3L3JA

Crystal structure of hla-b*4402 in complex with the f3a/r5a double mutant of a self-peptide derived from dpa*0201
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3jA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3jA01
2DMCA 1CI5A 4C58B 1KC5L 5KSVB 2NY2C 4XP6H 5KBNC 2DKSA 5ISZD 5HJ3A 3D3VD 5J1AA 4JKMA 4Y19A 3FQXA 1C7SA 2DBLH 1OTSC 2GJZA 5CIPH 2LFGA 3SDAA 2IAMD 5H37G 4P3WA 1OSPL 1YYMH 1HXMA 1LO0H 3QIUB 3C5ZA 1ES0B 2I25N 3QUZD 4FXKA 3ALXA 2M1KA 1BZ9A 3FT2B 3QCTL 3NACH 3U79A 2V7NB 4GAGH 4PP1C 4YQXL 3OKNB 4UQ3B 1FJ1B 3NPSC 3S4SB 3CVHL 4GBXA 4HK0B 4R3SA 2H8PA 1R0AH 4TNVF 2QQNH 2NY2B 2Z4QA 1AKJD 5EO1A 5ITFA 5MENA 1KLUB 4NN5B 4G6ML 1ZWIA 2ORBH 2X7LA 1CT8B 4PGJA 1QFOA 3WJJA 5CBAA 1JGDB 1NMBH 4KDWA 5C0AB 3C2SA 1PAMA 4JFXB 3F7RA 1S7RB 1CIUA 4D0CA 4LKCA 4Q9BA 1P4LB 4R2GD 2CUMA 3BRDA 2YS4A 2CLVB 1KENL 5E2WH 3O9WB 1U6AL 4QWWD 4PJIB 5F8RC 3FO2A 3NPSB 3LKNA 5ITBL 2GAZA 5IM7B 1L0XA 3LEXB 5D1XA 2X4RB 1JPSL 1CICC 3T2QA 3WN5C 1L7TL 4WUUE 4Q74A 2X40A 3ULSB 2MPAH 4QRSA 1SEBA 4HK3J 4WFFD 3ARFA 3VGEA 2X41A 1MPAL 2YOCA 2R1XA 3QR2A 4Z0BH 5L9DL 5J12C 4GUPB 3P9LA 1ED3A 5DI8A 1KV3A 4CW1A 4X5XA 4KROD 2NY0D 4WO4C 1JYNA 1OLZA 1SY6H 1NL0L 2Y1VA 3AXLA 3RI5K 3MREB 5E5MB 3DGGA 3EW3B 2R1YB 3MCKB 4KU1A 3O3EA 1U42A 5C0RH 2AERT 1FIEA 3VE0B 4Y5VA 1OGAB 2FO4B 5D1ZC 3HPLA 3VWKB 3QDGE 2VXSH 1T2QL 1CICB 2ITDA 1AI1L 3WN5B 1IC7L 5JXAL 1MJJB 3IRPX 4FXGB 1G7HB 4JRWA 4JAMA 4NWUH 1P7QB 2Y36H 3DVGB 1NLBL 4R0LA 3IFLH 3FONB 2F58L 4MA3A 2AJUH 1M7IA 3FCTA 3V52L 5J12B 3E6FA 4CVZA 5LAXA 2X10A 4LU5L 3TJHA 1N0XL 3QUXC 4TSBL 5GGTA 2DM2A 2Y23A 4GRLC 4WO4B 1B4JH 2H1PL 1AGDB 1OP3H 4YGAB 3L6FA 4PY8I 5TDNA 2FBJH 5ESVB 1I1AC 4KKBD 1R5VA 2MCPH 4P5TA 1KTDA 1G6VK 4DZBB 1W0WB 5CEZH 4QYOA 3X13A 3OWEA 5IBUG 2WM0A 3WE6B 5IMKB 1ROWA 2DKMA 2X1QA 15C8L 2XTJE 3BGAA 4JFHE 3ULUE 2WIMA 5EBWA 5KS9B 1C7TA 1T66D 2BCKB 5TPWL 2YSSA 3UAJC 1MQKH 4LLMB 4OGXH 3SBWA 5CJQL 2ED7A 1FE8L 1CDGA 2WP3O 1YEFH 3MRLA 3ZYJA 4GRLB 2AEIT 1H8NA 1QD0A 1I3UA 2QL1A 3WS3A 3PWLA 3MLZH 1BBJB 5L2KA 3O4LA 2VLJB 1QSED 3MODH 3A0OA 3DSNA 3OX8A 3O2DA 5GRJL 5DD3L 3NZHL 3CX5J 5EWIL 5I1CL 1UWXH 5C70A 3D9AH 3MRDB 4JKWA 3GZKA 5ENWB 3AB0C 3UXFA 5D2NA 2BC4B 4ETQA 2FJFB 2VC2L 5HHXL 3PP3K 4P2OA 4G42B 5SX5K 5BW7C 4E41D 4M48L 3I50L 1IGCL 1DBML 5HPMA 3GSQA 4E9LA 4DTGH 4UMGA 3MV7B 4O2CA 4OZGB 1LK3H 3RAJL 3RWHB 1BX2A 3U9UA 2D4DA 4X83A 5JR1L 3D25B 5GRUH 4AENA 9CGTA 1M1SA 1CN4A 1H0DB 4CN4A 3AB0B 5TDOA 1MCCA 3L3GB 3UZQA 1ZSDB 2PXYC 2BNQE 5F8QC 3TT1H 4JRXD 2Z93A 3EJZC 4KXZI 2IJ0C 4WRLA 1IQDB 3JWOC 4WEBH 4J1UA 3T65B 4UBDD 3MJ7A 4KTYA 3BZEA 3TBTB 1FYTA 2XTJD 5JOPD 2X4PA 1NBQA 2Z92A 4MQSB 2Y07L 3PL6B 3ULUF 1IZKA 4PG9B 5GGQL 3SKOB 3FRPA 1A1NB 1HDMB 3PDOA 4KVNH 5DS8B 4G7YH 4XNYH 3DTXA 1FZMA 4PJHB 4OZHA 3X12A 1CL7I 4N5UA 4IRJC 2XKNA 3GB7A 2I5YH 3M17A 4X9FA 5FO7A 3SGDH 4OCNC 1RZ7H 3UTPD 2YD1A 1CLYH 3S3JA 5K93A 4BFGA 1S7UA 4JDTH 5IW6A 3OKKB 3MXWL 4Z7NE 4HLZH 1DEEB 1KGCD 2D03H 3MJ6A 1ZKAA 4I5BA 1REIA 2EICA 2D0FA 5E2JA 2VERN 4MJID 2AEQL 4RAVA 3BHBB 1HH6A 4P48A 4DEPB 5IVZB 2QSTA 4MSWB 5FO9A 4ZUUB 4DUXA 1RZJH 4OM0H 5FDWB 1JHTA 2Q1EA 3GGWA 2BVQA 4QTIH 5SWSD 3TO4D 4IRJB 1NC2D 4P0DA 5E5RB 1IC4L 1FAKT 5ADPL 4HBQA 3WNPA 1T5WA 3E8UH 4G6FD 5CJ5A 4XI5D 2GY7B 2QHRH 4WU5B 5T3ZD 2HTLD 1IRAY 1SBSL 5CMAB 3MA7B 5HYJA 3BH9B 3BWUC 4WW1B 4HSQA 4BK4A 1GXEA 1KCVH 2VLLB 2NPLX 4LSTL 5GGRB 2GK2A 3CFEA 2G9HB 3BZ4A 5HY9B 2DI8A 3BT2L 4J23A 1FFPA 1RUAH 3P0VL 3VFPA 3U46A 1A7BA 1EEYA 4L4VA 4NBYB 1RU9H 2AV7B 3RUGE 4HH9A 3GJEB 1RUPL 4DKEH 3RDTA 3LQAC 3OR7A 1GH7A 3HA0A 4N5ED 2B1AH 1FLRL 1CGXA 4X6DA 1A2YA 3CSPA 2J8HA 3AAZB 3SE4C 1YMHA 4XBPB 3AS0A 1ZA3B 4Z7VB 4EOWH 2EDTA 3I2CL 1TCRB 4A6YB 3MLPA 3P9MB 1CYGA 4IDLA 4NPYB 3GMPA 4HAFA 1UADC 1H3GA 2PR4H 3ZT7A 2CQVA 4RISH 1BD2B 3DI3B 3BRGC 4FZEL 3HMWL 1AGEB 2X6MA 1U91A 5EZIL 5GRZA 5FYKE 4QT5A 3BX7C 3CFCL 5AG8A 3JTSA 1CFQB 2OJEA 2CK0H 5EUOF 4F7PB 5GGSA 3LN9A 3V5KB 3TJEL 3V6OA 4FS0A 4NGHH 4UT9H 4M1CC 4WFHD 2XN9B 4G8GD 1CGVA 4ZOBA 2F53B 4RBPH 4CU7A 4Z7NF 1JHKH 1S9WB 3LB6D 4KK9C 1YC8A 4DQOH 2EDYA 2EC9U 4HT1H 4K3HA 4BYHA 4K2UL 1QACA 4F7CA 4KJPD 4BZ1L 5DWUH 5EZJB 1C16B 5J1TC 3RZCA 4DAGH 2J4WL 4NIKB 3MYJB 4WHYH 5FCSH 1F58H 5L0QC 4MHHG 1T20B 5IVXE 3IETA 4MCZB 3HNSL 2B2XH 3BZFB 4WI7A 1X6LA 1FLTX 1EFQA 2IBBA 1P4IL 2VIRB 5EOTB 3O2VH 1DUZA 3MBXH 4GG6E 5ISZA 3D3VA 1DR9A 4PD4K 2FX7H 3MLXH 1U8KB 3ILQD 5AD0B 5D7LB 2IAMA 4F8QA 5IB3A 4ZS6D 3D1MC 1NSNH 3U7WH 1FFRA 3C9NB 3QUZA 4YX2H 4P2QE 3HI1A 1MHCB 1IAKB 2MMXA 4JREC 5L0QB 3BD4A 1A22B 5T1KB 4RMQA 2X44D 1I8MA 4NO2B 3OPZL 4FFZH 4OV6F 3JZ7A 1G1YA 5D6DC 3ARBB 2DTSA 2W0PA 1BFVL 5E00B 1AKJA 3QIBD 4L3EB 4NNYA 4M6NL 4JEGB 2JJVA 1LWRA 1AIFB 4ZUVA 2XZAL 2FRGP 4O9HH 4D0DA 5F1SA 3GM0A 3KPOB 4LAQL 4NM8L 5FYKD 5BO1L 4H1LG 4Y16D 4H0IA 5FKPA 2O61A 4MA1C 4PJFB 4ZUSB 4AT6B 3QISA 4UILH 1XH3B 4JREB 1E4KC 3MLYL 1C5BH 5F3BA 4KHXH 3L3HB 3DMMC 3VH8B 3PWPB 1G6RH 4HXBH 3BGMA 4HCRA 5IMMB 5JDJA 2EH7H 3B3IA 1A7NH 1T0PB 5DZLA 1FAIL 3MV9E 1WC7A 1J11A 4PJEB 3G9VA 3L3JA 1DEDA 1GGYA 3QQ4B 4LLVA 4AH2B 4FQPA 2PW2B 12E8H 5DT1L 1IEBA 1OAUL 2Y7QB 4RRPA 1JF5A 2FNBA 2C3WA 2R0WH 4B50A 4JFOA 1PG7L 4S10A 3Q6GH 3VFUB 2VZ3A 5GS1C 2I26N 4NZTH 5FECA 4CBPA 3IXTA 3DVNB 2BSED 4OCXL 2GFBB 4DW2H 4POYA 3MBEC 3I75B 5ILTH 5IVXF 1R6VA 1I7RA 4YO0A 3GSNH 2IADB 1XF3B 4P4KD 4GG6F 3BKMH 5C0JB 3L3KA 4KQ4L 1JGVH 4WNQA 2GSIA 1HCVA 1GC1L 1KYOK 1GHFH 2EECA 2XWJA 4Q6IA 1B2WH 3U83A 1G9NH 3RPIB 3S96A 5HGHA 1TMCA 2Z35A 3IFPA 2VABA 1VADA 3CPLB 3SDDC 3TM6A 3QUMB 1SVZA 3HZYB 1JPST 1K6QL 3C09C 5IROC 1CCZA 4DKFH 3PWNA 3CDYA 2XZQH 4MB3A 4KKAC 3GNMH 4D9LL 3MRPB 2DLFH 2OBGA 4OFIA 3IDMB 2Q7NA 5F7YC 4M7LH 5D7IE 4BQBA 4JO1L 5EIQA 1H5BA 4ZUTA 3CU1A 4Z7OE 1A6TB 2WY3A 1KT2A 3N9GL 3QFJE 1T5XB 3UDWA 3FOLA 4JDZB 2WIIA 5E95B 3QH3B 2NY5L 5AZ2L 1QSEA 1V5JA 4FQQB 3LRSB 3DYPA 2E7MA 4TOYL 4ODTH 4J3TA 1MI5E 1LO2L 2JB5H 1WV7T 3SO3C 2DLEA 5FKAB 3VGFA 4ZNEA 1JNHB 1VFBB 3EZ8A 1MRFL 3FFDB 2FJHA 2YC1A 5FA3B 3FT4A 1VSCA 3AROA 2X70A 3MRQA 4ENEC 2IANB 3U9PH 4H26A 4PJ8B 3EO9L 2E27L 5ETUA 3ARZA 4YDKH 1A9EA 4LQFL 1EGJL 4P23A 2EYSB 4K8RL 3CXHJ 4Z7UA 2A9NL 2OXHA 3F12A 3MCLL 3IDGA 3KJ4C 1RK0B 4JANA 4JRYE 4YGVA 3TN0B 4E41A 4U1MB 1AJ7H 3GSVB 5DQJB 4GFTB 3PHOB 1EFXB 4XWGH 4N9GB 3V4PH 2CDEB 4PRIB 4G8EB 1Q9LB 1F2QA 4Y4FB 3B2UD 1EIBA 3PWJA 2PCPA 3D2UD 1W8NA 3X14B 4CMMA 3BP6B 2MJWA 4F9PA 4JRXA 4L4JA 5AEAA 3X3FL 4H0GA 5KSUA 4PJBA 5E9DE 1IGFH 2UUDH 2OK0H 4RAUA 1QFUL 2OL3H 4WFED 1NCBL 3RWIA 1A4JB 3BKYL 3EZJB 1OAXH 3IDXL 5HDBE 5C0CB 4QXTA 1TZGL 2G75B 1GPOH 4KGJA 1CGYA 3A6OA 5D7IF 3L95A 1MJ7L 2J6EH 4WTZG 5EO0B 5FCUH 4OB5H 1S7TA 1X5IA 4G9FD 5DD0L 1CDCA 1NJ9B 3MACL 3KPRE 3QO0A 1NGZA 1IBGL 4U0QB 2YPLE 1KF9B 4TSCH 4L9DA 4LLWA 4NWTL 3KYNB 4U1SB 1W72H 4L8SA 4RMSA 5F97E 5L2JB 3U30C 4UT6H 3GO1L 1F2XK 2EDFA 3FB7B 5DVNA 2I07A 2EDOA 4MJIA 4Z77B 5CWSA 4R96A 4DK6A 2NY1D 2UZIH 5DSCA 3SPVA 4LARH 3O3AB 1F5WA 4YE4L 5T1LD 3WDHA 1XFPA 4TUKH 2HFFB 5TE6H 4LSQL 3DETD 1U3JA 4H8WL 1JZ7A 1TDQA 1MFCH 1QSFD 5SWSA 5JIHA 3TO4A 3UJJL 1NC2A 3F7VB 2XZCH 3MRHB 1U95B 5GZNC 3ZKND 1OD9A 4WTWA 4JRYD 4X0KA 3RWGA 1WIOA 3GKZA 4KK5D 4FQLH 2DLIA 3OB0H 1KPUA 3OKLB 5D6CA 5I1IL 2OJZH 3U30B 1HKFA 1UZ8A 1IAOA 1FO0L 2VZSA 5C0AE 1B0GB 4J4PC 1P53A 2CIKB 5FYLD 4QHMA 3UTZA 3TWCL 3ARUA 4Q9QH 4QRRB 2VDPL 1QNZH 3E0GA 5TE4L 3MNWB 4PJIE 1RZGB 4YHYB 4N5EA 4J6RL 5DJZA 5KJRH 5EDXA 1NMCC 1EH9A 4XNMA 4XP9H 1IEAA 1K4DB 4CL7A 5E94B 5HDQL 2VL4A 1MFBH 1S5IH 4KGLA 3JV4B 1QSVA 4HLZG 5ID1B 4Z8FL 4NZUL 3BH8B 3LDBB 4W4OC 2ARJB 4PTTB 1A02N 4Y2DC 5HDBF 3OQ3B 5J13B 4OKVA 5ACLA 3RTQD 5C9KA 5I19L 2VISA 5TF0A 1SVCP 1INEH 3B9EA 3BISA 5HHNB 1H3PH 3RL2A 3QPQC 2R4SH 3KWWB 1XIWC 1JJUA 1NCCH 2JK5B 2WNGA 5KVMC 1MCHA 4JPWL 1G7PB 4X6BA 32C2A 5IFJA 2W9DL 4LVOC 2C9AA 3VMPA 1OGAE 4TVPL 4HUUA 3AFLA 3GJFK 4X6CB 4G8GA 2VL5A 1KPVA 1SJXA 1YUHB 4LK4A 1HXYB 1SYSA 3DO7B 1HEZB 1QYGL 2NY6B 4JKKA 3X11A 1P7KB 4NDMA 2C4XA 3EAKA 4OLZH 4UAOC 4MNQD 2YPKA 3QCUH 2A0LD 4F2MB 4JVPA 2ILLA 5DRZA 4ODXA 1GGCL 4XCFL 1A5FL 2MNUA 2LVCA 3ISWA 4LVOB 2NY2D 3CSBA 4JO4L 4WIQA 4Z76B 3ULVE 5K9OA 1VFAA 4NUJB 3MLRH 4ZSOB 3VFMA 1XCTA 5F71A 1CD1A 2LAGB 3VFSA 4JM2C 1OTSD 1QPXA 3CC5B 4JO2L 4ZAKC 1QLEL 1JCKA 3V6ZA 4PP2A 3BVNA 4U1JA 3LMJH 1IL1B 3VXOB 4PV9B 1U8IB 4QY8A 3MYZA 4C4KT 2IQAA 3E3QA 2YBRA 4D94A 3RUGA 4OCRH 4PP1D 5CILH 2FLRT 1WEJH 2DI7A 2DMKA 3K8MA 3N1QC 3JWDL 4RFNB 4PJIF 2WWMC 2VDKH 4OBSA 2DIJA 1DE4B 2YRLA 3SO5A 3RL1A 1J0HA 3IF1B 1IKNA 1J7VR 4FNLH 5I9QB 5HYEA 1ZS8B 1MVUB 4LRIC 5HYQA 5DD5L 3U48A 4CADA 5GRYA 5BRZE 3QEGL 1GOGA 4NJAH 2NR6D 1T1XA 3BPLC 2EDNA 1S9VA 4KZDH 4BZ2L 4ZAKB 1R3LB 3MROB 3O45A 2APVA 2BOCB 3OL2A 4KJYA 3D0LB 1ETZB 2XV6B 4PD4J 1OF2A 1KEML 4RCAA 4Y16A 3T77A 2GJ6B 2AGJH 5EULV 2H6PB 4WU7B 1OW0A 2VDNL 4W70A 1YY9C 5F7NC 1OGAD 1UXSA 1NCWH 5BQ7A 5C0DB 1CICD 3MV7E 4JN1H 4OZGE 1T1WA 4QRQB 3LZFH 3ETBF 3BRFA 3EO0B 1E4WL 1OARL 4XVJL 1Y6KR 3DROA 4WI2A 4X4MA 5C0NC 1QEWA 1LE9A 4EI6A 1PJ9A 4OLWH 4OUOA 5DEGB 1OD7A 4OCYH 2OCFD 2VTFA 4HG4K 2IBZX 2QR0B 1P84J 4WO4D 5GGSY 1EV2E 1HE7A 3JBG7 1AD0A 1T1YB 4WW2C 5C0BD 4DWHA 1JTPA 3KAAA 1DN2A 4OIIH 1K9TA 1RHHB 3QUKB 1A1OB 3ZE2F 2ZZUT 4BSVB 4ZO6A 3RVTC 4HS3A 1RFDH 5D70H 3C6LB 2BOBB 5D1ZD 1SJEA 5B21A 3EOAB 4HZLA 4JVWA 4U0RC 4JFFD 4H5SB 3MJ9H 4PLJC 2X4QA 4NQCE 1DUYA 3ULVF 4YHIA 4QCIB 4GAYB 1VCAA 1O5DT 3DVIA 3B2VL 1T89A 4P4KA 4E42A 4KK8C 5F96L 2VXUL 2Q6WA 4YC2B 1HOCA 1NGYA 2ENSA 3G5XB 2MFNA 4X7EC 2OSLB 2ZUYA 1NEUA 4GRLD 2DDQH 3NH7H 4CVXB 1IAII 2VLJD 4QRUB 4Z18A 4G7VH 4HPOH 4ODSH 5IEHB 2R56H 3BKCH 1SHMA 4X9HA 4XP6L 3BO8A 4I0PB 1BFOA 5E2UH 3BZDA 4B7IA 5HVGB 2DBLL 2A6IA 3NCCB 43C9B 1MRCH 3UAJD 1UM5H 2OLDA 1YYML 3BOVA 5TF1L 1QFWM 1LO0L 4N8VB 1T21A 4NQDE 1CBVH 2FD6L 3VXUB 5ALCH 2P48B 5EC2B 3NACL 4I4WB 4XGZA 4GAGL 1KYOJ 3OJDB 2CR6A 1S78C 1TQBC 2V2TA 5F6IC 5E0QA 3FZUC 1R0AL 4L8CB 2QQNL 3ULUH 3N1PC 3OXRB 3GHBH 4L8BA 4O4YL 3H2WA 4NRYA 3OKEB 1F4WH 4DCQB 1PGRB 2ORBL 5INDB 4NT6A 1NMBL 1KJ3H 2XWBA 1U58A 1MIML 5FDYA 1F3JA 3GRWA 4M7KH 2K7PA 2YPVH 4IJ3C 1OB1B 2FLBT 1JRHH 5HI5C 5E2WL 3TA3B 3QDMB 3LEYH 4Z7VE 5JUEH 5FUZH 5F6IB 3GSRB 5EU3A 1FIGH 3R4DA 2E7LE 3PL6D 5EU5B 4JJHA 1DQLH 3IU3B 2HJFB 2MPAL 4OQTA 1JGLL 3HB3C 1BD2E 1UGNA 2ADGA 2DBJA 4Z0BL 1H3WM 3IKCA 3PIQA 4FOMA 2ZG2A 3HFMH 1WWWX 3P0YL 2PXYD 1SY6L 1S9YA 4IJ3B 3D2UA 5I1JH 3FB5A 3UPCA 2Y5EA 2B4CC 3SE3A 3B5GA 2XN9E 2OXGA 5E8DH 2F53E 2VJXA 1TENA 5ELIA 1EEZA 5EIIB 3V0VA 3G04B 1BIHA 1RUKL 2A6KA 5D2LF 2VXSL 5C2UB 2P8PB 1KCSH 4IHOA 4NWUL 5D1QC 1VPOH 4JHZA 2Y36L 1H15B 3HAEH 1FVCA 5F7LB 1AHWA 3IFLL 4JCMA 1DLHA 2AJUL 4LP4A 4IRJD 3TV3L 5FM5M 5KVEH 1HYSC 4X8JB 1CE1H 3D5OF 3CCHB 5JXED 1T83C 4G9FA 2KL6A 3ARGB 2FBJL 2MCPL 2AV1A 5EZOH 5CEZL 4P9HC 4PY8J 3MOBH 1CU4H 1IAIM 1N3NA 1QQDB 5CGYD 4R4BA 4AMKH 3LRHA 4MD5A 2EC9T 1A6ZB 4P49A 4XH2B 3JTTA 1N4XH 5D7LE 1CTNA 4TVSa 5BCAA 3VD5A 3HRZB 2HRLA 4A2LA 2DLHA 4OGXL 2YA2A 5T1LA 4NQSA 2I9LB 1YEFL 5TE7H 5DJYA 1PKQA 1MFNA 5EB9A 2ZUUA 4XCYB 3LKSB 1B0RA 1QSFA 3MLZL 4LBEA 2J8UB 2DQFA 1NLDH 1S8DB 3MODL 2H26B 4RA3A 1KIPB 4Z7VF 3SY0B 4JKLA 2N7BA 2JJTC 4JRYA 5JORA 1VEOA 4L3EE 3QHTC 3LPFA 1BD2D 3D9AL 3UPAA 1ZAGA 5JW5A 3FTGB 4GLRI 4L29B 4E5XB 3BWAA 4IMLB 2OP4H 2NY4C 4XC1H 1AXSB 2ZUQC 1D5MA 4PJFE 3QXWA 2VDOH 3W2DH 3RWDB 4RDQG 2VZOA 4Z0XB 2NTFB 2Z8VC 3MFFA 4NRZA 1WCBA 5C9JB 1LNUA 4IS6A 2HFEB 3JV6A 2GK0A 3PWPE 4LCWB 1XCQB 2V5TA 3D6GA 3G6JA 3H9SB 3N85L 1PG7W 3HC0B 5BOZG 4I13B 3GSOA 1N59B 2NX5D 3BJLA 1LK3L 2IF7A 1U8JB 4PJEE 1MRDH 4OV5A 4L9LC 5I1GH 5DYOA 4YDVA 5C0EB 5GRUL 1A7QH 2QSCH 5GSRA 2E8ZA 5CCKL 1YNKH 4G3YH 1ONQB 2NY4B 4LHUB 1A6WL 1KCRH 5EOCJ 3RTQA 43CAA 3WKNA 3ORJA 3W9DA 1BLNA 2HKFH 1HHKA 4OLXH 1AGFB 1TQCC 3HLAA 4LCCC 3D69B 3HE7C 4KK9D 4X5WA 5E4EC 1F00I 4FFWC 3U6RA 1QBMH 2H3NB 3WEXB 2VDML 4XHQA 1YEGL 1JNJA 2QKIB 5FOBB 1A6PA 2CJUL 4ZODA 3SQBA 1U9KA 2CLRB 4N0YH 4TUJA 4KVNL 4ZFOL 4G7YL 5HTSA 1QKZH 3SKNB 1ES0A 4UTBH 3FQNB 5EUKB 1FH5H 3FT2A 4MNQA 2YD4A 5LQBH 2V7NA 3INUL 1P9MC 1RZ7L 1FJ1A 2P45B 4UUJB 2VLME 4XVUC 1LP9B 4GW1A 4JDTL 5IJKA 1G7MB 2CH8A 3T2OA 1L0YA 5EORH 2D03L 4JPIA 3QG6B 2R2HB 3BW9B 3HE7B 4OCWH 5IBLC 1KLUA 5IGXL 1CFBA 3PABA 3R0NA 1MAJA 4JFDD 1JPFA 4PJ9C 5JW4N 1CT8A 2OTWA 1EMTH 2NW2B 3NIGE 3DV4A 1Q9WB 4WHDA 4ZOAA 4ZPTA 4QTIL 2VDRL 1ZANH 2IPTH 3QZWB 2WLZA 1Y18B 3E8UL 3F7PC 4JVUA 4R4NC 2J12B 5I76A 4I3RH 2QHRL 2X4RA 4KMQA 3RWFA 3ABZA 1FL3B 2FEDC 1N5AB 4EXKA 1KCVL 1CXHA 4PJEF 4ESKA 3ZYOA 5DJCB 3NIDE 3JUYA 4GUPA 5KG9B 1XF4B 3WFEH 2D4FA 1RUAL 2IANE 2W9EH 4UT7H 3QDAA 1RU9L 4DKEL 3QULA 2OR7A 3MREA 2HJLA 5E5MA 3DBXA 2R1YA 2B1AL 3L7EA 3RJQB 3MCKA 1GSMA 1MHEA 4G6AD 4RZCB 2W38A 3DMMD 3LKRA 1CF8H 3VE0A 3QXTA 4EOWL 1GGUA 1EHLH 4NM4H 1OGAA 5HHMA 1N2RA 3V5DA 4KAQL 4D9RE 2PETA 1CICA 3LSOB 2EO9A 4PRIE 3VU2A 1OGTB 3WN5A 5I30H 4DGVH 3P73B 1DLFH 2EDRA 3QPXH 2E6PA 5JNYB 2DB8A 2ID5A 3VFTB 4GAFB 1Q9OB 4RRPG 1NC4B 1PSKH 4M7JL 4WO4A 2AKRB 3LY6A 3QBTB 3QG7H 5BJTA 5C0BA 3ROLB 1DCLA 2VLMD 4JY6A 1Z0MA 4NGHL 3QDJB 4DZBA 4BSWB 1U8LA 5HGAA 1N5YL 4LF3B 5GRVL 5C07D 4U7KA 3WE6A 3KXFB 5IMKA 4BKLB 1JHKL 5D1ZA 1WAAE 4JFFA 3RHWF 3DUUB 4J7RA 4I18C 3SDXB 4DQOL 1KLGB 1G7JB 2VH5H 4HT1L 2X9YA 1RIHH 5C0CE 3QWOB 5KS9A 2BCKA 3SQOH 2ZP0T 5T3XH 1T1ZA 1D9KC 5DWUL 5F72S 2IQ9L 5DTFB 3WSQH 4DAGL 3QQ3B 4GKSB 3NIGF 1KB5H 5JMRA 3VXNB 3QUXA 1NUFA 4F57H 1F58L 4GRLA 4EUPA 4HG4J 1A0QH 4KTEH 2VLJA 5EZLB 3WNNA 1DBAH 4M93B 1AQDB 2SEBA 1AP2B 3CFBB 1CFSB 4W6YB 2HG5A 2CRMA 5I8OL 3O2VL 5CJ8A 3MBXL 1TVDA 2CLZA 3VJ6B 4QXUH 1B6UA 4MXQC 4KKAD 1CVRA 3DGCR 1WCQA 3CLEH 3U0WH 4XCNA 2FX7L 4XAWL 1ZMYA 1WISA 2IAND 3NIDF 1G9EA 2BC4A 4PJ8D 1HHIB 2PYFA 3R1GH 2ZUTA 4EDXB 1DBJH 4YX2L 4NBZB 1LEKA 1FG2A 3B9VA 5JLZB 3MNZB 1J1XH 1EX0A 2Z8WC 5HHQB 5BV7L 4FFZL 1A9BB 4HGWA 5TH2B 5J7CC 2X4NB 2C3HA 5ECJE 1EFXD 4EEEA 5IJVB 1W72A 4OZGA 1S7WA 3BPNC 2HTKC 3SE9H 4PJDB 1J8HB 4UNTA 1KCGC 4LNRB 3HNTH 3L3DB 2VXVH 4O9HL 4QRRE 3TO2B 4GG8A 4NZRH 4UILL 3I84A 2YK1H 3TIDA 5BW7A 2GUOB 5IQ9B 3H9HB 1WFNA 4KHXL 4XNQA 1UVQA 4AEIH 1G6RL 3IFNL 1X4YA 4HXBL 2PO6C 3MUJA 5F7KC 4HIXH 1NCUA 3TBTA 2EH7L 1J87A 4W4NA 1JF1B 4PDCE 4QOKE 3NZ8B 1WWAX 3SKOA 1A1NA 1HDMA 4LFHD 5DS8A 4PGCB 4KFZC 12E8L 4NYLB 5H2BA 2JIXD 4PJHA 1FNSH 5IG7A 3Q6GL 1U8MB 3CSYB 3KS0H 5KANI 5CS7A 4FRWA 2PXYA 5DUPL 1HSAB 4NZTL 5CP3H 4Q7DA 1GGIL 3HZMB 4DW2L 2EXYC 1CDYA 1WT5C 1Q0XH 2HLAB 1DEEA 2CKBH 3CD4A 2CDGA 3LQZA 3FQTB 4ZOEA 3GSNL 2K1MA 4R8WH 4OF5A 5HJ3B 4Y19B 3BKML 1A3RH 4DKDC 3B4NA 1UWEH 2GJZB 3QRGH 1GHFL 2XXCB 4XMPH 1B2WL 4IRJA 4KUZH 1HXMB 2HN7A 1G9NL 4YFLI 3MNVA 3BP5B 3C5ZB 2YD7A 4FXKB 2JJWA 1QBBA 1BZ9B 4U33A 5FB8A 5JXEA 3OBAA 3VGHA 1KCUH 4BFIA 2QADB 3EBAA 2AXJA 4GLRH 1ZHBA 4MVBC 4U1HA 4DKFL 2VDLH 4GBXB 3KPTA 4JPVH 2H8PB 1OSZA 3UTSB 4LSSH 4WW1A 2XPGA 2XZQL 2VLLA 1PG7X 3VRLE 2Z4QB 1J1OH 3GNML 5EO1B 5ITFB 2C26A 2DLFL 2DQDH 1XEDA 2BERA 1UT9A 1ZWIB 1UKTA 4M7LL 4Y1AA 4NCDA 4OZFA 3MC0A 5F7WC 1ADQH 2X7LB 4M1GH 4XPGH 3HC3H 4OM1L 5CBAB 1ND0A 1KNOB 4X80H 2AV7A 3GJEA 4DKAA 4D0CB 4LKCB 5IHLB 1EZVX 5GZND 1KTLA 1ZA3A 1MEXH 3EYVA 3PWVA 1PZUB 3LKNB 1T3FB 1TCRA 4A6YA 3P9MA 4NPYA 4RAHA 3H6JA 5D1XB 1WFUA 3BDYH 4LGPB 2JB5L 4N90E 4NQXB 1UFUA 4J4PD 1FNFA 1BD2A 1TJGL 3ARFB 1BPVA 1AGEA 1DL7H 2R1XB 2W60B 2GJ6E 3NCEB 3HAEG 4XPAH 1MCSA 3U9PL 3UX9B 1ED3B 1CFQA 4CW1B 2EO1A 2XG4A 4X5XB 1PYWA 4KRNA 3AXLB 3O3EB 4QRPD 3SE4A 3MOQA 5JW3H 1AJ7L 4JQIL 1S9WA 1RK1A 1I7TA 4Y5VB 4XWGL 1M7DA 2NX5A 3TNMB 3HPLB 2P47B 2ITDB 3WUWB 2R2CA 4IRSC 4YHLH 3D85D 4F37F 4TRPH 4MD4A 4Y2DD 4B53A 1DVFC 5FYJE 1DZBA 5EZJA 1C16A 4PLOB 2J88H 3E1F1 3A6BH 4MA3B 3FCTB 1M7IB 5E6IC 1MVFA 3MYJA 4CVZB 1ZHLA 5FXCH 5LAXB 3QPQD 3TBSA 2OS7A 3KG5A 2BJMH 5HGDA 4MYWB 5M94B 1UH4A 3GSXA 3U82B 5I1KH 2GTZB 4DGIH 4MCZA 1ITCA 3L6FB 3BZFA 2VZUA 4P5TB 1R5VB 3IJSA 2E9JA 3HUJE 2VIRA 1IGFL 2OK0L 1MFAH 2Q8BL 1QBLH 4XPFH 4UTAH 2OL3L 1MSPA 3DUSA 3X13B 2BSSA 1IC5H 1OAXL 2EDKA 4O02H 1U8KA 3WMSA 3VRLF 5AD0A 4IRSB 1NCAL 5K9KA 4ETYA 1DVFB 1T7XA 5FV1L 5B39A 1GPOL 3T0EC 2YSSB 4WGWB 3D39E 5FCUL 1VFOA 4DFHA 3CFKA 3VI3E 1IAKA 4ZTPH 3GMLB 3WIFA 4OZ4A 4PJ5D 1XGQB 2VZTA 3MRLB 3LN5A 4NO2A 5DC9B 4TSCL 2V5MA 3PWLB 1AO7D 5L2KB 3B5HA 3O4LB 4Z6AT 4UT6L 2B1HH 5ADOL 1RIUH 2OMBA 4JM2D 4F15B 3O8XC 5A3IC 4IBLT 2Z31C 1ZGLP 4ZAKD 3S34H 2UZIL 3GMOA 4JFDA 3NA9H 4OLYH 1AIFA 4LARL 3CZFA 5FM8A 3VXUE 4TUKL 3VD9A 5TE6L 3VGGA 1RURH 3K46A 4FFVC 3V4UH 4LPCA 1FVDB 2ADIA 5D2NB 4ZUSA 1CD8A 1N64H 1MFCL 4NJ9H 4ZQKA 1E6JH 2WWMD 2XZCL 1X5GA 3L3HA 3ULVH 3VH8A 3EDFA 4P2OB 3QA3A 2NXZB 5D6DA 1FVEA 1JPTL 4FQLL 2CUIA 4M43L 2VDQL 5HPMB 2OJZL 1DQTA 2G60H 3N1FC 4O2CB 1GGBH 5EN2A 3JVGC 4N0UA 1BX2B 2PW2A 2ATKA 2X4UA 5L88H 4AENB 4TUOB 5K33A 4Q9QL 1R5WA 2YKLH 4H20L 3NN8A 5TDOB 5E08H 1QNZL 5C08E 3STBA 3DVNA 4MMZC 4CJ0A 1YY9D 1U41A 1WVZA 1E4KA 1SQ2N 4PRAA 4XP9L 3LV3B 3DMMA 5E1HB 1WBXA 5J11C 4ZPVA 4ZS7H 3V2AR 4J1UB 1MFBL 4OFPA 1S5IL 5C0ND 3HUJF 2IADA 2LQRA 4PRPD 3BZEB 1YPZF 1XF3A 3KPSE 4CVUA 2X4PB 2Z92B 4U1GB 2VWEC 5C0IB 3CNKA 3KYAA 1CD0A 2H41A 5IQ7H 2OZ4L 4XAKE 2AEWA 1GC1C 3QJFB 4M00A 3DTXB 3G08A 3RPIA 5GS1A 1H3PL 2R4SL 3M17B 1PY4A 1NCCL 3QCTH 3VI3F 5FO7B 5DJDA 2NZ9C 1V7MH 1K3ZA 3RVTD 1AGBA 3P4NA 2IPKA 1S7UB 3AY4C 3EHBC 5IW6B 3ZKXC 2G2RA 4PLJD 5C07A 5D7KD 2YD3A 4I5BB 4HJGB 2DM4A 4LMQE 4RQQA 1YEHH 3MRPA 1VEPA 1L8JA 1OL0A 4KK8D 3QJHB 4OLZL 4UNUA 3DRTA 1IM3A 1BFTA 3QCUL 1A6TA 5D72H 4HLJA 2YXFA 1WITA 1JHTB 2BVQB 3PE9A 4LDLB 1T5XA 4JDZA 1KENH 1CXLA 2GQHA 3IVKB 5A2IH 4G5ZH 3QH3A 1JZ5A 3LRSA 4KVCH 2NY5C 4U7SA 3GJFB 1ZT4A 3MLRL 3ZKXB 4PJXA 4C59B 3BDBA 3RNQA 5HYJB 1VFBA 1U2CA 3EYFA 4NQVA 1WSST 4PGZA 3VGDA 1MWAA 3EDDA 4HIEA 4N0FA 2QJDA 1MPAH 3LMJL 4RGNE 4V3EB 5L9DH 2WQ8A 5A2KH 2DQGH 1BECA 1NEZG 2IANA 4JCLA 4L4TB 4PJ8A 3THMH 2ARWA 4OCRL 3V8CA 1Q9KA 3QDMD 2EYSA 5CILL 5DHVA 2BNUB 2J8UE 3I6LD 4HH9B 3CU7A 1NL0H 1S78D 3EYUL 4K8RC 2BP3A 2VDKL 2IH3A 3FZUD 4WWID 2FSEA 1UB6A 2EIEA 2AJYH 4X6DB 1A2YB 4FNLL 4U1MA 2VXQH 5DQJA 3PHOA 1YMHB 3QWRD 1FL5A 2CDEA 4NJAL 1T2QH 2F19H 4ZO7A 4ZFFB 1IC7H 5JXAH 4WI9A 3GMPB 4KZDL 4XAKD 2AJXL 4OZIA 2WQRA 5HI5D 3KYMA 3BP6A 5A1AA 2AGJL 4QT5B 4F80A 4LCWE 3HS0B 2OJEB 1FNHA 2Q76A 4A2MA 5A16A 1II4E 1NCWL 4KKCC 4JN1L 1F3DH 3LZFL 3LHPH 4JY5L 2UUDK 5L7XH 4WI5A 3HB3D 1WAAA 4OLWL 3DI2B 3AM8C 1H9VA 4OCYL 3VFVA 5I1AA 4F7CB 3F62A 2G75A 4B41A 3ZT5A 2JELH 5EO0A 2JIXA 1EBAA 4H25B 5CJQH 2B5IC 4TPRH 4OIIL 1MNUH 3RI5F 1K5NB 3K1KC 5TDPA 5D70L 1RFDL 2EDBA 4OUUB 1UQSA 3BIKB 3SKJH 3IETB 5AYUH 3KYNA 5K9JH 1AFVH 2F8VA 3MJ9L 1YN6B 5IVOA 4U2ZA 2C3GA 3U0TA 3FB7A 1K3IA 3NZHH 4MCYB 5GRXG 1DUZB 1FSKC 2ERJC 3DHJA 3B9AA 4OGZA 1HYSD 3UYPA 5F9JB 2IAMB 2DDQL 3NH7L 3ZT6A 5IB3B 3VWJC 2WBJC 4H8WC 1LP9E 2FX9H 3AC0A 2VC2H 3QUZB 1BVLA 3HI1B 4G7VL 4Y4KC 4ZYKB 4LDOB 1YECH 4HPOL 2R56L 2LU3A 3BKCL 4QF1A 4M48H 4YR6A 1JBJA 3FQRA 3T1WA 3OB0K 3OKLA 5E2UL 2A77H 1JL8A 5JW4M 2DJUA 1MRCL 1AKJB 5FYKU 1UM5L 3ARVA 4BJLA 2F5BH 2CXGA 4ZUVB 4RNRA 5ALCL 4D0DB 5L6YH 35C8L 4P5MB 2DRUA 1IGTB 1LO5A 3MNWA 3ILPA 5FKPB 1NFIA 2O61B 3H9SD 2X4OA 4R2GB 4HC1A 1K4DA 1ZT1A 4Y4KB 5F3HA 3ULUL 1Q0YH 2H32A 4YHNB 3LKPB 3CMGA 5ID1A 4YLQT 1F4WL 4DFIA 3BH8A 5HYSG 3BMVA 3GM8A 3B3IB 4MS8C 4PTTA 4HX1B 4J4PA 4LLDB 1WC7B 3O2WL 3TFKC 2NY4D 3L3JB 5ESAA 4J3WA 2QTEA 4AQ1B 4M7KL 4JFYA 2YPVL 4K9EH 4MB4A 5J4MA 3VXSD 3SHSA 4NKDA 3R06A 2NY0B 2E5EA 3LEYL 5DJAA 5JUEL 2F8XC 5FUZL 5I6XB 3ZKQD 1OTUC 4X6CA 1FIGL 1YUHA 4QRPA 1MCIA 1DQLL 3DX8A 5FOJA 3ZO0A 2LU4A 4GMTH 3ZTJG 3CAFA 5FGRA 1I7RB 2ZJSH 2MQ3A 5C86A 4M7LT 4JY4A 4YO0B 4W4OA 4EIGB 3D85A 5C09D 3HZKA 1TNMA 3HFML 4Y2DA 2B8OT 1UXWB 2Q3AA 3BPCA 2GSIB 4BUHA 1WFOA 4PYGA 1BM3L 2FDBP 4GXUM 1DJSA 2XWJB 3BESR 1XIWA 4JGUA 3RIFK 3KHOA 3S96B 5HGHB 1E28A 1LP9F 2Z35B 3IFPB 5E8DL 2VABB 1JNNH 1VADB 3SGEI 1K8IA 4FFEX 1ZLVH 3HE7D 2K3TA 3SDXE 4FFWD 4ZSOA 2XIDA 3BEVB 5CHNA 3PWNB 1VPOL 4QLRA 1CK0H 1JWMA 3MQIA 4G9DA 4RIRA 1NGQL 4R97B 4PV9A 1Q38A 1PY9A 1PX3A 1U8IA 2BVYA 1W0VA 3S6CA 3P0VH 1NFKA 1CE1L 2V5SA 1YA5A 4ZUTB 4XVUD 3F7YA 1T0NA 3S37H 5GSVB 1DE4A 5EZOL 1KT2B 4PJ5A 1YEJH 3SGJC 3S4SG 4RGMC 3MOBL 3FOLB 1CU4L 2X4TB 1N8ZB 5D7JC 1AO7A 5IBLD 5DFWH 1QSEB 4YFDB 3CZJA 1N4XL 4PJ9D 4JM2A 1EJOH 2F8OA 4ZAKA 2HT4C 1U8OA 2BOCA 2FJHB 2YC1B 2VUYA 4FZEH 3HMWH 4PJCF 5EZIH 5TE7L 3OGOE 4Q6YA 2X70B 3MRQB 1JPGB 1IC1A 4H26B 2VE6A 4R4ND 5ETUB 1A9EB 1DSFH 4L1DA 4P23B 1NLDL 4Z7UB 1B88A 5TQ2H 1GL4B 4CJ1A 3P4OA 2XQYG 3F12B 1HHGA 1FZJB 3EO0A 3BE1L 3IDGB 5D7JB 4JANB 4LRIA 4YGVB 5C6TH 2FIKB 3D48R 3TPUB 4E41B 4PJDE 1E4JA 1MCOH 1J88A 5DEGA 3FFCB 3U4EB 4NHUA 4K2UH 3P2TA 2QR0A 4NNXA 3S97C 1IM9D 1NC4D 5JDSB 4BZ1H 2WZPD 3PWJB 2VDOL 3BN9C 1T1YA 3B9DA 3U1SH 2PCPB 1GZPA 3KYKH 3ZDXE 4C56D 1CFNA 1YEEH 3RVUC 1RHHA 2R23B 1A1OA 3QDJD 5IEKA 4U6XB 4S11A 4BSVA 4X99B 4JRXB 3KXFD 2BOBA 1KJ2A 1MH5A 1MIEL 3EOAA 3PP4H 1VFMA 4F7EB 5FV2A 5CFHA 5AAMA 2R29H 4GW5A 3QP3A 1MRDL 3MLSH 4LLYB 4PJBB 5KSUB 5I1GL 4P2RE 4GAYA 2W59A 4RAUB 4PRPA 3RWIB 2QSCL 2RJMA 3MFGB 5KVGL 5GJSH 4G3YL 2ZSWB 3OGCA 3EO1B 1FNAA 5KOMC 3U7YH 3MV8B 1KCRL 4LSPH 4OGYH 4WW2A 2E7BA 3L95B 3S98A 4AZ8A 4K7PH 4OLXL 5IEHA 5DC4B 1NGZB 4X4ZA 3RWEA 3QNZA 4LCUB 4TULL 4EQ3A 2R0ZH 1QBML 5J56B 3U2SA 1DANU 3DX9A 4MB5A 4Y19E 1BFVH 4JE4B 4ZD3L 1WBZA 3GMNA 1I8IA 1D9KD 4N0YL 5FYKL 4MJIB 4OSUL 3S35H 4R96B 1FP5A 1QKZL 4N8VA 4OGAC 8FABA 4RFOL 5DSCB 4UTBL 3SPVB 4APQC 1FH5L 3BYTA 5LQBL 4I4WA 3RJDA 4NM8H 3V4VL 3L1OH 1JUFA 2V7HB 5SWSB 2IFGA 5IP4A 3MRRA 4P5KA 5EORL 3OXRA 3NFPA 3S36H 1Y0LA 4G6FB 4OCWL 4X0KB 3RWGB 1RIVH 4MXQD 1J8HD 3OKEA 5MENE 5F9WB 3OG4B 5H37H 5EU7C 3ES6A 3SCMC 3OR6B 4PJDF 5INDA 1EMTL 5C0FA 1UZ8B 4YPJA 1IAOB 2LU7A 4RMTA 3OKOB 5I1DA 2HRPL 2RAMA 2I9TB 3NOIA 4WUKH 5DT1H 1OAUH 4QHMB 1JI1A 3UTZB 3B8YA 4APQB 5IOPA 1ZANL 3ZL4H 2IPTL 2XACC 4CGTA 3SE8H 4JN2A 2X89D 2UWEA 1Y6NR 5F9OL 3QDMA 2DM7A 1RZKH 1AE6H 4LLUA 2DQHH 4U4BA 4GSDH 2DWEB 4N9OB 4B7LA 2HFGH 4JFPB 5EU5A 5FHAL 2ZCLL 1HYRC 1MOEA 4CUCA 2HTKD 3QWRA 3O6FC 5T5FH 5D5MF 2MTPA 1NBYA 2EYTA 4G6JH 4Y0GA 2BX5A 3WFEL 2IH1B 4GW4A 1ERNA 1NAMA 1I3RA 1J0IA 5FGCB 5DHXB 2W9EL 4UT7L 2VQUA 4D3CH 2BXYA 3ZE0F 4ODUA 2DWDA 3KPMA 4OKVB 2KZWA 1P6FA 1NMAH 4M1DH 2C4FT 4WJ5A 3RL2B 4PJAF 5I2IB 4LEXH 1CF8L 1ZLWH 2GTWB 4PRHD 5EIIA 4U49A 2PO6D 4NM4L 32C2B 5IFJB 5CKAA 5FFLA 5GZOC 5I30L 4PTUA 4G8GB 1DLFL 1KPVB 4NP4H 3WKMH 3QPXL 4Y19D 5FF6A 3O6FB 1S7QA 1YEDB 5DJ6B 3WFHA 3X11B 1P7HL 4NDMB 1C5DA 4NN6C 3BD5A 3FB6B 3CDFA 5ANMA 2P7TB 2P4AB 1NANI 3CCHA 4FQIL 3QG7L 1MFDH 3R8BB 1FC2D 2P5ED 1DBKL 2EXYD 2VLRD 4IIQC 5DRZB 4ODXB 3UTSD 1NUGA 2VZ1A 3Q48A 3N1MC 1U93A 5SWZD 3VXPA 4NNPL 2VH5L 2Y6SC 1VFAB 1RIHL 1TPXC 3WJLC 1XCTB 3HRZA 3IXAA 4QHLB 2X1XR 4LSDA 3WSQL 1Z9LA 3V6ZB 1T4KA 4NN6B 5KANG 2I9LA 1X5ZA 4U1JB 4NOBA 4F57L 5I17A 1QSZA 2XG5A 4QY8B 5GGVH 3HTLX 2IQAB 2AK1H 1T83A 1A0QL 2XQBH 2YBRB 4KTEL 3NTCH 5L2KE 3EKCA 3O4LE 1DBAL 4OKDA 4MVBD 2H26A 5DRWB 1OT1A 4OQTL 3SY0A 4XC3H 2NLJA 1PKOA 5ERWB 2FO1A 3RL1B 3VI4E 4QXUL 4XMKL 1UC6A 5HYQB 3GSWB 3CLEL 3U0WL 4CADB 3FTGA 4L29A 4E5XA 1TZHA 3VD4A 1M4KA 5DC0A 3NCMA 1HN1A 1JFQH 1KULA 2FWOB 3R1GL 5D2NE 3O45B 3RWDA 4PGEA 4KJYB 3WS6C 3K81A 1OF2B 1J1XL 5C9JA 4Y16B 3T77B 2XFXA 4M7ZB 3H9SA 1T80A 5IB5A 1FGNH 4U1NA 4K3DL 2DQIL 3EGSA 4X8XA 2E9WA 2PKDA 4PV8B 1UXSB 2JJTA 3FN0H 1ZVYA 1U8JA 4ZXBB 1T1WB 5BS0D 1JE6A 3SE9L 5C0EA 1NCBH 3NFNB 2DIBA 3OAYH 3DROB 4Q9CA 1QEWB 3HNTL 3PDGA 1LE9B 2VXVL 2EXWC 4HIIA 4I48A 4ODVL 1TZGH 3OJ2C 2ENYA 1OY3B 1L9NA 3U36A 4NZRL 1MJ7H 1AD0B 3VXSA 2P49B 2YK1L 4P5TD 1AGFA 3MRKA 3MACH 4HJ0C 2X5PA 3MRIB 4AEIL 4UV7H 4IMKC 3ESVF 3D69A 1T22A 4HIXL 4HS3B 5CSGA 4NWTH 1FYTE 3WEXA 3AS3A 3FAXA 4L9LA 4IRSD 5FOBA 3QQ9C 2X4QB 1T7WA 4WFGD 1DVFD 4YHIB 1I9RH 4JHAH 1RJYA 4QHKI 5C09A 5E6ID 1PVHA 3TH2T 2Q6WB 4OZHE 1HOCB 1NGYB 1SEQH 3NCFB 2LTQB 1KN4H 4GRWE 5DVOA 2NNAB 1L4IA 4PGDB 5FUCC 3N1GC 1Q0XL 3RGVC 3IDIB 4JGJA 4D9QD 2R2HA 2CKBL 3BW9A 4LCCA 3NAAL 5I75B 3HE7A 4LEOA 2XA8L 4Y5XC 5GS0H 5C2BH 1YDPA 4X7TA 1BFOB 1NCTA 4R8WL 5FYJH 4K55A 3BSZL 3VI4F 2KBGA 2P44B 2B0SL 1A3RL 4Z95H 1UWEL 2A6IB 2WMPA 3HMXH 3MGTB 3QRGL 3T0ED 4XMPL 1Z3GH 4M5YL 1E4XH 1T21B 4MA7L 1P9MA 2WLYA 1Y18A 4XGZB 25C8H 3HC4H 5TE4H 5GS2H 1F3RB 4ZO8A 1KCUL 3GBMH 2AJZB 4Z78B 1G0YR 3CVHA 2VDLL 2V2TB 2X09A 3S9DB 2M26A 4LSSL 1R3JA 2D7QA 1N5AA 5HYJE 5KAQG 5A3ID 2FB4H 2Z31D 1J1OL 4L8BB 1CIDA 3KPLB 2DQDL 4LPUA 4WEMB 3EUUA 4NRYB 4PJ9A 2EC8A 4M3JA 1Z6JT 1MLBA 2IEPA 4M1GL 4XPGL 2P1YA 3HC3L 4DVBA 4QKXB 4NT6B 2Z91A 4FFVD 1OP9A 2XWBB 4X80L 3BGFB 3MRNA 5CZVH 2OTPA 1U0QA 4YZFF 4DN4H 1F3JB 1JYVA 3MPCA 4NC1E 2R39A 3LD8B 4X6DE 3MCG1 3UZEA 1MEXL 1RJLA 4M5ZH 4MQTB 3VH8G 2A1WH 6CGTA 5EBLA 4UDTA 5EU3B 4BQ6A 1OVZA 1N6QH 4MAUH 4UIMB 5MHSE 4M9OA 2DOCA 2ADGB 1DL7L 1FHGA 2N1KA 3IKCB 4CU8A 3PIQB 1IM9A 1NC4A 2IPUK 3A6CH 5I18H 1V3LA 4XPAL 4RMVA 4G8IA 4OZHF 4FA8A 3KYOA 1MAMH 3D2UB 5D2LA 3MJGX 4C56A 4FXLA 3FB5B 3V6OE 3QDJA 4GRWF 4BSWA 4K71C 3G5YA 1NFDB 5JW3L 4LF3A 5E6YA 3HPJB 3KXFA 4GO6B 1CDBA 4K07A 1EEZB 3V0VB 4HHAA 3SDXA 3VFRA 1G7JA 1FFQA 2A6KB 2B39A 1RMFL 1EJ6A 5GQBA 2NQCA 4TRPL 4IHOB 4I1NB 2HP4A 2J88L 5IHBA 3A6BL 3VXNA 1DLHB 5EFIB 4YXHH 5F6HI 5FA4A 2ARJQ 1OWWA 2W1NA 2BJML 3MSPA 1IGMH 4YBLC 3ZMRA 3L5WA 3MUGB 2PUQT 2NZ9D 5I1KL 2XT1B 3UCRA 5EZLA 4G9FB 4J3SA 4X9IA 3JWDH 1AP2A 4K71B 1SYVA 2A6DB 1QBLL 4XPFL 4UTAL 4I8DA 1N3NB 4I18A 1IC5L 4O02L 5DD5H 5LBSH 4R4BB 1V3MA 4MD5B 4X4YA 1S7XA 4ZFGH 5CEYA 3G5VB 1A64A 1D9KA 4L4TD 1HHIA 1XAUA 3RX7A 2NY1B 2ADFH 3OV6A 2APXA 5T1LB 4ZTPL 1DN0A 4W6XB 1D5ZA 5DJYB 3MLTB 1PKQB 3WFDH 1IEHA 5TH2A 4M8VA 1B0RB 2HA1A 3VCLA 4LBEB 4X6DF 5DUMH 5IJVA 2DQFB 1PW3A 3P9WB 2B1HL 1RIUL 5HVHB 5JORB 4MXQA 1J8HA 3S34L 4XVJH 4FZ8H 3CFIC 3NA9L 2FR4A 5JW5B 3DWTA 3FOMA 4PB9H 1WWCA 3BWAB 1WJ3A 1RURL 1EERB 2A2QT 3V4UL 2A9MH 1D5MB 3ZYZA 1N64L 4NJ9L 1E6JL 4K8RD 2OX5A 3KPPB 2X89A 1LE5B 3MFFB 4NRZB 3ULVL 2NW3B 1LNUB 2F74B 3FN9A 4P46C 3G6JB 3BQUC 5DD1H 4ELMA 1EK3A 3GSOB 3VD3A 5IV2A 2G60L 4HIHA 1GGBL 2V5YA 3O81A 3QNXA 3QNYB 5SX4I 3DSFH 4WFFE 5DYOB 3VRIB 4YDVB 5L88L 5ICXB 1XGUA 1YEIH 2YKLL 3WFBH 1LDSA 2Z8RA 5E08L 1HSAA 3I6GB 3OMZA 3I9GL 3QYCA 43CAB 2NY3C 1JZ8A 4KKCD 1BLNB 7FABH 3MLUH 4PRHA 5CZXC 4ZS7L 1HHKB 2PO6A 1J10A 4P46B 3FQTA 4Q9RH 3KDMA 3HLAB 3UBXA 4X5WB 3U6RB 4HWBH 1LGVA 3SGKC 4D2NA 2XOTA 4AIZA 1GGTA 5IQ7L 1QR4A 4TUJB 3EYSH 4GKZB 5TF1H 3BP5A 5DUBA 3HG1B 1MCWW 2FD6H 1G9NC 5C6WH 3TPKA 4MNQB 1OP5K 2YD5A 2P5EA 2XWTA 2CO7B 1V7ML 2VLRA 1WT5A 1HSBA 1GOFA 4G8FB 4GW1B 4ACPA 1PFCA 3UTSA 4XTRC 2YWZA 4JPIB 4BA8A 1I1RA 3WXVH 1YN7A 4O4YH 5CAYB 1YEHL 5SWZA 2R0KH 3ZZ1A 3PABB 1JPFB 1YY8A 4U6VH 2OTWB 2ED9A 2P5WD 3QB7C 5TGBA 1KNOA 1JGEA 2FATH 3DV4B 4MJ2A 3PP3H 5D72L 1MIMH 4TQEH 4F3FA 1FZOA 4ALAH 4GKOA 5SX5H 4ZPTB 1CGWA 1L7IH 1SM3H 2O5ZH 4Y4KD 1T04A 4KI5F 4G5ZL 4MXVE 1RJZA 4KVCL 3P3YA 1T3FA 5KW9H 4MVBA 3OZ9H 5CGMA 1QSEE 2X9WA 5I76B 5J1SC 2AJVL 4MJ6B 1HKLH 2MWCA 4NQXA 3RWFB 5LVEA 1S5HB 5JIKA 4ZNEE 3MZGB 1JGLH 1PD6A 5E1AA 3T08A 1U8QA 3I3BA 2DQGL 5KN5A 1CDJA 2W60A 3SDCC 3H9ZA 3RIAK 2ESVB 3THML 2IMNA 3P0YH 1ZV5A 1R5IA 2KQNA 3C8DA 4P99A 3QULB 5A2JH 2HJLB 4NO3B 4Z7UE 3DBXB 3L7EB 1MHEB 2AJYL 4U6YA 2VXQL 4FG6C 4E41E 3UTOA 3H0TB 2O5YH 1AD9A 3LKRB 1RUKH 3NCBB 4V1DD 1G7QA 1N2RB 3FFCE 5HHMB 3TNMA 3V5DB 2F19L 3WUWA 3VG9C 5IR1B 1KN2H 3VXMB 3HE6C 4MS8D 3FHQA 5BS0A 1F90H 3TFKD 3OAZK 4FQHA 5A2LH 4UI2A 3UMTA 4PGBA 5I8CB 4OJFL 5E70A 2NZIA 3P77B 3TV3H 1F6AB 3DNKA 4WI8A 3AGVA 2GTZA 4HPYL 4JRXE 2UV3A 4K3JH 5BJTB 5C0BB 3D0VA 1OTUD 2X1PA 4TSAH 1HHJA 3ECBA 4DJMA 4JY6B 4TVPD 4CRPA 3T0VA 5E24E 4ZTOH 2ZUXA 1U8LB 4PJBE 3LHPL 5HGAB 5L7XL 5D1ZB 2QQQA 2DM3A 1YJDH 5JOPE 4HUMB 4JFFB 4IRSA 1FORH 4FP8H 4X98B 1DVFA 2JELL 5DZNA 1T1ZB 3J7HA 4RX4D 3IAGC 3IS0X 5E6IA 2V2WA 4TPRL 3GMLA 1MNUL 3QUXB 1CS6A 1UZ6E 1XGQA 4MQ7A 4EUPB 4A6YL 4MJ4A 3ARDC 3UTPE 2APTA 3MJ8A 3U4BL 3WIHH 5DRNA 2V9TA 3SKJL 4HUXB 1KB9K 4HBCH 5AYUL 1I1AB 5K9JL 4MXVF 1AFVL 5E8EA 5ICYB 1KGCE 2JE8A 2SEBB 2ICES 1CVSC 3IDYC 2C1PA 3E2HC 4XPHH 2HG5B 5TFSH 4MNGB 2CLZB 2FEEL 4MJIE 5IW1A 3V6BR 4J3UA 4XCNB 2A74B 3T0EA 2AJSH 2QQLH 1FVDA 1K85A 1FV1A 2PYFB 1ZLUH 2IBZY 1J12A 2FX9L 5SWSE 4P23D 1W2KT 1N0LA 1LEKB 1FG2B 2FH6A 3H3PL 1MCPH 2CIIA 1KOAA 1YECL 3ARDB 3QEQD 4NHCH 1OM3L 5D7JD 2C3XA 1F45A 3N85H 3PHSA 4HGWB 5T3ZE 2QQKL 1DANT 4JZJC 4S2SA 5FUOH 5EU6D 3FFCD 5TQ0H 1CG9B 2A77L 1W72B 3O8XA 4U1IA 2PYEB 2MOVA 2PNDA 2Z31A 1S7WB 1X5LA 3UO1H 2HT4D 4U1KA 1WGOA 3D87B 1WF5A 1U8HB 2F5BL 3NCJH 4TUOA 3QO1A 5DD6B 5CCKH 3WFCH 1D5XA 3BAEH 5L6YL 4K3EH 4ZDHB 1A6WH 4MQXC 4GG8B 3RRQA 5L8JB 3NIFE 1BGXH 3CLFH 1FFOA 3LV3A 3TIDB 1KIQA 1Q0YL 4XNQB 1UVQB 4Y8AA 4M6MH 2IALA 1FBIH 5HVWA 4YIQA 4PJBF 5J06A 5C0IA 4FMKA 2VDMH 3JVGA 1YEGH 2CJUH 3MUZ1 3MV8D 1RZFH 3BN9D 3QJFA 1TFHA 5H2BB 4K9EL 1EAPA 4GQPH 5IG7B 3RVUD 5FK9A 3INUH 3VFWA 2PXYB 2QV2A 1UZ6F 4WFHE 4Q2ZA 1KXVC 2VAAB 4G8GE 2PF6A 2EDQA 4GMTL 4HJGA 1CDUA 1RPQA 2ZJSL 2CDGB 3LQZB 5IGXH 3QEUB 3QJHA 3RBGA 2VLKB 1CD9B 4MNHA 4Y7MA 2WANA 3MLVL 3VGBA 4KI5C 1IAMA 2AXHA 1Y6MR 3H3BC 3KVQA 2J1KA 4KDVA 1IARB 2VDRH 2HN7B 1QUNA 1VERA 5HDLA 3MNVB 1AC6A 1AQKH 4DVRL 3S3SA 2A38A 3ESUF 3IVKA 3RPKA 1JNNL 5FB8B 3I3EA 4BFIB 5HHPB 4J2XA 1BQHA 3AY4A 3JSSA 3GJFA 5DMJB 3WD5H 3Q0HA 1ZHBB 2AEPH 4U1HB 4U3CA 2WINA 1OSZB 3L7FA 2DN7A 2XKSA 4FTVB 2XPGB 1G7IA 1CK0L 5DR5H 3CX2A 3B83A 5IJKC 1A6UL 4OGAD 3FJTA 3FO9B 4APQD 4Y1AB 4OZFB 3QIWC 4N8VG 4L4TA 1ND0B 3E3QE 1D5BA 3PQYB 3QWQB 3F6IA 4NKIL 2DQUL 3RVXC 2BNUA 1QA9A 1HI6A 3S37L 3NFSH 2PTVA 1QFHA 1YEJL 3NIFF 4JB9L 4Y4HC 2DQTH 1MHPL 1D6EA 1KTLB 4PBVC 3EYVB 3DYOA 3PWVB 5GGUB 4KAQH 4PLNC 3GUTA 3DVFA 3SCMD 4ZFFA 1EJOL 1A47A 4PRDB 4XP4H 4D0BA 3DARA 2LABA 4JFZH 3QUML 4WDIB 3C60C 4M7JH 3VFOB 1CZ8L 5DRXB 3HS0A 3LS4H 1DSFL 1EGJA 4YBQC 1PYWB 5I74C 5TQ2L 3MRJA 5KTEL 4HFUH 1UG9A 5C6TL 1XF2A 1N5YH 5I1EH 1DQDH 5J9PA 3GDBA 4C55A 3O6FD 1RK1B 1NDGA 1MCOL 1UKQA 1RZIB 1I7TB 4JPKH 1X5FA 3DX6B 4X4ME 1M7DB 1E0OB 2NX5B 3RGHA 1MY5A 2GT9A 4KC3B 2YMXH 3DYMA 1DQJA 3BFOA 4MD4B 5FHBH 1IFHH 2IQ9H 2P24A 2PTTA 2UY7A 1A7PH 4H25A 3U1SL 3KYKL 4HULB 1YEEL 3C60B 1TXKA 1ZHLB 3DXAD 3TBSB 1HIML 1E6OH 1K5NA 5HGDB 4X5LA 3GSXB 4ISVB 4OUUA 3BIKA 1A8JH 4AG4H 3PP4L 1G9MH 4PREA 1OAKL 2EDDA 5GZOD 2R29L 1YN6A 3IJSB 3MLSL 3LCYA 5I8OH 3S8WA 5KSBA 4MCYA 5DMYA 3DUSB 4HKJA 2VZVA 4NQED 3AM8A 4X7FC 2BSSB 4FFYH 2QHLA 5F1KC 5GJSL 4OCLC 1AY1L 1W0YT 4XAWH 5F9JA 3U7YL 5K9KB 5FM5O 4LSPL 4OGYL 3P11H 5B39B 4XNXL 5I8EA 3PHQB 1ZGLB 4F7TB 2JCCA 1WBYB 2NY7H 4Q0XL 3CFKB 5EO9A 3ZDZE 1BP3B 4K7PL 4ZYKA 3RUGF 3TYFA 1S7VA 3WIFB 4OZ4B 5CEZD 3LN5B 3B6SB 1JGUH 5BV7H 3GIVA 2R0ZL 4XWOC 1I75A 5MEPA 1DBBH 2Y6SD 5I71C 5K59E 1U92A 2Y72A 3T2NL 3PV6B 5BXFA 4UOW1 5E2VH 1YMMD 3S35L 3K80A 5GGTH 3GMOB 4JFDB 2P5WA 2F54D 3CZFB 1GRWA 4P5MA 1IGTA 3VWJA 3L1OL 4F58H 1OAYH 2ADIB 5MI0C 4ZQKB 4LP5A 4Y4KA 5BVJA 3S36L 3CVIH 4ZXBD 3ULUC 2ZCKH 1BIIB 3QDGB 4NCC2 2LVEA 3QA3B 4YHNA 3IFNH 3LKPA 1RIVL 4W6WB 4CNIB 1FVEB 3A67H 3EOTH 5FYJU 5I71B 5DVKA 2EDWA 1DP0A 4HX1A 1FO0A 4LLDA 1EBPA 4CN6A 4QRTA 5EN2B 4UU9B 4N0UB 4L5FL 4WUKL 2ATKB 2X4UB 2Q7YA 4QHUA 5D9SB 1IQWH 3ZL4L 1WWBX 4JQXC 3SE8L 1R5WB 3NN8B 5J0BA 2N7AA 2QSQA 1RZKL 5DK0B 5DUPH 1AE6L 1QO3B 4MA1B 1GGIH 2DQHL 2ZUSA 4HQQH 4GSDL 1YPZA 3DX7B 5BZWA 2YD8A 1I8LC 3IDUA 3O2DH 1MUJB 4IOFD 4PRAB 2HFGL 3WO4C 3DMMB 1WBXB 1IT9H 1EDQA 4ZPVB 3RWJA 5T5FL 4OLUL 3W0WB 4V1DA 4KKNA 1T03L 4G6JL 4MS8A 3WNMA 1RY7B 2EXWD 3PGDA 4BQ8A 4O58H 3TFKA 3VA2C 1S9XA 2AXGB 4M62H 1UXWA 3F5WB 3WXWH 1P5VA 4D3CL 4MD0A 3TO4C 4LHUG 5D8JH 4WTXA 4EN3C 1CR9H 2ICEB 1HILB 1NMAL 4M1DL 2DQJH 3AU1B 3G08B 4FQJH 5CINH 5GS1B 4KPHH 5T33H 1NFDE 4HJ0D 4LEXL 3ZDZF 5DJDB 1TVHA 4AEHH 1AGBB 2GKIA 3P4NB 3MBEB 2IPKB 3BEVA 3WO4B 4NP4L 3WKML 3QQ9D 2G2RB 2Y25A 5C07B 4WFEE 5K59F 4NQUA 4RQQB 3T4AB 4XBEH 3REWA 1L0QA 5DJ0A 4OM1H 3VGAC 4RX4A 3DRTB 1IM3B 5E8NA 1MFDL 2Q87A 4EN3B 5DK2B 3UTTD 5DVMA 4G9FE 5GSVA 2WUCH 4CVWA 3MGOB 4CAGA 2BSTA 3SDDB 2X4TA 1N8ZA 1JP5A 1RV6X 3LPWA 4JM4H 5EC1A 3BN3B 3C09B 1QG3A 5EOCH 1UWGL 4P57A 1ZT4B 3WYRA 1IILE 4PJXB 1JN6A 4HEPG 3RNQB 1F6FB 4XX1E 1TZIA 3EYFB 3VXTA 4NQVB 1LO3L 4NCC1 1TJGH 4HAGA 1MWAB 4KXZH 5DDHA 4HIEB 4N0FB 1ZTXL 5AUMA 5IWLC 4GRWH 2AVGA 1BQLH 5GGVL 2CD0A 1JPGA 2J5LC 3BDXA 1JF6A 1EAJA 4Z7WA 1PKQE 1AGCA 2AK1L 2XQBL 2YRZA 2FJGB 1QSFE 3QZWG 1Q9KB 3MRGA 3NTCL 5DHVB 3PDDA 1INQA 1FNEA 3SGJA 1FN4A 4XC3L 3QEHA 3QEQA 2IH3B 1SJHB 1BVZA 1FZJA 1BZ7A 2FSEB 2XYCA 1UB6B 5D7JA 4K94L 3TPUA 2FIKA 1HQRB 4YXLH 1TTGA 4PUBH 4JQIH 1BOYA 1OCWH 5EU6A 3FFCA 3WLBA 1FL5B 3U4EA 4KRMB 1CL7H 3ZHDA 3SO3B 1X9QA 5JDSA 4N0CC 4HDIB 1JFQL 4PRNB 5FYLE 4DZ8A 2G5RA 5EUOB 4GAJH 3CXDH 3MGAA 5IK3A 4OZIB 1EHNA 2R23A 3KYMB 4U6XA 1ZLSH 4X99A 2FGWL 4OTXL 1FGNL 3G6JE 3Q3GB 2V6HA 1NBZA 4F7EA 1JWSA 3DOSA 1NUNB 2Q76B 5A16B 3FN0L 3KJ4B 4LLYA 5H35A 3KLAA 2Q8BH 3MR9B 4XXCC 3Q5OA 5CGTA 2UY6A 3QI9C 1ORQA 5IESL 2ZSWA 3EO1A 1NCAH 5F7DA 3VFVB 3MV8A 5I1AB 1MFEH 4GXVH 1JFMA 3V95A 3BKJH 2JIXB 3OKMA 4G43B 2HH0H 4Z7OF 3ME0A 4UV7L 5TDPB 1D7FA 4LCUA 1UQSB 2BY3A 3C5SA 3QIBC 5EA0H 4BM7A 1WFTA 4Z9KB 3Q6FA 3PWUB 4YDLC 5ADOH 4LSVH 3U0TB 1I9RL 3OB8A 4H1LA 1XGPA 4JHAL 3K74B 1ZEAH 2FHFA 5JA9A 4KUCD 3HG1E 5JPNB 1SEQL 4QHKJ 1WICA 4MNQE 2E7HA 5JOFB 5IHUH 2E8YA 1KN4L 4O2EA 1YYLH 2V7HA 2OTUA 4X9GA 3MXVH 1BVLB 2NTSP 5HYIA 5GS0L 4QF1B 5C2BL 5DEFA 1JPTH 3TBYA 1FRGL 3O11A 4YR6B 3GI9H 3FQRB 4M43H 2VDQH 5FYJL 1MJ8L 2X05A 3OR6A 3ZE1E 3AS1A 4YWGL 1IGYB 5EG6C 1A14L 1X5YA 3MMEA 5CIPA 4Z95L 6FABH 3OKOA 3HMXL 2AAVA 2I9TA 5CP7A 3SKMA 5J6GA 3EDJA 4APQA 1Z3GL 1XR9A 5DXWA 5E7FA 5ID0A 4HW6A 1E4XL 4H20H 4RNRB 5ACMA 2N56A 4F33A 1F11B 4TTDC 25C8L 3HC4L 1LO5B 4M6AA 5JHLH 2N4IA 1PQZA 3ILPB 4DUVA 2DWEA 3GBML 4YDJB 1NFIB 3L9RA 2ICWI 1KEGH 5KOVC 3FB8A 2X4OB 5IT2H 4JFPA 3FRUB 1ZT1B 3G6JF 4WY7H 5F3HB 3V5HA 3C87A 2H32B 3V6FA 2FB4L 3NGBC 2RB8A 2HLFC 1CXFA 3SCMA 5LJYH 2IH1A 2EKJA 4S1DC 3AUVA 5ESAB 5CZVL 2OZ4H 4DN4L 4JFYB 5D93C 5B8CC 4Y8DC 1XGYH 2ICWA 1MCQA 3HR5A 1BEYH 4NKDB 5I2IA 2GTWA 3R06B 4M5ZL 2P46B 4P3CH 3T8XA 1RHFA 5DJAB 1X6NA 4P46D 3BQUD 2A1WL 3CDGA 2AK4D 4PY7B 1NMCB 5HHME 1I1YB 4YJZL 3BUYA 2DD8H 2AJ3A 4JFED 4QRPB 1VDGA 1N6QL 3DX8B 3O6FA 3NGBB 4MAUL 5F7HA 1YEDA 5C7XL 5DJ6A 2ZNWA 5J6HA 1WLHA 4JY4B 1EXUA 3FB6A 2P7TA 3D85B 1MAKA 3HG1D 3HZKB 3A6CL 4Y2DB 5I18L 2AXFB 3MZTA 3BPCB 1SY6A 1ACZA 1JZ3A 1MAML 5C0BE 1VA9A 2NY3D 5B8CB 4JG0H 2YD9A 3DXAA 3TNNB 1XIWB 4HCRH 1E28B 5CZXD 3GIZH 2IWGA 1EZVY 1MCNA 1O7VA 1OLLA 4LCYA 1K8IB 1MJUH 1AC0A 3NCYP 5JHDD 1QVOA 2DQEH 4KRPC 3QAZC 4JFFE 2H45A 4HF5H 5CHNB 1QFWI 4QHLA 1YQVH 4LSUH 5KS9E 4N8PA 5GIRA 4NQEA 4TN9A 4JGMA 5IHZA 1P4BH 1JWMB 3PJSA 4G9DB 4RIRB 5KSAC 4YXHL 4PB0H 1IGML 3QDHA 4UAOB 1W0VB 3I02A 1X5KA 5F6HJ 4IIQA 2EKSA 2V17H 2VLJE 3EYUH 3F7YB 2BNRB 5DRWA 5E99H 1T0NB 3RU8H 5ERWA 4JQVC 4PJ5B 4XTRD 1SMAA 4LLAA 4OQ1A 5HHOD 3TZVC 4JKPH 3QUYC 2Y06L 5MERA 4MNGE 1AO7B 3GSWA 5E8OB 5LBSL 5B4MC 4PJCA 3WJLA 4ZFGL 5C3TA 4JM2B 1P2CA 5JQ6H 1YMMA 2ESVD 2FWOA 3SJVD 3HNVL 1U8OB 4HKBB 2ADFL 1KB5B 5KSAB 2F54A 2AJXH 2GW5A 1H3VA 1MCFA 3WFDL 4GOSA 2VE6B 4S1SH 3ZDYE 5DUML 5E2TH 1I7ZA 4PV8A 5HHMD 4NO5B 4ZXBA 2E6JA 3T3ME 3VXMD 5T1DL 3P4OB 2PYEE 1HHGB 4JY5H 4AQOA 3NFNA 2RIKA 1YZZA 4FZ8L 5HGBB 4WTZA 4LKXB 1QRND 2R8SH 4N0RA 4U31A 4PB9L 1B0WA 3BPLB 3IKKA 4NHUB 3TESA 1XGTB 3SDCD 3IT8D 4NNXB 5F1OB 2A9ML 1ORSA 1TLKA 3BIBX 4NKMA 3K8KA 3WNKA 1GZPB 4WI6A 1CFNB 2UYLB 4UQ2B 3MRIA 4FQXC 5IEKB 2KH2B 5DD1L 2P8MA 5L8KB 1U3HC 4WWKC 1KJ2B 1MH5B 3UEZA 3HE6D 2YXMA 4GW5B 1JI2A 1F8TH 3WUWG 3DSFL 5IB1A 5D7IB 5I16A 4PRPB 3O4OC 3TT3L 1H3UA 5KS9F 2XY1A 3DUHA 4JFQA 1YEIL 4XZUA 3WFBL 4ODHL 4PJHE 3V9FA 3Q5YA 5KVFL 1NGXA 3OGCB 3QUXD 3O6LL 5EH1A 4AEFA 1PDKA 4B5EA 2NNAA 3S5LB 5F1IA 4WW2B 1KJVB 3MRFB 4PGDA 4XPTH 1I1AD 2BHYA 3OKYA 3IDIA 3SGDI 7FABL 3GBLA 3MLUL 1MF2H 4IMKA 4ONOA 4Q9RL 3RWEB 3QNZB 4LVNC 5EBMB 4J12A 4U0RB 1JYXA 2VLKE 1K2DB 4IDJH 1CTOA 3U2SB 4HWBL 3W5MA 3DX9B 1FZKB 3MGTA 1WBZB 5KVDH 3GMNB 2YEZA 1I8IB 4ZFOA 3EYSL 3LRGA 4YHMH 3ROOA 1UYWH 1D3CA 4ZOCA 3T1FB 3T0AA 8FABB 3N50A 4EQ2A 4FQ2H 1PLGH 5JIIA 5F88A 35C8H 3O0RH 1SBBA 3ARDD 4LL9A 4XB7A 3UTTA 1JUFB 2AJZA 4Z78A 4IM8A 3MRRB 4P5KB 4AYFA 4N8CL 2Q8AL 3ZDYF 2WWKO 1KG0A 3NFPB 4X4XA 2CKBB 4Y5XA 2PYED 1Y0LB 4FTVE 3STZB 2MQ0A 1CWVA 3WXVL 4LVHC 1GVIA 4NBXB 1ZXQA 4LVNB 3KPLA 4OZGF 3T3MF 4ONFH 2R0KL 4BH8A 3ES6B 4Y1AE 4U6VL 2MSPA 4CKVX 3M1BA 3RTQC 5C0FB 3O2WH 2FATL 3PQYE 5I1DB 4TQEL 5DF0A 1LEGB 4ALAL 1TIUA 3P30H 5IB2B 2BVUA 5DHYB 4L3AA 5IOPB 1L7IL 1SM3L 2O5ZL 1I9JH 1KCKA 2EE2A 4JN2B 3O3UN 2UWEB 3TC9A 4LLUB 3FAWA 1TQBB 5KW9L 3OZ9L 4HXAH 5E9DB 3W11C 3K4DA 1HKLL 4HIJB 4OT1H 1LK2A 4KJQC 4UIMA 2LE9A 3QIUC 2XICA 1CLCA 1I7UB 1NBYB 2EYTB 1Q94A 3IRZA 4PJAA 1GJIA 1IVLA 4GW4B 1NAMB 1I3RB 4POZC 3WDJA 4PJHF 3WFZA 1BM3H 1JNLH 4ODUB 2DWDB 3KPMB 3EJZD 3KPRB 1WUNT 2YPLB 1N7MH 2ZSVB 5ABDE 5T3ZH 1NFDA 4WJ5B 3HPJA 4NN5C 2O5YL 4UV4L 1Z5LA 4HKZA 2NX5E 1KN2L 1FL6A 1RUQH 2VLKD 2COQA 4X9BA 4PTUB 3DJ9A 1F90L 1P69B 4GQ9L 3UC0H 5FF6B 5F7UA 1S7QB 3FQWB 4ERSH 1V3KA 3WFHB 2A83A 3FRPG 5EFIA 3O9WC 1NGQH 1CXIA 2L7UA 3O3BB 1C5DB 4U6HA 4EKXA 4W68A 3CFDA 5ANMB 3P4LA 4QXGH 3MUGA 1F4YH 4K3JL 4TSAL 4QO1A 2ZOKA 5I1LA 1A7OL 4ZTOL 1IJ9A 2A6DA 1BFSA 1GAFL 5JO5A 2NR6C 1T2XA 4FTVD 3LN4A 1G0DA 1U8NA 1YJDL 1U93B 4O51A 3BPOC 3VXPB 1RUMH 1FORL 4CDHA 3G5VA 4FP8L 3CIQA 4Y1AD 5D1QB 2W0KA 4PJGA 4KI5D 3IXAB 3U7AA 3L5XL 3B9KC 3PQYD 4KY1H 3MO1B 2EYRB 1T4KB 4YFLF 1W8OA 4FHBD 4S1RH 3MLTA 5I17B 3M8OH 3ZKMC 4O5LH 1UJ3C 3VWKC 1AXTH 3WIHL 3BJ91 4XRCA 3RIFF 4HBCL 3FL7A 1T7YA 5BMFH 1BQHG 2NLJB 3GMRB 1YNTA 4XPHL 1QLFA 3BE1H 1HNFA 3ARWA 3DLQR 5TFSL 2PW1B 3BPOB 4JFDE 5MEQA 1RVFH 5A40E 1TZHB 2RGSA 1XZ0A 3QIWD 1EVUA 5GJTH 4UDUA 2AJSL 2QQLL 3B9KB 2XZZA 1PZ5A 3RVXD 5BVPL 2ZCHH 2CGRL 4PGEB 3KPPA 3MLWH 1LE5A 2RHEA 1MCPL 1A3LH 2NW3A 1EUTA 1F4AA 2YUVA 1UJ3B 2F74A 3IU4L 4NHCL 3ULVC 2XFXB 3GEWB 4Y4HD 1A4KA 2WUBL 5IB5B 4U1NB 1MIEH 1F13A 5TQ0L 5FUOL 3EGSB 5D71H 1Q8MA 3QNYA 4OIBA 3B8SA 3VRIA 4V2BA 3UO1L 4X7CC 4N0UE 1JIBA 3FO0H 1BOGA 5ICXA 3NCJL 2HVJA 1VENA 4MMXC 3WFCL 5KVGH 3BAEL 3TCLA 4NO0B 4HIIB 3C60D 4I48B 4K3EL 2BVEA 2ZUQB 3I6GA 2VITA 2D0GA 4YBQD 3TP4A 5GISH 3U36B 1MLCA 1BGXL 3CLFL 1NBVH 2FECL 3VXSB 2WBWB 1QFWH 4M1CD 5JQHC 2D9CA 3L3IB 1BJ1J 3MRKB 4I3SH 1G6RA 4P46A 3BQUA 4M6ML 2AK4A 3W0WE 1FBIL 1T22B 4KK6C 4TULH 4JFEA 2BFVH 4BFBD 1ZHNA 1XF5A 1Q1JH 4L9LB 4ZD3H 3CXHK 4KTDL 2Y5TA 4GKZA 1RZFL 5EBGA 5FYKH 1RJYB 4OSUH 3OAUH 4X7SH 4BELD 2BMKB 5C09B 2DMBA 4RFOH 3HG1A 3UYOD 5DFVC 2IBGA 2WK2A 2O93L 2EH8H 2XXMB 4JHWL 3V4VH 5IBTL 5I1HL 5C6PB 4G8FA 5CLTA 2NYYC 4WUUD 1FFNA 4LQ1A 1BVKA 5C07E 5BRZB 4HEME 1TQCB 4LCCB 2IG2H 4LEOB 5JHDA 5E4EB 5KAQF 3GSNA 1YDPB 2BXZA 4LNVA 4X7TB 3SGKA 3KLSA 1M6OA 5DJ2A 2QLVB 5HVFB 2HRPH 4ONHA 4E0RB 1K8DB 1A1MB 1QHPA 2OMNA 4PJFF 1AQKL 4OF8A 5F9OH 3QDGD 3ARYA 3PL6C 5HYFA 3ZHLA 4RA0C 4MJ6A 2BY0A 1XR8A 1DQMH 2X42A 4XWOD 3WD5L 5I15H 2AEPL 3CVHB 4UZGA 5HHOA 3VDAA 1S5HA 4PJXE 1R3JB 5FHAH 2ZCLH 2M2DA 1JTTA 5DR5L 2YHGA 1HH9A 2V2XB 2M8XA 4PJ9B 3QCVH 4XB8A 1MLBB 2ESVA 4DVBB 3SJVA 2Z91B 1EPFA 2GCYB 3MRNB 2ADJB 4M6OH 2YD2A 1XGRB 1D6VH 4NO3A 2D2OA 3NFSL 4PJ7A 1CE6B 4PIRF 3OTTA 4G59A 3F6LA 4JFHD 2G5BA 1NAKL 4PS4H 3CMOH 2E3VA 1BMGA 3ULUD 3H0TA 2DQTL 1RJLB 3ET9F 4NC0B 4NQCB 3EDKA 4YAQB 4KMLB 3W0WD 2L4OA 4DEPC 5EBLB 5IR1A 3VXMA 4UDTB 5F9AC 2ZUWA 4M61A 4G80A 4J8RA 4OLVL 2Y4SA 5H94A 1RD6A 4XP4L 5I8CA 1HHHA 5EUOE 1QRNA 1IAIH 2RQ8A 4OZIE 4JFZL 3SDCA 3P77A 2R2EB 5JXEC 1F6AA 1IM9B 5T1MB 4FQIH 3LS4L 4GXUN 4G8IB 1OP3K 3KYOB 2VYRE 1DBKH 5D2LB 2GI7A 2FYYB 4YHZH 4Z5RA 4C56B 2A6JB 3MBED 2R1WA 2J8OA 1MCRA 4HFUL 4NOFA 5CGYC 3TBVA 5J89A 3W39A 3G5YB 4YPGB 5I1EL 1DQDL 5SWQA 2EDXA 4JPKL 5LKNA 5DMIH 1M05A 4HHAB 4ELKB 3VFRB 1KCLA 3HE6A 4NNPH 2DQCH 5HD8C 4X98A 1CGUA 2YMXL 3S37X 4LASL 3GRWH 4OD2A 1IGIH 5FHBL 4XCCL 1J5OH 1IFHL 1I9EA 2DS4A 4NQDB 4IOIA 4OFVA 1A7PL 5LGJB 1R3HB 4EN3D 3TH4T 5CSBA 5I66A 3OJVC 5FA4B 1C12A 1E6OL 3TBWB 3L5WB 3SDDD 1MCEA 4OCSL 4HUXA 4AG4L 2E7LC 1I1AA 1G9ML 5ICYA 4OQTH 1FYHB 3LH2H 4DGYH 2VKXA 3BI9X 1BQUA 1SYVB 2OL3A 2VXTL 4MNGA 4OI9A 4PJXF 4FFYL 4I18B 1UWXK 1LO4H 4XMKH 4OF6A 4X4YB 1S7XB 2BNQD 2A74A 5CEYB 1D9KB 3FKUS 3T4YA 3P11L 2OI9C 2J6EA 1LQVA 2NY7L 1ZLUK 3ARDA 1DN0B 4XBGB 1D5ZB 2W0FA 1JGUL 2MQCA 2IFFL 3VCLB 4K3DH 2DQIH 1DBBL 1CG9A 3E2HA 3WBDA 2PYEA 1FC1A 1JMXA 2NXYC 3EJYC 3JV0A 3RVVC 5E2VL 1UB5A 1U8HA 5GS3A 5GGTL 5DD6A 2FR4B 2ITCA 3BP7A 3FOMB 2D9QB 3CK0H 4ZDHA 4ODVH 4ENED 4B0MM 4F58L 2OI9B 1OAYL 4OZIF 5LWYH 3CVIL 4R7NB 3MRBA 4BFEA 2ZCKL 4RFEA 1I4FB 3A67L 2XI9A 3EOTL 4JZJA 1VKXA 4ELMB 2XKUA 3Q2CA 2CK2A 5B22A 4LPXA 4V3DB 5IV2B 4HIHB 2R9HC 3BPNB 1WAAF 4N0CD 4GRMB 4NQTA 2NXYB 3BYYA 5HSFA 3QNXB 4K7PX 1TJHH 4I77H 4ZFZA 3RNKB 3BEWA 1BF2A 1VACA 4ZUWA 1XGUB 1IQWL 4H88L 1MHHA 4K9EC 3C2AH 3IAPA 2BSRA 2MHAB 3GSUA 3ARBC 3QHFH 5BZDA 4HQQL 1OHQA 2R4RL 3O2DL 4QXWA 4F9LC 3UJTH 4X6CE