3L3JA

Crystal structure of hla-b*4402 in complex with the f3a/r5a double mutant of a self-peptide derived from dpa*0201
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3jA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3jA01
4HLJA 1U3HA 4Y4KB 3UJJL 3LVEA 4YFLF 3BKCL 3L95B 4OZ4A 3AMKA 4R4ND 5CP3A 2J5LC 3RX5A 4JO2L 1KB5L 3QUMB 4OBRA 3IS1X 4S11A 3VGBA 3DUHA 3VFGL 3C6LA 5CD3A 1HXMB 2HMID 1TQBB 4P5KB 3DUUA 4JKLA 1U3HB 5E2UL 2JB5L 4OCYH 4OZ4B 4GKOA 1PLGL 2HAZA 1MFBL 4H0IA 2PF6A 4XPAH 4NHUE 1PSKL 1YNLH 2DQUH 1QSFA 3ARYA 4ZUUA 2QBWA 1IAMA 1E4WH 4EXKA 1WVZA 2IQAA 2W65A 1I9EA 1OQXA 1GGCL 2YXFA 4P0DA 4R2GD 1TXKA 1OSPL 2VAAA 3V6OC 4UIKH 5IGXH 2Z93A 2X9WA 1FGNL 4U7SA 1EEQA 3RUGE 4RIRA 1Q8MA 4L29A 5K9KA 3L7FA 1LP9E 1NGPH 2E7CA 1EGJH 4PR5A 4RDQF 3M17A 5D1QC 3HUJF 3GIVA 4N9GA 1K3ZA 2NY0B 3MREA 2Z93B 4JFQB 1FV1A 1YEJH 2OTUB 4PP2A 4ACPA 2MCPH 2GCYA 5DURD 3NACL 3NGBC 4RIRB 4L29B 5E8DL 3L7FB 5D1ZC 4UU9A 2NPLX 4PR5B 2C4FT 3M17B 4PJ9C 4XWGH 4ZFGH 4KKLD 1K85A 2CKBL 3GIVB 5I1DB 2B20A 4N9GB 3MJ7A 4TSAL 3MREB 1CXKA 1NLDH 2ZCKH 1FV1B 3EYQC 4PP2B 4X0KA 1DCLA 1DQQB 1W72L 1DBMH 3MLZH 2UZXB 3LEXB 5DHVA 3QIWA 1FVDA 2VL4A 5EU3A 3FO9A 4UU9B 2FHBA 3CMGA 3O4LE 4POZD 1A7QL 3QFJD 3MJ7B 5KS9E 2PN5A 4XNUH 1YA5A 4X0KB 2VTFA 1OP3H 4WHTA 2DM4A 3QNYB 5DHVB 1X5IA 2ZCHH 3OAYK 1FVDB 4P3CH 3FO9B 4HFUL 1RJYB 2R8SH 2K9UA 3DETC 3SGEH 4DVRH 1I9JL 4NOFA 4HULB 4L8SA 3H9HA 1RUML 4WHTB 3QCVL 5I8OH 2A74A 5B4MC 3GO1H 5E9DA 3TIEA 4OT1H 4M6OL 3GSUA 5DMIL 1MLCA 3QT2A 3CX2A 1II4E 2YPVH 3H7LA 4J3VA 1RULL 3EJZD 4L8SB 3JV5A 5B21A 3H9HB 5I9QC 1JNJA 1MFDL 1R3KA 3PWNA 4H20H 2A74B 2Y06H 3ARRA 4Q0XH 5E9DB 4EVNA 3ULUF 2DQJH 4LCWB 4U6VL 3KYMB 4H26B 3WNNA 1K2DA 2FB4L 6FABL 4XC3L 2EDHA 1MLCB 2AJ3A 3K2UL 3FFDB 4HX1A 5IHBA 1QYGL 2VXVH 5DJCA 1I1RA 4PB9L 1YEIL 1R3KB 3QUXD 3ZYJA 2EO9A 3PWNB 4G5ZL 4RMVA 1YMMB 3W39A 4FA8A 1JK8A 3I3DA 1CGWA 4EVNB 3STZA 1K2DB 2DBJA 3QP3A 2AJ3B 1RIUH 1IC7H 4M1DL 2Z92B 5CUSH 3WXWL 1BF2A 4HIJA 3K8LA 1AR1C 2I60H 4JREB 2EYTA 4WFFD 2PETA 3CVHH 4KPHL 4JKMA 3CZFA 1EAPA 3PQYE 1JK8B 3W39B 2VLLA 1NEZG 2FGZA 3STZB 3VD9A 3FFCA 2AXGA 3MV7A 2XT1B 2NY1D 3VGDA 4PJXE 4FP8H 1NFDE 4HIJB 2ESVA 1O5DT 2EYTB 1YEKL 1D6VH 4L4VE 3CZFB 1EAPB 1RIHL 3X12A 1WWBX 2VLLB 1A47A 4Z0XA 5JOPD 3FFCB 4A6YA 4JG0H 3MV7B 2J4WL 3KNBA 5HGHA 4LFHG 1JUFA 4JHZA 3CLFL 3EHBD 1DANT 2ESVB 3DWTA 4GQ9L 3CZJA 5KVEL 1IGTA 1IZKA 3E3QE 5FHBL 2JIXD 3LKNA 2ARJQ 3X12B 3S34L 3KXFD 1E4KC 1OAYL 3I6KA 1ZA6B 2R0KL 4Z0XB 4A6YB 3KWWA 2BSTB 3UTTD 1MIML 4X6BA 3KNBB 5HGHB 3PUCA 1PGRB 3UDWA 1F02I 3VG9B 1ONQB 1IGTB 1QRND 4YGAB 3LKNB 5ALCH 1IC4L 3CDFA 4HUXA 5JMOC 4Y2DD 3ROLA 4Q9RL 4KK9C 3KWWB 5E5RB 4O02H 1KELH 4X6BB 1MRFL 1T04A 5KZCB 4APQB 5J1AA 2BDNH 4C56A 3CMOL 4RDQG 4HUXB 2AGJH 1JPTL 1A3RL 4WUKL 1LK2B 1KYOJ 2H2SC 2P42B 1AXTL 2A6IA 5JUEH 4NHCL 4CVUA 4HCRA 3FT4B 1TTFA 1T04B 4M6NH 3MLVH 3NAAL 3P77A 1R3HA 4NN7B 1KXTB 4QHKI 1AY1H 3TM6A 3UAJD 4J3UA 4GAGH 4IMKA 3O6LL 4TPRL 1CXHA 2PTTA 3TH2T 3RWDA 3VXUD 1EFXA 1MCPH 4WFEE 4C59B 5I8CA 3QI9D 5KVDH 3P77B 4NO2A 4U4BA 2OBGA 3MUGA 3EO1A 1I1YB 5HYFA 1AH1A 2A6KA 2YUWA 3FRPA 3NN8B 5EOCH 4Y16C 4JDTL 2PTTB 2VDLH 3FO1B 3RWDB 4PBWD 2WUBL 5DK0A 5IBTH 5C0BA 1EFXB 4KMLB 4WFGD 2EEAA 5I8CB 1OB1A 2FX9H 4PJAA 1XIWB 3SQOH 4NO2B 4ZXBD 3MUGB 5EO1A 5EU5A 2BNQB 5DUPH 3MV8D 2A6KB 3C8KA 1BIIA 4L5FH 4WV1C 3BFOA 3GMNA 1DFBL 3DBXA 2WM0A 5HSFA 4QOKA 1A6TB 3OBAA 4XVJH 1CBVL 3A6OA 2XZZA 2YBRA 5C7XH 3G9VA 4XCFH 4R3SA 3R4DA 5EU5B 4ZO7A 1BIIB 4XPFL 3UYOD 3OSKA 1NPUA 3D2UA 3GMNB 4LVNB 1WFOA 3DBXB 3MUY1 2C3HA 1YYLH 1DANU 3QEUA 1VEOA 2B4CC 4G6AC 4I0PA 4LNRA 5ACLA 4PY8I 4TNVF 3MRIB 2YBRB 2VZSA 3B83A 3SCMA 5A2KH 4R3SB 3SE4C 2ZNXA 2IFGA 3P0VL 3D2UB 1J12A 2BJMH 3VFUB 3ZE2E 3FTGA 3QEUB 2NY5L 4I0PB 1R0AL 1T7VA 2E6JA 3RY6C 2PYEB 5JW4N 2YK1L 3SCMB 4BYHA 1KPUA 1RU9H 4M7KL 3RBGA 4AT6B 1B4JL 4Z77B 2NYYD 2B39A 1MIEH 1N6UA 1CG9A 1UJ3A 2OLDA 5C8JA 2AXFA 2EH7H 3BKYH 2VXSL 3KLSA 4CL7A 4YNYB 1KPUB 4OZIE 4OSUL 5ADOL 1WT5A 2QJDA 5C92A 2EDWA 2VLKD 1IT9L 3BZEA 2BY1A 5J89A 4KZEH 3RX7A 4QRRE 4U6HA 2DQDL 5JPMA 4FQ1H 2VR5A 1CG9B 1UJ3B 5H37G 5C8JB 2AXFB 3R06B 4ZS6C 4ODXA 5D5MF 5CGMA 4Q7DA 4FQXC 1FIGH 4NFDA 4PJDB 3VGGA 4XNZC 4K55A 5GJSL 3VFTA 5DMYA 3ULUH 1ZHNA 3EFFA 3BZEB 3NZ8A 4U6HB 3FN0H 3I2CH 2R4SL 4N0YL 4WY7L 3QUYC 5IVOA 5JHDD 3QPQC 4GW4A 4IS6A 1QFUL 4RAVA 2VMFA 3AB0C 4OLYL 4D9LH 2V2WA 4O4YH 2UYLA 4Y5XA 1EO8H 4FFEX 1TJGL 3O3AA 1J8HA 1ZHNB 3EFFB 4XB8A 3U2SA 1MI5A 4XP1L 3NZ8B 3U4BH 2AS5M 5I1JL 4HPOL 5HHME 3D39D 1TPXB 4GW4B 4GG6A 3HZMA 3DO7A 2PUQT 1NBQA 5HYJD 2DD8L 4DFIA 4C83A 2A9NL 2UYLB 1WAAE 4I0CC 4Y5XB 3KPSD 4MA3A 3KYOB 3O3AB 4XVUD 1J8HB 2DQTL 4PJIF 3U2SB 3RWEA 5BRZA 3RTQC 4IRSC 2KUTA 2F74B 4JZJB 4BFIA 4WI8A 1I9IL 3BEVA 4YDVB 4NQDE 5CIPB 3HTLX 3OAYH 4GG6B 3RVVC 1YEHH 12E8L 4YC2B 5B3NA 5GRXG 1Z3GL 5H37H 1CICC 2E6QA 4JRYA 4MA3B 1BWWA 3ROOA 2YPLB 3HAEG 3U48A 2PKDA 5JXEC 3RWEB 4UILH 1YEFH 1KLGA 1JZ3A 5CJXC 1XGRA 3RWJB 5I1LA 3BEVB 2YA1A 4ZFZA 4NWTL 4LP5A 3K46A 2X09A 1WTLA 4O9HH 4NBZB 1E4XL 3PGFH 4JFFE 5JQHC 3JV4A 1MPAH 1WBYB 5EWIL 3G5XA 5EU6B 1KLGB 3K74B 1XGRB 4WWID 2E7MA 4S1QH 4J23A 4NO0A 4ZYKB 4ZFZB 3O6FB 4GSDH 5FYLE 1QNZL 1L0XA 1A3LH 4GAYA 2H1PL 1AO7E 1JYWA 5KVGL 4E41A 2XI9A 4G6FD 4HJJL 4KRMB 1NSNH 5HDLA 3MA9L 3VWJA 2PR4L 4OTXL 2GJZB 4YXHH 3FT3A 3EZJB 3G5XB 5GGVY 3MLPA 3UJIH 3FMGL 4WJ5A 4NO0B 2D0HA 2O5ZH 1J1PH 4GAYB 5EPMA 1Z6JT 1NC2D 2NXZC 1ES0A 4E41B 1PAMA 3CJJA 1S8DA 5D1QD 3AGVA 2Z35A 4NZTL 3VWJB 3FQTA 3FT3B 4KVNH 4ZS7H 3AREC 3WNKA 1P84K 3KG5A 3CX5K 3S96A 4DN3H 4YUEH 3BXNA 4G7YL 3H9YA 5FOBA 3ZL4H 5D1ZD 1CU4H 4PJ9D 2Z91B 4NC0B 2Z35B 1IGCL 4LLWB 2DLIA 3INUH 1SMOA 3EOTL 1L7IH 3FQTB 4PJ7A 4XC1L 1GPOH 5FK9A 3EYQD 3ZSSA 4TNWK 3S96B 3GSRA 1MUJB 1NCBH 1U58A 4LRIA 1FH5H 3BPNC 4OZFB 5DA0B 5FOBB 2EIBA 3ARSA 3BZ4A 5T1KD 3ZTNL 1DSFL 2DLFL 5EZJB 3L3OB 1JHLH 1BX2A 4J6RL 4WO4C 1LILA 5DUML 4PUBL 4E5XA 4JFZH 4FQJL 4PJ7B 3MRHA 4NN6C 5AG9A 4PJIE 2EKJA 4P2QE 4MXQA 3GSRB 4XT1C 1AQKL 4PPTA 2CXGA 2B7DT 2XTJB 3BDBA 3BZ4B 4JCMA 4FNLL 4YDIL 3UJTL 5CZVL 5JQ6L 3DHMA 2F8XC 3DETD 4E5XB 4KI5C 1KB9K 3MRHB 2XZQH 3DURA 4C54A 4ONFH 3OKDB 4ODHL 4P23A 5B4MD 1FDLL 3BGFB 3KR3L 1NCWH 4BSJA 3WFBH 4O58H 5CJQH 2ZOKA 5IB2B 1H9VA 4QTIL 4X7DC 3FQRA 3OB8A 3VFWA 1RUKH 2VWEE 2BVQA 3DURB 3C87A 4PJGB 4DGVH 1RVFL 2Z8VC 4R0LC 4NKIH 3QXAB 4IIQA 3RDTC 1O0VA 1ED3A 5MEPA 3CFDA 4PRPE 5E08H 1HN1A 3L3HA 2FECL 3IU4H 3DTXB 2Z8RA 3WN5B 2Y23A 3FQRB 1GJIA 4IMLA 2Y36H 1U8MA 3VFWB 3HS0B 2BVQB 3AAZA 3ARPA 3TV3H 4P9HL 2HYMA 4XHJC 4IIQB 4G6JH 1BOYA 3CFDB 3BP6A 5SWSD 3REVA 3ZHKA 2CUIA 3L3HB 1SYVA 5EUOF 5A2LH 4U2ZA 3QDMA 1AR1D 2DQIH 1BZ7A 3I6GA 5F9AC 5D7LA 1IGJA 3S37L 5TE4L 2WWKT 3QUZC 5FYLH 1BMGA 2BVTA 4MAUH 3BP6B 4FABL 3RWCA 5I15L 5DF0A 2CJUH 4GH7B 4JQIL 1OAUL 1SYVB 4K3EH 4RMUA 1JRHL 1BZ7B 4V2BA 5DLML 2CGRL 1FGVL 4LSRH 3I6GB 3EDDA 3DXAD 4YDJB 5D7LB 5BV7H 1GCFA 2DI7A 3UTOA 5FEBA 5HGDB 4YDLB 4MX7A 4MJIA 4X4YA 5C3TA 4DUXA 3RWCB 1HHHA 4ZTOH 2FL5B 3IDNB 3SKMA 1H3TA 3ULUD 2EDKA 5CGYC 4YZFE 1RI8A 5DURB 4U1GC 5EOCJ 5DJ6B 2P5WE 5DYOB 4MB3A 1AIFA 3G6JA 1NGYA 4MJIB 1UH2A 1HHHB 1HYRC 4ODSH 2PYFA 5GGQH 5L7XL 1OAQH 4F33A 1Q1JL 1UWGH 3B9DA 1C5BL 1ZVSA 4KV5E 3BUYB 1YNKH 4AENA 4KQ4H 3V8CA 1OARH 3HC0B 1BM3L 1QSFE 4PREA 3UROR 1NGYB 4OGZA 5E8OA 1TZGL 2AV7A 3L3JA 1HHJA 1HH6A 3QFJB 2PYFB 1MJ7L 3QIBA 5K33A 4F33B 3QBTB 3HE7A 1ZLVK 1I8LC 2R56L 1ZVSB 3IAPA 2ICWI 5HPOA 5IB3A 4RMQA 4HEME 2C7UA 1V7ML 3N85H 4PREB 3C5ZC 4Z7WA 3VFMB 4ZTPL 3I75A 2AV7B 3L3JB 3WJJC 3EO9H 2H2SD 3FT2A 1HHJB 1HH6B 4U6YB 1A7OL 3HE7B 5FKPA 3WFEL 2FEDC 4JFDD 1HZHL 4L9DA 3PJSA 2XOTA 2MFNA 2R0ZL 4Z7WB 1QVOA 2XY1A 43C9B 4GO6B 3FT2B 3B4NA 2C1PA 3GM8A 5FKPB 1JFQH 1JIBA 3VXNA 4MA8L 5EBGA 2XWJB 1FL3A 4H8WC 1EDQA 5BZWA 1IM9A 3KPPA 3BVNB 3BP4B 5F1NB 1QVOB 4O2CB 4P57B 4Y16D 2D7MA 4XNXL 1KTLA 4RBPK 2C1PB 2B1HL 4RGMB 4RAUA 2OR9H 3QUXB 4UAOB 1WZ1L 1FL3B 3FO2A 3IAGC 4KUCD 5BZWB 3GSVA 1HE7A 3GZKA 4N0CD 1IM9B 3KPPB 3X3FH 1NCTA 3L1OH 1N3NA 4LHUA 4LLQA 5A40E 1KTLB 1BOGA 4GAFB 5T1LD 3ZE0E 1R24A 2GSIB 3FO2B 3ILPA 1OP9A 1NFKA 3GSVB 2I9LA 1UVQB 3UTSA 4OJFL 1CS6A 1N3NB 4LHUB 4NN5B 3D3VE 4XCEA 2WSKA 4MD5A 4D0BB 5TDPB 4LLQB 2QSCH 2DWEA 1T80A 1D7FA 1DUZA 1BOGB 3G04A 1R24B 3LMJL 4G6AD 2VC2H 3ILPB 2VQTA 2JJTA 5C09E 3EYOA 1IKFH 5JW3H 2I9LB 3UTSB 5AZEH 5BXFA 5D6DA 5GS3A 3SKUD 5EC2A 3BH8A 4U1JB 5IHUL 5JXAH 4O5LL 1BFVH 4ISVA 5IBUG 3G04B 3GMRA 3QXUA 1UEMA 3GJEA 1QRNA 5C0AD 1IBGL 2YA0A 5BXFB 3WNPA 1ZT1A 4HUUA 5EC2B 3BH8B 4PRDA 5I0ZA 3UTTB 1GGIL 5DMKA 3DV4A 4GRMB 4W4OA 1NCCH 2ZPKL 4K71C 1JBJA 2ZUYA 4ISVB 3VCLA 3T0BA 3BWUC 4RCAA 1RJCA 3TJHC 2DI9A 3GJEB 4HS8L 1QRNB 1AKJA 3X17A 1T03H 7CGTA 3VFRA 4LCUA 1ZT1B 3MBEC 4ONHB 3WFDH 4HUUB 4LDOB 4RMTA 4OGYH 3DV4B 5MENA 3LB6C 4MLSA 3FHQA 3LSOB 1D5MA 3VCLB 1D5BA 3VFSB 4ZS6D 1LD9A 4OM1L 3X13A 5I1EL 4ODWA 4FQXD 4ZOCA 3VFRB 1DDHA 1LDPH 2ARJB 2UWEF 4R9HA 4MWFB 1CDCA 3RGHA 5MENB 5K93A 4LMQE 5C6TL 2VN4A 1D5MB 3B43A 3NH7H 4KY1L 3P9MA 3QUYD 1D5BB 3SPVB 3QPQD 3CIQA 3QUML 1LD9B 4FZ8H 2DTSA 4ODWB 2MWCA 4JR9H 5TQ2L 1WIPA 1J0HA 1NAMH 3MOAH 5C08E 4F8TA 1DDHB 1OWRM 3SDDA 5TQ0L 1FAIH 1ZEAL 3F6LA 1HHKB 5IG7A 4M48L 4YQXL 1UCBL 5IFAL 3VXUB 2EYRA 4F9PC 3P9MB 3UPRA 1AHWB 1SY6H 3MRNA 1J1OH 3QI9B 4LSUL 1RMFL 3D25A 4HKJA 1SEQH 3MLUH 3MV8A 2X1QA 1IEAB 3SDDB 3VXSE 1I9RL 2BP3A 2XZCL 5IG7B 1UG9A 3O4OB 1BAFH 1LQVA 1F42A 1H3PL 3KYAA 3RTQD 3QG7L 2EYRB 4IRSD 3UPRB 4JFOA 3NCBB 3MRNB 1AP2A 4HBCL 3RVVD 3BDXA 3TWCH 3D25B 2DTML 5F7NC 2FIRT 3T2NL 3MV8B 4C56E 1CICD 4CMMB 1KGCE 1LWRA 4YHMH 5JXED 1KFAH 5LKNA 4KGLA 5TFSL 4JFOB 5I1HL 1AP2B 2Q8AH 4KHTL 5E00B 3KHOA 5KJRH 2J2ZA 3QB7C 4I77L 2YEZA 5D7IA 3SDAA 1QTYT 4GS7C 2QQNH 4CN6A 4HKXB 2FLBT 4ZD3L 3O8XC 2BVUA 2Q20A 4JY4A 5DC0A 2XWTA 1MREH 1FORH 2YN5A 3O9WC 2QL1A 4Q6IC 3SDAB 4NJAL 1GOGA 3PF2A 3O3DA 3MJGX 1S7TA 3T2PA 1YY8B 3QCTH 2BXZA 1DBBH 4JE4B 5F9DC 5CKAA 1CGTA 4JY4B 5FUZL 1JGDA 1KCSH 3QQ4A 5C0BE 3GKWH 4PJAE 4IJ3B 1JNNL 2GJ6D 4HWBA 3FONA 3Q6FA 3V52H 3O3DB 4Q9BA 1Q9KA 1CTNA 4TSCL 4OFVA 2WW8A 1NGZB 1RZJL 5KSAA 3VI3F 1WCQA 3VDCA 3CFCH 1E4XI 4QOKE 1JGDB 2HVKA 4OLXH 3U9PL 3VRLF 1AGBA 5DT1H 5I2IB 5FDYA 4H0GA 4XXCC 4WENB 1FVCA 5KG9A 3Q6FB 1P6FA 4NO3A 1Q9KB 3IKKA 1PKQB 4PJBA 4NM8H 4EN3C 5C2BH 2PXYC 5KSAB 3ALXA 5AWNL 3BIBX 4LVEA 3MGOA 2HVKB 4I3GA 5ADPH 4HWEH 2QLVB 1AGBB 4DGYL 1XCQA 3ARDA 1S7RB 2NY2C 5KG9B 4WO4D 4NSKB 4NO3B 5FM5M 4PBVC 5F7YC 1KPRA 3C60C 2WAHA 4KHXL 3ARBA 3MGOB 4XNQB 3IXAA 2JJSC 5L2JA 3J7HA 4P5TC 2ZUVA 1F4YL 4KI5D 1AGDA 4MS8A 1TZIA 2DQCH 1KPRB 1T2XA 1YMHA 5DHYA 3FQNB 3BDYL 4YGVA 1OAXH 4NPYA 3ARBB 4ZQKB 3SGJA 1CXLA 2ID5A 4GRLC 4CDHA 3IXAB 4WUUD 3O2WL 4J3TA 4JB9H 3KPSB 2RB8A 3O0RL 4ZNEA 5L2JB 2LTQB 1OT2A 4N1EA 3MRBB 4X99A 4Z8FL 3VMPA 5JIHA 1NL0H 1TZIB 1KF9B 1YMHB 2E3VA 5DHYB 3CSYA 4PP8C 3K0WA 1MCKA 3F7RA 4MZ3A 2Q86B 5HHQB 1LK3H 4UQ2B 3RDTD 4NQUA 1S7SA 4YK4B 5LG1A 4PJCF 2FYYB 2EE2A 4NC1E 2H3NB 2J5LB 4DW2L 2D31A 4B50A 2GITA 3CSYB 2KZ1B 4HIXL 1K4DA 4XHJD 3QO0A 3O6KL 3LZFL 1OTUC 4U1IA 5I30H 2BRQA 1I8KA 1S7SB 4Y0GA 1WZMA 3BJLA 4A6YL 2IQ9H 3PGCA 3MBXL 4G9FA 3V6OA 4QCIB 1BVZA 3V8OA 2D31B 3LPWA 2NW2A 3G08A 1MI5E 2XQBH 3U7WL 3L5HA 4KDVA 5KSBF 3IRPX 1K4DB 3QO0B 2R29H 2VLRA 4U1IB 3V4PH 3QUZD 1I8KB 3J8F7 3KJ4B 3H7BB 3VRLE 3HC3L 4RBPH 3PGCB 2VITA 4Y7MA 5BRZE 1NAKL 5IT2L 4WVRA 5IR1A 5HHOA 2VLRB 2FECI 5BZDA 3N1FC 2BX5A 3SDXE 1KJ2H 4M61B 5D1QB 5E8EA 3U36A 4K94H 1U8PA 4KUZH 5EN2A 4JRYE 5ICZB 3EOBA 4KTEH 2VITB 3MJ8A 5CGYD 3D85A 2X1PA 4CNIA 1N6QH 1ZHKA 4OKVB 3NGBB 2VO5A 2WWMD 5F3HA 1IAIM 5D1ZB 2HJFA 4LNVA 4M5YL 4EKXA 3U36B 5E8EB 4LIQE 2HFGL 1U8PB 1R3IH 2FLRT 1IARB 1WBXA 4HS6A 5EN2B 4IRJA 4P2CG 3EOBB 1F8TH 4HCRL 4NM4H 2P5EE 1CLOH 3MJ8B 3D85B 4DKAA 4KDWA 5F3HB 3IFNL 3BMWA 4QHKJ 3QISA 2HJFB 2FGWL 4XMKL 2OJEA 3L5XL 1JRHI 2MKWA 3MZTA 5ITBL 3DX6B 1VCAA 4OLVL 3OWEA 4DWHA 3G5ZA 1JTPA 4MGXA 1ZLUH 3KLAA 4JKWA 3NFNB 5GRWA 4Q9QL 5F7MC 1Y6MR 5L0QC 4Q97A 1VFBA 5D2LB 2NY5C 1KENH 1HI6B 2OJEB 1A6UL 1RZFL 3C5ZD 4NYLB 3K80A 5DFTA 4C55A 3G5ZB 4LOUC 4PRAA 5FO8A 3BN9C 2XRAH 3HI6H 3KLAB 2FEDD 1T6WA 5DRWA 3RWHB 1VFBB 1VFMA 3TYGH 1QKZH 3QDAA 1F4WL 3GGWA 3DMMA 3WFCH 5F44A 1LEGA 1XGYH 1WWCA 4X6DA 5T5FH 3GI9H 2CRMA 4PRAB 2VDRH 3MFGB 5FO8B 5FM4A 1G7PA 5FXCH 5I9QB 1A1NB 1GAFH 2XYCA 1XMWA 2H26A 3R1GL 5IEHA 3P11H 3MZGB 4PLKC 2EXWC 3GGWB 1MCOL 2Y6SD 4JGJA 4O2EA 4NGHH 4OAWA 3DX9A 1FRGL 4HD9A 4XCYA 5JIIA 4X6DB 2E8YA 1ZS8A 3IYLW 2KZWA 2X40A 1KEGH 1HSAA 4PY8J 4UOW0 2CD0A 2H26B 2QQQA 5IB1B 5IEHB 1P7KB 1LQSR 5SWSB 4Y19E 4OLZH 4XP4L 4JCLA 4O2EB 2EEBA 2F58L 2IGFH 3DX9B 4OAWB 4XCYB 1T0NA 3HNTH 4RZCA 4LK4A 4MHHG 2KBGA 2HWZL 2NY3C 4V1DE 4AEEA 2DQFB 2DYPA 1N5YL 5J11C 3VGEA 1OL0A 1HEZB 1P84J 3E3QC 3CX5J 4MSWA 4WCYH 5DO2C 2EC8A 3ZE1F 3P0YL 2FR4B 4P4KC 5GS0L 1OD7A 3VH8G 1T0NB 4TOYH 2X44D 1A3QA 5FGCB 2X4QA 5TF0A 3UC0H 4BZ2L 4ELMF 1U8LA 3VD5A 4U1MA 1MF2L 3LAFA 5C0GB 5T33H 1CGYA 4H25A 4NQEE 4Y88A 4JPKH 4ZSOB 1ORSA 2HFEA 1T66C 1V3KA 2M8XA 3VDBA 1NDGB 1SM3H 1KSRA 2R0WL 4WTZG 3EJYC 1YN6A 5F3BB 5H8DA 2X4QB 4JN1L 2D7TL 2DM3A 1U8LB 3WO4C 4X6CF 4HV8A 1D5ZA 1A1MA 3ZTJG 3E8UH 4H25B 1ORSB 3QEHA 4MCZA 1KB9J 3QDME 5IQ7L 5C0IA 2FH8A 3GBMH 1YN6B 1JPGA 1HXYA 3MBED 1FNSL 5F7DB 2QHLA 4HF5L 2O5YH 2QHRH 1PKOA 5ISZA 3LB6D 4MNQA 4HV8B 1D5ZB 1WFUA 4FS0A 2W38A 1I7ZA 5E8NB 5TDNB 2IAMC 3QEHB 4Y1AD 1HILB 3DROA 1CK0L 4FOMA 5E5UB 1X5YA 4C57C 1HXYB 3L3GA 5F8RC 2MQCA 5BVPH 3GBNH 1EH9A 4PJEA 5CEZH 2VUOA 1I7ZB 3QQNA 5ICXA 4JO4H 2Z0BA 4DTGH 3WLBA 4HIEA 5JDJA 3DROB 4HZAA 1ACYH 4BFBD 3MRKA 4XMLL 3NMEA 4EI6B 2O61A 4M7LT 4V2CB 4JJ5A 2ZUWA 1HNGA 3G6JE 4Y16A 2R2HA 1NLBH 1PX3A 5DJXA 4EI5A 4OFDA 4PJEB 2NTSP 4URTB 3IDGA 1ZGLM 1P4IH 5B22A 4WW2C 3SE8H 3MRKB 3ZTJH 1S5IH 1WZKA 2P46B 4LIQL 5A3IC 3UX9B 2DDQH 5C86A 1EHNA 5I19L 3AUVA 4Y16B 1OTTC 2R2HB 2F19H 4N0UA 1DVFA 1MEXL 5DJXB 3IDGB 3M1BB 1JMXA 1RZKH 4K3DL 1A6WH 2BNRD 3QH3B 4X6EA 3H6JA 4ELME 1HKLL 4NQXA 5T1LB 4DKDC 5IP4A 3B6SA 5KSUA 1U42A 5DJ2A 1W0WA 2E8ZA 2PO6C 2E9WA 3FL7A 5F9WC 1BD2D 1RK1A 3PL6C 4ZNCD 1DLFH 3HAEB 4ORGB 2Q87A 2PW1B 5AZ2L 5HJ3A 3MNWA 1CIUA 3OKYA 5EA0H 1JNLH 4NQXB 3O8XD 4UDTA 3U46A 5KSUB 3T0EA 5DJ2B 3L6FA 3QG6B 1W0WB 2GFBB 2J8UA 2F53D 1IC1A 1A14H 3EO0A 3O9WD 1JWUB 4KAQL 3MYJA 4JPVL 5HJ3B 1S3KH 2VXTL 3WNOA 3D1MC 1UM4L 4OCXH 5T3XH 4KMTH 4UDTB 2W0KA 4DN4H 3L6FB 3ZDYE 2J8UB 2NY4C 3SE3C 2WP3T 3MV9D 4P9HC 1RZ7L 3LQAC 4M43H 4NZUL 1K6QL 4LCIH 2EDQA 1NH6A 4UNTA 1CZ8L 1RUQL 5LQBH 4YPJA 4TTGA 5FECA 2Q76A 4KRLB 3GBLA 2QV2A 5T1MB 2VLME 1QOKA 4FQXA 2R2BA 4XBEL 5TJWK 4TUOA 1IGYA 1DQJB 1Z9SA 4EDWH 1GGBH 4ENEC 3SO5A 1NUDA 3QUYA 5FECB 2Q76B 3AS1A 4CAGA 2PXYD 5SWZE 4EN3D 3EDJA 4BELD 1SJHA 4FQXB 2R2BB 1F3DH 3BZFA 1J87A 4XNZB 1NMAL 2O93L 1D5XA 4TUOB 1IGYB 2EEDA 3LQZA 3MV11 4XZUA 4MNHB 3ZHLA 2NY2D 4X7FC 2B2XL 2B1AH 3QUYB 3C60D 5HTSA 4BKLA 1A6PA 4H1LA 1SJHB 3I9GH 1GC1H 3BZFB 2APFA 3LQZB 4P5TD 4XZUB 1OHQA 3TJEH 4IDLA 5HVHC 5DUBB 2E7HA 2YD8A 4BKLB 3RI5K 3DVGB 4H1LB 3VXMD 1TCRA 3EDEA 5B39A 2G75A 4GRLD 3EYVA 4JHAL 4PIRF 3TO4C 4JAMA 1XGUA 3QR2A 4EIZC 3RVUC 3UTPE 4JPWL 4UDUA 2DKSA 2J88L 3WIFA 2BRRL 5EG6C 3R8QA 1PY9A 5B39B 3VXPA 2G75B 2OK0H 1BBDH 2A83A 2NW3A 5F8QC 4UT7H 3IFLL 5L2KA 2IPTL 3RNKB 4R7DA 4UDUB 3TPUA 5AD0B 1INEL 2XA8L 2VZUA 4HT1H 3JBG7 4P4RA 5GPRA 3VXPB 4JFHE 3SDCA 4K8RL 5GZNC 3NA9H 2OMBA 1Q0YH 3TPUB 2EYSA 2Y1VA 2EDTA 3H9SE 5F9OH 5BO1L 1JHKL 4JANA 2L7UA 4L3ED 4P4RB 4X8JB 4GRWF 2WQRA 35C8L 3TP4A 4MB5A 5FGBC 5IKCA 3QUKA 4PS4L 4WEBH 5JHLL 2FO1A 3HZKA 4HMEA 1M71B 4YXKL 2EYSB 2E27L 3AREA 1P5UA 4JRXE 1TETH 3ZO0A 4CU8A 4JANB 4QLRA 4TVPE 3ARFC 4NQCA 4JQXC 1A4KA 3S5LA 1FC2D 5IKCB 4OUUA 3QUKB 1JMZA 1G9EA 2NXZB 1G6RH 2GJ6B 2G9HA 4IDJL 4OD3H 3MCKA 4EQ3A 3IGAB 1NFIA 3HZKB 1SMAA 4RMWA 2YWZA 4YWGH 2VXUL 3AREB 3O4LD 3RKDC 3C8DA 3NZHL 4I3SH 1HQ4A 4LLYB 4NQCB 2ICWJ 3S5LB 4KQ3L 4LMQI 2UY7A 3AVEA 5C3LD 3D0LA 4KZDL 5CILL 2W91A 4I3RL 2G9HB 2QQKH 3MCKB 1IGFL 3THMH 1P4BL 4NUJA 2OZ4A 5D7IE 2YWYA 3P0GB 1LEKA 2NZIA 4P48A 3C2AH 5D7JA 1HQ4B 3WS3A 4AG4H 5EZIH 3T3PE 2AK4E 3BPNB 4NP4L 5D93C 4G59A 3HNSH 4DGIL 4WO4B 4XBPA 1IAOA 3GMPA 5GGUA 1NCAH 2VWEC 3WS3B 2DLGA 1HNFA 3LQAH 2AK1L 1J9CT 4BZYA 4P46C 2AEPL 2EXYD 4RRPA 3TCXA 1XF1A 4M5ZL 1UH4A 4MAYA 2ED7A 4G80A 4XBPB 1DQDL 1IAOB 4N8PA 3GMPB 4NNYB 5GGUB 4MVBC 4LOUD 3QZWG 1OCWL 4X7SH 3CDGA 3BN9D 1JPFA 1ZOXA 1AI1H 4GLRI 1MHPH 4HGMA 4XH2B 4PJHF 5DD1H 3V4VL 4S0UC 2OP4L 1T7YA 4G80B 2XQYG 3RZWA 1S7XA 3AU1A 3PGDA 3B3IA 2Y5EA 1U6AH 2V2XA 1NUGA 2GTWA 4PJBE 4R0LB 1U3JA 5F71A 2PTVA 1NBVL 2QKIA 4PLKD 3NVQA 5KW9H 4XVTL 4P2RD 1U8QA 4X9IA 3V0WH 3S3JA 2BOCA 1QSEA 3AU1B 5E95B 3PGDB 1FPTH 32C2B 3B3IB 1KPVB 4ZOAA 1L6XA 2V2XB 4HUVA 2A9ML 1RUAH 2R4RL 2Y4SA 1JHTB 3BH9A 1GSMA 2GY5A 5GGTA 5CS7A 4D0DA 4AL8H 1F45A 4YHOL 1EAJA 1E6OH 2F5AH 2BOCB 3W82A 4MJ5A 1TMCB 3TT3H 2MPAL 1TQBC 1UB6A 5GISH 3VD3A 1MRCH 2E7LE 2NY7H 1ZLSL 1OGAE 2R69H 1ZWIB 1BGXL 1QR4A 3QUZB 1B2WL 4D0DB 1F6AB 4X4MA 5DO2D 5CP7B 5F6HI 4I8DA 3DO3A 4GW1A 4P4KD 1XGQA 4QRPD 4P2OA 2OR8A 4S1SL 3WIHA 4OV5A 2XXMB 3C6LC 4KK6C 4M7JL 2ZUSA 2OL3A 1UB6B 1YEGH 1I1FA 1WEJL 1CD9B 4BQ6A 4OIBA 1DE4A 2E9IA 1S9YA 4GW1B 1KJMA 1HYSC 5MERA 1XGQB 3U9UA 5GRJL 4QHMA 4OV5B 2IH1A 2I27N 1V7NH 2OL3B 1BZ9A 4U1GB 4UT6H 1T66D 4UOJA 4X4ZA 3QDJA 5AUMB 3BT2L 1FFOA 3FQWA 1I1FB 4JY5L 3MXWL 1K8DA 3EJYD 1DE4B 1AD9A 1PY4A 3RAJH 1KJMB 3MCLL 3U9UB 4QHMB 4M1CC 2IC2A 4GW5B 1Y6NR 2AEQL 3RP1A 4G9FE 3ETBF 3QDJB 1KCKA 1FFOB 3FQWB 4LAQH 4LVOC 3MGAA 1K8DB 1KJ3H 2VNCA 2ADJA 3LHPL 3WJJA 4PJHE 2ZCLL 3NTCL 4DEPC 4YR6A 2R2CA 5J6GA 4HUNB 2P8LA 3AM8A 2BY0A 5H2BA 4FQIL 3T2QA 2CDGA 4OLUL 1QFOA 5HHOE 3WO3B 1ADQH 2ADJB 5JR1L 5H35A 4NFCA 1Q9OB 1JPST 2RFXB 4JO1L 3QIWC 4NQSA 3QWQB 4YR6B 1VADA 4F7MB 4WTWA 4TVPL 4GG8B 3EFDH 4XP6L 4IOFC 3EYUH 1A9EA 3QJHA 5J6GB 3PWPA 2P8LB 5H2BB 4FQQA 1MJUL 1RZJC 2X41A 3LRSA 4AM0A 4OLWH 5GJTL 2BFVL 3O11B 4I2XE 1EZVY 4NQSB 1A7PL 2CO6B 2EIZA 1VADB 1NGQH 5TE6H 3V0AC 3QDGA 1A9EB 2YMXL 2MSPA 5TF1H 3PWPB 3WIIH 4FQQB 4A2LA 1SBSL 3LRSB 4AM0B 5IOPA 1NKOA 3C9NA 2L0DA 4U2YA 5A3ID 5FUOH 5HYQA 3MYZA 4GRWH 3TESA 1MCRA 5DRNB 2CMRL 5E2VH 1OTTD 2EIZB 2GAZA 2EH8L 5HHXH 2ZKHL 3CK0H 1INQB 1FP5A 3HLAA 5F88B 1A6AA 4G8GA 3QDGB 3KJ6L 4U49A 4ZUTA 4LSTH 3MACH 2A77H 3SJVD 2F5BL 3MLRL 2ZZUT 1YYMH 5HYQB 5LGHH 5JZ7C 2GAZB 1F3DJ 3S4SB 3MRLA 5J6HA 4PJFA 3Q6GH 1JWSA 4G7VH 2VAJA 5GSVA 3TBWA 1RQ5A 1A6AB 1YPZB 5HHNA 2YHGA 1G6VK 2QTEA 1BHGA 3PL6D 4BQ8A 3B5TA 1QBLL 3AROA 3WDIA 4XI5C 3QO1B 4HWBL 4MLIA 3GRWA 3QHFH 3NFPB 1VA9A 4OZGF 3NIGE 3CUPA 1FBIH 4PJFB 3VRJA 1JWSB 5GSVB 4PGJA 5J6HB 1Z5LA 1VESA 5SWQA 3KS0J 5I1KH 5HHNB 3RGVA 5FAAA 5DFWH 1JGVH 1YDPA 3PWJA 5F1SA 3T77A 4N8VB 2A6JA 5CCKH 5HDQL 3CC5B 4XRCA 4LASL 1LNUB 5HPMA 1CDUA 2HH0H 3CUPB 1Z5LB 5J7CC 3TJHA 1X5ZA 3RGVB 5HVWA 1MCSA 3VD4A 1YDPB 1KB5B 4DZ8B 2NY4D 5IB5B 3A6BH 3MBEA 4XPHH 3O6ML 3CH1A 1N7ML 5HPMB 5K59F 4WEMB 2HT2C 1XAUA 4PRIE 4JGMA 2I26N 2VDNH 3VG9C 1G9MH 1UC6A 4UV4L 2L7JA 3MBEB 3U4AA 2DBLH 2VL5B 3CH1B 4N5EA 2J6EH 4PGEB 4HXBL 2YSSB 5C0CD 3ISWA 3VXRA 4B5EA 3LKRA 2MQ0A 3UDWC 4BZ1H 5J0BA 3MLWH 4B7LA 1JF6A 2JCCF 3F7YA 1JGLH 4PRHD 1MCHA 3MPCA 1S7VA 2VZ1A 3QRFM 1UH3A 1XR9A 4UOW1 4YO0A 5DVMA 3DSFL 3VXRB 5IW6A 3HI1A 3LKRB 3Q5TA 4HUWA 1NBYA 2UZIH 5GGSY 3F7YB 4PY7A 4X7EC 5E2TH 3REWA 1EUUA 5B3JE 2ADGA 1S7VB 2CKBB 5ALBH 4UTBH 1N4XL 2DQGL 4YO0B 5IW6B 1G1YA 2ADFL 3RU8L 1E6JL 4HUWB 1XGTA 1NBYB 3TO4D 3DHJA 1MCWM 1RZIA 4YDKL 4LEOB 4PY7B 3RVUD 5FUCC 3REWB 1MCLA 3TN0D 4U6XA 2V17H 5C07D 3OPZH 2ADGB 3LCYA 5ISZE 4MNQE 2Q7YB 1JL8A 4OZGE 4IMKC 4E42A 4D9RE 4CJ0A 1BD2A 4K3JH 1XGTB 1YECL 4YE4L 5DHVH 3HZVA 4MJ6A 1EGJA 3LS5L 2FHFA 4YPGA 1YUHB 3PDDA 1AO7D 1RZIB 2YOCA 1BEYH 2UV3A 4PLNC 5E5MA 3WNLA 3E6FA 5KAQF 4E42B 2VDQH 4OD1L 4OCSH 3ULVF 1BD2B 5FHAH 3HZVB 4MJ6B 4YPGB 4Q6IA 3TEUA 4H5SB 5GZND 2KH2B 2CR3A 4GS7B 4LLDA 3BISA 5DC9B 4U6TA 4UZGA 5E5MB 2CUHA 3E6FB 3O8XB 5DJ0A 5EU7E 5TE7H 1B90A 3IJYA 3HNVL 4PJDF 4F8QA 1FN4A 3NIDE 3HMWL 5MP6H 5CAYB 5I1GL 4DZBA 4WGWB 1TJHL 3O9WB 4Q6IB 3M45A 1FZMA 1G7IB 2R9HC 3PDOB 4P5MB 5CSZB 5IMOA 4LLDB 2WBJD 5L9DL 1PEWA 2NR6C 3UP1A 5DJ0B 4XPTH 1I3UA 2IPKA 3IJYB 3QXWA 1GRWA 1X7QA 1MNUH 4FQLL 4YBHA 5INDB 4DZBB 3VW3H 4I0PC 4X7TA 5EBWA 2JCCE 3O2VL 3T0AA 2OSLA 2R1WA 1MFCL 5HGAA 5GGRA 1IMHC 2FX7L 3RKDD 2UUDK 5ID0A 3VGAC 1OLZA 3BQUA 3SKNB 3HZYB 2IPKB 1CFNA 3H3PH 5DEGA 4P2QD 4YFDB 1X7QB 1A6VL 4XPGL 3TLRA 4X7TB 1FL6B 1Q72L 5EBWB 3A6CL 4LQ1A 2X4OA 2OSLB 2R1WB 5GGRB 3QWOA 5GS0C 2F54E 4GG6F 5ID0B 3V7AG 3BQUB 4NWUL 1J18A 1CFNB 5DEGB 3G5YB 1A1OA 4OLEA 4FZEH 3OB0H 1N6VA 4KXZH 3T0EE 4LPYA 2Z31A 3HPJA 4GAJH 2IAND 5DJ8A 1E27A 1ZLWH 2ZSWB 5A1AA 2W9EH 1FYHB 1NKRA 4EUPB 3KPRD 4WI3A 3TYFA 1WT5C 3LOWA 3UYRL 1GIGH 3ZDXF 1G9NL 2FX8L 1A1OB 2FATL 5CBEA 5FCUH 3HPJB 4P46D 3T4YB 3LKQA 5DJ8B 4DKEL 4P5TB 5ACZB 4PRPD 5F96H 4F37F 2EDJA 1S7WB 3DI3B 1CFTA 1G0XA 1CXEA 1IGIL 1MOEA 4NC1C 5D70L 5A2IH 2ZG3A 1W8OA 4F7TA 2B8OT 2VDML 3TIDB 4GRLB 5C0JB 3ULVE 5DVNA 4FRWA 2I5YL 2V7NB 2JE8A 1HIMH 1CFTB 4Y5XC 1J0JA 1CFSA 3OAZK 3P40A 4NHUB 4NUGH 3TBVA 3RUGA 25C8H 2YD4A 3FRPG 4RGOL 4ZUVA 1UENA 2J1KA 5LBSL 2ZOLA 3DIFA 1UXSB 4Z9KB 1SJVA 3WUWA 3CFEB 5EUKA 7FABH 4OI9A 5D7SH 4JY6A 3NCJH 5I18H 4Y4KD 1IM3A 3C6SA 3TBVB 3RUGB 4PG9A 4KJPC 1RFDH 3I6LD 1LP9B 1TJIH 1F90L 4GLRH 1R5WB 3DIFB 3BO8A 3WUWB 4U7KA 1WC7A 2EICA 3OKEA 1KCUH 1U3HD 3C6SB 4JG1H 2GI7A 4PG9B 3VD7A 3IETA 4P3DB 4HBQA 3CSGA 5KVMC 4PJ7F 4YHKL 2W9DL 4D3CH 1LO2L 3UCRA 3BO8B 4X80L 2WLZA 3HCVB 1WC7B 3C6LD 4XHQA 4KK6D 3G5VA 4YX2L 4BQ9A 1FL5A 2JTDA 5E7FA 3GNML 3RPIB 3BIKA 4GMTH 2WIIA 3IETB 3MRPB 2W60A 1FG9C 1QSFD 1HYSD 4HGKC 3O4LB 4MNGE 3VFVB 5L2KE 5KAQG 3G5VB 5KS9B 2DOCA 1FL5B 1I7UA 5EC1A 1CXIA 1CD0A 5SV4A 3BIKB 2NY0D 2G60L 1EFQA 3ZDXE 4MDIA 5FYKL 3T8XA 1DQMH 2W60B 4UB0L 4M1GL 3QNZB 4M1CD 4PJGF 3RY4A 2QSTA 1I7UB 4QY8A 4IBLT 5F93C 1T7ZA 5DRXA 5C6PB 3F58L 4KRPC 3ES6A 2CR6A 3S9DB 1K4CA 1VPOH 4MDIB 3RA7L 4J2XA 3T8XB 1WSST 1F4AA 3QHZL 3GHEH 5E94A 2DKUA 1EEZA 4MYWB 1CGUA 2D03H 4QY8B 5DRXB 5L0QB 2OYPA 5IVXE 3BOVA 4WW1B 2ITCA 3ARTA 1LO0L 1T89A 4HS3A 4LRNL 5D6CB 4LRIC 2CDFA 5LVEA 3QIWD 2V5SA 3C2SA 1EEZB 3HUJA 1QLEH 3OHXB 4WIQA 5JO5A 2VXQL 4IOFD 1MCFA 1MAMH 5EBMA 1X5XA 3MROB 2APTA 3NPSC 4HS3B 3K4AA 3PQYA 4HC1H 4HFWA 3DI2B 3JWDH 5KOVC 2Q7NA 2CDFB 2ZJSH 1RK0A 4PJXA 2Y07H 3K1KC 4XCNA 1PYWA 4PB0H 1CDYA 2ADIA 5JO5B 4LSSH 3MOBL 3BP5A 4L4VA 2GTZB 1UZ8A 4TYUA 2HTKD 3PQYB 4HFWB 5A2FA 5F7KC 1T83C 1U92A 4JFYA 4P23C 4LSQL 5E9DD 2WZPD 5B8CA 2G5BA 4PJXB 3D3VD 1F6LL 1NFDB 2ADIB 2IF7A 4JN2A 3GSWB 4XMPH 1ZXQA 2CPCA 3IFOB 2IJ0C 3BP5B 4L4VB 3PWUB 1UZ8B 3IJHA 4LBEA 1UXWA 4QNPF 2XTJE 1U92B 4LPCA 4WHDA 5JZ7D 5B8CB 5HY9B 4OQTH 3CFKA 3PNWA 4BQBA 4FXKA 1RZ8A 2NY3B 1K5NB 2Y72A 4QRUB 1RJLB 3U7YL 3QCUL 1ZV5A 1QBML 5DZLA 4G8EA 2XN9A 3IJHB 3R0NA 4LBEB 4W6YB 4YHPA 1I4FB 2EC9T 5KVFH 4K2UH 4P4KB 2BCKA 1EMTH 4XI5D 2OI9A 4QHUB 3CFKB 3PNWB 3EBAA 3RQ3A 5E1AA 5L6YL 8FABB 3N9GL 3MRQA 4CU6A 4HJGA 1VGEL 4BA8A 5J9PB 1P4LA 4DQOH 5CIPH 3ULVL 3C08H 1MCNA 5D71H 3WS6C 4YHPB 3ZKXC 3IDXH 4BH8A 2BCKB 4OI8A 2W0PA 2WNGA 1IQWH 3CLEL 4L4TA 5ABDE 3FFCD 1DQLL 1HOCA 1QSEE 3MV7D 5E1AB 5B38B 2YD3A 2IFFH 3MRQB 5DZOA 4XP5H 2AI0L 3VXOA 1CLZH 2ESVD 1DL7L 2B0SL 3DX8A 4BH8B 2VJXA 2VABA 4K8RC 1BIHA 1UQSA 1FYTA 1HOCB 4OZFG 4FXLA 2HT2D 2IAMA 4NRYB 1MAJA 4Z7VE 5J4MA 4CVZA 4F7CA 3VXOB 1SEBA 3F62A 1A7RL 3VG0H 1QP1A 3TGXA 1N0XH 4WGVB 2NLJA 3DX8B 3S35X 1EX0A 2HKHL 4X4ME 3MLSH 1IL1A 4S1RL 2VABB 5ETUA 4HQQH 3UPCA 1YC7A 1UQSB 1A02N 2IAMB 1MQKH 4CVZB 4AEHH 4F7CB 4M9OA 4NQVA 1SEBB 1MHEA 1FE8L 5KZCD 5DSCA 3LS4H 4BQCA 4PTUA 3RWFA 4ONGL 2ZP0T 2AJVL 1F58H 1IL1B 5IROA 5ETUB 2UUDH 3U82B 3ALWA 4UINL 2UVFA 5BJTA 4WW2A 4NQVB 3QIBC 4QRSA 5F72S 3RJQB 3HE7C 2YD5A 1KLUB 1KV3A 5KN5A 2XPGA 1U8HA 1S7UB 3RWFB 4C56D 1KN2L 2I9TB 4JKPL 2JJWA 3FOLA 5LWYL 2BHUA 4ODTL 5BJTB 2BXYA 4WW2B 4QRSB 4AMKL 5GRZA 2FSEB 2AXJA 4LEXL 4PBXA 1T21B 4OZFH 5KN5B 4DK3A 1M7IA 2XPGB 1CFQA 1WGOA 1C7TA 4QT5A 3FOLB 3ZT7A 1BQHA 3EGSB 2PO6A 5CINH 1EERB 2FZ3B 1A7BA 1AE6L 4ZAKA 1EFXD 3ESUF 5C71A 2KQNA 4BFEA 2EC9U 1CFQB 4TQEL 2DLHA 1UM6L 4MXVE 4KVCH 4QT5B 4G6KL 2H32A 1BQHB 2PO6B 4NRXB 4I18A 3N1MC 1A0QH 3M8OL 2FBJH 2IPUK 1MCDA 1QUNA 4ZAKB 5C0BD 4G6ML 1KBGL 1INDH 3QWRD 2APXA 3UZVB 3IFPA 4OZIA 1T2QH 3MX0A 2YUZA 3D9AL 4W4NA 4QRRA 4CW1B 2H32B 4NJ9L 1XF5A 3SGDI 2BC4A 3P30H 4F58H 3SE3A 2MTPA 1P69B 4JM4H 4OFYA 2K3TA 4QOKD 3ABZA 3CVIL 3LIZH 2NNAB 2LVEA 3IFPB 5JORA 4OZIB 2R9HD 1IFHL 2OZ4L 4XVSH 2NR6D 4QRRB 2VLJA 2AJYL 2VDOL 1XF5B 3BRDA 3PP4H 2BC4B 2NY4B 4G8GE 3N1PC 4I0PD 4R4FH 1T6VN 2JJTC 2VB5A 2EDLA 3QEQE 3SCMD 1JNHA 4RFOH 2JF1A 5D6DC 1TZHA 2CQVA 3G6DH 2AABL 1S5HA 1RIVH 4UTAL 3VWKC 4OGXL 5HHMA 2RCSL 4Y5VA 4XTRC 5IW1A 5IIEB 4ZODA 1CLYL 5E2WH 3UBXA 3BKJH 4V3DB 4QXTA 5E4EC 3Q2CA 1ZANH 1J0KA 4R96B 4GMSH 4M7LH 4X98A 1C1EH 1JNHB 1GGYA 1OM3H 5BMFH 5GS0D 1S5HB 1A5FL 3MCG1 3NFSH 3NIFE 4PG2C 5LAXB 4EBQL 2VDPH 4MA7H 5HHMB 1AR2A 4NQDA 5IW1B 2JELH 3BIAX 3FB5A 1X5FA 3FQUB 4K23L 4R90H 3UBXB 4FQCH 1XEDA 3FJTA 2HT3C 3SQBA 4R26H 5DR5L 1FFRA 3KPNA 1AGFA 2E9BA 3C09C 3GIZH 1AFVL 2VKWA 4WI6A 2IH3B 4NQDB 5JOFA 4XPBL 3S88L 3KXFE 3FB5B 4N68A 1H5BC 3HKFA 3RWGB 5I1IH 3DYPA 5HVHB 3D0VA 5KANG 4JFFA 2FD6L 3HFML 3KPNB 1AGFB 2WBKA 3EOYG 4OM0H 5GHWH 5AEAA 4EXPX 4XAWL 1ZHBA 3OKLA 1B6DA 5JOFB 3T0WA 4J3WA 4PP1C 3VGHA 5GGTL 1ITCA 4P59H 1AO7A 4WNQA 3PABA 3KPQB 2VZVA 1LMKA 5C07B 1AC6A 4JFFB 5FIEA 3CH8A 1OW0A 4HIHB 4RISL 4FQ2H 3JTCA 4G8IA 5CZXC 1QFWL 1MQ8A 1J8HD 1U8NA 1VHPA 1ZHBB 3OKLB 1MI5D 4HH9A 3GDBA 1LO3H 1C08A 1J5OL 1AO7B 1H3VA 2XNAA 3GSNL 4WNQB 5F6HJ 1UM5H 3PABB 5FYJL 5A2JH 3WIHL 1UEYA 3WLWC 1CL7H 5EO9B 5HHVL 4G8IB 2VQ1B 1U8NB 2JJUA 4HH9B 3RHWF 5BRZD 1X5GA 4KJPD 4LHUG 2COQA 3ZKNC 4QXUH 1F3JA 2XNAB 2ZG1A 3JWOL 5CZKA 5ICYA 5F89A 1UA6L 4M03A 3KLDA 3H0TB 2ORBH 1C5CH 4GQPH 4UNUA 4JRYD 4KK8C 3ARFA 3OQ3B 1M05B 4JQXA 1OTSC 5I74B 4YHZH 3LD8B 3LH2H 3RRQA 2P1YA 1EJOH 3P4MA 2ICES 3ARFB 4WFGE 4PJIA 3HB3C 1L7TH 3OAUL 3IJSB 3GSOB 3OTTA 5DXWA 5DEZA 1AGEB 1X5KA 2AK1H 1Q38A 1JZ5A 2V5YA 3MRDA 1D5IH 4NO0D 1Q9LA 3QXVA 4YXLH 1MY5A 4BSVA 4JM2C 4RX4A 4E41D 4X4XA 1HH9A 4PJIB 3VWJD 4P2QB 3ZYZA 5JOEA 3L7EA 5TPWH 1OPGL 3AY4C 1B9ZA 3BRGC 1F4HA 1Q9LB 1BJ8A 2JKXA 4C4KT 1O7SA 3A67L 4BSVB 4OGAC 1HH9B 4K9EC 1FFNA 3BEWA 3L7EB 4KRPD 3KLHC 2H2PC 5HDOA 5KSAC 3MLYH 1Q0XH 3U0WH 5I76A 5BVJA 3B5HA 4LARL 3I50H 4QRTA 1AJ7H 2C26A 4TTDC 4MVBA 1CDBA 3CXDL 3U30C 2X7LA 4HWZA 3GMOA 2AQ2A 4HAGA 4M6MH 3PHQA 3OZ9L 4DJMA 3G9AB 1MRDL 4P46B 3WJLA 3GI8L 4NO5A 3OJDB 1I1AA 4MB4A 5I76B 5BVJB 4PRPB 1OAZH 4BUGA 2W0FB 3P73A 4QRTB 1F4XL 1KC5L 1T3FA 3RL1A 4KJYA 3LEYH 3ARDC 3RL2A 1EEYA 2X7LB 3MRGA 1OT1A 1PD6A 3GMOB 4HWZB 4P9MH 1AGCA 2WIMA 1DBKL 3PHQB 4N0RA 1GOFA 1CF8H 1MWAL 3D48R 1NJ9A 4U3HA 1I1AB 4AH2A 4F57L 3P73B 1CXFA 2VLKE 4TUKH 1UACL 4PLJC 2QQLL 3SE9L 1CGSL 1IAIH 1T3FB 3RL1B 5KTEH 1BREA 2LTQC 2FO4B 3RL2B 1EEYB 5FCSH 2V5RA 4NFBA 3MRGB 4DCQA 4Z95L 1EHLH 2LAAA 4M4PA 3QHTC 2E7LC 4J1UB 3DGCR 43CAB 2J3SA 1BF8A 2IPUG 3BUTA 3QSKB 1FC1A 4P23D 3V4UH 5T5NG 3QNXA 5JHDE 3BX7C 4DCQB 3UO1H 1A7NL 1ETZB 5H94B 2P5WA 3DRQA 1FNGA 3DGGA 3MJ6A 4WFHE 1YEEH 4R4BA 1MFEL 3WXVL 2CRZA 3S6CA 3BKMH 2OTWA 3QNXB 3D39E 3DX7A 2P4AB 4NQED 2P5WB 3DGGB 5HYJE 3MRCA 2P45B 4R4BB 4I4WA 1RD6A 3F5WA 5HD8C 3C6LB 5CD3B 2HRPL 3KJ4C 3MJ9H 4RNRA 3DUUB 4TULH 4ERSL 5D2LF 3S35H 5CWSA 4KJWC 3QDMD 4ETQA 4CN4A 4XB7A 3F5WB 1QSFB 4ZUUB 5D7LD 5L88L 2IQAB 1R3JA 4FFVC 4RA0C 2W65B 4L3AA 2WUCL 1T0MA 2R0LL 4XCCL 1RURL 4Z7NF 4EDXA 4PJ5A 2VAAB 2RHEA 5T1DL 4G3YL 3PWVA 3HMXL 4HW6A 3HC4H 2AW2A 4ETQB 5F7EH 1QLRA 4HPYL 1KCVL 1VACA 5K9KB 2XXCB 4JHBA 3KGRA 4HK3J 3WKMH 1R3JB 2ZNWA 4K8RD 1X6NA 4MJID 1SY6A 1SYSA 3GK8H 4EDXB 5EUOA 3ALPA 4LVOB 3PWVB 2AKRA 4GXUM 1OP5H 4NBYB 2GCYB 3BSZH 2FIKA 1QLRB 4X6DF 4DEPB 4OCYL 2C9AA 1KLFA 4XP9H 3AFLA 3WSQH 1VERA 4XPAL 4ZUWA 3CFBA 4IRJC 3ULSA 1YNLL 4JDZA 4L4JA 2DQUL 1A6ZA 2RGSA 1V5JA 1E4WL 1CFVH 2FIKB 3QIWB 5EU3B 4AEIH 4UIKL 5IGXL 4EOWH 2CKNA 3QIBD 5DD3H 1A6ZB 4CRPA 2JB6A 4XX1G 3HE7D 3QRGH 2GT9A 4NT6A 1NGPL 3F12A 1EGJL 4RGNE 4PJ8A 5CKGA 1KEMH 2DJSA 2Q8BH 3D3VA 4K9EH 5JW4Q 4RWYH 1CYGA 1YEJL 1A21A 4DFHA 2MCPL 5BS0A 3G6AA 5C09A 2JB6B 1Z9LA 2ZUXA 4K3HA 5AG8A 3EYSH 4XWGL 4PJ8B 4ZFGL 3TIEB 3D3VB 3WD5H 3DMMC 3GSUB 4DAGH 1NLDL 2ZCKL 4JHWH 1D6EA 2GSGA 2GUOA 3LKPA 5HBBA 1DBML 3MLZL 3OKKA 3G6AB 1EPFA 3TT1H 5C09B 5ID1A 1G9NC 3K2MC 1IEHA 3K1DA 1IM9D 4G9DA 2MNUA 1FFQA 1KT2A 3MRMA 5SX5H 4XNUL 1D6EB 2GUOB 3LKPB 4HX1B 3HUJE 3OKKB 1K3IA 1ND0A 3QAZC 5DJCB 2ZCHL 4P3CL 2A0LC 1R3LA 2R8SL 1F6FB 4DVRL 1KT2B 3UXFA 1OGTA 3MGTA 4QXGH 4LHUD 1C5DA 5I8OL 1ND0B 2OM5A 1M7DA 3GO1L 4OZHF 3V6BR 4OT1L 1FAKT 1R3LB 4V3EB 3UTSD 1UWXK 3IXTA 2HN7A 5IESH 1OGTB 2AXGB 2C4FU 3MGTB 2YPVL 4BJLA 1T22A 2X9XA 1C5DB 4H20L 1M7DB 4MXWH 2Y06L 4Q0XL 5C08A 2DQJL 1YJDC 4EIGB 3D87B 4PJEF 1U8IA 1JPSH 3IXTB 4MZ2A 2HN7B 4LQFH 3ZT5A 4GXVH 2VXVL 4F9LA 1JUFB 1T22B 2OXHA 2FBOJ 3GHBH 4XTRD 3GMLA 4YH6A 3OF6A 4Q6YA 2Y7QA 5IFHH 2DIAA 5C08B 3IRZA 3SEPA 2HT4C 3JV0A 2XN9E 3SGDH 3VXSA 1RIUL 1IC7L 1NGXA 3I6KB 4Y4FA 1U91A 5CUSL 4KUCF 4ALAH 4LHQB 2I60L 5DMJB 3RJDA 5EIIA 5ESQA 3DXAE 2F9BT 3CVHL 4TUJA 2Y7QB 1TITA 3RBSA 1VEPA 1PG7X 2HT3D 1AKJD 3VXSB 3U1SH 1ACZA 4UUJA 3QEGH 5IK3A 1NGXB 4U1LA 4FP8L 1MSPA 1IJ9A 1U91B 4Y4FB 5EOQH 3ROLB 3UTPD 3ULUE 4L4TE 3DARA 1JCKA 5MEND 3O81A 5EIIB 5ESQB 1D6VL 3T0XA 3JV6A 4TUJB 3TNNA 5ITFA 5J1AB 4NNXA 2DF3A 4JG0L 4C56B 5HI3C 2XG5A 4NNPH 4AQ1B 5IK3B 4U1LB 1FO0H 3GB7A 4KU1A 2A6IB 2XWBA 4TSBH 1FYTE 1J11A 3W81A 5GGVH 4L8BA 4PP1D 1NGWA 1JZ6A 3TNNB 5GRVL 2VR9A 5ITFB 1R3HB 1J8KA 4HKZA 4UNVA 4LCYA 1W8NA 3SDDD 2J8UF 2BSRA 1FCGA 3GB7B 2XWBB 4OFPA 5CZXD 5EU7C 1KIUA 1U95A 2LAGB 4L8BB 4EI5C 1JF5A 1EV2E 1NGWB 2EKSA 5ALCL 1BQLH 4LGPB 1KJ2A 1F2QA 3QWRA 1UKQA 1C7SA 3N0PB 2CRYA 4OZHE 4HKZB 5K9QI 4O02L 5IV2A 3EO1B 1KELL 1TLKA 1UJTA 2UWEA 3WLWD 4HIIA 4QKXB 3ZMRA 3HI5H 1UYWH 2H8PA 4JFDE 2BDNL 4TVPD 1ORQA 1U95B 5E24E 4AIZA 1DVFC 2XV6B 5DK0B 3LPGA 2GW5A 3HN3A 4OCWH 5C0BB 1WQVT 3ZKND 4YEFA 2AGJL 1KJ2B 1OB1B 4PJAB 2C1OA 4DOHE 1IVLA 2ED8A 5EO1B 2Y5TA 3BE1H 5JUEL 2H6PA 2J12B 4HIIB 3C8KB 4MD0A 4KK8D 4M6NL 2H8PB 3MLVL 4ODBD 1TVDA 4AIZB 4FQPA 1OTSD 4QOKB 4D9QE 4MQTB 1AY1L 2C1OB 2V9TA 5IMMA 2ENSA 1QFWI 4GAGL 2Y5TB 2Y25A 4KFZC 3LEVH 4MD0B 3HE6A 3EYFA 3SDAD 1MCPL 3HB3D 1QSZA 3LV3A 5KVDL 1HK6A 5J1SC 4LNRB 2QR0A 3T0EC 15C8H 5IMMB 3HG1A 5EOCL 1WLHA 4X9FA 2VDLL 4KGJA 4JM2D 2CXKA 3VGAB 5IBTL 4EJ1C 2FX9L 3SQOL 3V5DA 1T1YA 3FTGB 1ZHLA 4ODVH 2QR0B 2LU3A 5DUPL 5AYUH 4XXDA 4L5FL 2VH5H 3TBSA 4J3XA 4EEEA 4OGAD 2EDOA 1G7JA 2X4TA 3BWAA 4XVJL 3V5DB 1RPQA 1T1YB 3KLHD 3U79A 1S9XA 2H2PD 5KSAD 1ZHLB 4Z7QF 5C7XL 2HJKA 4U7MA 4XCFL 3UZQA 4XXDB 1DBAH 2WV3A 3TBSB 1BQUA 4TTDD 5EORH 2H41A 1V05A 4KK5C 1G7JB 3ARXA 1YYLL 3HR6A 3BWAB 4RQQA 1UZ6F 2IALA 2VLJE 5C0AE 1YJDH 5JPMB 1BWMA 1S9XB 2DQEH 4X6FA 4ODXB 2HJKB 1IC5H 4ELKA 1YQVH 3VFTB 2BJML 3ARDD 4HG4K 4E0RA 1HINH 5D7KE 4RQQB 2V2TA 5JDSA 4CU7A 2OJZH 1KN4H 2R15A 3QQ3A 2KPNA 5C0DA 4HXAH 4IS6B 4ELKB 4RAVB 1RU9L 3ARBD 4OF3A 5IMLA 5LCVH 4NKOA 1ZAGA 4PLJD 2V2WB 5C1MB 1QQDA 1MIEL 4QTHA 3KYKH 4OFKA 4E0RB 1MI5B 2EH7L 4FTVE 3BKYL 4MS8D 3SOBH 3SDYH 1RHFA 2V2TB 4QXWA 1U9KA 3VJ6A 5JDSB 2H9GA 3QQ3B 2AVGA 5HYIA 1JWMA 3HZMB 3DO7B 3SDXA 5L8LB 5IMLB 2AJSH 4NKOB 4C83B 3GSXA 1NQBA 4KZEL 4IHOA 1AQDA 4FQ1L 4QTHB 3TH4T 5BRZB 4GXUN 3WE6A 3BYYA 4BFIB 5LXGH 2H9GB 2RJMA 1FIGL 5CFHA 1JWMB 3SDXB 1T1ZA 4MQXC 4CMHB 3ULUL 5EFIA 5F1OB 4JRYB 3FN0L 3I2CL 3ROOB 4IHOB 1AQDB 2DJ4A 2P5EA 1OAKH 5GS1A 1IGMH 3WE6B 2CK0H 5I1LB 1F5WA 3B9AA 4D9LL 4JFXA 4FFZH 4ZFOA 4O4YL 1EO8L 5L8KB 5CEXA 5HD8D 3SDCC 4OCRH 3U4BL 2AJUH 3ARGA 1Q9WA 2DQHH 5D72H 2P5EB 3JV4B 4G9FD 5FO9A 2N7BA 4KJWD 4Z18A 3GSQA 2C3XA 4KI5F 2XACC 4JFXB 5E03A 4ZFOB 1EHXA 2VLRD 1IEBA 1BVKA 5CEXB 5D5ME 4FFVD 4QEGA 3ARGB 5KOMC 1W2KT 1VEMA 1N0LA 4KH2A 5DD0H 5J12C 3V5KA 5FO9B 1YEHL 2HVJA 3B9KA 2EDNA 4WJ5B 3A0OA 5FM5O 3HAEH 5HHOD 1XH3A 2CUMA 1IEBB 1BVKB 5EPMB 1G7MA 2HP4A 2WP3O 1EXUA 1ES0B 1MH5A 3P9WB 1S8DB 4UILL 1YEFL 4LSPH 5CEYA 1MCEA 1ZTXH 4PGCA 2B4CH 2D7NA 4KRPB 3V5KB 4FG6C 5K9JH 3B9KB 3D85D 4I0KA 5KSBA 4O9HL 1XH3B 3BXNB 1G7MB 2XKSA 2VR4A 3PGFL 3E2HA 1EXUB 1MPAL 4GOSA 2AJXH 5CEYB 1I85C 3FO0H 1GOHA 2EDRA 1P6AB 3QFDA 4S1QL 4IRJD 4OF6A 5FK9B 3QIUA 4GSDL 5D7JC 1GVIA 3DLQR 1A3LL 3MODH 3NABH 5DD5H 5ELIA 2LV4A 1CN4A 1G7HA 2APBA 4Y19A 1PZUB 1U58B 1NSNL 3MRFA 4H1LG 3KPOA 4YXHL 3O2DH 1P2CA 1BX2B 2P49B 3UJIL 4V1DA 2WLYA 3QFDB 3NPSB 3B2VH 2O5ZL 1MFAH 1H3WM 1J1PL 1G7HB 5DQDH 1T83A 4Y19B 4I1NB 3KPOB 3KPLA 4KVNL 4ZS7L 1P2CB 1YNTA 4MAYC 5B39G 4V1DB 4DN3L 1DUYA 3STBA 4YUEL 4NZRH 1FCCA 3ZL4L 5I75C 1CU4L 1HHGA 4P23B 1T5WA 4W6WB 3INUL 1L7IL 3DMMD 3KPLB 4H88H 1GPOL 1YNTB 2OX5A 2ZOKB 5EZOH 2BOBA 4NQEA 3WDJA 4E9LA 4JLRA 1N59A 1DUYB 5CJOH 1NCBL 4ZPTA 1MHHA 1FH5L 1HHGB 1JHLL 1TNNA 1QR1A 1T5WB 1ED3B 5MEPB 4UV7H 4TRPH 4JFZL 4TNWF 2BOBB 4NQEB 5HYSA 3T4AA 4M62H 1N59B 4IMLB 4JFEE 1U8MB 4OB5H 3SGKC 3AAZB 3O3EA 4H1LH 3WS6A 4WUUE 5SV3A 2A0LD 1QR1B 1T1XA 2EO1A 2XZAH 3REVB 2YRLA 2XZQL 4PDCE 4NKDA 5HYSB 2D9QB 4ONFL 4NZJA 3QDMB 2IWGA 3O3EB 3EIFA 1QHPA 2DYPD 1NCWL 3ZKXB 4WTXA 3WFBL 1QSVA 1IGJB 4O58L 1T1XB 5CJQL 3SKJH 3S5LG 5I1CH 4ZFFA 1RUKL 4NKDB 4P2OC 3FHAA 1PG7H 5DWUH 5FDWA 5IFJA 4DGVL 4NKIL 1CE1H 2X4PA 4YBQC 2A73A 2O5XH 5E08L 1L0QA 3ME0A 4MX7B 3IU4L 3DVFA 3JWOC 1KTKE 5EU4A 4X4YB 1WISA 2Y36L 4P3WA 4ZFFB 3WDHA 1XF3A 3SKMB 5FDWB 3TV3L 3BESR 3SGEI 1NCDH 2RAMA 2E6PA 4G6JL 4BM7A 1J1XH 2A73B 4O51A 2HT4D 5J56B 3X3GH 1AIFB 2BVYA 3G6JB 3H3BC 4HHAA 4B53A 2VYRE 4F7EA 1WF5A 4KK9D 2GYSA 5EU4B 1FNLA 2DQIL 2N1KA 1XF3B 3BPCA 1JGEA 2HKFH 1XF4A 5JA9A 4BK5A 1P7QA 5FYLL 1DEEA 4MAUL 4XNYH 4O51B 4AENB 3JWNC 1JN6A 4Z7UF 4O2FA 2CJUL 3IKCA 4HHAB 1X4ZA 1YPZF 4K3EL 4ELMA 5E8OB 4UT9H 2GEEA 5ISZD 4MNQD 3OKOA 3BPCB 3QIBB 4RRPG 1JGEB 4LSRL 1XF4B 5BV7L 4PJ5E 2XTLA 3MO1A 1P7QB 5D8JH 4G6MH 1DEEB 3AM8C 4PJFF 1JN6B 3PV6A 5HI3D 5IB3B 5FYKD 3IKCB 4ZTOL 2C7UB 5FA3A 4ELMB 1G7LA 4YIQA 3I75B 3CFIC 3MNZA 4X6CA 3W9DA 3MXVH 5LJYH 5D1XC 5D2NE 5EUOE 2J7LA 3BMVA 3F7QA 3PJSB 5TH2A 3S3PA 1N5AA 5I8EA 1DBJH 1H3GA 4ODSL 5GGQL 4IRZH 1OAQL 3F7VA 2MJWA 3BZDA 1UWGL 3MNZB 4GBXA 3PHOA 3W9DB 1NMCC 1YNKL 2ED9A 4EI5D 4KI1A 4KQ4L 3VXNB 1G6RA 1OARL 2EE3A 2Z8SA 2BVOA 3BAEH 5I8EB 1FLRH 3E6HA 1BLNA 2EZ0C 1BP3B 5C0RH 4YAQA 3PHOB 3L3KA 1DVFD 4RAUB 2AEIT 1G6RB 2OQJA 4Z0BH 3N85L 2BVOB 1UGNA 1CLCA 3S98A 4DUWA 3FRUA 1H8OA 3EO9L 5GRUH 4BH7A 3IB4A 4YHNA 4LPUA 2VE6A 3E6HB 1QFHA 5AYQA 3X11A 4JO3H 3W0WA 3MLTA 4YAQB 5SWZA 2BERA 3L3KB 4LSVH 4WI7A 2CLZA 3VA6A 2BNUA 5BS0E 2OQJB 3ZSTA 1RUPH 3FRUB 3QPXH 4QO1A 2NY1C 3TF7C 3ZT6A 2YKLH 3WCYA 4XCEB 3NCCB 3VWKA 3X11B 1JFQL 4MD5B 5E7BA 2F54D 3MLTB 3S7GA 5SWZB 2DWEB 1KCRH 1DUZB 1BFOA 4M02A 5CHNA 2CLZB 2BNUB 3RGVC 1F2XK 3T0ED 3EYOB 4U1SA 1GGTA 2UY6A 4F15C 1WUNT 4Z7UE 5FFLA 3CSPA 4PG2A 4Z5RA 3VWKB 3BYTA 2OR9L 2C3WA 3CDYA 1N8ZA 3OGOE 1BFOB 1OP3K 5CHNB 1NC4A 3GMRB 3X3FL 2X89A 5E4EB 3L1OL 2LU4A 4U1SB 2DI8A 4YFLI 3RNQA 3OG4B 4LKXA 1J0IA 2VQUA 4PRDB 5DMKB 1AXIB 3VXQA 1PVHA 1H5BA 3Q1SH 3ARWA 4YHLH 4OIIH 1AKJB 4Y2DC 5DEFA 2NY6C 4LCUB 4WWKA 3RNQB 4LKXB 5ENWA 2QSCL 3MLXH 4KK5D 5GS2H 3C09B 4N5EC 1T4KA 2OL3H 3TCLA 2VC2L 2Z8WC 3VXQB 1IKFL 1H5BB 5JW3L 4Q2ZA 3K4ZA 5AZEL 3H8NA 4LLVA 3X13B 2EECA 1FIEA 1QEWA 5DEFB 4FFYH 4WWKB 5JXAL 3ECBA 2A1WH 3W2DH 3H9SA 5CD5C 1BFVL 5E99H 3H42H 1T4KB 4D94A 3VE0A 3TCLB 2VDKH 1NMBH 5GQBA 1JGUH 1FZJA 4Q2ZB 3EUUA 5ILTH 1PW3A 4OF8A 1QEWB 2IBBA 2MMXA 2YPKA 1G84A 3ECBB 3JVGA 3RIFK 3S36H 1R6VA 1NCCL 3H9SB 4CVXA 4J8RA 4JRXA 2NZ9C 2WY3A 4Y1AE 3VE0B 1GHFH 4R8WH 1T03L 1CT8A 1FZJB 1KIQA 1N64H 5MHSE 3S4SG 2IG2H 3WFDL 2DN7A 4OGYL 3RX8A 4HKJB 2FH6A 2YPKB 1U2HA 2DJUA 4J8RB 4JRXB 1OOAA 3RIAK 2X1OA 1I3GH 3FB6A 1LDPL 5FGRA 1ODAA 4PYHA 4JRWA 4N8CH 4KTDH 2VIRA 4MQXD 3LN5A 1VFAA 1Q94A 3NCFB 3NH7L 4N8VG 5L2KD 1A64A 4FZ8L 1ULVA 1IKNA 4H8WH 4JR9L 5I8KH 1NAML 3MOAL 2AK4A 3FB6B 2X4RA 5GRVK 1FAIL 1UWEH 2DIJA 1CR9H 2VIRB 1N26A 3SDCD 2YEZB 1FVEA 4JM2A 5D7IB 1U93A 1LO4H 1QBBA 1P1ZA 1T20A 1SY6L 2A2QT 1J1OL 5T3ZH 3WFHA 3AY4A 2AK4B 3VFOA 1SEQL 2BNRE 3MLUL 2XWTB 3QJFA 1EHAA 4JPIA 1BAFL 2NXZD 4JM2B 4UBDC 1U93B 5IQ9A 5JLZA 5F21B 2UWEE 4ORZC 1T20B 1S7TB 5ANME 3ARED 3TWCL 5IWLA 4S0TD 1KNOA 4K7PH 1B4RA 4ZMAT 4KDTC 3TFKA 4LU5H 4NQCD 3M07A 3QQ4B 4DKFH 4ZG1A 4YHML 4I9WD 1ZA3A 4JPIB 4N9OB 4LSDA 5IQ9B 5JLZB 1KFAL 2AEWA 2OMNA 3FONB 3TA3A 4ODUA 4PRNA 2Q8AL 3TZVA 2F53E 4FG6D 3AMLA 1CDIA 5KJRL 3BQUC 4QHNA 1MJ8H 2QQNL 3O41A 2P8PA 3GRWH 4OI7A 1FVCB 3U30B 3UJJH 3IDIA 3TA3B 5JMRA 3BKCH 4ODUB 4PJBB 1LP9F 4JO2H 3MV9E 1MREL 1FORL 4IOIA 1KB5H 5D7JD 3B8SA 2Z31C 2YS4A 5CLTA 3VFGH 3O41B 1XCQB 2P8PB 3HG1E 3ARDB 3QCTL 4MCYA 5E2UH 1DBBL 2JB5H 2E7LA 1FG2A 3CFJA 1PLGH 1KCSL 3MRJA 3T04D 1MFBH 1OGAA 4YLQT 3GKWL 3C5JA 1PSKH 1K9TA 2R2EA 3PIQA 1G0DA 3D5OF 1U41A 3V52L 3BI9X 1YY9C 1BECA 4MCYB 1VKXA 4MAYD 5DK2A 1GGCH 1AGDB 1LEIA 1OSPH 2KDGA 1ZLVH 1FG2B 3CFJB 3CFCL 3MRJB 2X10A 4OLXL 1OGAB 1FGNH 1CI5A 4YGVB 3C5JB 4NPYB 5DT1L 3PIQB 4ZOBA 3KAAA 5KS9F 3N1GC 4K3GA 4AIXA 3JTSA 4NM8L 1VKXB 5J3HC 4X99B 4XAKE 5DK2B 5C2BL 3EAKA 1LEIB 3WV0A 5ADPL 4HWEL 1CFBA 4R7NA 4WU7A 4PD4K 3NACH 4CKVX 1HXMA 5E8DH 5IVNA 3AXLA 4KKAC 2YD7A 3B8YA 3JTSB 2HLAA 2CKBH 4LAJH 1ZKAA 5TGBA 1QSED 3VXME 2LQRA 4TSAH 2GITB 1JZ8A 4R7NB 4WU7B 1W72H 2YZ1A 3VI3E 4PJHA 3AXLB 2J6EA 4Y5YA 1V3JA 3LDBC 2HLAB 2DQCL 2Y9RT 5TGBB 1QBAA 4G9FB 1A7QH 5FV1L 1OAXL 2NW2B 3G08B 4M8VA 4PGDA 1MCJA 4MMXC 4JB9L 3P4LA 4PJHB 4Y5YB 1T7WA 4HFUH 4Q58C 1NL0L 5FYJD 2DMKA 1I9JH 4JFQA 4P2OD 2OTUA 5GS2D 3B2UC 4PGDB 4J3SA 1LK3L 4GFTB 4YEEA 4YBQD 1RUMH 2B5IC 4RWHA 3QCVH 2ERJB 5IR1B 5HHOB 2BHYA 4QGTA 5BZDB 2BHZA 3IU3A 4X8XA 5EH1A 1L8JA 4I2XA 4X7CC 3O3BA 5I1DA 2BY2A 5MI0C 4M6OH 4Y8DC 5DMIH 4L3EE 5F70A 1YN7A 1DQQA 4QHLA 4LPVA 3LEXA 1RULH 2Q3ZA 4HG4J 4CNIB 5I30L 1ZHKB 4EUPG 1MFDH 3QDJD 2ZG2A 3N06B 4PJXF 1M4KA 4NCDA 3IU3B 1NFDF 4RGNC 4I2XB 2IQ9L 3O3BB 4U6VH 5A43C 1PEZA 4PGZA 2FB4H 3SN6N 6FABH 4XC3H 1WBXB 4WI4A 3UBXI 1U2CA 2XQBL 3K2UH 4HS6B 1RJZA 4IRJB 1YN7B 2XFXA 4PTTA 4QHLB 1QYGH 2R29L 3QNYA 1EZVX 3HHRB 3V4PL 5F6IC 4PB9H 1YEIH 1ZT7A 1RJYA 4G5ZH 5E4IA 1O7VA 2XICA 2J8OA 2N7AA 4U1HA 1RJZB 5CEZE 2XFXB 4PJCE 4M1DH 4PTTB 3WXWH 4HZLA 4BFGA 1KJ2L 1JYNA 4KPHH 1ZT7B 4K94L 4KUZL 1T89C 4PV9A 3BD5A 2J8HA 3QXDA 4KTEL 4U1HB 1N6QL 5D1XD 4HZLB 4K7PY 1YEKH 3X14A 1K8IA 5DRWB 4LCWA 3PWPD 3KYMA 4H26A 1R3IL 1RIHH 5KSBE 4PV9B 4YFEA 3DMMB 3FFDA 4EUPH 1F8TL 2XY2A 3QXDB 4NM4L 1LEGB 2VZ3A 1CLOL 2J4WH 3CLFH 1G7PB 3K4DA 4GQ9H 1YMMA 3WUWG 3QDGD 5T3ZD 3X14B 5KVEH 1K8IB 4J4PC 5FHBH 3S34H 1XF2A 1OAYH 2R0KH 2X70A 2Z92A 3MUHL 4HK3N 2EZ0D 3S37X 1MIMH 5B8CC 2OCFD 3RZCC 1ZS8B 3QAZB 4PRIA 3T0VA 2E7BA 3R8BB 4G8GD 4POYA 1HSAB 1KENL 1NANI 1RZGA 2LABA 1IC4H 1XF2B 3QEQD 5CJ5A 2X70B 4Q9RH 4ZO9A 2XRAL 3HI6L 4RZCB 2ILLA 1MRFH 4PRIB 1BZQK 2DYPB 3TYGL 1QKZL 1RZGB 4KKBC 4P2RE 3WFCL 5DZNA 3CMOH 4MSWB 1XGYL 1IILE 5T5FL 1JPTH 1A3RH 4WUKH 3GI9L 2VDRL 1RV6X 4KTYA 2OI9C 3IDYB 5T3XE 1AXTH 1YC8A 1GAFL 4NHCH 5I17A 4Z7OF 3P11L 3RGVD 3TPKA 5EIVA 2X4SA 1ZA6A 3NAAH 4NGHL 2BSTA 4Q74A 5DRZA 4U1MB 4WW2F 3ULUC 4OD2A 2NTFA 3O6LH 4TPRH 2X1XR 1KEGL 1ONQA 2L4OA 3WHE0 5I17B 1I8IA 5IJKA 2HFEB 3TJHD 1HHIA 1DZBA 2X4SB 4OLZL 4QRPE 4Y4HA 2IGFL 1V3MA 3HNTL 5DRZB 4OD2B 3V6ZA 2NTFB 4OZGA 4APQA 4JDTH 1A1MB 3OR7A 1I8IB 3TBTA 2WUBH 3C8HA 1HHIB 4MCZB 4NQTA 1EBPA 4WCYL 5C0IB 5DDHA 1LK2A 2NY6D 4Y4HB 1JPGB 3ZE2F 4TOYL 3QQ9C 3SBWC 3JTTA 3FT4A 5ISZB 1WIUA 4Z6AT 4MNQB 4N5ED 3V6ZB 1FLTX 4OZGB 2EDBA 5DGRA 1DFBH 3OR7B 4P2YA 1URLA 3TBTB 1T7XA 1GXEA 1Z9OA 4UIMA 3UC0L 3VXRD 1CBVH 1BFSA 5DDHB 3QA3A 4QWWC 3L3GB 4TNVK 5T33L 3JTTB 5CD5D 4XPFH 4JPKL 3PXJA 5IROC 3SO3C 4DVBA 1SM3L 5ICXB 4OZIF 3WLBB 4HIEB 4NZDA 3UPAA 3F6IA 1I1YA 4UIMB 1P53A 3LY6A 3QA3B 2XG4A 3NN8A 2O61B 4NRZA 3FO1A 3E8UL 4JJ5B 4OKDA 2NZ9D 3ZE1E 3P0VH 1SBBA 4EI5B 4DVBB 1XIWA 4JQVA 3GBML 3MRRA 2NY5H 3AS0A 1R0AH 4ZFOL 2BNQA 2O5YL 2YK1H 2QHRL 2JCCA 4NRZB 4M7KH 1B4JH 4N0UB 2AAVA 5E2JA 1C8PA 1A6TA 2V5MA 1DVFB 4N0CC 4LCCA 4YBLB 3MRRB 4Z7OE 4OCMC 4S10A 2VXSH 3CGTA 4ZDHA 2EIDA 4ZAKC 2JCCB 3LKSA 2K1MA 3EJJX 5BVPL 3GBNL 2DMBA 4X6EB 5JA8B 4OSUH 3RY5A 5ADOH 5CEZL 2F54A 4JO4L 1IT9H 4DTGL 1YEDA 1X4XA 5IJVA 3ERYA 2DQDH 1ACYL 1MCQA 3B6SB 3MRIA 4X6CE 4LCCB 1WAAF 3VDAA 1T5XA 4BK4A 4I18C 2RBLA 5B38G 1RK1B 4ZDHB 3LKSB 1NLBL 1GZPA 1KTDA 1X5LA 1JYVA 5GJSH 2GY7B 5GGRY 3MNWB 2F54B 3VFUA 3U4EA 1P4IL 3UTQA 2D9CA 1YEDB 5IJVB 4MA1C 4JFPA 3SJVE 2R4SH 3SE8L 2W59A 4N0YH 3U46B 4WY7H 2PYEA 1S5IL 3T0EB 2CDEA 1JI2A 1QFUH 1T5XB 2DDQL 4JGUA 4AT6A 2YR3A 3HPLA 4OLYH 3EO0B 4Z77A 1GZPB 2F19L 1KTDB 4UBDD 3MV01 1TJGH 3MYJB 1JP5A 3U4EB 3UTQB 4XP1H 3K7UA 1F00I 4JFPB 1RZKL 4GKSA 5I1JH 4HPOH 4HC1A 4DK6A 4RFNB 1U3ZA 2CDEB