3L3OB

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
184
structure length
184
Chain Sequence
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 26
structure length 184
sequence length 184
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3l3oB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3oB02
3HE6D 4U2YA 3TO4C 3KS0H 3QHTC 1BZ7B 2OJEB 4QRPE 2I5YH 1G7MB 5J6HB 2PYFA 2HKFL 2H2SD 1OM3H 2EC8A 4O51B 3OV6A 5DQDL 2XN9E 2VQ1B 1A3RL 2NXYD 3CSGA 3TIEB 4Z8FL 4I3GA 1D6EB 5DF0A 2X9YA 4W81A 4FNLH 4S1QH 3O8XC 43CAA 4PJDB 2V2XB 5C0BE 5FCUL 1AGCB 2VZVA 5EU5A 2GFBB 1DUYA 3U7YL 4PRID 4YGVA 2PO6A 5HXMA 4G7VH 4PV9B 1DCLA 1N3NB 1P6FA 3BD3A 3RVUD 2ICCA 1HH9A 4MQXD 3OKKA 4C56B 4IRJD 3HMWH 4ZUTB 4BFEA 1G9MC 1EFQA 5D9SA 1JRHL 5FUOH 2HLFD 3VI3E 2Q76A 1MAKA 4XCFH 4FA8A 2WBJC 1B4JL 4RFNC 3MV9E 3GKZA 1MH5A 5FYJU 5H94A 5E2VH 4XNQA 3LVEA 1DQLH 1C5BL 1S8DA 4V2CB 3NZ8B 5C09A 3V0VB 5I9QB 5DJCA 1F4WH 4UU9A 4BKLB 3W9DA 3PDGA 1H0DB 4R90L 4XXCA 2N4IA 3QUZC 1XGYH 2VO5A 3V52L 1HCFX 5C07B 1JWUB 3UJIL 4W70A 5C0CA 1M7DB 4EN3D 3TZVC 1RHHB 5IMOA 4HF5H 2YD9A 2CQVA 3B9AA 3NA9L 4R4FH 4R0LC 4U6VL 3ZHLA 3O3AB 4O4YH 4MXWH 3OGOE 1GZQB 1RIUH 4ZUVB 1UM4H 2OCFD 5CZVL 5T1MA 5DJXA 3HMXL 3VFMA 3HG1A 1DQJB 1YUHA 3U1SL 5EBWA 1PG7W 3GSWA 5IHZA 5MERB 4BSJA 4Y19A 4OZ4B 1RZGA 1T21A 4YPJA 3GSVB 1KCSH 1WLHA 4JY6A 3C08L 3U0WL 2QQNL 3KS0J 3U2SA 1E4XL 2IADA 1H9VA 4BZ2L 4HWBL 4QHMB 5IW3A 2G9HB 1A02N 1ZLSL 4Q9CA 1VGKB 3KR3H 5BRZA 4QTHB 2VLME 5DD6A 2NW3A 1U9KA 3GIZH 1WZ1L 2ATPA 5LG1A 3F7VB 4L4TA 1F6FB 4RAUB 1F13A 5JHDD 3DJ9A 1G9ML 2R56L 3HAEA 15C8L 1LP9F 1IGCL 3K3QA 1TNNA 4X6DA 2ZWLT 1IFHH 1AD9A 2F9BT 3LB6C 4LLAA 3IDIA 3I3BA 3MUJA 5KAQF 2Q7YA 3GMOB 4OCXL 5DMYA 4HWZA 4NQXB 1OWRM 5FM8A 3MODH 4ZUWA 3WHE1 2JIXA 5HDQL 2CDEB 4XP1H 4RIRA 1UJ3C 1INQB 2W0KA 4BZ1L 2IALA 3CPLA 3VXSA 3P4MA 5A16B 4PIRF 3S37H 4IRZH 4L3CA 5BV7B 3O9WA 4V1DE 5FFLA 3S5LG 3W9EA 4J1UB 5SWSD 1ZE3C 1NCCH 2IBBA 4NHCH 3D69A 3VFGH 1PDKA 2R23A 3O3BA 5C6WH 4ELKB 1ZGLM 3IF1A 4LASH 3FMGL 5BVPH 1X5FA 4HKXB 4KZEH 3MO1B 5D6DC 5SX4H 3IFPB 3KLHC 3FQNA 4P48A 1I7RA 4Y4HA 2DQEL 2ESVA 3QUKB 5KG9A 1NMAH 4JFDB 1P7HL 3C60B 1HQRB 2QHLA 1OGAE 1QFWH 1N64L 3TPUB 2CLVB 2H1PH 2RB8A 1V8HA 3ULUC 4X6FB 1P69B 2NQCA 5TF0A 3MJ8B 4KTEH 5HHVL 2IF7A 5BS0A 3KPLA 2ARJA 4YPGB 5D96B 5FECA 3M1BB 2UWEA 4G6KL 1CFQB 2UYLB 4K9EC 5T1DL 3LQMA 4PYHA 3W5MA 3SDAB 1OHQA 2YD2A 1S7UA 3GSQB 1FVCA 5I1EH 2O5XL 1G6RB 1OW0A 3M45A 5EA0L 2ARWA 4BFGA 5D72H 5KANI 2A6JA 1G7HB 1Z5LA 3MXVL 1IM3B 3SE9L 2J8UE 3T0EC 3TH4T 5I1LB 3U30B 1AR1C 2XKNB 1MCPL 2VDKL 4CU6A 5FYJD 2BSRB 3Q6FB 2FB4L 2AJSH 2CLRB 3VFOA 4MJ4A 2P46B 4HBCH 4LIQE 4WI7A 1E4KA 1KJ2A 3R0MA 4PGEB 4DAGL 4CU8A 3T4YB 2DLFH 3ARFC 4U1JB 3MYJA 4HIJB 1JWSB 4FQHB 4M9PA 5DJ0A 5F3HB 3TBTB 5EBLB 2YSSA 3L3GB 4RFEB 2DICA 5BW7A 3CC5A 3UTQA 3B2UD 3N1FC 1XFPA 3TJEH 3VXRD 5HVHC 4HD9A 3O81A 1J8HD 1CXEA 2VN7A 3E0GA 2DS4A 3NCYP 2ZOKB 4MAYA 5GZND 3E6HA 4G6JL 1INEH 4TUJB 4RDQF 1YNTA 3PGFL 3VFRB 5EZLA 4WUUE 5FUCC 1JV5A 1U8OB 3ULUL 2Z92A 2ZUQB 4U0RC 3WFBH 1RV6X 1J0KA 1MRDL 1MF2L 2A83B 4LQFL 4U3CA 5HHMD 5I1GL 4RX4D 4K9EL 1U93B 1CFTA 4NKOA 4M02A 1SM3L 1J1OL 4JB9H 1MLCA 2VOTA 5ENWA 1QR1A 1TIUA 2D03H 3HN3A 1MQ8A 3V5DA 9CGTA 4LHUB 2IAMC 2P7TB 1CDCA 3DX6B 2F19L 4OQTA 5IBUB 2P5WD 3DPBA 2KPNA 5LGHH 3QXDB 2FO4A 1BEYH 3KXFA 5B21A 3KPSE 2PW2A 4XVTH 3ARSA 2Z31D 2CKBL 3KPMB 2Y1VA 1PVHA 5JDJA 2VMFA 4UT6L 4EKXA 3B2VL 4J3UA 2A74B 3K2MC 4JFFA 3BAEL 3VFWA 3GBML 1RU9H 5KSBE 2VLKE 3OAUL 3O2VH 5C0NC 4MNQA 3MLYL 4DQOH 2PCPB 4PB9L 4H20L 2E5EA 4XXDB 4MCYA 3X3FL 1SYVA 2HFEB 1P4LB 1JGVL 1UQSA 3D3VA 4R7DA 4ZOBA 4FMFA 3VW3H 4Y5VB 2VDLL 4Y8AA 2NY2D 4LBEA 4XCNA 1DVFD 1LE5A 3RDTB 4DGVH 1C1EL 1EH9A 1OB1A 3RVTC 5E99L 1U3HB 3AUVA 3C9NB 2HJLA 1ZT7B 3IFLL 1NLDH 5DJ2B 3TT1L 2V2TB 3PL6D 1VCAA 1KN4L 3WEXA 4DOHE 3FN0H 1FNSH 2R0LH 4L8BB 1A14L 4GMTH 3EYFB 3VGFA 1ZVSB 2VUYA 1XF3B 1WF5A 1JPSL 3GIVA 5FM5O 1NEUA 4U7MA 4S1DD 3QISA 3V2AR 5DK3A 1J5OH 4PRBB 2WK2A 3LHPH 5D1QC 5HI3D 4MCZB 5E8DL 3IVKA 2PR4L 3RZCB 1Z9LA 2ITCA 4N0UB 3UYOD 4UIMB 2AK4E 1P7KA 5F7HA 5IJKC 5J89A 5DJZA 3MACH 5IF0A 3CFEA 3OKNB 1I3RB 2HH0H 5LQBL 3OJVC 1AHWB 5FOBA 5CEYA 1TZIB 1LO2L 3HC0B 5D7IE 5C0FB 4LDLB 4PRNB 5ESQB 3REWB 2C1OB 2EIEA 1FORL 2DQGH 1WCBA 1RURH 4OV6F 1RIVH 5C3TA 1RUKH 3VD5A 1FZJA 2B4CC 1AO7B 1FVDB 5E6IC 2QTEA 3G6AA 3WFHB 3QCTH 1P2CA 1R3LB 4MD0B 2XZQL 2DLHA 4N0FB 1GJIA 1LMKA 1PG7L 3F62A 3PQYD 1CI5A 1AY1L 3KLAA 2BXZA 2H41A 3O3EB 4LLMA 4ZNEE 5D2LB 2P24B 2PW1B 1WFNA 4X6CF 7FABL 3SKUD 1VB9A 4Z7UA 2FEEL 5DEFA 4YDKL 1I8KA 3BXNA 4TSBH 4HIHA 4I5BA 3VFTB 3I75B 2XOTA 1OTUD 2K3TA 1R3HB 4GLRI 1NJ9A 4FXKA 2QKIB 2X70A 1EEUA 4LHQB 3DXAA 3IJYA 3SE3A 2NXZC 4ZFOA 2V2WB 3OKLB 3QDJA 1I1CA 3ARDA 4HXAH 4UOW0 1CLZH 3IDYB 2HKHH 4MWFA 1L4IA 3BN9C 2F53B 3QT2A 4LLYA 1NBZB 1Z0NA 5HY9A 2J6EH 1NAMH 1JGUL 3VWKA 4HJJL 1OP5K 1FV1A 1UENA 3I50H 1UWGH 4Z7VF 3EOTL 1F4XH 1DBBL 2EDXA 4P23B 1MCLA 4X99A 5TF1L 3IDXL 3P0YH 3PWJB 1D5IL 5AZ2H 2ENYA 3VMPA 4LPVA 5IFAH 1OTSC 2Y6SD 3UTZB 1FO0A 3QIUD 1FFNB 1Y18B 1S5IL 3FO2A 4JFYB 4XMLH 5DT1H 5E9DA 2ERJB 4JKWA 1OAXH 4NYLA 5GSVA 2B4CL 2O5ZL 5I18H 4WI9A 4QXTB 3UPRA 2MCG1 1ZWIB 5CZKA 4OI8A 1BD2A 3NIGE 4FQXC 5CWSA 4KGLA 3QXWA 2AXFB 1A6TA 2AABL 2AI0L 2GTZA 3U4EA 3C5JA 4M1GL 2IBZX 5DUMH 4QTIH 1NGZA 4DEPB 4Q9QL 3MRIA 3AXLB 5FF6B 4PJHE 1VACA 1MCFA 3B9KD 4CADB 3O6FA 5B39A 3LH2L 4P2QD 1HXMA 3CSPA 4Z5RB 1QBMH 3RNKA 3OKEB 4CL7A 3G9AB 1SJXA 4JN1H 3D85A 4FZ8H 1B3JA 2BOCB 1TLKA 2D9QB 1LO3H 3P9MB 4WVRA 2BNRD 4WEUD 2C26A 1ZLUK 1FBIL 3I2CH 3HUJE 2P8PB 2EDOA 1YEIH 2NR6C 3MLRH 1F2XK 1MHPH 5ANME 43C9A 2AP2A 4P2OC 4ZXBD 5JZ7D 3KLDA 5AWNH 4KUZL 1DBJH 4ODUA 4MYWB 5I15L 3D39E 5L2JA 3ARBD 5E2WL 3ZT6A 2ZPKH 1NL0H 3HE6B 4Z7WB 3QAZB 1MCKA 3TFKC 5L2KD 5FO8A 1MWAB 1IZJA 2R0KL 4FTVE 1N5YL 2PTTB 4XBPB 1SMAA 4ZS6C 1BZ9B 2HVKA 4WV1C 5JXED 1P9MA 3L3DA 5INDA 2NXYB 3ZDZF 5C0JA 5I73C 4LHUG 5CCKL 5DMKB 3DTXB 4EJ1C 3CZFB 1A4JA 4ELMB 3VU2A 4KI5C 1QKZL 3UDWC 4R96B 4X80H 1OOAA 4PRIB 3S35H 4NRZB 1J12A 1A7QH 2XKUA 3STLB 4M3KB 3MX0A 1U3ZA 4IRJB 3BZ4B 4EIZC 3IDJA 1WT5A 3V6ZB 3KPPA 4FFVD 3BDYL 3R8BB 5HJ3A 3CSYB 2B0SH 4XBEL 4NP4H 3TT3L 3NGBC 3U0TB 1FYTE 1MEXH 4MA7L 4NGHH 2YPLA 1K4DA 1RJCA 3BE1L 4GG6A 2G60L 4NUGH 2F5BH 1I3VA 3ZSTA 4D9QE 3EJYC 4YC2C 5EU6E 2DQDL 2X4OB 4UINL 4HUVA 2P5EB 2GJ6D 4LSUL 1KT2A 4EN3B 3KDMB 4NCC2 3EBAA 2Q87A 3MCKA 2HN7A 4LKXA 1BAFH 2X4TB 1OT1A 1KEML 5TE6L 1AD0B 2DQTH 4OCSL 1JK8A 2Z8VC 3WD5L 4KK6D 4ZPVA 3EZJB 1SY6L 5C09E 2JB5L 1N6QH 2PXYD 5AEAA 4RZCA 4H8WC 3GJFK 4GAJL 1YPZB 2VL5A 1T04A 5C0CE 5C08E 3GO1H 2VABB 1W0WA 1D5BB 2EDKA 1HDMB 4X9HA 1QQDA 1O7SA 2FGZA 5T3XH 1I4FA 4MNGB 4QGTA 5K59E 4NFCA 3U6RB 4PJXF 2Y06L 3UZEA 2Y5TB 4NKMA 1QR4A 5BCAA 5DVKA 4M61B 5CJ5A 4DW2H 4PBVC 4E0RB 3K74B 4XWGH 4AT6A 2E7CA 5IV2B 5D5MF 3Q6GH 4Y19E 2E7LC 1B9ZA 4JG1L 4PLKC 3PNWA 3ARED 4YQXL 2H8PB 2ZOLB 5JHDB 2DI7A 4O2FB 3DBXA 4JO2L 4Q7DA 1GPOL 3L3HB 1UM6L 2DM7A 3KYNA 3H42L 3OKOB 1MJ7H 3BKMH 5DRZA 5IB5A 3LIZH 4PJ9D 4FHBD 5BRZE 1RVFL 3MPCA 5DUBA 1DQMH 3OKYA 2IQ9L 3SO5A 5DHVB 4L4TE 1UXWB 4BK4A 4JM2A 5EZOH 3PJSB 1R5WA 3EKCA 4X6DE 2IPKA 1NLBL 2CXGA 5IMMA 4GT7A 2EDNA 3T04D 4MDJB 1IC1A 3STZB 1I1AD 2YD7A 4OLEA 1T1WA 2B2XH 1AGDB 4K71B 5MEQB 1KCVH 4JPIB 5SWSB 4PRHD 4YLQT 2YUWA 2G5BA 2W92A 1VEOA 4H8WL 3VI4F 8FABB 1N7MH 3MV11 2JJTC 4HUUB 5D2NC 1J0HA 3BWAB 2W65B 4LEXL 4UTAH 4RNRA 1TQCB 4HH9A 2I9TB 4Z77A 3VXSE 3QEQA 4KMLB 3SQBA 1FNGB 1Y6NR 4L3ED 4NDMA 4PJCB 1DBML 3G5ZB 4JCLA 4I0KA 4ZFGH 2IMNA 3X3GL 3QIBC 2ADJA 4WI8A 5HHPB 4M62L 3GSNB 4WW1A 1JI1A 3QXVA 3RVWC 1U8IA 3QHFL 1IM9A 1I85C 2VKXA 1YZZA 4OZGF 4WGVB 3T0DA 4XNUH 4BFIA 3GB7B 3TWCL 1CE6B 1JNHA 4ZFFB 5CEZD 5E2TH 5IBLC 4GRWF 2WP3T 4HCRH 4PGJA 1AFVH 2YBRA 3QUMB 4PLJC 4NM8L 3OAZH 3PWPA 1DQDH 2A9ML 5GGVY 4OF3A 1RJZB 2NY4B 1B2WH 3EO0B 3WHXA 4DVBA 5DD5L 5BS0E 5T3ZH 3SDCA 3DHMA 1H3WM 2UWEE 4JZOA 4XWOD 1N6UA 3MRPB 4JFEA 4OCRH 4KKLD 1T1ZA 3GMRB 4YFDB 3MRJA 3Q1SH 5KW9H 5F9WB 3M07A 2GK2A 2LTQB 1MHCA 5KVDH 3EYQD 2D7TL 3I6GB 3GSOB 4C59B 2LV4A 5ETUA 3VD3A 4N9GA 2EEDA 3ILPB 4TUOA 2GCYB 4K3EH 2NX5A 3HZYA 1EGJL 3MBXL 4I2XB 1YY9C 3MMEB 2YZ1A 2MHAB 4R6UA 2WAHA 3CFDB 3S4SA 3F6IA 5K9OB 5DSCB 3Q3GA 2EH7L 2GIYA 3VXRB 4GKZB 2J6EA 4WO4C 1NAMA 3P30H 1J8HB 2E8ZA 2NTFA 4XPBH 1FE8H 32C2B 2JCCA 3E6FA 3EW3B 4PRPE 5EZJA 4ORGB 1ZLVK 4DCQA 1GGBL 3P9LA 2EIZA 1MQKL 3MV7E 2FD6L 4U1LB 5E2UL 4HKBB 4I77L 4UIKL 3ULUF 3L6FB 3QUYA 5EDXA 1GOGA 2BRRH 4OCYL 4HC1H 1T83A 4LCWD 5L8LB 3ARTA 4G42A 5HHMB 4HIXL 4ISVB 2Z93B 1NCAH 3WLBA 2IFGA 4NZJA 3FOMB 2BY1A 3SJVA 3BPLB 4ODVH 5GGTH 3CSBA 1DL7H 3X14B 1FZOA 3TF7C 2W0PA 3CXDL 4YR6B 2P5WB 4HKJB 1JUFB 3T8XB 2LU4A 4S2SA 1NGWB 4XC3H 1ACYL 2Z31B 1KIRA 1U2HA 3QH3A 4LARH 1P4BL 4JQXA 3ZZ1A 3LKPB 1R0AL 1CGXA 3QCUH 2JLLA 5CINL 4IMKC 4HXBL 3VFUB 5EC1A 2NY6C 1U6AL 3BPCA 2ZUUA 5FEBA 1MFCH 4IRSD 1C5CL 2BC4B 5F6IC 3TNMA 1REIA 3SDDD 1IKFL 3EYUH 1OAKL 1U91A 1FIGH 2GJJA 2LQRA 4U1KB 2G75B 2ITDA 5B8CC 2BMKA 1Q9KA 5AUMA 4QRRD 3DVGB 4X8JA 1NBYA 4HH8A 4IHOB 4ZAKD 5HI4C 2NLJB 3MRCB 1QOKA 3SDYH 4NQCD 5A2JH 3WIFA 2UVEA 2NY2B 4PRAA 5JOEA 4LLQB 4YDJA 1DVFB 3PP3K 1YEFL 4MNQE 4HDIB 4LPTA 1CDGA 3NCJH 4CVXB 4OBRA 4PG9B 3QWRD 1YECL 4LCIL 1IGYB 3U4BH 1OAYH 3BW9B 3RL1B 2BNUB 3WL9A 2C5DC 1CICD 5B3JF 3QPXL 4GRLC 4KRLB 5F7LB 4EXKA 1RUQH 3D3VE 4ERSH 3PL6B 4JO4H 4NKIL 4S0TD 4WY7H 1YEDB 3RHWF 4N8VA 12E8H 1T66D 4XBGA 4YE4H 3W39B 3RX5A 4CMMA 5I1IL 4PJ7A 3HRZA 2VRAA 4WENB 3FL7A 1X5XA 1MUJB 5K9KB 5CMAA 3OGCA 4XP5L 2A2QT 4LPXA 5FYKE 1BVZA 3WHE0 3MREA 3QNYA 4HV8A 5GSRA 1NFDA 3CX5J 1F45A 3O8XD 1SBSH 3GMNB 3DI2B 3MLTA 3BGAA 3QJHB 4QYOA 4F7CB 4X4ZA 1AGBA 5IVOA 2CR3A 4JFZH 4AH2A 4AMKL 3DO7A 1FZMA 5D93C 3VXME 1FL5B 4YHPB 5I6XC 5KSVB 3QDMD 4CRPA 2JB6B 3O3DB 1DQTA 3UC0H 4FN0A 4XRCA 4ONHB 1LP9B 4I0PA 2ZG3A 1BOYA 5A2IH 3RTQA 4JLRA 1G7PB 1WZLA 2PO6C 3MNVA 1UWXK 3PQYB 2XRAH 3QXAA 3MLVL 3JWDC 1DLHB 4LVOC 1O5DT 2X89A 5F1SA 3T3ME 3QUZD 4YNYB 1KPVA 4JQVA 4WTXA 1EBAA 1MRFL 4ENED 3FO1B 1RZJH 4U1HB 3TV3H 1HH6B 3GSUA 3P2TA 1BLNA 3ARQA 4PJAA 3QWOB 2XFXA 5E4EB 1FH5H 2VLRA 1K6QH 1QA9B 3GBNL 1HKLL 1QG3A 4GKOA 5C0IB 3RWFB 4XXCC 3QO1A 4XC1H 2DKUA 2YXFA 4UTBH 2R2CA 2DL9A 4HKZB 3BKYH 2V5MA 1SHMA 2Z9TA 3Q48A 4Z7UE 4B53A 5I66B 5EUOA 3CFJA 4IM8A 1T7YA 5C0AA 3VXOA 5KVFL 2FWOB 1DSFL 1NC2A 1V3LA 2MJWA 3TYGL 4ONOA 5LWYH 1I9RL 1KIPB 2ATKA 1EDQA 1A7PL 4YO0B 1F4YL 1KLGA 3DXAE 1IC7L 5GGRA 4IDJL 2E7BA 1YJDH 4TNVK 4BQ6A 4C83A 1KJ3L 4FQIL 3QDJE 5T1LD 2F5AH 5EULV 3QIUB 4OGXL 3FFDA 1KIQB 4YEEA 3GGWB 3O11A 2X4PB 3IDNA 4JZJB 4KJYB 3L3IB 5DD0L 3MJ7B 5JIIA 4RAVA 1HIMH 1UEMA 5DQJB 5C7XL 1LO5A 1PJ9A 5JNYA 5ALBH 3K46A 2W9EH 4FQQB 1F90H 1RIHH 1A1MB 4HG4K 1T2QL 2DKSA 3JWDL 1YDPA 1FFRA 4JVPA 2VAAA 4G8EB 5E9DE 1AXSA 3WJJA 3HPJB 3PWUB 4N68A 2R1YA 4G43A 3UTTD 1AH1A 2R2EA 4QO1A 3B9KB 3FQRA 4P2QB 1JYXA 3RI5F 1BHGA 1HHGA 1Q0YH 2X1WL 4UQ3A 4I18A 5GGSA 2FZ3B 1M05B 2FX9H 3V0AC 3D9AH 4LPWA 3EFFA 4KKCC 4EIGB 3TESA 2BNRB 2OYPA 1OQXA 1WBZA 4ZSOB 4OFYA 1DFBH 3MJ9H 3CMOL 5E24E 5HYJE 5GHWL 2N7AA 3I9GH 3KLHD 1V5JA 5FHBL 1T1YB 1IBGL 2X4RA 3KAAA 2R8SH 4ZXBB 1OP3K 3DRTA 5D7JA 4HCRA 1HYRC 4S11A 5CEXB 3ARBB 1OF2B 4YHIA 4DKEH 5FA3A 1FC2D 3ULUD 2H6PB 4QHUB 1B0WA 2KKQA 1KEGH 5L2KB 4D9RD 4GMSL 5FKPB 4KVCL 3UZVB 2OL3B 1DE4B 3SO3C 1A6UH 1A9EA 1UM5H 4A2LA 5J11C 1P1ZA 4OF6A 1ZMYA 3QJFA 5SX5H 4DUVA 4K23L 4G6AC 1MHHB 3N85L 5E08L 1CK0H 1U95B 3QG6B 4TSAH 1T89A 5HSFA 4XAKE 4YAQB 4DKFL 1MRCL 1A6AA 2VE6A 2E6QA 1MJ8H 5KVEH 1KLUB 3T0ED 2J2ZA 3HC4L 3A6CH 3QFDA 1N59A 2ZSVB 5BZDB 2H9GB 3RIAF 4JANB 5IB4A 2EO1A 4OZIF 1G6RH 1EBPA 1OW0C 4N8PA 4X4XB 3MRBB 3ARFD 5GS0D 3O4OC 2M2DA 5I75C 2CD0A 1J8KA 5I19L 5CUSH 3NACL 4HC1A 4JPKL 1FG2A 1PW3A 2GJ6B 4JDTH 1QSED 1MJUL 3IYLW 1E4KC 1Z3GH 3E3QE 3C8KB 2ZKHL 5BQ7A 2IJ0C 5DRXA 5ICZB 5GGTA 3BRFA 1M1SA 2PXYB 4GH7B 4P59H 1S7TB 1I9JH 5BW7C 4P3CH 1IT9L 3G6JE 4J8RA 5IWLA 3SDXA 4MX7B 5B4MC 1WEJL 2AJXH 1U8PA 5KS9F 5EFIA 4NRXA 1Y6MR 1UYWL 1YNLH 4G3YL 1JMXA 2FX8H 5TQ2L 1S9YA 4GAYB 4MAYC 2VZOA 5DI8B 1OLZA 3PDOA 4KI5F 1C08B 4HIIA 5HTSA 3WKML 5IFHH 1XF2B 3MRFA 4BFBD 2J4WL 4M4RA 5IQ7H 2BJMH 4XT1C 1ZANL 2W9DL 3ROLA 4KFZC 4JAMB 1VPOL 4P46A 2IAMD 5IW1A 4WW2B 4OGYH 3RGVD 3AREB 2AEIT 4JN2A 2IPUK 1ITCA 1MFEL 2PF6A 3MNZB 1OLLA 5AYUL 4KKBD 3ZHKA 4FFZL 5GGQL 3CU7A 2CDGA 3DGGB 5JUEH 2NNAB 4JG0L 1Z9MA 4J3VA 4PJ9B 1INDH 1IAIL 1CDYA 4ZO9A 2EYSA 3ROOB 3LSOB 5I1DA 1ZSDB 3IU3A 4W6XB 3HLAB 1K5NA 1KF9B 1KELL 2J8HA 3KNBB 5TPWH 4WU5A 3G04A 5DD1H 2AJVH 4U31A 3RUGF 2FSEA 4NN5C 4WI5A 3K2UH 4OT1L 3AS0A 3RVXC 5F7KC 4KAQH 1I1AB 3QRGH 4KV5E 4JGMA 1V05A 3LKSB 3MRRA 3B6SA 3F8UB 2ICWB 4OLXL 4OTXL 4PRHB 5KOMC 4OZHB 5IVXA 3NAAH 5FGSA 3RVTD 2VXQH 4XNZC 5I76A 4Q0XH 4L29B 1CGSH 3ULVD 5F9AC 3G5XA 2C3VA 4N9OB 4X6CB 5FYLD 3QQ9C 2VDNH 1X5AA 2V6HA 4L3EB 1IGTB 5EORL 5GISH 1LD9A 1BZ7A 4JM4H 3QBTB 5JIHA 4QT5B 4YFLI 1G7MA 3AU1B 3OR7B 2EC9T 1WWAX 3H9SD 5EU4B 3UROR 3LDBC 5D7LA 2OP4L 4TSCL 1LE9B 2BVOB 1QSFD 3TIEA 3OHXB 3RA7L 3QEQE 5JQHC 4YJZL 5HGDB 4LSPL 4HLJA 1T7ZA 1FRGL 4PJDA 2V2XA 5EWIH 4Z7QF 1AGCA 4JKMA 2GFBA 3DUUB 4NRYB 1DDHB 1XR9A 5DRNB 1I7UB 4KQ4L 1LO4L 1D7FA 4U2ZA 4Z7VB 4OQTL 4R4NC 3U7AA 4C56A 4D9LL 4ZUTA 2R2HB 2DM4A 3LN9A 5JPMB 1TZGL 5HDBF 1KYOK 3W0WA 4BYHA 3PIQB 1AR2A 2AQ2A 3D0VB 3CFBB 4M6OH 4WJ5B 4KQ3H 1QFUL 5DHYB 5CIPB 1JNNH 3BP7B 5E6ID 5E2JA 3WCYA 3QFJE 3V0VA 1OAZH 3M8OL 4BKLA 3DURA 1PLGL 1PZ5B 4UV7L 1JPGB 5CZXD 1JL8A 4H5SB 3PWPE 2LFGA 3FRUB 3CU1A 5C07A 1JWUA 5SWQB 3K7UA 4ZUUB 1V7MH 5F8RC 4JRWA 5M95B 3T1WA 4NO0D 1RHHA 1TPXC 2V5SA 3IFNL 4S1RL 3CIQA 3DSFL 3O3AA 5AZEH 1JFQL 1GZQA 4ZUVA 1FCCA 4WUKL 2X9XA 4YX2H 3WS6A 3H6JA 2VLLB 3GUTB 4P2RD 1DQJA 3V5KA 5EN2A 2X1XR 1WIUA 1MCCA 5F72S 5ISZD 2ZCLH 2I5YL 3QA3B 1JN6B 2NX5E 2V5YA 3PV6A 3U1SH 4OZ4A 1OM3L 4MJ6B 3GSVA 2EDTA 3NCBB 1KTKE 5FYKL 4LLUB 1Q0XH 4XPHH 4LCWB 3BN9D 4X5WB 4GSDH 4FNLL 5TDNB 4JFOB 5IKCA 2G9HA 5F71A 3JUYA 1VGKA 3PV7A 4QTHA 5TDPB 2FJGA 1Y0LB 3G5YB 2L4OA 4FXLA 4XPAL 4HWBH 4G7VL 4RAUA 4S1SH 3ARDC 4WFHD 3GI9H 3HMWL 2NYYC 1OTSD 4K7PY 2SEBB 5FUOL 2VSCA 4BSVB 1CXIA 4XCFL 1ZHKB 5E8NA 3VWKC 2XQBH 3GMOA 3I6LD 3SE4A 5E2VL 4G80B 1DQLL 4P4KD 5A3IC 3SJVE 3KPTA 4FQXD 1RK1B 1F4WL 3K80A 2QQLH 2CDEA 5FB8A 2YXMA 1KGCE 1XGYL 4AM0B 2X7LA 2OMNA 5E8EB 4IRSB 5DO2C 1INQA 4JHWH 3SDDB 4HF5L 1Z2KA 3TO2B 3MJ9A 4R4FL 1G9EA 5HHNA 4G8IA 5HI5D 4O4YL 4MXWL 4F57H 4MZ2A 3BMWA 1RIUL 2XWBB 1UM4L 1UH2A 4J1UA 4QRRB 5J9PB 3NZHH 4ZAKB 1D5XA 3TVMC 2A6KB 4NQCB 2V9RA 2R39A 4X7TB 1N5AB 4ELKA 4N90D 5DRWB 4JFPB 1RUAH 5D7SH 1CIDA 3NH7H 4HKXA 5ICXA 1KCSL 5JW4R 4WI6A 3VFNB 3O6FC 3WO4B 1RPQA 1CICB 3QUKA 4JR9L 3BP4B 1X3DA 3JTSB 4P2OD 5ESVB 4Y89A 1BOGA 1KTLB 2DQJH 3C60A 3KR3L 1HQRA 1IQDB 1BFVH 4ZFOL 2GY7B 3GIZL 3TPUA 2DIBA 2CLVA 1A7OH 4L1DA 4LDOB 3VD9A 3TO4B 3KPRD 3PP4H 4F7MA 4RGMC 1SJVA 4YPGA 2XWJB 1IFHL 1N8ZA 3AS2A 4TTGA 2UYLA 5IMLA 2D9CA 3FB7B 4ZS6D 4K07A 1EO8H 3SDAA 4HQQH 4G9FD 3LRSB 1FGVL 3GSQA 3MODL 5T1DH 3ZL4H 3O8XB 1G6RA 1XGUA 2JJSA 2QR0B 5CP3H 4RA3A 2DWEB 4PJXB 3VFVA 3FAXA 1ZGLA 4KI5D 1VGEH 1FO0L 1BECA 3UTPE 1NDMB 2MMXA 1MWAH 4R8WH 2EKJA 4XP1L 4PGZA 1SJHB 2DKMA 4PJHF 5I1LA 2XKNA 3QDMB 4LLDA 1A4KB 4K2UH 5D5MB 4KRMB 3S37L 4IRZL 2CLRA 4PGEA 2OJZH 1JGDA 4TNWF 1NCCL 4RFNB 5IEKB 4UQ2B 4U1JA 4HIJA 3TBTA 5F3HA 4FQHA 3QCVH 4NHCL 5EBLA 3L3GA 2PYED 3VFGL 3MCLH 4RFEA 5GGUB 3SN6N 2RAMA 5HHXH 4KY1H 4LASL 1ADQA 5BVPL 4KZEL 3QUZB 4WFFE 3T65B 1WT5C 4U7SA 3HS0B 4EBQH 1S9VA 3H9YA 3TCLB 1I8MB 3QEUA 4LSQH 4CW1B 2DQFB 3HNSH 4QHLB 1NMAL 3E3QC 4W4OA 3KJ4C 1IEAA 2GTWB 4TUJA 2A1WH 2ZSWB 3L3JB 2F54D 4XNMA 1K8IB 1QFWL 3DHJA 4GFTB 5HHQA 1U8OA 4J12A 1J0ZA 1IGJA 2H1PL 5F1NA 2CGRH 1T5WB 4G6JH 4JQIH 5TJWK 4KTEL 3U48A 1MCWM 1MLBB 3BHBB 2A83A 3L5WB 3VJ6A 1E28A 2CUHA 2DTMH 1U93A 5DDHA 1K9TA 5LAXB 4PJAE 5T3XE 5JORB 5DQ9B 4LCCA 3RX7A 2VLRE 1TCRA 3ZTNH 5I1EL 2NCMA 3FO0H 2BCKB 2RBLA 4LHUA 2P7TA 1XEDA 4R2GC 1JZ6A 1CD1B 5AD0B 3QXDA 1IEHA 5T1LB 4HZLA 5DJYA 5EUOE 5C0AE 1EHAA 4F33A 1OSZA 3GNMH 4JO1H 3HI1B 3BEWB 4H1LB 2AJSL 1JGEB 4DVRL 1E6JH 2PN5A 1U3JA 4OZGB 3EGSB 3WE6A 2ICWI 4WFGD 5EU3A 2DLFL 4P3DB 4H0IA 1B90A 2ZG2A 4GRWB 2X4QB 2CK0H 5FDYA 4OV5B 1G9NH 2XPGB 1QLFB 1WAAA 2PCPA 1ZLUH 1XGTB 4XXDA 3OAUH 1CCZA 3TJEL 1JPTH 2HFEA 1P4LA 1UJ3B 3UTTB 1EJOH 4PB9H 2Y9RT 4Y5VA 1NGPH 3A67H 1EO7A 1INEL 3MOAH 3RDTA 3PGDB 3QDGA 4G8FB 1ZLWK 3D48R 4JM2C 4EUPG 3AMLA 2Q6WB 2Z91A 3C9NA 3WFBL 1ZT7A 3VXUD 2FIRT 5DJ2A 1CS6A 2V2TA 4PY8I 1CD8A 4L8BA 5DWUH 4O9HH 4KVNH 4URTB 1CFSB 1C7TA 4JB9L 3TT1H 1X44A 1ZVSA 4GS7C 1XF3A 2D03L 1YEJL 3OMZA 3QIBD 4CMHC 4X7EC 4YUEH 4PRBA 5D70H 2BNQD 4MCZA 3RVWD 5LGHL 2YHGA 1BEYL 5BMFH 4HGKC 3RZCA 4XVTL 1GGCL 4OF5A 4U1NB 4UIMA 5F7WC 4U1SB 5DC4B 1QLRB 3JV6B 2FYYB 3OKNA 1AHWA 2HRLA 5IBLD 3GSNH 1XH3B 1CQYA 5C0FA 1RU9L 3REWA 3O2VL 5B3NA 4KH2A 4PLJD 5EOCH 2DQCH 2HT2C 5DGRA 3DX8B 4DQOL 3UJJH 5FOJA 3SOBH 2B39A 5C2BH 1AO7A 1FVDA 4FXGA 4O5LH 2OK0H 3T0EB 5MHSD 1RZ8B 4H26A 4MD0A 3VW3L 2A6IB 4PJIE 2YC1B 4M4PA 5HYIA 4NWUH 2HJFA 5I74B 2CKBB 3O3EA 3RL2A 3GHBH 4DGVL 5D2LA 4MQ7A 2PW1A 2QSCH 3ARFB 3GJFH 1YY9D 1R5VB 2HAZA 1NLDL 2X1OA 4HMDA 5FYJH 2VDMH 3FN0L 1FNSL 1R3HA 2R0LL 4Q6IA 4Y4FD 1U8MB 4GMTL 5HVHB 1QSEB 1MELA 4WO4D 2QKIA 5DMGC 4JKPL 3T0BA 3H3KA 2VH5H 3FRPG 4K8RH 2DD8H 2V2WA 1I8IB 4TUKH 1J5OL 3LHPL 5IIEB 1OWWA 3MRKA 3T0AA 3L7EB 1T03H 1NBZA 4W4NA 2AXGB 4K7PX 3IRPX 4PP2B 3UX9B 3MACL 3NIFF 5CAYB 4GUPB 4ZTPH 4P23A 4NPYB 2HH0L 1VHPA 1JGUH 1ED3B 5F9DC 3B5HA 1FN4B 2HJKB 4WWID 1T2JA 3UTZA 5TF1H 2A38A 3SDXE 1Y18A 2DQGL 3ILQC 4JFYA 3VFSB 1RURL 2X44D 1A5FH 1T83C 1RIVL 1RUKL 2HTLC 2IAMB 3B43A 4KMTH 5C0DB 4WI4A 1UB5A 3RGVB 1ZWIA 4QKXB 5EOCJ 1IGIH 3H0TB 3MRDB 4QWWC 2AXFA 3MUY1 4JRYE 3MV8D 5CD3B 4LPYA 3SBWC 4KJQC 1LEIB 2AI0H 1ES0A 1KTDB 2FH8A 4TTDD 5FF6A 4WRLA 4LVNC 3I3EA 3OG6B 4TSBL 4CADA 2WV3A 3LKOA 4NCDA 4Q9QH 4IOIB 4NKDB 3OKEA 4NQED 3MRHA 1VFOA 2LVCA 5EC2B 2DI9A 3LZFH 5HI4D 1ZXQA 3PABA 2WWMC 1X5KA 5F3BB 1EERB 3BH8A 4ZDHB 2J1KA 4P4RA 2HTKC 1U3YA 4HXAL 5EBMB 1Y6KR 1A1OB 3JWOH 1CLZL 3HFMH 2VISA 2M26A 2HKHL 4OLYH 1JF1B 3FT4B 4XP9H 5EG6C 5ACZB 2W60A 2JELH 1F6LL 2J6EL 1NAML 1A9BB 3DYPA 2FDBP 3I50L 4GRLD 1UWGL 1F4XL 4M7LL 5AZ2L 3HE6A 4Z7WA 4Z0XB 4H0GA 1AC0A 3VRJA 5CP3A 2HRPH 3IS0X 1J9CT 5IFAL 1MCIA 1DEEB 5E2WH 3QQNA 3H9SB 5DT1L 4XMLL 1MWAA 4XBPA 1OAXL 1BZ9A 1U2CA 1TENA 3MGTB 5I18L 5H2BB 5AG8A 4GKSB 1UZ8B 3IKCB 1QSFB 2X4NB 5CJ8A 3S96B 3MA7B 5DMKA 3CZFA 5D7KD 4ZO7A 4PRIA 4XP4H 4J3TA 4LCYB 3IJSB 2VLJD 1EVUA 4B5EA 5D7LE 3AVEA 4OKVB 5DUML 1XAUA 4IRJA 4QTIL 1XGQB 3BZ4A 4F7PA 2CR6A 1XF4B 3V6ZA 3U79A 2ADIB 2CIKB 3MRNA 4D8PA 4C55A 3CSYA 2QV2A 1MCEA 1HI6B 3WBDA 4PJDE 4I1NB 1QBML 3L95B 3U0TA 1M7IB 5E6IB 2ED8A 4UBDC 3T1FB 4JN1L 4UOJA 1UWEH 4FZ8L 4OJFL 1LO3L 3QDAA 5HYQB 2DYPD 1A2YA 4C56E 3HC3H 2X4OA 3I2CL 2VNCA 1FNEA 2G60H 1WZKA 2RJMA 4JHAH 4EN3A 4NO0B 3KDMA 2VKWA 1YEIL 2I26N 3MLRL 3CH1B 4N1HB 1FG9C 1MHPL 3PGCA 2O61B 2LVEA 4PJFA 4Q2ZB 4I0PC 5AWNL 1L0XA 3QXUA 3QO0B 4CJ1A 4P2RB 1BX2A 1OPGH 2Q86A 2ZPKL 1A7RH 3FQUB 4J4PD 5TH2B 1M71B 1EUUA 2P8MB 5ISZB 5C07E 2YWYA 5SV4A 3CFKA 1TJHH 4JQVC 4L4VD 5JOPE 1EUTA 1D5BA 4AYFA 3ARGC 3OKMB 1HDMA 1S9WB 2DIJA 2OSLA 1MVUB 4NZTH 2AVGA 4MNGA 4Q97A 2ID5A 2I07B 1YMHB 3U6RA 2OXGA 2YEZB 1BQHG 2Y5TA 1HQ4B 1SYSB 4WTWA 5F1IB 3T08A 3LAFA 4PJEF 3HG1D 3FB8B 4E0RA 4X80L 3WIHH 3S35L 4F3FB 5IV2A 4PV8B 5LKNA 1A7QL 4EOWH 1S7VB 2H8PA 2ZOLA 4NHUB 3HE7A 4O2FA 2IAND 3QR2A 1BF2A 4G9DB 2HMIC 3DI3B 2B0SL 3C5ZD 1GPOH 1OY3B 4NQVB 4NP4L 3I02B 5FAAA 1DJSA 1MEXL 3B8SA 4P4KB 4NGHL 4XCYB 4LIQH 4FQXB 1B6DA 5DHVA 4NUGL 2F5BL 1DN0A 3P40A 1UXWA 4I4WB 4P5TA 4YHYC 3PP3H 2BVQB 5K33A 3PJSA 4LAJH 5IBTL 4PTTB 2Y7QB 3VRLE 4EDXB 1EIBA 4HUNB 2MTPA 4M48H 4JREC 4OFKA 5SWZD 1BAFL 3STZA 5IB3B 4WCYH 3L3KA 2DQTL 4OD1H 1NUGA 4TVPD 3MGOA 5MEQA 5T5NG 1Z6JT 3T0WA 4RISH 1N6QL 1T1XA 8FABA 4HUUA 3BWAA 3FQTB 2W65A 4Z7UF 1OAQH 4LKCA 2APTA 4RSVA 5L8KB 2IMMA 4OZIB 4KKCD 3WJJC 3GO1L 4HWUA 4OCLC 3DROB 1JHTB 2CMRH 3QI9C 1OL0A 1EPFA 5T3XL 1L0YA 1JTOA 2DMBA 3D25B 3IGAB 4U1MB 5IGXH 4DFHA 5F93C 3LKRB 4P2OB 5HHPA 1J1XH 1Q9WA 5ACLA 3GSNA 3F65A 4DW2L 5JR1H 4F37F 4XWGL 4LMQI 3DIFB 3LD8C 3KPRB 4M62H 1HKFA 1BBJB 1B0RB 2ZJSH 1I8LA 4ZODA 5FA4A 3GB7A 3PWNB 1CE6A 4ZFFA 4U6HB 1MJ7L 2K9UA 2UY7A 4JFDE 3BKML 4NC0B 2C4FU 3LIZL 3WN5A 1FFOB 1ND0A 5KS9B 4WV1B 5D7JC 1J88A 2ESVD 4PJGA 4X7CC 2EYTB 4G9FB 4AY0A 3LRHA 1DQML 2BY2A 1UWXH 3S9DB 4HK0A 3DSNA 4Y2DD 4KKAD 5CSZA 5EZOL 4NM8H 3GJFA 1KPRB 3EO0A 4IIQC 1X7QB 1GH7A 5E7FA 2OL3H 4A2MA 2Z35B 1CE1H 4P2CG 5ESAA 4ETQA 2NZIA 4WHYG 2B2XL 2AKRB 4WFEE 1KCVL 3I6GA 3GSOA 2Q20A 3ILPA 2H2PD 1TQBB 1MVFA 2FECI 1N7ML 4I2XA 3LN4B 2PYEB 3MMEA 1T89C 4MVBC 2MHAA 4NJ9H 4PJBF 4PJ8A 1FIEA 4UTAL 1FAIH 3IKKA 4QRPA 5K93A 5DSCA 4IJ3B 3SGDI 4YC2B 1UA6H 3MBXH 3VXRA 5D8JH 4JFHE 4GKZA 4K55A 1J8HA 3KPQB 2RFXB 3ECBA 5KTEH 1D6VH 4ORGA 3UPAA 1NGXB 1T4KB 3RUGB 5GPRA 4HKBA 5JA8B 2YRZA 2GT9B 5C0BA 2F54B 1A1NB 1YNKH 3MGAA 4MJ5A 1CDHA 1DBAL 4E5XB 3V6OA 5GS2D 1CLOH 5E2UH 1RJYB 3KPOB 1RHFA 5B4MD 2IH3A 4XNUL 1KCKA 3MUGB 3ZDYE 5E2TL 3FOMA 4HCRL 1H5BB 3IDUA 3JV0A 4MJID 2VC2H 1AFVL 4H25B 5I71C 1FVEB 4NQTA 3X14A 5IWLC 1DQDL 5DJ8B 3VA6A 5JOFB 1M6OB 4YR6A 4DGYH 3P4OB 1B2WL 1JUFA 4MSWB 4Y0GA 3T8XA 2VZ1A 4HUXB 5DR5H 4O00A 2EDRA 4YIQB 1PX4A 4OCRL 2Z31A 5A2KH 3LKPA 2VXVH 5KW9L 2JKXA 2BVEA 1RAMA 4M00A 3TIDB 3VFUA 5KVDL 1R3IH 4UAOC 1HK6A 4U4BA 2HFTA 4OUUA 4K3EL 3GMLA 3S3PA 4GXUN 4P46C 4LCUB 4RGNC 1IEBB 1GXEA 3INUH 4YGAB 4X5XB 3KXFD 2FEEI 2AJUL 1I3GH 2QHRH 1Q9OA 3P30L 4IHOA 2NLJA 1FE8L 4EI5A 5TQ0H 4PGCB 6CGTA 3BGMB 2AGJH 4GG6F 1OP3H 1NMCC 1LDPL 1DVFA 4JFFD 3VRIB 4HDIA 2OS7A 1I9IH 1VERA 5GJTL 4CVXA 4PG9A 3RWGA 1WAAE 2BRRL 1IGYA 4HC1L 4OFIA 3BW9A 3OAYK 5D2NB 3RL1A 2GY5A 2BNUA 1EEQA 3VXUB 3H3BC 4OCNC 4YZFF 1NCAL 1ERNA 1YEDA 1CDUA 1A64A 3K1DA 4JRXD 4NKIH 5GGTL 5KVGH 1GC1H 3MXWH 3QG7H 5I1JH 3VGAC 3QIBB 5EPMB 4GW4B 1MUJA 5I8CB 4M6NH 1BWWA 4O2EB 4W6WB 3QUXC 1EXUB 2BNQB 2YA2A 4L3AA 4L8CA 1SJEA 4Z7NE 2QSVA 4XC3L 2VQUA 4LARL 4HG4J 4KMQA 5I17A 3EO1B 5DEGA 4DTGH 4F9LC 3QCUL 3GMNA 3BWUC 1P5VA 2GSIB 2WWKT 4XVUC 4L1HA 4NC1C 4F7CA 1MFCL 1X5IA 1AQDB 1H8SA 2FCBA 1FL5A 1HHIA 4YHPA 3EYUL 5DMIH 1FIGL 2EZ0C 2JB6A 3O3DA 4TULL 4Q9BA 4AMKH 1WIOA 3OB8A 1XGRA 4ONHA 3IDMB 1ITBB 1P7QD 3MROB 3WFEH 3ORJA 1S7WB 3BOVA 3SDYL 5D1XC 3L5JA 1XZ0B 2ICEB 3PQYA 2P49B 3N1GC 4H88H 5IB1A 1QPXA 1OGTB 4JM2F 1FLRH 3WUZA 4YH6A 3NCJL 4YNYA 4ZYKB 4YHOH 1EZVY 3B9VA 3U4BL 1AO7E 3FO1A 1OAYL 1RZJC 5BXFA 4D94A 1CXLA 1HH6A 1LEGB 1L7TH 1RUQL 4ERSL 4JO4L 2O26U 4ONGH 4WY7L 4Y4FB 1K2DB 4EEEA 3CVIH 3CZJA 4FQPA 1NCWH 1YYMH 1NUFA 3X13B 4WO4B 1ZEAH 3RWFA 12E8L 4K94H 1AGEA 4K3JH 2DF3A 5D2LE 2BSED 3MRGB 3WIHA 5E95B 4HKZA 5DD3H 1HKLH 3AM8A 1DANU 5F89A 2ICWJ 3TBYA 4EUPH 5DS8B 4L9LC 4MD5B 2FWOA 1KUMA 3C2SA 4XAWH 2CUMA 4WIQA 4IOSD 4L8DB 3WS6C 1KIPA 3B3IB 1NCUA 4DFIA 4KWUA 1ZT4B 1SBSL 1BF8A 1GGYA 1S5HB 1RD6A 3UP1A 5E8OB 5H37G 1YJDC 5FM4A 2A73B 1BVKB 1UVQB 4JFZL 2P1YA 2XG4A 3ARDD 4XNYL 1KJ3H 3GGWA 4CVZB 3HCVB 2R4RH 3MNWB 2AXJA 2I27N 2X4PA 3U36B 4JZJA 2BOBA 3L3IA 4KJYA 4Y7MA 5IK3B 3UC0L 3ZYOA 1U8JB 1GIGH 4Y16C 5J1AA 1IILE 3MCG1 5A3ID 1LK3H 4FQQA 4PY8J 1A1MA 2XRAL 1PQZB 3BQUD 3MV8B 1ZHBB 1PKOA 2NY6B 4G6MH 4QRSB 5IW6B 2VL4A 3HPJA 3PWUA 2UZIH 5F6IB 1RZJL 3FZUC 4HPYH 2E6JA 4B0MM 1FL3A 3B9KA 3TV3L 4P2QA 5B8CB 3N1MC 1FH5L 1VFBB 1BD2D 1MFAH 1K6QL 4KU1A 4NQEB 2WUCH 5EO1B 2FZ3A 2O5YH 2FLBT 4BELD 2EXYC 4XTRC 3LV3A 2P8LB 4XC1L 3K8LA 3TVMD 4ACPA 1Q8MA 2BNRA 4UTBL 3GM8A 4ZSOA 3BKYL 1CDJA 3G08A 4L5FH 4AIXA 2F74B 3UXFA 5D1ZA 1T1YA 2JCCF 2YS4A 1UFUA 1J05B 3O6FD 5LWYL 1TVDA 3VH8B 4ZXBA 5I0DA 3T09A 1UT9A 4GRLB 1ZS8B 5FHBH 1QEWB 5FDWB 4M6MH 2JK5B 5DGQA 3BZFA 2DIAA 3RWHB 4TOYH 3FB5A 2XG5A 5LGJB 2F5AL 2OTUA 4QHUA 5KSBA 5L2KA 4M1CC 1F11B 2QEJA 3ZKMC 5FIEA 5FKPA 2CDFB 2OL3A 5FKAB 5JXEA 1HIML 3C60C 3NPSC 5ICYB 3NVQA 5JMRA 4U6XB 5GRYA 4DWHA 1IL1B 5FK9A 5ALBL 4Z7WE 2W9EL 1F90L 1RIHL 3BJ91 5EIIB 5E00B 2ADFH 3OQ3B 2VLJB 3DWTA 5JMOC 2PYFB 3N85H 3ZDXE 3CX5K 5E94B 5D96C 4NSKB 1K3ZA 3JUZA 1TNMA 4X98A 2IWGA 4MXVE 1DQQB 2ZSVA 1YN7B 3CMGA 2H9GA 4ZUSA 5BZDA 4JANA 1ZHNA 3GSRB 2OR7A 3D2UA 4XHJC 5MEND 4F7TB 1S7SB 43CAB 2JJSC 5HHOD 2EIBA 4PRIE 2FX9L 3MRBA 5EU5B 2VZTA 3D9AL 4JDVB 1DUYB 3ZYIA 4GBXA 2DYPB 2BY3A 3U30C 3MJ9L 4LVOB 5BV7L 3I9GL 4OZFG 1UXSB 4QNPF 2Q76B 2Z4QB 3C8KA 2R8SL 5CP7B 1CZ8H 1HSAB 2AK4A 3HPLB 5H94B 5ICZA 2PXYA 3GHEH 2YPLD 1S7TA 2HT3C 4UU9B 5MP6H 4DKEL 5I8OH 3BT2H 5F1OB 5E4IA 5TDOA 1KEGL 4L4VB 1YA5A 4I0CC 3W2DH 1SQ2N 5L0QC 4AEHH 5EIVA 1ZGLP 4W4OC 1A6UL 1UYWH 5LBSL 1ZHLB 1UM5L 1BVLB 3L9RA 1C08A 4Y5YA 1H3XA 4PJ7F 5T1MB 4QOKA 2MFNA 1KYOJ 3OF6D 5TFSH 5ID0B 3NABL 2ZUQC 3HG1B 5DZOA 1CK0L 2VDRL 4HUWB 4TSAL 5IROA 1YPZE 5EBWB 3RKPA 4NO5B 3GSWB 4WW2A 5IHZB 1JF6A 4R2GD 3H9HB 4ZPTB 2AV1B 3AREA 2GHWB 4ZNEA 1MJ8L 5KVEL 3BIAX 1T21B 2IANB 3A6CL 1MIMH 3MNZA 4MNGE 1NFDF 3UYPA 1XIWC 1EFXA 3UMTA 4PGDB 4HIEB 2NNAA 3U2SB 4LCCC 1F5WA 4PJ9A 1KCUH 3C5ZB 5D4QA 2IADB 1XF5A 3ROOA 1G6RL 3LSOA 3QNZB 5GGQH 1ZSDA 1VFAA 5DD6B 2NW3B 1G6VK 5T1KD 1Q38A 5JHDE 4LFHD 2UZXB 4L4TB 5CUSL 4MHHG 1FNLA 5BVJB 2PTVA 3HAEB 2HG5B 4JDTL 5GJSH 5C0RH 4QXUH 2V7NA 4KDWA 3QQ3B 5SWZB 5BO1H 1I1AA 1Z3GL 3VG9C 3QXTA 2HFFB 3GRWH 2ICWA 3WLWC 4BH7A 1U8QA 4N5ED 1A3LH 1KJ2H 4L4JA 4PRHA 4KZDH 4HWZB 2XI9A 4P5KB 4OZHA 4P59L 5JIKA 1I9JL 2FEDC 4P3CL 4ONFH 1ADQL 4L29A 2AJXL 4JM2D 2NY5H 1YNLL 4EXPX 3UAJD 3BRGC 2F53D 4Y5VC 4L3EA 2FX8L 5J56B 3P4MB 4KJPC 2PNDA 3SCMD 4L3CB 5SWSE 2DQUH 4QT5A 5IFHL 3H7LA 3FT2B 3AU1A 3OR7A 5IQ7L 2BJML 4E41D 5EU4A 1BJMA 2E3VA 1KXQE 1LE9A 5J6GB 3O3BB 4OGYL 2BVOA 5C9JB 1RI8A 4BJLA 5HGDA 4PJCE 3FQNB 1CDBA 1KOAA 5JUEL 3DUUA 4NRYA 1KSRA 4M7JH 4MB3A 5DRNA 1I7UA 3GMPB 2ESVB 4TQEH 2XY2A 3SO3B 4AQOA 4WHTB 1VADA 5J11B 1CYGA 2R2HA 4Y2DB 2AS5M 5TPWL 4D3CH 5DD1L 3PIQA 1EA9C 3FJTA 3D0VA 3CFBA 2AJVL 4ODWB 4G7YH 3BO8B 5DHYA 1EZVX 3KPLB 5LCVH 3K2UL 1MNUH 2ARJB 2YD6A 4CNIB 4KAQL 1B88A 3QRGL 4UT7H 5KOVC 2QJDA 3ZKQD 4OAWB 1PZ5A 1JPGA 4XNXL 1ZAGA 5J57B 4H5SA 5JDSB 3FRUA 3DMMC 5SWQA 1FVCB 4ZUUA 3NAAL 4RMTA 2VXQL 3D39A 3O0RH 2KL6A 4Q0XL 5HGBB 4P9HH 2MKLC 1CGSL 3O4OB 1QPPA 3RIFF 5I75B 2A6JB 3RWJA 1Z5LB 4Z9KB 4X6BA 5FYJE 3VDCA 4JFED 4FTVA 2VLLA 1LILA 1I7TB 3GUTA 2VDNL 1JI2A 4QXWA 5GISL 1RUPH 3FN9A 1OSPL 4HULB 3VFOB 4WUKH 4JM4L 3RY6C 1L9NA 1SEQH 3QA3A 4GXUM 5GS0H 4I2XE 1UCBH 4ZQKB 2XICA 5KN5A 4M7LT 1AKJA 4Q6YA 3V8CA 2BSSB 4PUBH 2X40A 4LLUA 4PG2A 4UDTB 3VXRE 5HGAA 4LCWA 4X5WA 1G0DA 4Q6IC 5TDNA 1J8HE 1MOEA 4YBQC 5FYKH 5LXGH 3EJZD 5DK2A 4LHJB 5EWIL 1KC5L 1LK2A 4HK3N 5CBEB 5TDPA 4PTUB 1QO3A 3EYOB 4MLSA 4MJIB 2XTJD 3DVNA 3IETB 3E6HB 4R3SA 2I25N 3BKCL 1FYTA 3G9VA 1YNTB 4XPAH 3V6OE 3SGDH 3ULSB 2NY7L 2Z92B 4XI5C 4Y4KC 4KHXH 4BSVA 5ALCH 5EU6A 1ZHKA 2HTLD 3KYKH 4M6OL 5HHME 1IMHC 4RA0C 4KQ3L 5E1AB 1JNNL 4NJAH 4HLZG 5IM7A 4G80A 3O4LD 1HZHH 4NKOB 3GKWH 3LPWA 1OAZL 2A9NH 2W91A 1MLCB 5SX5K 4AM0A 1ZLWH 5E8EA 4IRSA 1KGCD 1TVHB 1V7ML 2P5WE 3MUZ1 4NZUL 3TO2A 3CLFL 3IB4A 2DI8A 1JYWA 5DTFB 5AZEL 2P5ED 1S9KC 5C08A 2LE9A 3KXFB 2IPTH 2VDOH 4YX2L 4QRRA 5J9PA 1OCWH 4NN5B 4ZAKA 2C7UB 3SKNB 2NW2B 4WHYH 2A6KA 3FB6A 4NQCA 3U9UA 1MCJA 2B7DT 4I8DA 1N5AA 2ZCLL 5DRWA 2WWMD 4I9WD 4JFFB 3FRPA 2HLAA 1KBGH 4MNQB 5MEPB 2HTKD 3O45A 3QWRA 3VFNA 2MQCA 4UNTA 1Q0XL 4XPHL 1FCGA 5D6CB 4MCYB 4GSDL 4MA1C 2HP4A 3BP4A 5ESVA 3DARA 1KTLA 1IQDA 4NO2B 4JR9H 4NO3B 1MIEH 3MFGB 4MD4A 4JRXB 3VG0H 4AL8H 4S1SL 3HI5H 1LE5B 2YRPA 5K9JH 3GI9L 4NZRH 4YDIL 4BSWA 3ULVH 2XWJA 2ILLA 3MLSH 5J13C 2CKNA 3FB7A 2HJLB 4MA8H 2XQBL 4XMPH 3O8XA 2EO9A 2QQLL 3CFCH 2DWEA 4PJXA 5E5RB 1NDMA 1EVTC 1FGVH 1V7NL 3GIVB 2Q8AH 1SJHA 1KB9J 4JHWL 4PJEB 1L6ZA 1FO0H 1A4KA 1IZKA 4OQ1A 1HHKB 3GJEB 4F57L 3WDIA 2GK0B 3IVKB 3SKOB 2DLGA 4NQSB 3T4AA 5IEKA 3NZHL 4UQ2A 1P7QB 3ARPA 4UBDD 1ONQB 4IBLT 2N1KA 3CFEB 2AQ1A 5FOBB 5CEYB 1RUAL 4FQ1H 5KANG 3RVUC 2IBZY 5D7SL 5DZLA 3NH7L 3T65A 2IH1B 5JO5B 5E6ZA 3V7MA 3HS0A 1GGIH 1WCBB 1GSMA 1F6AA 3TCLA 3FTGA 1TPXB 4HUKB 1I8MA 1FZJB 1LP9E 2OBGA 3G6AB 2DQHH 4HWEH 1FP5A 2GTWA 1P2CB 4F2MB 2YA1A 2DQJL 4F7EA 1BFVL 3PQYE 5IVXF 1A7OL 3X12A 2MKWA 3V4VH 3KLAB 3PP4L 1MLBA 3GZKA 4FFYH 1F8TH 3CX2A 4EN3C 3L5WA 1VKXB 3N0PB 3ARGD 5LAXA 1W0VB 1JCKA 4L8SA 2WINB 2OLDA 5DEFB 5JORA 2RQ8A 1D3CA 1KLFA 1EO8L 4I5BB 5DQ9A 4P49A 1ZA3B 4HQQL 2YN3A 1WUNT 4XB7A 1JP5A 3ZL4L 2NY1C 1NJ9B 1NH6A 3LKNB 1NCBL 4MNHA 2VZ3A 1CD1A 1VGEL 3IJHA 3JVGC 5AD0A 4ZFOB 1OAUH 1MWAL 4R8WL 4Q58C 5T1LA 1L7IH 4RRPG 4U3XA 5J7CC 3ARDB 4PPTA 1BMGA 2OXHA 2NY4D 4K2UL 4H1LA 1JGEA 4LP4A 2HMID 2BK8A 4LLYB 5I1CH 1UC6A 2C3GA 2OJZL 1SVCP 3EGSA 4FP8H 3GRWA 5ACMA 4P3DA 4ODHH 3P4NB 3QCVL 4DVRH 3MCLL 4PRPA 3RY5A 4X99B 2X4QA 3MV7A 5HHXL 4OV5A 2XPGA 3BQUB 3HZMB 4KY1L 4XMKH 1JMZA 1G9NC 1XGTA 1NC4A 3HE7C 2QBWA 2BZDA 3LY6A 3RWEB 3UTTA 4EBQL 5GSVB 4LSQL 5FO9A 3HNSL 3VXQA 3T3PF 1RK0B 5TGBA 3PGDA 1BD2B 2A1WL 4M7ZC 4P5TC 2WM0A 2A77H 2CGRL 2Q6WA 3TVMB 2F8OA 4JQIL 1KNOA 3S35X 3C5JB 4IS6B 3QIWC 1MI5D 4G6FD 2DTML 2APXA 3DETC 2AJYH 4PJBB 5D6DA 1W8OA 3QI9D 3MRIB 2DN7A 4RFOH 1K85A 1I1RA 2I9LB 4ZD3L 1VACB 4P2QE 3O6FB 3T2NH 3ZTNL 1MCOH 2GUOB 3FO0L 1BQHA 4QY8B 2XA3A 3ZT7A 2VIRA 3TP4A 2BNRE 4JY5H 3JTTA 3KPNA 4ZSOE 1QHOA 2R1WA 4XGZB 5EOTA 5DFVC 1YEJH 2C3XA 1RQ5A 5FHAH 4U1NA 1HXYB 3K81A 4NQDD 1U42A 3GNML 4JO1L 1QLRA 3AB0C 3JV6A 3VFPB 2EH8H 2E27H 1GGCH 1E6JL 4Q9RH 1NCTA 5T5FH 5DVLA 1HSBA 4EI6A 1IGFH 4LRIC 4PREA 3DX8A 2ZNWA 2CK0L 1WK0A 1ZK9A 4RBPH 1G9NL 1I1FA 5H37H 3VDAA 5L2KE 1I8LC 1JBJA 4CN1A 1KJVA 2GKIA 1JPTL 5FO8B 3D18B 5DYOA 1RZ8A 4KXZI 5T3ZD 1EJOL 1WSST 2A6IA 3WN5C 3WXWH 3L3DB 2CKBA 1NGPL 1CWVA 3A67L 3U4AA 4GAFB 1R5IB 3MOAL 5C0JB 1QNZL 5H35B 5MENB 4JY4B 1GRWA 4Q74A 5HHOB 3OX8A 1J0IA 2B1AH 2X6MA 3OKDA 2E9BA 1R5VA 4HFWB 1NUDA 1W2KT 2VDQH 1U8MA 5DWUL 4O9HL 1YY8B 4KVNL 4FOMA 1HN1A 5EZIH 2XIDA 5HJ3B 4HEPG 2OMBA 4K8RC 3DRQB 4M9OA 3KJ4B 3OXSB 4JKPH 2YPLB 1CXFA 4YUEL 4MA3A 4PJ8C 5D70L 3U9PH 4GG6B 2EYRB 5IIEA 3L7EA 3B2UC 1MCHA 3C87A 5BMFL 1BIIB 4E42B 2GJ6E 4OGZA 3BEVB 4HUVB 2COQA 3VXMA 1KT2B 2Q3ZA 1H3UA 2HN7B 3C09C 5GZNC 1ED3A 5CLWA 1JK8B 1HINH 4LF3B 3GSNL 5E8PB 1FN4A 4ZPVB 2HJKA 3F5WB 1UGNA 5EOCL 2DQCL 5GIRB 3CDYA 5L88H 3UJJL 5C3LD 2IAMA 3SOBL 5C2BL 5C0DA 4R2GB 3EYSH 3RGVA 4O5LL 2OK0L 3V7AE 4BQ8A 4LLVB 1BFSA 3TNNB 3H0TA 1CG9A 3MRDA 3TA3A 4NWUL 3TH3T 3R1GH 4QOKE 3HNVH 5CD3A 3GHBL 1CD0A 4GO6B 2GI7A 4JFXB 2QSCL 1Z0MA 1R3KB 2AXHA 1MCSA 2DMKA 3E2HB 5T1KB 1AP2A 1OVZA 2NMSA 2DM3A 4RGND 2Y36H 3MLPA 3UZQA 2ZUXA 5FYJL 2Z31C 2VDML 5DA4A 4IOIA 4NKDA 3WXVH 4QCIB 1QUNA 3KYNB 5EC2A 1X5YA 1SEBA 4ZS7H 1J1PH 2VH5L 4K8RL 2DD8L 5IB5B 3DUSB 5F3BA 2DWDA 4TUKL 5EBMA 5IQ9B 5DUBB 3MOBH 3L3OB 3JWOC 3BUTA 1R24A 4KROC 1T03L 4JM2B 2AEQH 5ACZA 1X6LA 4K7PH 3ZLQC 3QNXB 3EDDA 1LNUB 4EI5C 4GW5A 4OZFH 4ZTPL 3MOQA 3SCMB 1DVFC 2BDNH 4Z0XA 4PRHE 1YQ2A 3MRQB 3NCEB 4OZHE 4GS7B 1QYGL 4M7LH 1DEEA 4NN6B 4AJ0A 3H9SA 2G5BB 3HNTH 4E41B 1A5FL 3IDGB 4OM0H 3M17B 5C0GA 4KMTL 4CMHB 3MGTA 4ODTH 3NIDE 1UZ8A 3QUXD 4X6CE 1T3FA 4NCC1 4RNRB 3MA7A 1PGRB 3K0WA 3C2AH 4L3EE 4Z77B 3QEQB 4YHLH 3W11C 1IGIL 4HBQA 3JZ7A 5IJKA 3ALPA 2F8XC 3BMVA 2FBJH 4M03A 4YHML 4OKVA 5JA9A 3MBEC 1XGQA 4WW1B 1XF4A 5E03A 2WBKA 3UJTH 2EDJA 3JSSA 2ADIA 1U8IB 4LSTH 2EZ0D 3OJDA 2YA0A 4O58H 1HI6A 2Q7NA 3P77B 3L95A 1M7IA 5CEZE 5HYJA 1QBLH 3ES6A 4XZUB 3T1FA 1CBVH 1AGFB 3LZFL 3CK0L 4ALAL 5K9QG 5HVWA 4HS6A 3GFUA 5D1XD 5HYQA 4Z7VE 1ORQB 2J5LB 5L7XH 1GHFH 2LAAA 2Z8RA 1OD9A 4OJFH 3JWOL 3HFML 2D4FA 4NO0A 3W0WD 4OLYL 3BSZH 3CH1A 4XP9L 3RKDD 2MCPL 1JPFB 2JELL 3NFSL 1NEZB 3EOYG 4DVBB 4Q2ZA 3QEHB 3JV4B 4JZOB 1EEZA 4JFEB 4F8QA 3QO0A 2YD4A 1KCRH 4P2RA 3FO9A 1T1ZB 4UUJA 4POZD 5TH2A 2MPAL 3FQUA 4OLUH 1M71A 4M43H 1MHCB 2HRPL 4APQD 3BDXA 5MEOA 5ETUB 4N9GB 4U05A 1NFIB 2DBLH 3OKMA 3HZYB 1S9WA 2VTFA 3V79C 2XA8H 3S4SB 1OTUC 1EHLH 4GG8B 1S9XB 2YEZA 2R0WH 3ZE0E 1HQ4A 1ODAA 3HHRB 3UTSD 4PR5B 5DHXB 3WDJA 1YMMD 4DCQB 4U1IB 2JCCB 3WJLA 4AG4H 5EZJB 4XX1E 4F3FA 4XP4L 4N0CC 2XTJB 4PV8A 2MNUA 2D4DA 2DB8A 5IBUG 1FPTH 4NHUA 2CIIA 5K9QI 3FOLB 4LCWE 1UZ6F 1HYSC 5DJAB 4G8GD 4R7NA 2EICA 3OXRB 4P4KA 4XCYA 4Y16D 3O4LB 1UWEL 4RQQB 2R4SH 5M7QA 2CRMA 4I4WA 4K3DH 1S78C 2BVQA 3HC3L 1H3TA 4C54A 1C8PA 2Y7QA 4EDXA 4JHAL 3CVHB 3OAYH 3G6JA 1H8NA 4XPGH 3RPIA 5IB3A 3RWCB 5IBTH 3MRLB 4MDIB 4Y2OA 3MR9A 1XF1A 1KIRB 1S7QB 3QH3B 1ZOXA 3ZDZE 1OPGL 1A7RL 4EDWH 3FQTA 3LOWA 2EXYD 2EE9A 3S3JA 5EC1B 3BPCB 1QRND 1TJHL 1FZKA 5E1HB 1FNAA 4NZTL 1JHTA 3TNMB 2M8XA 5DUPH 5HYEA 2GW5A 3B9KC 2X4SB 2IG2H 4OI7A 1HOCB 3GI8H 3D25A 3IGAA 4QRRE 4U1MA 3T0VA 2BMKB 3TN0A 2FJHB 3V8OA 1MFNA 3X11A 3LKRA 4P2OA 3V4UH 1NBYB 4NQCE 4F15C 2YUZA 3WIHL 1DP0A 4PRAB 4U3HA 4EOWL 1NANI 2MQ0A 3KPRA 1BBJA 2EEAA 4LU5H 4NUJB 4N0RA 1T7VA 4M1CD 5D1ZC 4FQ2H 3ZKMD 2P43B 4QHKI 2X1PA 1XCTA 4OUOA 5A43C 5JZ7C 5KS9A 1P6AB 3BKJH 4J2XA 3ZYZA 4LIQL 4XBGB 1T7WA 1C5DB 3UDWA 5C86A 3D1MC 4CMMB 1KPRA 4PJ7B 1CGUA 3HRZB 3DX9A 1HEZA 5CKGA 2X4UB 4LK4A 2Z35A 4M48L 1TJIH 3HI6H 4F9PA 1NCNA 3Q2CA 4WCYL 4HJGA 2H26B 3EOBB 2AKRA 4OD1L 3BZEA 1QD0A 4HAGA 2Y72A 5BOPA 4RISL 4HLZH 3QNYB 4HV8B 5B22A 4QRUB 1NFDB 5L9DH 4PJXE 2V9QA 4KC3B 4XHJD 4LFHG 2PYEA 3ZSSA 3P0VH 3PUCA 1AI1L 1CXHA 1OAQL 4ODXB 5I1KH 1JGLH 5CS7A 3LCYA 3QDME 1BGXH 5D5ME 2CMRL 4FFVC 3KPQA 2RFXA 1D9KA 5IGXL 1T4KA 1QFOA 5HD8C 3RUGA 1II4E 4XRCB 4I0PB 4I3RH 1O7VA 3NOIA 1J1XL 4XB8A 5JR1L 2GT9A 1OTTD 4GBXC 2DMCA 1X4ZA 1RJYA 2HT3D 3KPOA 2J12B 3V6FA 2G2RB 1EAPA 2ZJSL 3O2DH 3HZKA 1DBAH 1BJ1H 3ARGB 4JZNB 1D5MB 1WISA 1H5BA 3CDFA 4YBLB 4Y5XA 1UADC 2PXYC 1FVEA 1GGUA 2BXYA 4HHAB 3QFJA 3EYVA 3S36H 1A47A 1M6OA 1WIPA 4DZBB 3P4OA 3QO1B 3DX7B 4HUXA 2E7LA 3BPOC 5DLML 2OL3L 2J88H 1CE1L 3O6LH 5CGYD 1XIWD 4Y5YC 3TIDA 1YEEH 1T6WA 1KB5H 3QEGH 4PLNC 4I3SH 5IROC 4LCUA 2QQKH 4WW2C 4NJ9L 2GJZA 4WWKC 3T2PA 1A3QA 2HT4C 1FAIL 4FQJH 4YHYB 4CJ0A 1UA6L 4YHKH 4R9HA 4X5XA 3BGFC 5D8JL 3PHQB 4HSQA 4UNVA 5KTEL 4CUCA 1D6VL 4PGCA 4JREB 3SEPA 3BGMA 4PJ9C 3IDNB 4OZFA 2AJUH 1YEKH 1L6XA 2VXTH 3VRIA 3WLWD 5CHNA 2ZUTA 3UYRH 3VCLB 4DGIH 5JNYB 4HW6A 1Z9OA 1KJMB 3NMEA 1YNKL 1NEZG 1LDPH 4WGWB 1T6VN 2YD8A 1CLOL 2FEDD 5D2NA 2VDPH 4P0DA 2CRIA 3VXUA 4RMUA 4PJFF 5GJTH 1MI5B 4G6FB 3UTTE 1FL6B 3S34H 4KK8C 4NWTH 1I1AC 2R1YB 2Y4SA 4TVPH 2R2EB 3QI9B 2FNBA 1UB6B 3FT3A 2HVJA 4KJPD 2VC2L 1WGOA 1GC1C 3QDGD 1T22A 1HHGB 4UQ3B 1J87A 5EPMA 5GGSB 1DANT 1BJ1J 5I8CA 4O2EA 1WFUA 5KSAD 4DGYL 1EXUA 2FR4B 4MB5A 2BNQA 1F3JB 4N1CA 3KHQA 2YZ8A 5DR5L 3RP1A 5C8JB 4YK4B 1L9MA 2OZ4H 4N5UA 4NQDB 4B7LA 2VZUA 2R69H 2DLIA 1RZ7L 3EO1A 2VXVL 5F9OL 4QGYA 1S7XB 1R3IL 5IMKA 3DRTB 4BM7A 1AQDA 4O2CA 4MS8D 2C3HA 1OT2A 4Y1AD 3INUL 3ULUE 4KRPC 3AGVA 1NFKA 5FA3B 3REVB 4D9RE 2YPVH 4U6YA 4OSUH 4IIQB 4LOUD 3IDMA 3BRDA 1I3GL 2QHRL 3CD4A 1KCLA 3MROA 4BQ9A 4TULH 3X17A 4U7KA 1JHLH 5TQ0L 2AGJL 1XZ0A 4JE4B 2ICEA 3TCXA 1QBAA 2Y25A 4UI2A 3AY4C 1OGTA 2F58H 4LMQE 1MPAH 4D0DB 5I8EB 1I9IL 3SE8L 1TZHB 3DMMD 1B0GA 5L6YH 1G7IA 5FXCH 2RHEA 3T0EE 1NDGB 1LEGA 2VE6B 1A6AB 1QHPA 2FHCA 3U7WH 3BIKA 4ZO8A 4Y4FA 1K2DA 2YD1A 3KYAA 3VWJD 3X13A 3HZVB 4WO4A 2RIKA 1WZMA 3EYQC 4K94C 5ABDE 5KVGL 1GC1L 5IESH 5IUSA 3MXWL 3QG7L 5I1JL 3DGCR 3S5LB 1HHJB 2E9JA 2ADGA 1WBYB 1T0NB 1J18A 4M6NL 3Q5OA 4NFDA 5DS8A 3TO4D 4MD5A 4WNQB 3OG4B 5CJOH 4Z78B 2YK1H 4PY7B 5DK0B 4L8DA 1QSEE 1ZT4A 3BUYA 4YBQD 4DTGL 4GJTB 5I30H 2ZP0T 5E8OA 3NBNA 3RNQA 5BQ7B 3OR6A 2A73A 1BVKA 3QULB 5I71B 1U8KB 3ETBF 5GS2H 5DMIL 1KXVC 4CVZA 3HCVA 4J8RB 1RFDH 4PG2C 3U36A 4XI5D 4Y4KD 3QSKB 4LSSH 5IK3A 1U8PB 4IEFB 1U8JA 4XNYH 4PJGF 4ZNCD 3WFEL 5GRUH 5CSBA 3FQXB 1X5LA 5B3JE 4IMLA 5GZOC 1S9YB 1J11A 4H88L 2FLRT 2WBJD 1PD6A 4CVUA 3PDOB 4IMKA 1QFHA 4P57B 4HGWB 5ERWA 1FLRL 1U8NB 3KGRA 1K4CB 5EOQH 3PWVB 4QRSA 3CUPB 4JHZA 4YHOL 5H8DA 4XP6H 3UTOA 3PHOA 4RGNB 3MLXH 2WMPA 1L7TL 1HILA 4ONGL 5B8CA 4JN2B 3CVIL 1VFBA 3TZVD 2QQQA 1G7QB 1NCWL 1YYML 4NQEA 5EO1A 1ZEAL 4K94L 4K3JL 3FFCD 4RMRA 2P8LA 3DVFA 3UO1H 3ZKNC 4IRSC 5FGCB 1V3JA 2XT1B 5DD3L 5I1DB 1ZTXH 4LGPB 4P9MH 1K5NB 3FCTB 3B83A 2F74A 2YPKB 1CTOA 2WWKO 4UV4H 2E7HA 4KI1A 4XAWL 3VH8A 4GRLA 1ZS8A 4IDLA 3WUWB 5C0EB 4NZDA 2ZCKH 5FDWA 3RWHA 35C8H 3MRRB 5LGJA 5E70A 4D0BA 5DXWA 2D7NA 2FGWH 2WIMA 1T0PB 1F11A 3RQ3A 5IVXB 1N4XH 3ULVE 5I76B 2R4RL 2CDFA 3VI3F 5JPNB 3QUXB 4KUCF 3G5XB 5FYLE 1GIGL 1GZPA 3TBVB 4U6XA 3UBXB 4GLRH 1DN2A 3L5XH 1G7LA 5A2LH 3LB6D 1LK3L 1LD9B 5EIIA 3F7YB 2A6DB 5E00A 4I48B 2VLJA 3H9SE 4G6ML 1J10A 5E94A 2UZIL 4NSKA 1JJUA 5D7LB 1RJLB 1N6VA 1QSFE 4WDIB 2VR5A 4HPYL 5BJTB 2VWEE 4LRNH 1DQQA 1YN7A 3G6DH 4PJ5D 3GSRA 3P73A 3CH8A 2UY6A 5JW4Q 1MFAL 4F7TA 1S7SA 1BQLH 1F2QA 2WUCL 2O5YL 1RSFA 4JDVA 3GK8H 1XR9B 5D1XB 2DYPA 1MCBA 3LS4H 4L5FL 4WU7A 3I84A 5F88A 3O2DA 1MFBH 4NT6B 3W0WB 5GRVK 5GS1A 1UXSA 1CXKA 1XCQA 2Z4QA 5ITFB 2DJSA 5CP7A 1ULVA 5BV7H 4OM1H 5MI0C 1HSAA 4KHTH 4N8CH 1X5HA 3HPLA 3O9WC 3STBA 4M6ML 3LMJH 4TOYL 1BBDH 4J4PA 2DJUA 3DURB 1F02I 3CDGB 2X05A 4APQB 1UJTA 5FO7B 4L4VA 1GOHA 4YBHA 2AEPH 1K8DB 4ENEC 4DUXA 4A6YB 5HYSB 1KENH 3RAJH 4AIOA 2APVA 4L9LB 1MHEB 1ZHLA 1BVLA 2PTUA 3DYMA 4ZMAT 3MSPA 4FMKA 4P2RE 4Y4HC 3UTSB 5ID0A 2BVUA 1YMMB 1KB5A 1EK3A 5LBSH 1FGNH 4PJIA 4HUWA 4MGXA 3V5KB 5ISZE 2XWTB 5EN2B 2NY1D 2ADFL 4NO5A 5ADOH 1NCDH 3H9HA 4ZPTA 2AV1A 3NABH 3PV6B 2EC9U 2VDRH 1CU4H 1HCVA 2IANA 1YC8A 1NPUA 2APFA 4YXKH 3NTCH 4L8SC 1FSKC 3V9FA 4PGDA 4HIEA 2OR8A 3B5TA 2X1QA 3C5ZA 3JXAA 5DJDB 1AR1D 4YFLF 3QNZA 4G8GB 5IKCB 1A22B 1DEDA 4Y16B 2BP3A 4ZOEA 4TRPH 3WS3B 1XR8B 2FJGB 1TTGA 1IARB 3TJHC 4WFHE 5IHBA 5F8QC 1MAMH 5IJVB 5JW3L 1U8LA 3MJ6A 5BVJA 3MTRA 2HG5A 2X42A 3HE7D 2OI9C 2ZUYA 1PY9A 1CT8A 1MJJB 1I75A 5SWZA 3QQ3A 3WNKA 3I6LE 4PB0L 3AS1A 2EKSB 5IG7B 2HFFA 4WHDA 5E8NB 3IXAB 1CZ8L 4NIKB 2CRYA 4K3GA 3GHEL 4P5KA 3ZHDA 3ZKXB 1CGWA 4FFWC 4GW1B 1VEMA 5MP6L 5FB8B 4P5TD 5I8OL 3BT2L 5L8JB 4HS3B 4OCMC 1QRNB 2X7LB 5GGVL 1ADQH 3H7BA 3QIWD 2NY5C 3W2DL 2M1KA 1MAJA 4AEHL 2OZ4A 2AK1H 5HHNB 3DETD 4G8IB 5KSUB 1GAFH 25C8H 7CGTA 4ESKA 3NCMA 3O6MH 4RGOH 3IT8D 4PRDB 3FT2A 2EDLA 5TFSL 4PS4H 1PKQB 2QSQA 1D5XB 1WTGT 4N90E 4X9FA 4JRYA 4OZIE 5J6GA 1E4WH 1TVBA 4NNYA 5C9JA 3E8UH 4OD3H 5DFVD 2J8UF 5ICXB 1MIML 4J3OC 1IE5A 2ICES 5DFTA 4RRPA 4BQCA 5KVMC 5DZNA 2GSGB 3W5NA 1KCUL 3GMPA 1GYAA 4WHTA 1O0VA 3HRPA 1BOGB 3N1PC 3NPSB 1DBKH 4XCCH 3TBSA 4Y2DA 3RU8H 3KPRE 2DRUA 3VGDA 3ESUF 4F7MB 4ODWA 3BO8A 5C0ND 5GJSL 3TBWB 1XMWA 5F6HI 5C0RL 1N8ZB 4QXUL 4CNIA 5KS9E 5BO1L 4CKVX 1DLFH 1PBYA 5IMLB 3GRWL 4G9FE 4OAWA 4M8QA 1X9QA 1A3LL 1KJ2L 5KAQG 3EOAB 5JDSA 4KZDL 4LDEB 1TTFA 1NANH 4KI5E 1X4YA 2V17H 1XGUB 4ONFL 5DEZA 3ZYJA 5HGBA 3VFVB 4XNXH 1ZGLB 4P9HC 1JIBA 2H32B 2WIIA 3UEZA 3WNPA 4Z7OE 1LGVA 4F8TA 1CR9H 1KFAH 2NY5L 1CF8H 4JJ5B 5CFHA 3KYMB 2JJWA 5F1KC 2OQJB 1I7TA 5DC9B 4LLDB 1LO0H 5I74C 2GAZB 4LAQH 3C6LA 4QRQA 3R8QA 1YQVH 3WIIH 2DQUL 2B5IC 1JGDB 4CU7A 1NBVH 2PYEE 4K8RD 4ZQKA 5GS0C 1OSPH 5E0QA 2OJEA 2BSSA 3N06B 4PJ8D 5J6HA 3LN5B 4GAGH 4CVWA 4QRPD 4UDTA 3WUWG 4O51A 1DR9A 2VQ1A 1IC4H 5EO0B 2CUIA 4MJ2A 5D1QD 2XN9D 4KGJA 5CBEA 1D6EA 1S9VB 4PTUA 3QEUB 3RUGE 5L0QB 4M7JL 4TQEL 3EYOA 4MJIA 2BSTB 1H8OA 3DVIA 4OI9A 4CN4A 3IETA 1IEAB 1KC5H 2F54E 2AJZB 5KSBF 4JGUA 2EDEA 5C0BD 3ULSA 4XNMB 4D3CL 5HHQB 4PV9A 5EB9A 1N3NA 1IGJB 2QSTA 5F1NB 3BKCH 1W72B 1A6VH 3UBXG 1BQSA 4G7YL 5E1AA 4R97C 5LCVL 1MNUL 2NY7H 3VJ6B 1E28B 5DDHB 1YN6B 5I16B 1P5UA 4UT7L 1XIWB 1BFTA 4KDTA 4KUCD 4JDZB 3U83A 4LCCB 5CLTA 1TCRB 3MV9D 4JHBA 3NZ8A 1T2XA 3RJQB 1TVHA 3KYOB 1H0DA 1IKNA 3O0RL 4P9HL 5JW5B 3RGVC 1FC1A 5DTFA 2HFGH 3ALXA 3NN8B 3PXJA 2YUXA 1M7DA 2FATH 4HZLB 4NZUH 5DJYB 4KKBC 3CLFH 4CDGC 3CLEH 4F33B 3TA3C 1OSZB 4Y8DC 4GQ9H 2C7UA 3SKNA 1RUPL 2NW2A 3VD7A 1UH4A 4WFGE 2P42B 1SEQL 3VG9B 3FQWB 4TNVF 3WE6B 4Z7QE 5B38B 5GS0L 1UCBL 4QHKJ 5EU3B 4FS0A 1MY7A 1FAKT 5F7FA 1WWBX 3VDBA 5MEPA 4PUBL 4FG6C 5MERA 5CJQH 5IEHB 2NXZD 4KDVA 3TM6A 4KROD 5D6CA 3WFCH 3WKNA 5HDBE 1QRKA 1DZBA 5LXGL 2UV3A 5J4MA 1T0MB 3UBXI 4NO2A 5JW4N 4EI5D 2XNAB 1HWHB 3RFZC 4GRMB 4NO3A 4QHMA 4OB5H 2FECL 4JRXA 1WWWX 3JWNC 5D7IF 1Q1JH 3QDGB 3SE3C 5HYSG 2HWZH 3SY0B 1URLA 3F7VA 5D2NE 2VLMD 4RDQG 4LQ1A 1F97A 1LQSR 1PG7X 5KSAB 3ULVC 4KHXL 3VXUE 2ORBL 5ALCL 1D5ZB 2Z91B 3A6BH 3KYKL 3K8KA 2J8OA 3OB0K 4YDIH 2R2BB 4XPFH 4NJAL 4U1GC 1HZHL 1JNLH 2MQ3A 3GKWL 1E4JA 1QP1A 3W11D 5IHUH 2A9NL 1GL4B 4ORZC 5EUKB 4C4KT 4KTYA 4NQXA 3B9DA 4WW2F 4C57C 3O2WH 2OTWB 4TN9A 4PJEA 1E6OH 3WNLA 2BNQE 1ETZB 3EJJX 4Y1AB 3MBED 3RWDB 4CN6A 1V7NH 2D7OA 2VWEC 1HHKA 3GJEA 2GK0A 3BPNC 3SKOA 5DC0A 4YDLC 5AYQA 2IPTL 3V0WH 2VDOL 4NQSA 4X6EB 5A16A 1OCWL 1P7QA 3FONB 5JLZB 3D5OF 1ONQA 4FQLH 4V1DD 2YD3A 5INCB 4NM4H 4ZTOH 1ORSB 5EH1A 2R1XB 4AIZB 1KBGL 2IH1A 5JO5A 5IFJB 3MUHL 1NBQA 3DMMB 5MHSE 2D7PA 3MO1A 3IFPA 4FXGB 4YXHH 4M93C 4F2MA 3VWJB 3VXTB 4H26B 4P2YA 2NR6D 4OZHF 1TXKA 4JFDA 4U33A 2HJFB 1MIEL 2I24N 1N2RB 5CZXC 1AXIB 2AERT 3VG0L 4AL8L 3RL2B 3HI5L 1S3KL 5K9JL 4MQ7B 3NIDF 4NZRL 2D0GA 4R4BB 3ULVL 1VKXA 1OGAD 1BJ8A 3B4NA 4X6FA 3MLSL 1W0VA 3MJ8A 3LS5H 3V7AG 2WINA 4MA8L 3TFKD 1WJ3A 2CLZB 2WLYA