL 3OJVC 4YO0A 1RZJC 2OTWA 4W70A 2FWOB 4KVNL 5E24E 4NBYB 1MI5D 4HUXA 4YBQD 1OAUL 1MELA 1CLYL 5BZWB 4WO4D 5KOVC 1OY3B 1CIUA 1BQLL 1ZLSH 4V2BA 2ADGA 3AMLA 1S7XA 4Y16D 2GCYA 2CO7B 1DFBH 1V5JA 3SDDA 2XT1B 4YWGH 4W6WB 1J1OL 4ELMB 1UM4L 2OSLA 4P5TC 3GFUA 1J8HB 2GY7B 3HAEH 1P4BL 5IK3A 4WCYH 1G9ML 2OP4H 5AYQA 3FT2B 5BV7H 4NO3A 3KS0J 4YGVA 4DAGH 2BNRD 1FAIL 5TDOB 4HPOH 4CBPA 5L2KA 5BMFH 3FN0H 3ULSB 3WBDA 4WY7H 5SWSD 4JN1H 1F3RB 3LQAH 1ZSDA 4PJ8C 4NPYB 3IJSB 25C8L 2G60H 5FGBA 1ORQB 5C0CE 4O4YL 1XGTA 1ZGLB 1JNHB 4U3XA 1NGWA 3GSXB 5BQ7A 3ILQD 1EJ6A 4PR5A 3FQRA 5TE4L 3M1BB 2YA1A 4H88H 3KNBB 3VGHA 4WO4C 2YXMA 2I60L 3BWAA 2ICCA 3MRLB 4FQ2L 1IAIH 2FIRT 4HCRA 4OUUB 4D9LL 4Y16C 2XQBH 1U8MB 4FG6D 2XKNB 3JTSB 4JFOB 4R2GB 4OV5A 3WIHA 1NGXA 1F45A 4FQJL 3B2VL 2D0GA 3G08B 3SKJL 4BYHA 4DTGH 2AVGA 4WDIA 5TJWK 4HEME 2VLRD 3VRIA 4KDTC 5HYSB 1CDIA 4NHUB 4L9LB 3PWJB 4MSWB 5IR1A 1PZ5B 3WL9A 1RHHB 4JPIA 2FLBT 4QHMA 4QRRD 5E2TH 3ZDYE 2PN5A 4L4VD 4FMKA 3KLHD 2WY3A 4GXUN 2OZ4H 4KJWD 2BY1A 3B5TA 1WTGT 2GHWB 1UGNA 4RDQF 4OZGF 1OQOA 3N1FC 1I8IB 3NCJH 5DVOA 1NEZG 4UTAL 4JRWA 2PNDA 4BFEA 4L8SA 4PJIB 4NFDA 4HMCA 4MVBA 4GMTH 2NY1B 4PGCA 1RUKL 1U8HA 2VJXA 1FG2B 1IGYA 2VL4A 5C0CA 2CR3A 1FO0L 5DSCA 3ROLB 2VLKB 1G7PB 5HVGB 3WKMH 1OGAB 4JFDE 1G6RL 4E5XB 1PX4A 3LIZH 2VTFA 1HEZB 2GK0B 1SM3H 5MI0B 3FO2B 4OLYL 5KS9B 1H5BC 5E94B 2F8VA 1B3JA 3CSBA 2YC1A 4Y4HB 1JYXA 5IGXH 2X10A 1I9IL 4FQPA 3QZWA 3C60C 1ZT7A 4BSWA 1T03L 3VCLA 2QHLA 1JPST 3KLHC 3SDAD 1F6AB 2WBKA 1NSNL 4U1SA 3P9LA 5LBSH 5DD5H 5HHXL 4GLRH 2UYLA 1U36A 5H2BB 43CAA 1AXSA 4DGIH 5T3ZE 5I8KL 4ZO6A 5IBUB 3HR5A 3FO0H 1LO0L 5BZDA 3RTQB 4GQ9L 3T8XB 5T3XE 3ARZA 5SV4A 5TGBB 4OFIA 1KJ2H 2C4FU 2ITCB 5FXCH 4D2NA 3MUZ1 1PKQB 3GSQA 1HH9B 4O2FA 4Z0BL 5JQ6H 1S7SB 3FONB 1LK3L 5ESAB 3RVVC 2NTFA 2FGZA 1MAKA 3AB0B 2E7BA 4KHXH 3PWLA 5I8EB 1J0JA 1CLZL 1U3HD 3BD3A 3HRZA 4OGYH 1MCCA 1CFTA 1AJ7L 1LP9F 1UB5B 3BAEH 1DLFH 1WZ1L 5DXWA 1YMHA 1TENA 4FFYL 3H9HB 4NQCB 3GRWH 1M6OB 2R0ZL 1W8NA 1U3JA 5F6HJ 5GGTH 4BH8B 4BQBA 2APWA 5E4EC 4NOFA 4V3EB 4ZAKA 2QQNL 4JFDA 4KV5F 5JLZA 4R7DA 2VL5A 3ULUE 2ED9A 4TVPL 4U6VH 3ZT7A 2P5EA 5MP6H 4GRMB 2B1HL 3SDYL 3L5IA 4QHNB 5ISZE 4X8JA 2LVCA 1QBML 4M5ZL 4MNQB 4OCXH 4BSVB 2KPNA 1WBXA 4G8GB 4AH2B 4UOJA 5L88H 1IQWH 1IFHH 3WUZA 5DHVH 3C8KB 5LWYL 4OJFH 3LKRB 4XP9H 5EC2B 1LEGA 2X4NA 3H7BB 4BK5A 4PJGF 3L5XL 3S98A 4J23A 4S2SA 1I1YA 5DO2D 3SE9L 2E27L 5LQBL 1RVFH 1JRHI 3TJHD 4ZFOA 1AGFB 1B90A 1CL7H 4GXVH 1RJZB 3HNSH 5DK2A 3HPJB 1LO5B 2VZ3A 4XNUH 4A2MA 3IRZA 4R2GD 3HKFA 4GOSA 4WGVB 2AEPL 2CRZA 1U3HC 2A73B 3DV6A 2H6PA 1Z3GL 2ID5A 4JFQB 1C5DB 5EOQL 1OPGH 3MMEB 4M6OL 3AS0A 3D0LA 1MLBB 3F6IA 2AJXL 3I02B 3SKOA 4OZFG 4PTUB 3V6FB 5ABDE 5F72S 1FC1A 3GSVA 4X4XB 1T83C 1HIMH 3O6FA 2NY4B 4Q2ZA 4R0LB 3QIBA 2VITA 5T5FL 4ODHH 4G6JH 3VWJB 3BPCA 4JN2A 4X99B 5HHNB 4JJ5A 3RL1A 4KKBC 4HCRL 32C2A 2D9QB 3WIHL 4K2UH 2CGRL 3HNTL 3T1FA 5FK9A 3V8CA 4LLQA 4FZEH 1SBSH 5EOCJ 1FZKB 4AIZB 5GXBB 4HQQL 2DN7A 5ISZA 1I7RA 4P9HH 5DJ0A 4XP4L 5KSUA 4KVNH 1OAUH 1IBGL 1QO3B 3PQYB 1CLYH 5DO2C 3RY5A 4HUNB 2VLKD 2EKSA 2XY1A 1I1AB 3SCMA 4DKAA 1S7TB 1BQLH 1UXWA 5I66A 4Z7WB 4MJ5A 4R2GC 1IRAY 3GSNB 3L3DB 4CVXA 1J1OH 6FABL 2A6IA 2EECA 3BESR 1U3YA 2W07A 1JTPA 4B7LA 4AEFA 2DMCA 2NNAB 4L9LC 2ATKB 1G9MH 5IMKA 2R39A 1IM9D 3CFCL 1CBVH 3BYTA 4UNUA 1HQRB 2VLLB 1FAIH 1P7KA 4R3SA 5HGAA 3E2HA 1OP3K 3EDJA 4QXTA 3IF1A 3TBVA 3K2MC 3DRTA 1XCQA 1F00I 1YYLL 4GAYB 4PIRF 3MUGA 4P4KB 1YPZE 25C8H 5BO1L 4AK1A 3RTQD 5I1HL 5F7UA 4O4YH 1A9BB 1T1XB 4LKCA 5IB1A 3BHBA 3O6KH 4ODTL 5FAAA 1AIFB 2ICEB 2NY1C 4MB3A 3RNKB 5TE4H 3QIWD 4DQOL 2I25N 3QI9B 4U0RB 3RRQA 1T5WA 5SWZE 2VDKL 5K93A 5L2JB 4MZ2A 1ZLVH 5D7JA 2I60H 5IVXB 4FQ2H 3FT3B 5CJ8A 1VDGA 3FQXB 4GBXB 3PE9A 4KKNA 2AJ3B 4FQJH 3B2VH 4S1QL 1M4KA 4NQCD 3SKJH 2IH1A 1FVDA 4RISL 5JPMA 4Y4HC 3C08L 4L5FL 5CIPA 4F37F 5JW3L 1BP3B 5JXEA 5K9OA 1GH7A 3MRHB 4Z7QE 2VWEE 4LCIL 3ARWA 5DVMA 4CN1A 3OKDA 4OKVA 2EDNA 3O6LL 4TNVK 4MNQD 1RIVL 2IADB 4X7DC 5DK3A 2PYEB 4OF3A 5MERB 3QO0B 1I3RB 3A6BL 1N64L 3BUYB 4G8GD 3RTQC 2WK2A 1WBYA 1Q9OB 4WW2B 4K7FA 4XC3H 2BY2A 1INQB 2IQAB 4YJZL 4N0CA 2QBWA 1RUKH 3MRKB 1YPZA 3B43A 2QR0B 3DTXB 4O58L 1FO0H 4UI2A 5GSVA 3ZDZE 3AB0C 1IARB 1DEEA 3EO1A 3UJTL 1BD2D 4BH7A 4OFPA 4Y4FA 3NFNB 2YUXA 1G6RH 1C16B 2B8OT 2F53B 4PLOB 3IDIB 1GPOL 3EZ8A 4UQ2B 5SWZA 4XP1H 4OLYH 3VGFA 2HJKA 2I07B 3V4PL 5ID1B 2CRIA 2NY4D 2R1XA 2J4WL 2XTJB 1RJYA 2ZZUT 1I9IH 4I48B 4YXHL 5J11B 5T3ZL 3VWJD 1T03H 5D7KE 1BQSA 1KTDA 2AW2A 4ZFOL 3P9MA 5T3XL 2VDLL 3KLSA 1NSNH 1WC7B 5D4QA 4F8TA 5HHXH 2PYFB 3RIFF 4K7PY 1N5AA 4K94L 5JHDD 3CLFL 1LO0H 2YXFA 4LCCA 4GQ9H 4HIHA 1S5HB 1CIDA 1FBIL 1PG7W 5EO0B 2X4PA 3T77B 2WSKA 1JN6B 4XBGB 3D39B 4HDIA 2GJZB 5CWSA 1GC1L 3PQYD 2D7PA 3WCYA 3BZFB 4X6FB 4OI9A 4Z0BH 1LK3H 1DVFB 5I1LA 2K7PA 3EJYD 1IGML 2RQ8A 1A2YB 3RJDA 4Y1AD 5EIQA 2BVYA 3I75A 3AREA 1W72B 2XN9B 4DUVA 1CLZH 4G7YL 5JOEA 3RPKA 4XX1G 1MCSA 3ULUL 1WZ1H 2P43B 4FFYH 4J3XA 1E28A 4U1NA 4POUB 2R0ZH 2AQ2A 4L29A 4NYLB 3PL6B 1G7HB 1KJMB 2NY4C 3X13A 4R0LC 1NDGA 4YEEA 1QR4A 1HHJA 2VABA 2VAJA 2X09A 12E8L 4X6EB 3VWJC 2NY2B 1CD0A 1MFAL 4HWNA 5CP3A 4TVPH 2Z4QB 1YUHB 1CFVL 4LCWB 1ZK9A 2EDEA 2B1HH 4JFEB 3SDYH 3VWKA 4LLDA 3HZYA 2DWEA 1BFVH 3ARYA 4LVOB 4P4KD 4RWYH 4M5ZH 1LP9B 3X11A 2FZ3B 3HC0B 5FYJE 3ZHKA 3TCXA 2VH5L 2MQCA 2OQJB 3DX6B 2C1PB 5LWYH 3WS6A 3RVTD 4PJ5B 4HKZA 1CR9L 3L5XH 1EHNA 4PRNA 2VXUL 3CXHK 1UM6L 3OB0K 4LLVA 3VA2C 3RY4A 3SE9H 2E27H 5LQBH 1F3DJ 4XMKL 3EJYC 4GBXD 1MWAB 2P7TA 3SKMB 5E00A 2VOTA 2AEPH 2BDNL 5DURD 1Z3GH 3HLAA 5EOQH 1WAAF 4JDVA 3L3OB 1XAUA 4M7ZB 5C09B 2JB5L 4NZRL 2AJXH 2DQGH 4U1JB 5F1NB 3P77B 1SYSA 4RX4A 1T80A 4RGOH 1S7RA 3ULVE 4PJGB 3GMLA 4XRCB 2Z92A 4KRPB 5T5FH 5CMAA 1OLLA 3NCYS 3D69A 3O45B 4U1IB 4RFEB 1JV5A 3Q1SL 4MNGB 2WINA 1MCIA 1MVUA 3S36X 4CRPA 5DZLA 3MRNB 2PYED 2DQIL 4P4KC 3WIHH 3NOIA 2AI0L 4JG1L 4KVCL 4LL9A 4RQQB 3HNTH 5FDWA 2HTKC 4NN7C 1B4RA 1XIWB 3BP5A 5MHSE 2L0DA 2M8XA 4HQQH 3RVTC 3P4MA 3QI9C 3O9WD 4U0RC 5FF6B 4XP4H 1MFEL 3O81A 4JFYA 4YHKL 4JM4L 1SJHA 5DUBA 3JV5A 1IBGH 1ROWA 2VE6B 4YFLF 4WWKA 4MX7A 1EVTC 4GBXC 3UPCA 4UDTB 5GS3A 1NGYA 2C3WA 2FHCA 4JY6B 5GGSB 1ITCA 1NMBL 4P48A 2F53D 1UJTA 2E6JA 3KPNA 4XHJC 1CXIA 2KQNA 2FEDD 2BOCB 3TBYB 4OQ1A 3REVB 5C2UB 4X80H 3U2SB 2VXSH 4GLRI 3NFSH 2XTJD 3KPPA 4X0KB 1P1ZA 1J0YA 4D9RD 4M1CD 4HT1H 5AG9A 3LCYA 1VKXA 3TP4A 2DM2A 3DGGB 1EDQA 1KIUA 1Z9SA 4PV9A 4XCNB 1WFTA 3ZKQD 3L95B 3RI5F 3B2UD 5I75B 4OLVL 1ZS8A 1FL3A 3MYZA 2RGSA 1OP5K 4M48L 2ADJB 3FZUD 4OF5A 2NX5E 2IANE 4PTTB 3BKJL 5BO1H 5I1HH 3QQ3B 5GS1A 1H3GA 4U1GB 4WW2C 5CEYB 2PF6A 1SEQL 3UTOA 1CICA 1SYVB 4Y2DB 4ODTH 3K4DA 2HJLB 5I71B 4N90E 3D39D 3O9WC 4JZJA 1Q94A 1K8IA 3VFPB 4J3VA 3CZJA 1Q9LB 5IWLA 3KPQB 2VDKH 3V5DB 3PDOB 1DVFD 1C08B 1OAKL 1T1YA 1D6VL 5CZXD 1BECA 2QQQA 1MF2L 2VAAA 2X4SB 4G8EA 3D1MC 3VJ6A 4G3YL