3L3OB

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
184
structure length
184
Chain Sequence
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 26
structure length 184
sequence length 184
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3l3oB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3oB02
4KJYA 4JFFB 2O5ZH 1VFBB 5D2NB 3SDCC 4NN7B 1RK0A 4TUJB 3VFOA 1GGIH 4Y1AD 4NQXA 1A7NL 4F15C 3FQWA 3TVMC 3RVUD 1OOAA 4LRNL 5GHWH 4PPTA 2P5EA 1AQDA 3FB5A 5DS8B 5MEND 2DQEL 4JRYE 1XCQA 2KUTA 3WSQH 5DSCA 1QBMH 1HH9A 5FF6B 1KLGA 5IB2B 4M4PA 2OSLB 4QXTA 2VDRH 5HGGS 1IGCL 2DB8A 3CFJB 1WZMA 5DRNA 4P46D 4KDTA 3QZWB 4R2GD 3HE6A 5BV7H 1U3HA 5DF0A 4NBYB 2F54D 2NR6C 1OY3B 3QUML 3ZSSA 4QRPA 4LLMA 2HRPH 3ARGB 3O3DA 3MPCA 1RZ8A 2VITA 5INDA 3WNLA 5CGYD 4HWBL 1CLZL 1RUPH 3OJMB 3UJTL 1U8OA 3MRGA 3GM0A 3MREA 4J6RL 4RBPH 4H25A 5BQ7B 4JO4H 4K3JL 3DRQB 3TN0D 3HI6H 1UEYA 4GW5B 1SJVA 2F19H 3MLSL 3BAEH 2PO6A 5F70A 4HWZA 2YS4A 5MI0C 4FQ2H 1MH5B 3RX5A 1H15A 4YDLC 5DRXB 1KENH 5E2TL 4FA8A 3D18B 3LOWA 4QTHA 4Y5XB 3ARQA 4OGZA 2ZJSH 3BKMH 4JGJA 5FYJD 3VFGL 4HZLA 4QCIB 4EIZC 1HI6B 5FGCE 1T1WB 3VD4A 4FQQA 4PB0H 1MIMH 4M62L 5A3ID 4GAGL 5EA0L 1UKQA 4LCWA 1YEGL 5T5FH 2VDOH 3MO1B 4X6EA 1JZ8A 4XXCA 1SY6H 4K2UH 3W9EB 5JHDB 3HE6D 1IC4H 3GB7B 4LSPH 2HTKD 5IV2B 4NQCD 4Z77B 4E0RB 1FFOA 1KEML 5J3HC 2X5PA 2VLRB 4PJHE 15C8L 3BKCL 4JM2C 2YZ8A 2EIZA 5HYJA 5A40E 3NFNB 3B9DA 3VFSB 3PV6A 2OLDA 3DBXB 5C9JB 4NZJA 1ZHBB 3IT8D 3QUYC 1YPZB 1JGEB 1UZ8A 2F5BL 5EO1A 4UILL 3MUY1 3MLXL 1LK2A 4U1MA 3TBSA 3CVIL 4J8RA 4PS4H 4XCCH 4NQDA 5JW5B 4MJ5B 4ODUB 5F7NC 4LU5L 3E2HC 1EFXA 4WEMB 3NABL 1FC1A 3WE6B 3QNXA 2QQLH 1MQKL 3HMXL 3RVVD 1BD2B 1F6AA 4HH8A 2D4FA 3PGFH 4NNYB 1FH5L 3RJQB 4N8PA 3VFTA 2UUDK 1GGTA 1XF3A 5JXAL 4S1QH 3NMEA 5JR1L 3FQNA 4I0PB 5BVPH 3G6JE 4UINH 4WW1B 1T4KB 4YAQB 3QUZD 5B4MC 3PWLA 3FOMB 1CGTA 4K71B 3H9SE 4ISVB 4J4PC 3SGEH 4K8RC 1A2YA 5D2LE 3RDTA 4XCNB 5DRWB 2NY7L 1ZS8B 1PYWB 4U1NB 3LQAC 3DV4A 4XVJH 5E7FA 3ZT6A 4NN5B 2D03H 3SDDA 1LDPH 4KDVA 1Y18A 4BK4A 3EOBB 3VXSA 1AGBA 1N64L 3DX9B 1VCAA 4K3HA 3QI9A 3W2DH 4AG4H 4AZ8A 3CZJA 1DLHB 1UXSB 3P4NB 2ZOKA 4ZUVA 1FNGA 4RISH 2ZCKL 2YOCA 3LB6D 4LLYA 3EHBC 4IDLA 3B2UC 1T3FB 3OF6D 1RVFL 2ED7A 4OLYL 1MREH 4HPOL 3SDXF 3SKJL 5C7XH 5I17B 3PP4H 4XNMA 4ODHL 2F74B 2ZPKL 4NQDD 2LQRA 3R8BB 1SYSB 3GJFA 2LU3A 4PRHA 1MPAH 2P4AB 1IARB 2YPLE 3UAJD 4FXLA 4YQXH 2Z31B 1EHAA 2G5BA 3SGJA 3P9MA 5B22A 4UTAH 2CDFA 3TO4B 4PRPD 3IB4A 4X5WA 3DOSA 2EH7H 3UJIH 2BVYA 2AJYL 3TJEL 4ONHB 1NC4B 4Z7WE 5F1NA 1BQLL 3HLAB 4GUPB 2FX7L 1JPFB 1CQYA 3DGCR 4KRPB 5J89A 5GGSY 5F7EH 1LO3L 4LCIH 2IC2A 5E4IA 1IC7L 1CS6A 5L2KA 4RFNB 3HN3A 3MUGB 4Z7QF 5ADOL 1WFNA 1KGCE 3HNSH 3IAPA 5CD5D 4XVSL 3MLRL 4FG6D 1A02N 3SE3A 5FHAL 1XF5B 4IS6A 1HHGB 3D3VE 4RAUA 1NJ9A 4EUPG 1G9NL 1KIQA 3DX7A 3ULSB 2MKWA 1KPUB 5ETUB 1BZ9A 5DUBB 4EVNB 4JZOA 4WO4C 3VE0B 5EO0B 4MAYD 3GK8L 5E2VH 5GGSA 2CQVA 4I3RL 3E1F1 3VFNB 5K9KB 5D7IF 2FEEI 1KT2A 4KK6D 1U9KA 3IJHB 4G8FA 4Z0XB 1MI5B 2APVA 5HHOD 3CFDA 4F7MA 2A77L 1I3UA 4KI5F 2JK5A 1EO7A 4ZPVB 1DN0A 1T22B 3FO1A 3LMJH 3TEUA 3SDAB 2X6MA 5I15L 2ZZUT 3SJVE 5DRZB 2XTJD 2CRIA 4LCYB 1S9XB 4WWKA 1ITCA 1DL7L 2JB6B 3MGOB 1FPTH 1FRGH 2W9LA 2CLZB 1JV5B 4HUWB 4Y1AB 1PKQA 1OTTC 3O41B 3F12B 3V4PH 3DPBA 1GZQA 4KGJA 3MXWH 4TYUA 2JJSC 4GJTB 4FFYL 1GCFA 3QDMA 5L7XH 1UKTA 2O93L 1AIFA 1DQLH 4NKQB 2VXSL 5FM5M 1FYHB 4TNVF 1XMWA 3RWFB 1FBIL 1GC1C 1QRNE 2LFGA 3KPOB 4QHMA 1AY1H 2KBGA 4YUEH 3FAWA 4YHYB 2HH0L 4RGNC 4XCEB 4YPGA 3P77B 2PYEA 3BI9X 1JHLH 4L8SA 3PP3H 1EBPA 4JFOB 3FCTA 2IFFH 3ARBA 1QOKA 3IJYA 1K2DB 4G8EB 3QO1A 4G42A 2QHLA 2C3XA 4AQOA 4ELKB 2HT3C 5JXEA 4OD3H 1DUYB 3WJLA 4GAYB 1ODAA 4KY1H 1ZVYA 4DGYH 3UTSB 5ABDE 2VABB 5JHLL 3V5KA 2NY1C 4NKMB 1FO0B 4Y4FD 1N6QL 3NIFE 4ODWA 5E5MA 1PZUB 1D9KB 3DVGA 1FNLA 3RWIA 1DQQB 3OPZH 4MD4A 5F3BA 3FN9A 3GSWB 5CJBA 5CZXC 2VLKD 3TN0B 4M6MH 5LG1A 3BN9D 1A1OA 3R4DA 1P84J 2JELL 4XRCA 1U6AL 1K9TA 4IRSD 3T1FB 4KGLA 3S96B 1FL6A 1F8TH 3QPXL 2BC4A 5E6YA 5FYKD 1HKLH 5HVWA 4PYHA 4RFOL 3PWPB 3JUYA 2J6EL 2X89A 2IH3B 2RGSA 3MV8E 4KZEH 3LPWA 2GJ6E 1DEEA 4HKBB 3PDDA 1OTUD 1KCRH 2Y9RT 1JN6B 1IRAY 4Z0BH 2CJUL 1SBSL 3V0VA 1XFPA 3DI2B 3STZB 2W0KA 4YHMH 2VXQH 1ZEAH 5I8OH 3OWEA 4HCRH 5GRJH 5BV7C 3C8HA 2E9WA 4YDJA 1V7ML 1NGWA 4XAKD 4LQFL 4NQUA 1RZGB 1CI5A 3W0WD 4LARH 4M8QB 1A3LL 5IVXE 5A43C 2CXKA 2FHBA 2MHAA 4NQCB 4V1DD 2ZWLT 3WN5A 4ONOA 2DL9A 1HINH 5ACLA 3A6OA 4NZUH 4IIQA 4ZAKB 4RNRA 5HHVL 2ZUQB 3QEGH 2BNRA 4Y5YA 5KS9A 1XGQB 3QQ3A 1ZA3B 4RCAA 5H8DA 3LRGA 3MA7A 4HXAL 3RVWD 4XPTH 2H6PA 4HAGA 5T1LD 3CXDH 3IXAA 1RJLB 1JWUB 3QIUA 4BUHA 3PDGA 3RBGA 1EUUA 2P5WD 3GRWL 5DXWA 3REWB 5GS0D 4QHKJ 2D7TH 4LBEA 2DLGA 1A21A 4DZBA 1JPGA 1KN2H 1JFQH 4XP9L 4WHTA 1Y0LB 2FLRT 1JIBA 4HWNA 1CE6A 1CXFA 2NPLX 4NUJA 4D9LL 5EIIA 1AD0B 3BJ91 4MDIA 4R96A 3EYFB 4UAOC 5MP6H 4MA8L 4KI5C 5JPMB 1CIUA 1M1SA 2UWEA 2AXGB 1QBLL 3PE9A 2XFXA 2EDLA 4PYGA 4JFXB 1EGJH 3LKRB 1G7PA 4IDJH 3QUZB 2AJXL 2YD8A 1S9VA 2DBJA 4Q97A 3KHOA 2QQQA 3DXAB 5FV1L 2PYFB 1RK1B 1AP2B 4YK4C 3GBML 1TTGA 4EUPB 1EEZA 1FFRA 2BVTA 2V6HA 2DBLH 1RQ5A 1Q9LA 4IRJD 4GS7B 3VXQB 3GKWL 5DD3L 1WIUA 3MZGB 3R1GH 1PG7X 3VD3A 1F4WL 5AYUH 4XBGA 1JZ6A 3N1MC 1AXTH 2HJFB 3VXRD 1IVLA 4EDWL 5IK3B 3QEUB 1I1FA 1IILE 4OCWL 4LF3A 3P4LA 1HN1A 2X4SA 3B43A 5E2WH 5MEPA 3P4OA 4HW6A 1EEYB 4I18A 5HHXL 4TVPH 2GK2A 4Y89A 1S7RA 1BBDH 5I1HH 3I02A 4NFCA 1ES0A 4JQXC 1U8LB 1A7QL 1QTYT 3RWGA 3UYOD 3AB0C 1OAUL 2AEQL 8FABB 3L9RB 4HIHB 3KYNA 1JGDB 2CDEA 4U6HA 2X4OA 2HT2D 2E6JA 2E27H 5J6HB 3Q6FB 4PRPB 2VRAA 5B39G 4L8CA 4GSDL 5C07E 1Q0YH 4LHJB 4DKAA 2YMXL 2BP3A 4I9WD 4OAWA 1F90L 1J8HD 1BFVL 1DJSA 4ORZC 1WCQA 1IM9B 3AS3A 4LNRB 3RHWK 4OLVH 2H1PH 3OR7A 2VLJA 4QOKE 2H8PB 5JORB 1NANH 3VWJA 1EZVY 1D5MA 2VISA 3O6KL 1HXYB 1UM6H 4MJ6A 1FNEA 1EK3A 5GS1C 3D9AH 4CMMA 3VG9B 2X4PB 5F93C 1DDHB 3QNYB 1J5OL 4Z95H 2ICWA 4TULH 2I25N 3MRFA 3KYOA 4S1SL 3P73A 4AM0B 1CICB 1CXIA 1AKJD 3MRLA 4LEXL 4M3JA 4AQ1B 4HKJA 4TUOB 3QA3B 2B1AH 1W0WB 1EVTC 4D94A 5F9OH 3V7AE 4OCLC 1EAPB 1FVDA 3IGAA 4M1CC 2PXYB 1JHKL 2Q8AL 3RAJH 4HD9A 1UZ6F 3FZUD 2VDNH 1M6OB 1C08B 2EDDA 3DVIA 1EJ6A 4OT1L 5D1XD 1RZIA 3WD5L 1CLOL 4XPBL 5EOQH 4QLRA 1UA6H 2ZG1A 3V6OC 1B4RA 2NXZC 1LP9F 3ULVH 1BJ1J 1OW0A 4HF5H 2HLFC 4NO2B 5AZEH 2QTEA 4L4VE 1O7SA 3ZKXC 2CLVB 4LDEB 1CD0A 5JMRA 3QH3A 3PHOA 2V5YA 2XOTA 1BFOB 5HVHB 4I2XA 1YMMD 2FJGB 4MA1B 2GEEA 4R8WL 3U0PA 3VJ6B 1QFWI 2ZNXA 5GGRB 5E8EA 2EKJA 3QULB 3WKML 2Z8SA 3IYLW 2I26N 5LXGH 1EHLL 2YR3A 3RWHA 1RSFA 2A2QT 4NO3A 3NIDF 5EC1A 2E7CA 1XF4B 4WTZG 1QLFB 4MQXC 1D5XB 2ZOLB 4CNIB 1R6VA 2IANA 4HFWB 4JFDD 1SEQL 4HIXH 2O61B 5FCUL 2IG2H 4PGEA 4Z7VF 1UVQB 2UY7A 12E8L 4GH7B 3OKLA 2R2CA 1B4JL 5BOZG 1VGEL 3ARPA 2R8SL 3OKKA 4FFVD 3O3AB 5EU6B 3UXFA 2BMKB 5KOVC 3R8QA 5IEHB 5C0JB 2BVOA 1W0VB 3VFVB 1PG7L 4MXWH 3HI5L 1L0YA 3MBXH 4QRSB 1KXQE 4JANB 4IRSB 5DUPL 1OL0A 2Y4SA 3L1OH 1IEAB 5MHSE 3EJZD 4P9HL 1K8IA 3QJHB 3QQNA 4MS8D 4OZFG 4F7TA 3SGKC 3W9DB 2R0KH 3RU8L 3WFEL 1X4ZA 2LAAA 2AAVA 4P2OC 4QRRD 3CFJA 3QWQB 3QZWA 5EU3B 4QHLA 4CU6A 3B9VA 3BP5B 3GHBL 4A6YB 3GMQB 4WEBH 4LKXB 1MCPH 2PTVA 3CU1A 4IJ3C 3IU4L 4LSUH 3EIFA 3W0WB 4YJZL 4IEFB 3GJFH 5D1QA 5E99L 5E8NB 4V1DB 4IOFC 3AREC 3WXVL 2DQCH 2Q8BL 3GMLA 1FSKB 5KSAC 3IKKA 4DOHE 3PHQB 5BQ7A 4JDZB 5FO8A 4U6VL 1W2KT 3DRQA 4LLDB 1CTOA 1GH7A 4GW5A 4G8IB 4PFEA 2J3SA 3NFSH 5T1LB 3C87A 4LSDA 3JWOH 3P30H 3MOBH 1BFSA 1LQSR 4G43B 3HMWH 2W59A 1ZLWK 3VRIB 3EYSL 5FM5O 4NQEB 5DRXA 3V6FB 5B39B 4HDIA 5IROC 4G6KL 4ZUUB 2QADD 3D18A 1FNHA 2NY3C 4IMLB 4LSRH 4OUOA 4PJ7E 4NPYB 4W4NA 4Y5XA 1NMAL 1ZT7A 3B9KB 1HI6A 2YRLA 1T1WA 1L9NA 4Y4KA 4XHJC 3FT3B 4EDXA 1KF9B 2VC2L 1UWEH 5J7CC 3S35H 4OLZH 4ZQKA 5I8CA 3CVHB 1IKFH 1SHMA 3MO1A 5J11C 4WUKL 2L4OA 1DBJL 3W9EA 5JHDA 5JDJA 3MLUL 5GZND 3GB7A 5KVFL 3EUUA 2R2EA 1KB5B 4P23C 3W81A 4D9RD 5IV2A 1NFKA 2CIIA 4NKIH 3GSUA 2UUDH 1AHWB 5FO9B 4JPWH 2SEBB 2AXFB 2VLRA 4KUCF 2EEDA 4TRPL 1VADB 3MLTB 5TFSL 1IM3B 3SO3C 5BRZE 4XAWL 3WS3B 3BQUD 3VFSA 4WV1A 4ZD3H 1YPZA 1JGEA 3CFEB 5DLMH 4Q2ZB 5HDQH 3D85A 2VKWA 3ULVF 4QEGA 1A6ZA 5EBWB 5ITFB 1D3CA 2Y72A 3VXRB 3QT2A 4X6BB 2VNCA 4MHHI 3N9GH 1JP5A 3TBYB 3QIBA 5T1DH 3U4BL 2FRGP 4NOBA 5SWSE 4NP4L 3HI1B 3LN4A 4JFYA 2XXCB 5FYKH 1DBMH 2HWZL 2V9RA 4Y4HC 5KANG 1HCFX 2IAMC 4RDQF 1BD2A 1AR1C 2X2YA 4FQHB 4P5TC 2B1HH 3M1BA 4NNYA 4DVBA 3G5VA 1JTTA 4DGVL 3FO9B 3HG1D 5DJYB 3UTQA 1F4XH 4GMSH 4QHKI 3OXSB 4WW1A 1T4KA 1MCSA 5D96B 1FE8L 3H8NA 4K23L 4YAQA 3VXPB 4ISVA 2Z35B 1BIHA 5DO2D 2Z4QB 3BXNA 4BFBD 2IH1B 1ZS8A 1PYWA 4U1NA 4QHUB 4R2GC 1KCKA 3H9SB 4R90L 3EYUL 4OJFH 3EOBA 1D6VL 1IFHL 4DW2H 4UV4L 1J8HB 2BSSB 3IFLH 4WWID 1JHTB 3MACH 4XZUB 5DD5H 2Y23A 5E6ID 3B83A 4BZ1L 5ID0B 5IBTL 5GGQL 1WISA 1XGRB 5I18H 3QUMA 4JGUA 4HUUA 5I30H 4I4WA 4Z8FH 4YE4H 5DQDL 1FGNH 4ZXBD 4P2QE 4AEFA 1EO8L 3MCKA 4EI6B 1BEYL 4MNGA 5ADPH 4PJ9B 1WITA 3OB0K 1G7MB 2JJTA 5JA8B 4F8TA 2DI7A 1HCVA 4MD5B 4QY8B 1OAYH 1T7ZA 3AM8A 4OZHE 5AG8A 1SYSA 4LLWB 2K7PA 1A4KA 4JREB 4KI5E 5GS2D 3DJ9A 4PRNA 1D5IH 4CW1B 4WI6A 4NSKA 3G08B 1J0YA 2NX5E 4TPRL 1YECH 1CK0L 2AK1L 4G8GA 4KKNA 3VA6A 3TO4A 4YO0B 2OZ4L 1JF1A 5DJ2A 5IVNA 3CFKB 1QSFB 3BJLA 1BM3H 1B3JA 1NC4A 5CD3A 5CIPB 4OZFB 1OCWL 1U42A 2HFFB 4OZGE 1T66C 3HLAA 5KZCD 4GUPA 1QUNA 2H45A 4KDTC 3S98A 4Z7WB 3HE6C 1U3HC 3OQ3B 4PG2C 2ERJB 4U0RC 2MFNA 4TVSa 1Q0XH 3LKQB 4NC2B 1J0HA 4JO1H 4TTDC 2IALA 3MFGB 1YMMB 3MFFB 4XP1L 4PLNC 1N59B 2QSTA 1VEMA 4HFUL 1FNSL 2Y06L 1J9CT 2IBBA 1I9JL 4MAUL 4TSCH 1XF5A 1EX0A 1HHGA 5I6XB 3L3HA 3D5OF 4PRDB 5EIVA 5AEAA 3TWCH 1KPUA 4KKCD 5EFIA 4YFLF 5DUBA 6FABL 1XT5A 5EOTB 5EO0A 1NL0H 2D4DA 3VFNA 4GG6E 5K9KA 2PO6C 4KUZL 1OGAE 1ADQA 3G6DL 3IJHA 1H0DA 2H32A 1L7TH 3HUJF 1MI5A 2EDWA 1MJUH 4GKOA 2XI9A 1RFDL 5CJOL 1CL7H 3RVVC 1HDMB 2P8MB 3BO8A 2E7BA 3PXHA 3SDAA 4L4TB 4IRZL 4JHAL 3HMXA 4GRWE 5DRZA 4P57B 3ULVC 3IKCB 1T0NB 4GW1B 3MRMB 4LCYA 1S9XA 2DQIL 4NNPL 5CCKL 1HYSD 4HKXB 2JB6A 1G0XA 3MGOA 3V6BR 3WJJA 3ECBA 1TJGL 1JV5A 3I50H 5KSVB 3EDEA 4KK8D 1WC7B 3QFJD 3F12A 4FABL 4XXCC 4PRBB 4ZS7L 4J1UB 3FT2B 5JNYB 4AYFA 4P4RA 1B2WH 1JZ3A 5ESQA 1A6UL 1G9ML 2MQ0A 3TNMB 4QRUA 1BQUA 1PLGH 4I8DA 3DUSA 5E00B 2APTA 2QQNH 1S7XB 4U1SB 2H2PD 2ADIB 2A0LD 1TTUA 3I2CH 5GJTL 5AAMA 3E8UL 4S0TD 3M17B 4OM0H 1F45A 5HYQB 3MODL 4XCEA 2QLVB 3OSKA 4WUUE 3G9AB 1OAZL 1PY4A 5AD0B 2J4WH 3T0ED 3BWAB 4UTBH 2QKIA 4PD4J 4G8EA 1FDLL 4HSQA 4ELKA 2B0SL 2ZCLL 1MVFA 5E08L 2E5EA 1MCBA 1DUYA 2Y07H 2ZG3A 3MV11 4GAYA 2G5RA 4LIQE 3U2SB 3LKNA 1WUNT 1PZ5B 3C09C 4TUKL 5I1CL 4KV5E 3UAJC 4Y2DD 1U58B 3C60A 3BZDA 5LGJB 4NKMA 1FO0A 5GQBA 2R4SL 3P0VL 4PR5A 1D9KA 5ISZE 5CINL 2FZ3B 1IQDB 1DQQA 4ZNEE 4G7YL 3GSWA 1DANT 2QSCL 2BSED 3MJ9A 1KLUB 2AJZB 5I8KL 5C0BD 1TIUA 1CD9B 2NY0D 1GPOH 1MEXL 5ICXB 3T1FA 4YEEA 3S96A 1OPGH 4Y16A 1QR1B 4JPKL 4NKDB 3LEYH 1QSZA 3RDTC 4KPHH 1JZ2A 4LPTA 3PWPA 4D0DB 3SDDC 3UZEA 4OCXL 4ZOCA 3DVFA 4HKBA 1G7JB 3TV3L 3HC3H 1BAFL 4FMKA 3OKNA 3QI9C 2GUOB 4OSUH 1FAIH 3WO3B 1JN6A 1H3TA 3WUWG 1OTSC 1GGCL 4KQ3L 4FG6C 5DMJB 3S7GA 4C83A 5CEZE 5GISL 4ERSH 4U1IB 3H0TA 3RNQB 1GHFL 1ZT1B 3SN6N 3WHE0 3TYGL 1KEGL 1R5VB 1UWGH 2NYYC 3DTXA 5K9JL 1RZGA 3GI9L 5DMGD 2W1NA 4M8QA 5EZOH 4U1JB 2R2HB 1A6VL 2R29H 4OFYD 4R7NB 1CGWA 2XQBL 2NY2D 4ZAKA 5C1MB 1U8MB 1ZXQA 3BZ4B 2MCPL 1JZ5A 4M61B 2X4RA 1XGQA 3BRDA 1ITBB 2EE3A 1JNLH 1RIVL 3IJSB 1U8IB 5D72H 2LTQB 1MRDL 2HVKB 3GSQB 4L1HA 2LABA 4P4KA 2XTJC 5DD6B 5KVDL 3REWA 3UPAA 3AAZB 2HMID 3JWOC 1HHKB 5ACZA 1YEEL 4NNXB 2WWMD 3LS4L 4UU9B 2QQKL 4ZUWB 2G75B 3DRTA 1WWCA 1Y0LA 2XZCH 5KAQF 1MF2L 5FYLH 2YPKB 1YJDL 3V4VH 3VFRB 3EYFA 2R1WA 5JPMA 4FFWC 1YDPB 2AV1B 4NWTL 4CMHB 2AXGA 5GRWA 3LQAL 2CRMA 1U93A 1CQKA 4XNXH 1R24A 3HG1B 5C6WH 1S7TB 1KACB 4M6AA 4XP4L 4JFXA 4OIIH 4QNPF 3MLZH 3U30B 5KS9F 1MELA 3ULUD 3HC0B 3GJEA 2XZQH 1T2JA 3SE3C 2A83B 4M7KL 2F9BT 1S5HB 3DXAA 3D39E 5TE4L 2XZAL 1RK1A 2D9CA 1RY7B 4G6AD 3SQBA 4PJDE 4ESKA 3QEHA 4QWWC 3EYVB 5DMIH 3GNMH 5M94B 4KVCL 3TYFA 2WLZA 5B38G 5T3XE 2HJFA 3GMMA 5DT1H 5IK3A 1FNAA 5I1DB 1FZOB 3K8KA 3K4AA 4YHOL 2UWEF 1RJYB 1CE1L 1FFNA 1EEYA 3WMSA 4PB9H 2PW2B 3BDYL 1UCBH 5DK0A 2QSQA 5IWLA 4UT9H 3IFNH 4UMGA 2P7TB 1UZ6E 2E6PA 1ZHNB 4FQJL 4FQXD 4WWKC 2EDKA 3O9WB 1X5FA 1U8LA 3CC5B 4L3EE 2XRAL 3DUHA 3O4LA 1C16B 1UYWL 4N8CL 5D70H 1DBBL 8FABA 1TCRB 3L9RA 4HIHA 3NA9L 3AS2A 1MFAH 1N0XH 4F7PA 1VKXA 3TZVD 3U7WL 1FYTE 3QWOB 4KK9D 1OTUC 5EOCH 3SE4A 4Z7OF 4HGWA 3NIGF 4E41D 1P7KB 4PTUB 4KROB 2BVPB 4OBSA 4PJFE 4NGHL 4HPYL 4XCYB 3MRHB 1XF2A 5H35B 3U0TB 1IM9A 4LNRA 2HFTA 4P5KB 4L8SC 2DI9A 2OP4L 3QWRD 2R0ZH 2ADJA 1J05B 4P3CH 3RKPA 3ARBC 3KPNB 5F21B 4DQOH 5D5ME 4MA3B 1HXYA 2RCSH 3KPLA 5JXEC 3VDCA 3WJLC 3O6MH 5DJXB 3TPUB 3BHBB 5ECJE 2X4PA 1DDHA 5EZJB 3THML 5ALCH 4Z7VE 1HQ4A 3O2WL 4MQ7B 4PLKC 4N0UA 1CICA 3GFUA 2UV3A 1UXWB 1LHZA 3NAAL 3BESR 1A7PH 2CR3A 1NCBL 5IB4B 2ZCHL 1BP3B 3ZKSD 4CL7A 2DTMH 5ESVA 2PXYA 3M07A 2F5AH 2OTWA 3T04D 3QIWB 1J8KA 1GOFA 4KK5D 3GRWA 1NC2D 4B50A 5C3TA 2Y6SC 4MZ2A 1ZOXA 3BZEB 5GGRY 1A1MA 1HOCA 3R0MA 4NO2A 5TPWH 5EORH 1JK8B 5J13B 2WBJD 2XWBA 3FO0L 2BK8A 1CGSL 1Q72H 4JRXA 1KJ2L 1AGDB 2WUBL 3WUWB 5IFAH 3QFJB 3BKYH 4NHCL 3IDNB 2JF1A 1RV6X 3VJ6A 5GGRA 2CRZA 5FO7B 1JPTL 3QULA 2GJJA 4XP5L 1NLDL 4FS0A 4LEOA 2YN5A 1NCAH 2VLLB 3WN5C 1A5FH 3KR3H 3RTQD 4Y5YC 4LVOC 3ARDB 4TSBL 4JZJB 4CNIA 5DR5L 1HHIA 4DJMA 4HFWA 4NQVB 4XNQB 1MHCB 1KIUA 3QIUC 3RKDD 3SKUD 1JGLH 4JB9H 3OKOB 2GK0A 5K9OB 4M5YH 1ZHKA 5EWIL 2HTLC 3ESVF 5GS2H 5TQ2L 5K33A 1UEMA 2VR9A 3WLWD 3EOAA 2FL5B 3T2NL 3QEQE 4XPGH 2M1KA 2PR4L 1A7NH 4JKPL 3O81A 4Y2DB 5F89B 3O3AA 5EU6A 4GXUM 4LRNH 4UIKL 5CFHA 4JFEB 1SMOA 2BMKA 5IEHA 2DQEH 1IL1A 2CH8A 3IVKA 2HT2C 1NCUA 1W0VA 2M2DA 4OD2B 4QRSA 3ZT5A 2VLMD 3MRDA 2NY0B 4MLSA 4QRPE 1QBML 2YD2A 1IGCH 2X7LA 4M7ZB 3LH2L 1RULL 1IEAA 5IBLD 2VDRL 3FAXA 2V5MA 2WBWB 5DVMA 4X6CB 3QXVA 3TT3L 2AQ1A 1GZPB 3V79C 3KPRD 3WIFB 3QUMH 1ZTXL 3WUZA 4M5ZL 1T1YB 3BEVB 3NCYS 4OGXH 4HXBL 1CLZH 3BOVA 3UJTH 3AS0A 1U8JA 4NWUL 2QV2A 4J6RH 1KTKE 1OP5K 5B38B 3DROA 1SQ2N 4K3JH 4I18C 2DWDB 3SKOB 5KG9B 3MLSH 1BBJB 1TMCB 4DN3L 4LSTL 5HHPA 5D1XC 4RMRA 3PHQA 5TQ0L 3DSNA 1P84K 2YSSB 4FQCH 4LLDA 2EKSB 2DQHL 2BOBB 2ITDB 4C56D 4QT5B 4MQSB 4JKMA 5E2TH 5BOPA 1R3IL 1QFOA 4PY7B 3WNNA 2FCBA 2N4IA 3VFGH 2CR6A 1AQKL 3TCLB 1MCIA 3VRIA 1JNHB 3ROLB 4NQEA 1F4YH 5MEOA 4M62H 4GAGH 2X4QB 4ZUUA 5EA0H 4IMLA 1YEGH 4NPYA 1MIML 3B9KA 1KJ2B 5HYJE 5DC9B 2H26B 2ARJB 3ARXA 2YKLL 3UZQA 4JRYD 5F6IC 5F88A 3VXUE 1U8QA 3VWJC 4S2SB 2NXYD 2C3VB 4LLVB 4L3AA 1KEMH 1AO7E 15C8H 1ERNA 2XN9B 3BKCH 1DBAL 1C12A 2O26U 3I6GA 3ZE1F 1GOGA 1KB5A 1JMZA 3BGFC 3RL1A 4O51B 2F5BH 2PNDA 3L3IB 4HUMB 5CEYB 4UILH 5FO9A 2ADFH 2AXFA 4OQ1A 3K80A 1VADA 3MLTA 4W68A 3DYMA 1IM3A 3MX0A 4QRTA 3WS3A 3CVIH 2H32H 4LVNB 3FONA 4PJHA 4BFIB 3CFEA 4Q2ZA 4PS4L 4LU5H 3X11B 1NCNA 3CH1A 4J12A 3I3BA 3QDJD 1NMBH 5ITFA 3NABH 1G1YA 2A6KB 2BY0A 1N2RA 1MQKH 3HMXH 1OW0C 2AVGA 1YNTA 5FUOL 3TBYA 4HLZG 2UZYB 1FH5H 1WAAE 2CGRL 2YHGA 4N8VG 4KKLC 4OKDA 4PJGB 4MX7B 3VXSE 5JXAH 4FQXB 5JR1H 3HPLB 3KWWB 4M1GL 5H94B 3AC0A 5H37H 5SWSB 1NGQL 4FQHA 4P3WA 5D1ZD 4P59H 2NY7H 2ATPB 3BP6A 4UNUA 5IEKB 1N64H 1BF8A 1LDPL 5I19L 1YPZF 5L88L 2IH1A 3CDCA 2ZUUA 4L9LB 4E41B 3RIFF 4QHUA 4YHPA 5CLTA 1B88A 2BHUA 2H2SC 3H9SA 4EI5D 1ORSB 4JJ5A 5FB8B 2ZCKH 5D2LA 2BSSA 4MMZC 3PWNB 1EH9A 2R4RH 1RVFH 3FTGA 4POZD 5C0DB 4OLYH 3SKJH 3GIVB 2Z91B 3MV7B 2AKRB 5EBLA 4ODHH 5E8DL 5FGBA 5J4MA 2ZPKH 1S7WB 3S88L 2RAMA 2IPUK 3PG2A 1MRFL 5GRXG 4EI6A 3L7EB 1A6TB 2EEBA 3IFPB 5EPMA 5JA9A 3MV9E 4PRID 4PJ9A 1G7MA 3MJ9H 1H3UA 3L3DB 1GIGL 3CK0L 4YQXL 3KYMB 4F33B 1OQOA 1F13A 4EN3A 1FL5A 4LLWA 4LIQL 3T2PA 3VXOB 4GBXD 5DFTA 4R26H 3MMEA 3P11L 2AJYH 4N5UA 2XWJB 3TJEH 4AL8L 5L2KE 4PJCB 4OZHB 2JTDA 2OI9B 3G08A 5MERB 1BQLH 3PXJA 4O2FB 1ZWIB 2FX7H 4YO0A 4WU7B 2FECL 3CFKA 1QSFA 5E56A 2EXYD 3F8UB 1AFVL 3KLAB 5HYSG 4JN2B 1TZGL 1IAKA 2WBJB 1LO3H 4NDMB 2HFFA 2YUVA 3V6ZB 4JY4A 4LCIL 4XP6H 1MCHA 4PBVC 4Z7WA 4XVSH 5ANME 3MLRH 4MWFB 5FHAH 3IDUA 5JLZB 5EBMB 1G9NH 3D87B 1YEHL 2BOCA 2YPVL 5GSRA 1YNKL 3MFFA 1C1EL 5KW9L 3L3KB 4JJHA 3WV0A 5D1QC 3BQUC 3GK8H 4OIAA 3O8XB 5CEZL 4I3RH 3ORJA 3K7UA 4PRDA 4LAJH 3DARA 1W8OA 2DKSA 4DWHA 3D3VA 4YNYA 5EOTA 4H1LG 3V5HA 1HXMB 2A77H 4ENEC 4NQSA 3DNKA 4G9FD 1QVOB 1WSST 2HN7B 4X4XB 3T3PE 1U8PB 5I15H 3CSBA 2YD6A 3DURB 1JYWA 5IB1B 2E9JA 3GM8A 5DVLA 2FECI 1DL7H 4GG6B 4Y0GA 1PD6A 1OGAB 1ORQA 2V2TB 4JVPA 4EBQL 1HDMA 2YPLD 1LNUB 2NY4B 1FRGL 1TVDA 4Y5XC 1TZIB 4GAFB 4XX1G 4YLQT 4L3CB 3IKCA 4GW1A 3MRMA 5JOPE 5C0IA 5KSBE 3V4PL 3MJ8B 4Y4KC 4HKXA 4Y19D 5IMLB 1NCCL 1F00I 5KSVA 3SKMA 3SJVA 1ACYL 3UX9B 2AK4E 1K8DA 1WC7A 2N56A 5DO2C 1I7UB 2VXSH 1NFIB 5H2BA 4PRBA 3T09A 1LE5B 5JNYA 3FT2A 1FBIH 2WK2A 3VXME 4FTVD 3I84A 3GSNL 5LAXB 4E5XB 3P9WB 5IHUL 1UJ3B 4LDLB 5D9SB 4HIIB 3TNMA 2HH0H 2OJEB 4YUEL 3WO4C 1A3QA 5E8OB 1CWVA 3PIQB 5SWZE 2WSKA 3VDBA 5BS0D 2I9TB 1FG2B 1TNNA 4WV1C 2R1YA 1KGCD 1G9EA 4WHDA 5DVNA 3ZKMC 2B5IC 1EV2E 5AD0A 4KAQH 5JHLH 5TDNA 3BWAA 1FORL 1N6QH 1OSPL 4P48A 3LY6A 1IZKA 2FEDC 1RZFL 3S34L 3QIBC 1CYGA 3U2SA 4OZIB 1DQJA 5T3XL 1DLFL 1U6AH 4N8VB 3I6KB 4HGMA 3U6RA 1J88A 1IQDA 3KPSD 4HJGA 1OM3L 3QPXH 3CX2A 3WKNA 2V7NB 4RFOH 4HG4J 5ISZB 1HKLL 4YHNA 3RA7L 1VEOA 5ICXA 2OZ4A 4K71C 3V2AR 2FX8L 1QR1A 4WHCA 5TDPB 4D0DA 1Q94B 5HI3D 1I7TB 4NN5C 1SBSH 1T83A 2JE8A 2EIEA 4EIGB 4WENB 3AXLB 1DQTA 1G7JA 1URLA 3BPCB 1CDBA 1ZEAL 1PY9A 1T2QL 5IW6B 1MLCA 4MJIE 5EDXA 2W0LA 4X9BA 5DJCB 2GJ6A 1A3LH 3IAGC 4MLIA 2P8LA 3X13B 3RNQA 2VO5A 2MMXA 1DZBA 1R5VA 4PLJD 3LDBB 5HHQB 1QRND 3MRCA 4XMPL 1NFDB 5L0QC 4HXAH 2IBZY 5FOBA 4U1JA 2FD6L 4R3SA 4MA7L 5AAWA 1XIWB 1MLBB 2Y25A 1QEWB 4R7NA 1RU9L 3GO1L 3AM8C 3DMMD 1OD7A 5IVXA 1U8MA 3SKNA 3BZ4A 3GRWH 2UWEE 1YNLH 5BCAA 1KLFA 1U8IA 5EU7C 3HR6A 2HVKA 3C6SB 4R4BB 4XP9H 3VMOA 4KKAC 4U0QB 1KN2L 3QDJB 5EG6C 4RFEB 5DD6A 1HNFA 5E9DB 3AAZA 2H9GB 4MA8H 5FHBL 2VZOA 2X41A 4FN0A 4NNXA 1OAKL 1N6UA 2G75A 4Q6IB 1QBLH 4KK8C 5A2LH 5HYSB 2YPKA 5D7SL 4I3GA 1B0GA 4Q0XL 3PL6D 1OD9A 3AU1A 1BVZA 3UBXG 3RL2B 2AV1A 3RPIB 4KRPC 4MNQD 4QHNA 3D6GA 5D1ZB 1F11B 3DVNA 3MC0A 4RFNC 5DGQA 5CLWA 1J18A 3MV8D 4KXZI 3GBMH 1Z5LB 5ID1B 3FHQA 3HE7A 5CWSB 3MBED 3MRIA 2A0LC 3OAUL 1D5BA 1R3KB 4K55A 1QSED 3GKWH 4YHIB 5DD3H 43C9B 2CKBL 1S9YB 1F4WH 5JZ7D 5KVEL 3IDXL 4EDWH 2ZUXA 3UYPA 4DFHA 3CDGA 3U36B 4OCWH 4ZFOL 4H1LB 1P5UA 1QLEL 3JV0A 5HHXH 1VB9A 1NUNB 3VFMB 4FP8L 5JIIA 2UZXB 1I8KB 1ZANL 4PREB 2ZSWB 5FUCC 3CSYA 1FZOA 1BOYA 1BBDL 5I1HL 5I2IA 1ZLSH 5JW4M 2Q20A 2CRYA 3SDCD 4F2MB 4M6NL 1PEZA 5BW7C 1XEDA 5CP7B 4BQ9A 1OAUH 2AEQH 2PW2A 3SDAC 4POUB 4C55A 2P7TA 43CAB 4LHQB 4BH7B 4PV9B 3TVMD 5C0NC 3O9WA 3QFDB 3WJJC 1SJHA 1YEDA 3Q48A 2WNGA 3CC5A 1ZT4B 2DWEB 1J11A 1C16A 3NZ8A 4GSDH 3HC4H 2VLJE 3WDIA 3O6LH 3EGSA 1K3ZA 3C08L 2YMXH 5E94B 4H0IA 5CJQL 1F90H 2EYRB 5FCSH 1BFVH 4J3UA 4LAQL 3LQMA 2NLJB 3ZDYF 1P7KA 4PGZA 5EC2A 1B0WA 4YR6A 3O6KH 1WCBB 5HI5C 4KRMB 5ICYA 3VFWB 5F7MC 2LVEA 3RI5F 3V4UL 3U0TA 3JV4B 4LFHD 2Q76A 5FECB 4KZDL 1J5OH 5IMKB 1NMCC 1YEJL 5C0CD 1NAMB 4MA3A 4CN1A 4S1SH 3TBTB 2NY2C 4QOKA 5F7FA 2BFVL 5DJXA 3BHBA 4NCC2 2G9HB 1EMTH 3OKEB 5D5MB 5L2JB 4ODSH 3C60C 3JUZA 2B1AL 2YWYA 1ZKAA 1JHKH 4MXVE 2VOTA 2Q8AH 3RBSA 5F9OL 3S35X 1D9KC 4OT1H 1BVLB 1M7DB 4GT7A 4ZFFB 2VUYA 3HRZB 1UXWA 3BE1L 1CLOH 3WD5H 4XPBH 3K1KC 3DI3B 5DI8B 5J1AB 3BIKB 5IB4A 1XR9B 4M02A 2HMIC 4G9FB 4KC3B 4I2XE 3MLWL 5HPMB 2XIDA 3QIWA 1B6UA 4Y16C 2DM2A 3GZKA 3KYKL 1BQHB 2ENSA 3F6LA 5E24E 4OKVA 5D7LB 1GGBL 4ZSOB 4NC0B 3WIHL 3VFPB 1JK8A 1HHJA 5F8RC 1FJ1A 4R8WH 4YDVB 4OF7A 1NANI 4PJEB 2VUOA 3NCYP 4Y19B 2DQFB 4RGMB 1AGDA 3WKMH 3QCTL 4L4VA 3DYOA 3WUWA 4LCCA 3UJJL 3FKUS 1EHLH 4JKWA 2A6IB 5C07D 5T1MB 4HUNB 4P2RE 1I8LA 3IDNA 4CGTA 2A73A 4FTVB 1MOEA 5J3HD 1SEBA 4XBPA 2YUXA 1G9NC 3ZE0F 4JM2D 1FZKB 4UDTB 1SEQH 1WT5A 3EDDA 2VLLA 3QXDB 1TVHB 3QUYD 4X98A 3FQTB 3QAZB 4JFFE 4WHYG 3EYQC 5D2NE 4ZAKC 1V3LA 1EUTA 3MRJB 5BS0B 4LSSL 12E8H 5EN2B 4JZJA 1X5LA 4JVWA 4X7EC 3HFML 3GMRA 1IAMA 4NQVA 4PGCB 4FNLL 1B4JH 5MEQB 1VGEH 4O2EA 5BZWB 2WIMA 2R8SH 3PNWB 3MGTB 3OKOA 4XPAH 4P4KC 5K9OA 5I9QB 4NZDA 1NEUA 3BEWA 4U3CA 2FL5A 3FQUB 3EO1B 1WTLA 3IETB 1PG7H 3BVNB 2ATKA 3HI5H 3NN8A 5F89A 3S4SG 4NZTL 3STLA 1T0PB 4JFEA 5DUPH 3HCVB 2PKDA 3KPSB 3CMOL 3F58H 3KLHC 1L9MA 4WFED 3UBXB 4P9HH 4WFGE 4J4PD 5IW1B 3WEXA 4KK9C 3O3EA 4UQ2B 4K8RD 1B6DA 5T3ZH 4BKLB 3RU8H 3VXTB 3WFEH 3UROR 25C8H 4PJ8D 4OLUL 1BMGA 5IOPB 1U92B 1G7LB 1BZ7A 2KL6A 2W9EL 4LNVA 5C86A 1GZPA 3GHBH 1TPXB 2OTUA 4HUXB 1VACB 4GS7C 2ICEB 3EHBD 3IU4H 3B2UD 1JGVL 1T1YA 4DAGH 3ZE1E 3BEVA 2MWCA 3IDIB 4PD4K 4YEFA 3MCG1 5E99H 2GKIA 1NDGB 3WXVH 3PQYD 4WVRA 5B38A 4WI8A 1NKRA 2DQCL 3L3GA 4U6VH 2HJLB 4U1LA 4ZTOL 3GSXB 1O0VA 1BX2B 2DWDA 5IWLC 1E6JH 5HDOA 3SKOA 4Y5VB 1BBJA 3G5ZB 3SE9H 5E5UB 2HFGL 4NFBA 1NBYB 3NFSL 3DMMB 1RUAL 5L8KB 2BRQA 2DMKA 3P30L 2NY5L 2YSSA 4UZGA 3CUPA 2BOBA 2ITDA 3EYSH 2I07A 1MCJA 4G6KH 4QT5A 1IGJA 2JCCE 2VWEE 5JHDE 3ESUF 4PY7A 1NMAH 1NGXA 3SE4C 3TCLA 5J06A 3L5IA 4RBPK 3Q5YA 1JNHA 3ROLA 1YYML 2KQMA 2VC2H 4XB7A 1FIEA 4UDUB 2X4QA 5JO5A 4APQB 1S7UB 1KJ2A 2EC8A 2O5YL 3S35L 4KJQC 3PL6B 4OLZL 2CUIA 3MLUH 3CFIC 4PJ7A 1YPZE 5KVFH 1P7QD 4MNQB 5JPNB 1HSAB 4HX1A 3CSPA 4TNWF 2C3VA 3T2QA 5DYOB 3MBEB 4TRPH 4WNQB 5TFSH 1WF5A 5DJDA 2ESVD 2I60L 4OQTL 4WO4D 2WV3A 1AO7B 3JVGC 3VGHA 4O51A 3MRQB 4FQ1L 4YFLI 5CEYA 32C2B 1CICC 4PJAB 4ZOEA 4DEPC 2WZPD 1FQ9C 4M93B 3CCHA 2EYTB 4YBHA 3TNNB 2XPGB 1L6XA 3RZCA 3EOTL 1XGYL 1MVUB 4RWYH 4ZO7A 5DGRA 3VXNB 1A3RL 3RPKA 2PXYC 4V2CB 3N9GL 1VSCA 3X11A 4WFHE 1MWAB 3A67L 4G6FB 5BRZA 1IAIL 1NCDL 4NP4H 4DUXA 1QZ1A 5HD8C 2A6KA 1RD6A 4D0BA 1MCOL 1R5IA 1NLBH 4I77H 3SDCB 1DBML 3NCFB 3D2UD 4TNVK 2J5LC 4DGVH 1XGTB 1OTTD 1N4XL 3U7AA 1ZAGA 2KZWA 2R69L 3TVMB 3HPLA 1A14L 5KJRL 1FE8H 1P4IL 4K23H 1MIEL 3G6AA 1CFQA 5D7KD 1ZK9A 5SWSA 4U1GB 3BW9B 3TA3A 3FJTA 3REVB 4MA1C 4C59B 5DQJB 4NC1C 1MFCL 3EYUH 1D6VH 1IFHH 4UV4H 5IEKA 1OB1B 2HJKB 1G0YR 1CD1B 4BH8B 4PJHF 2QR0A 4DZ8B 5IBTH 5GGQH 3LEXB 3PDOA 3O3UN 4RGND 4L9LA 1FFPB 2VZ3A 1ORSA 3BMWA 4WIQA 2VIRB 3BRGC 5DQDH 1CGUA 1WIPA 1VFAA 1ZE3C 4YE4L 1EO8H 3NCEB 2P47B 5C0DA 4NN6C 2HT3D 1BEYH 2OL3B 1IAII 5EBGA 3GIVA 3MV7A 5ADPL 5C0CB 5EOCJ 5DTFB 3L7EA 1A6TA 1F42A 3B8SA 3IFPA 4BUGA 5CZXD 1DFBL 1F5WA 1OARL 3FFCE 5B3JE 1WZKA 3ILPB 4TPRH 3S4SB 3KYMA 1S7VB 1CK0H 5DWUL 3VXOA 2OZ4H 3OG4B 2WIIA 1F97A 2XWJA 4PJCA 4OZHA 4X9FA 2XA8L 4IHOB 4UT6L 5D2LF 1OCWH 5MERA 4O2FA 2OX5A 1ZWIA 3NTCL 4ORGB 4WU7A 4PJXE 1QO3B 2FO4B 2NX5A 3ZDXE 1P2CB 3O3BB 3H3KA 3ARTA 5ILTH 2OYPA 1KYOK 2ZUSA 1MQ8A 3VGBA 2W0FA 1FNSH 3OTTA 2Y06H 4MWFA 1NUDA 3BZFB 1I9JH 4OZGA 3KS0J 4MAUH 4Z5RA 5T1KB 4BQ8A 5JLZA 5D8JL 5EBMA 3DHMA 1MI5E 5IR1B 5ANMB 3BSZH 5D6DA 3JV5A 5CBEB 3TP4A 3TWCL 1X5ZA 4HKZB 2GTZB 4LSVL 1Q8MA 3O8XA 3FB7B 4DTGL 3T08A 1CDUA 1NL0L 2WINB 1FHGA 4KUZH 4RMTA 1FSKC 3G6DH 1PQZB 1U8HA 3TT1L 4M48H 3E6HA 1L7TL 4P2QD 4Y1AE 3VWKA 5CJOH 3MOQA 3ARRA 1QVOA 3UPRA 4X4XA 4UV7H 1CL7L 1OF2B 1U8PA 4IRZH 4JHAH 3C9NA 3DURA 3E2HB 3QG6B 1SMAA 4IOIB 5IB1A 3SCMD 4HS6B 2DQIH 1DE4B 4NNPH 2J8OA 5CCKH 5MENE 4Z7WF 4GG6A 1CLYL 3MR9A 1OGAA 1TJGH 1G0DA 1YEIL 3RUGB 2V2TA 5E1AB 3MNWB 3K2UL 1ONQB 4KI5D 1LNUA 3WHXB 2WWKT 5EU4B 5I1GH 2XKNA 2JIXD 4FABH 3S9DB 2DM4A 3MRKA 4ZS7H 5T5NG 4S11A 3MJ8A 1A6UH 1G9MH 4UNTA 1U3YA 5IMLA 2CMRH 3OL2A 1B2WL 3UTTB 2L7JA 2Q3ZA 4MB4A 2F54E 1NFIA 3GBLA 2GYSA 2D7OA 3CX5K 3FO2A 4EI5C 2QQNL 5GJTH 3DIFB 4U7MA 1UJ3A 3E8UH 3DETC 3UEZA 3DX8A 5DURB 4HIIA 4GRLB 1KTRL 1QBBA 2JJWA 3MODH 1JWMB 2OJEA 3UTSE 4W6XB 1AXSA 3VXMB 1OAZH 1Y6KR 2NW2B 2EDHA 3PIQA 2X4UB 3HAEH 4AT6A 2D7NA 3Q3GB 1DBKL 3MNVB 1PBYA 3PGCB 2I9TA 5DJ8B 3KDMA 5EZIL 4U2YA 2HFEB 1I9IH 4YZFE 2B0SH 2X09A 2ZCLH 3TC9A 4F9LA 5E08H 1YUHB 4PJIE 5D4QA 1YN7B 4TUKH 1CL7I 1KELL 2E3VA 2E7HA 3EAKA 5LBSL 5I1CH 2MSPA 2R4SH 4WUUA 1S9KC 3P0VH 5CINH 3BH9A 1N26A 3NPZB 3RWEB 2QSCH 4TQEL 3T0DA 4X80L 2E9IA 3SPVA 3FRUB 1KG0B 3FQXB 4NO0D 5I8KH 4OZIA 5J12C 2XG4A 5TH2A 1I85A 1LO0L 3LRSB 3PP3K 5FYJE 3BDBA 3RY6A 5FGRA 1J86A 4JPKH 4HQQH 2EDJA 5ISZA 4ZNEA 4GW4A 2X9YA 5C6TL 1EHXA 1INEL 4P9HC 5F9AC 2X4TA 1LE9B 3UTPE 3EBAA 5TDPA 4QTIL 8CGTA 5I1JL 2D3VA 3BGMB 1GGCH 4NQCE 4KQ3H 2MCG1 3UC0L 5IKCB 5GISH 3G5XB 1DCLA 3HKFA 1GHFH 1NAKL 3AXLA 2WWKO 3BPCA 4QGYA 3TYGH 3BKJL 1KEGH 1EEUA 3C5ZA 5IW6A 2UYLA 5K9JH 1YYLH 1YMHB 3O45B 3GI9H 1KC5L 1P7QB 3I6LD 1MCQA 4L5FL 5C08D 5B3NA 4YGAB 1A6VH 3QO0B 5FGBC 3WNKA 3X13A 4MJIB 4PBWD 3T0XA 3VGAC 5GGVL 5ICZB 2DQDL 2R23B 1NEZG 2XQBH 1LO4L 2MCPH 3CH8A 3NIFF 4LGPB 4JAMB 3I75B 1Q9OB 4AMKL 4YC2C 3QYCA 4WO4B 1MFDH 2OXHA 2YZ1A 1RIVH 4OCYL 4NM8L 1XIWA 4M1CD 2DYPD 4YDIL 1SYVB 2P1YA 1JNLL 4EN3C 4RMSA 1FG9C 3B5GA 4JREC 5C0RL 5KVDH 2YK1L 3BPNB 4PV8A 3V0WH 1K6QL 1LO2H 1OGTA 1YEEH 1E27B 3GSOB 1FVEB 3VA2C 2JB5L 2HLFD 2QQKH 3HZYB 3W5MA 3X14A 1UT9A 1JTPA 4LCUA 1MF2H 1YJDH 4RFEA 5E9DA 3V4VL 2H9GA 4NWTH 4UT7L 1Q1JH 3RVTC 1MHPL 3VRJB 2F58H 4JRWA 1YQ2A 1MFEL 1N8ZB 4JHZA 1RZ7L 5DJZA 5HYSA 2X05A 3ZO0A 4XP4H 3RWCA 3OKMB 4BA8A 3B3IB 1A64A 2EDYA 3RPIA 4UUJB 5ERWB 1F11A 2IMNA 3E3QE 1ROWA 2XZAH 3GSNA 5IM7B 4JQIL 3GIZL 3RGVB 3C5ZD 1Z5LA 5ID1A 1A8JH 5IVXF 4B53A 3JZ7A 5HGAB 4O4YL 5IHZB 4MQXD 2EH8H 2EDBA 1CGXA 3OKDA 2FJFA 3K4ZA 1ETZA 43C9A 1L4IA 4RGNB 1VHPA 4PG9A 1JWSB 2GTWA 1NGYB 1R3HB 3D39A 3U36A 3ES6B 4H1LA 1V5JA 4Z7UE 3ARFB 3BDYH 1UJTA 3VFMA 1PJ9A 4HK3J 4FQJH 5CBAB 1FN4B 1I8KA 1RZJL 1DVFA 4PREA 2NY1B 2ZSWA 5KVMC 3MA9L 1CU4L 4PRPE 5FUZL 4F2MA 3LEVL 3WL9B 3L5WA 1VESA 1VPOL 2PUQT 1UYWH 2R15A 4N8CH 4KMLB 2BNQD 3PJSB 5CP7A 1DBBH 4JLRB 1E4XL 3NA9H 3LHPL 5CS7A 2FX9L 3QFDA 4EOWL 5I16B 3S5LA 4N0YH 2DWEA 5D7JD 3U7WH 4FXKB 2EDRA 2FGZA 4JY6A 1X5YA 2GFBB 1G7HB 4KVNH 4L3EA 5BO1L 1MSPA 1XCTB 3F6IA 5IUSA 4HPYH 5M95B 2FB4L 3C6LB 3KXFD 1YY9D 4ZYKB 4P2OD 5HHMB 1XH3B 1H9VA 2NLJA 2OP4H 4OF3A 3K81A 1G7QA 2R0ZL 3V7MA 1TVBB 4N9GB 5BV7B 4KQ4L 2I27N 4PJFA 4PLJC 1KSRA 1NUGA 4NKOB 5FECA 3O6ML 5IMKA 1IT9H 3THMH 3O2WH 2CK0H 1NAMA 4IOFD 3ARED 5ALCL 3V5DB 3O2DL 4NOFA 1C5DB 3VH8A 5KSAD 3NAAH 3NACL 1E4WL 2G9HA 3OKEA 1NCBH 5D5MA 5K9QI 4QRQB 2ZCHH 7FABL 5J9PB 5L6YL 1BGXL 1TXKA 3QQ4B 4FXGB 3OHXB 1FCGA 1F4HA 1M7DA 4M9OA 2OQJB 3VFUB 1GOHA 2F5AL 3HRZA 4LOUD 4X8JB 1AC6A 1D6EB 3X12B 5J1AA 1XR9A 3PWVA 3I3DA 4JFZL 3BD3A 1T7WA 3BH8A 5D7IB 5DHXB 2NY3D 3ZYIA 1BREA 1BQHA 5EORL 1CGSH 2ILLA 1JJUA 3C5SB 1KJ2H 2WUBH 3AY4C 4UAOB 2FSEB 1EDQA 2APXA 2F8VA 4XHJD 3F5WA 4GOSA 4HK0A 4OUUB 2JIXB 3L5XL 1YQVL 4JPVL 5DJ6B 3BUYB 3GMPA 3BKYL 4FZEL 3PGDA 1JPTH 1NBQA 3IDMB 1QSVA 4XP5H 1NLDH 1FYTD 1PSKL 2A6IA 5T1MA 3GSVB 4P23D 2PW1B 4PTTA 1HQRA 4YK4B 3PHSA 1A5FL 5FK9A 1NEZB 1KFAL 1FZKA 4P2RB 5DR5H 4NIKB 4UDTA 1J87A 5EU6E 1TVHA 1CT8B 1SVCP 4ODXB 4ZFOA 1QPXA 2WP3T 4JO3L 3MRJA 5TQ2H 1WFOA 4P2YA 2FHFA 3T2NH 2PR4H 5BZWA 4JKPH 3PNWA 3MGTA 4XPGL 4HIJB 1AD9A 4UIKH 2BVQB 3U1SL 4D9QD 2YBRA 4TSAL 4Y4HD 4YHZH 1CCZA 3FQUA 2IAMD 2VMFA 1FCCA 1AR1D 1A9EA 4P5TD 2F53D 3AB0B 3BVNA 3WLBA 4K3DL 5JOFA 5FDWB 5CAYB 1T7YA 3QEQA 3HCVA 5C09B 4UQ3B 3LH2H 3QCVH 1RULH 4CMHC 3UBXA 1SJXA 3FT4A 5C6PB 1AR2A 4UQ2A 1G9MC 3F62A 1M71B 3HE7C 3TT3H 4BKLA 3VXTA 5IVZB 4X99A 4XVUD 5TE6L 1MRCL 3MNZA 4OFIA 2DKMA 4XAKE 1ZTXH 3W0WE 4M5ZH 3X3GH 1G7LA 5IJVA 1M05B 3DO7A 1BQSA 2V2XA 3TLRA 3S8WA 4V1DE 4HXBH 5C3LD 5IFHL 2D0GA 1KJVB 4NWUH 4OGXL 3F7QA 4X6DE 2NMSA 1IGFH 2F15A 4G5ZL 5GS1B 1J1PL 2H3NA 5C08B 4PGBB 1I1YB 4DN3H 1H8NA 1NDGA 4LSTH 1WBZB 3LSOB 2HVJB 4OGAC 3U9UA 5TQ0H 5EU5A 4TVPD 4XCFL 1FC2D 2HJLA 1I4FA 4DVRL 3GSXA 4NQEE 1CBVL 2DQHH 4HHAB 4K3EH 4FQCL 3G5ZA 3EDJA 4HAFA 2VR5A 3O9WC 1MFNA 1PFCA 1R3IH 4KMQA 5CJXC 2P5ED 3BP4A 2GAZB 4HG4K 3H3PH 1AQKH 4HBQA 4CVZB 1S8DB 2NXZB 2V17H 3F7RA 1S9WB 2XWTB 1KPRA 3GJFK 3TM6A 1F4YL 1PAMA 1T66D 5CSBA 3ZKXB 2YKLH 4U1HB 4XTRC 3WIHA 2VE6A 5E1HB 2JCCB 1U3HD 2Q7NA 3QDGB 4APQA 2FBJL 4TTDD 1HWGB 4QRPD 1HHHB 3DUUA 1DBAH 5JPNA 3CDFA 1JYXA 2V2WA 3N85L 4MXQC 3VXRE 1B0RB 3VXUA 4WNQA 1SJEB 1YC8A 3MCLL 1G6RB 2ADFL 4WEUD 3ZTJG 1ADQL 1AO7A 2A74A 1WTGT 5CJ5A 3K2MC 4L8DB 5I8EB 3A0OA 32C2A 4EEEA 4Y88A 2PO6D 3Q6GL 4PJAA 5IBUG 4FMFA 2FIKB 4KUCD 2XPGA 1IEBB 1NMBL 2YRPA 4CADB 1MVUA 1WBXB 1DTUA 1IEHA 5FUOH 3P9LA 4ZPTB 5ELIA 3BN3B 2CGRH 4GKSB 2IPTL 4LQ1A 5F8QC 1U8NB 3L95A 3ULVD 2Q7YB 3ETBF 4PJ7F 4M1GH 5T3ZE 4JG0L 1NGQH 4PJ5B 1YJDC 4U1KB 1X7QA 4LP4A 3V0AC 2MQCA 5J13C 1W0YT 1XGTA 5I1AA 4GRWH 3UDWA 4LCWD 4I9WE 4JFPB 4U31A 4P59L 1J8HE 1OAQH 1WAAA 4ONGL 3EO9L 5C0EA 3QJFB 3NCJH 4PJ8C 5I19H 4LCCC 3BW9A 3REVA 3EYOA 2MKLC 5L88H 2BY3A 1I8LC 4U6XB 3WCYA 5ESAB 1Q9KB 1BJMA 3QUXA 1DN2A 3MV01 4L8BB 4F58H 2HJKA 5HYJD 3KXFB 3LN5B 1CD1A 4QF1B 1WT5C 4KTDL 2R4RL 3VXUD 1H5BC 2VIRA 1JNJA 5E8DH 4JZJC 4D8PB 3B9AA 3S88H 5LCVL 3T4YA 1MUJB 3KAAA 1MRFH 2X1PA 1J0IA 4IJ3B 1BVKB 1FO0L 2OL3A 5EH1A 4WRLA 1GVIA 2KDGA 3DX6A 4MDJB 4IMKA 1EFXD 5SV3A 1GIGH 3CK0H 4HMDA 1CG9B 1UB6B 5I75C 3MJ9L 1QR4A 2ADGA 5DTFA 4ZDHB 4LIQH 5KSAB 4X0KB 1I1AA 1QSFE 2IADA 4ODBD 1A9BB 5C0AB 3P11H 5DDHB 4JKLA 4AL8H 4HV8B 4R26L 1M7IB 3VGFA 3S4SA 1SM3L 3MV9A 5JQHC 5KTEL 4RMQA 2AJSL 5F72S 3FFCB 1CIDA 3RDTD 1F3RB 3L6FB 4RAVB 4YGVB 1AFVH 4PGDB 1YMME 5I71C 1TZGH 3SDDD 1A7RH 5FYJL 2OM5A 1H8OA 4QXUL 3S3SA 4NT6A 4XMLH 3VXSD 4ORGA 4X7TB 3QI9D 1V7NL 2FO4A 5EULV 1LP9B 4XP6L 1OTSD 1P2CA 3O3BA 1H8SA 4IBLT 3BP7A 2P48B 1YEHH 2YPVH 5EO9B 4PJXB 1YNKH 5BJTB 4K07A 5FFLA 1C1EH 1QQDB 5KW9H 1AGCA 5J11B 2IQ9L 2IQAB 4BZYA 4RDQG 2NYYD 4HT1H 1K3IA 5F7LB 5T1KA 5CEZH 4AK1A 2AEWA 4HMCA 4P23B 3WNOA 3S6CA 3CU7A 1C5BL 4OLEA 5ANMA 1XGUB 3NFPA 2E6QA 4OQTA 5CBEA 3SOBL 3ZDZE 3QQ9D 5DZNA 3QXAA 4HKZA 4PRHD 4X4YB 3SO3B 3FB7A 5CEXA 4CBPA 4OZHF 4L4TE 3VGGA 2WINA 1JZ4A 5DZLA 5I1LB 4Z76B 1PQZA 2ID5A 4P3DA 1FV1B 1Z0NA 4CVXB 1BJ8A 3L7FB 4EBQH 3HS0B 3NPSC 1Y6MR 3MYJA 4R4NC 4YFEA 2PETA 3QG6A 2IPKB 4HS6A 1DE4A 3MXVL 1JRHL 1BHGA 1F4AA 2Y7QA 4OZGF 1NCCH 5E1AA 3MNWA 1ACYH 2XQYK 1ONQA 2IAMB 4FFWD 5EUOE 3WHXA 3DWTA 5EU4A 5MENB 2F53B 4IM8A 4BZ2H 5L2KD 2Z92A 1E28B 3GSNH 5IHUH 5HY9B 4L9DA 2YD3A 2OMNA 3RZWA 3KPTA 1I9EA 4RSVA 1I8IB 3UTTA 4JDTL 4OLWL 3G5YB 1LD9B 5KSBA 3GI8L 2WAHA 4P46B 4OZ4A 4R0LC 2Q6WB 4R2GB 5IFJB 4NJAL 2AEPL 2AK4A 1X5IA 3GUTB 2F54B 4J2XA 4GRLA 1N5AB 5AZ2L 2P45B 3K3QA 1JWMA 1KCUL 3VXMA 4QWWD 4B7LA 4WI5A 1EXUA 5DHVH 2NW2A 5TE7H 4MZ3A 4H1LH 4S1DC 2X4UA 1FORH 1QP1A 4O02L 3Q3GA 1OSPH 4L29B 3P3YA 4KAQL 1DQDL 3MNVA 3RNKB 3H7LA 3TIEA 4PY8I 5L9DL 4GG6F 5DJ8A 5IBUB 3RZCC 1RZFH 2HFEA 2CUMA 4OV6F 1I8MB 3S34H 1A6PA 5SWZA 2FWOB 3WFZA 4X7CC 1G6VK 5T3XH 1DLFH 5ITBL 1JRHI 4PJIB 1UH3A 2HLAA 4WWKD 2EICA 1ZLVH 5BXFB 1OM3H 4GRWF 3RWEA 1RI8A 4XWOC 3FRUA 1KG0A 5CSZB 3RA7H 2FJHB 4D3CL 3LRSA 2FX8H 2P5EB 1AQDB 3TA3C 5BZDA 2ARWA 3QUKB 1T2XA 3QDMD 3SY0A 3KPQB 4RZCB 5DSCB 1HH9B 1KLGB 3WS6A 3O6FA 3H9HB 4QXTB 4BJLA 3CDYA 1LE9A 4NO5A 3ZL4H 3CLEH 1T2QH 4F7EA 1KPVA 5DRNB 4L9LC 2VXVH 2PYED 3HE6B 2VXTH 1U3HB 1HILA 4U0RB 3C5JA 5IKCA 2MJWA 5JW4N 3ARBD 3B5HA 4KXZH 1MHEB 3KNBB 4LLMB 4LPVA 1YEFL 5JXED 1TLKA 4OZIF 1LDSA 1YMHA 4XMPH 4HS3A 3O3DB 1P6AB 4N0CC 4RX4A 2FD6H 5INDB 35C8L 3QO0A 4MA7H 4YHKL 4MJIA 5ICZA 1RU9H 1U8KA 3GO1H 3MREB 4KV5F 4PLKD 1QKZL 4JAMA 4BSVB 1Q9OA 1OWRM 5GRYA 1WGOA 5HGDB 1CFSA 1NGZA 1YNLL 2PO6B 4UBDC 1WIOA 3LVEA 2E7LA 4A2LA 1I7RB 2G60L 2BCKA 3SCMC 4HWZB 5IVOA 2Y6SD 2DLFL 5FHBH 1E27A 1H15B 1FVEA 1OAKH 5C0GB 3HG1E 2X89D 4ZO8A 4LHUA 2PF6A 2GY7B 5D7SH 2AQ3A 4J23A 3NVQA 3ZHKA 5IQ9B 4Q0XH 5CGTA 2P46B 4EZMA 4HZLB 4PBXA 4RMWA 3VRJA 2PTTB 1HZHL 1N8ZA 3T3ME 1X3DA 1MHHB 2AV7A 3DYPA 4X6EB 1KCSL 3OAUH 3B3IA 5DEGA 4NUGL 4UUJA 4FFZL 2WLYA 1T1ZB 2CKBH 2YXFA 3NBNA 3RGVA 5D6DC 3IF1A 3QDHA 5KVEH 4F7CB 3U4EA 2VDQL 3IDXH 5HGAA 4GQPH 4DKDC 2AXHA 2EIZB 2BNRD 3P0YL 3O8XC 5HGBB 1QLEH 1RZKH 2CKNA 1U0QA 1JWSA 4FP8H 3QIUD 2DM7A 1NGYA 1R3HA 4GFTB 4WW2B 5I73C 1ZANH 1NSNL 2HTLD 4GKZA 1F6LL 3VWKC 4U1MB 4U6YA 2D2OA 3ES6A 4M6NH 3K46A 5L8LB 1Z3GH 3ARFA 4EJ1C 4NQDB 1ZLSL 1ZVSB 4YBLC 3VW3L 2VQ1A 3GMOB 1EFXB 5CBAA 1FN4A 1IAOA 1UGNA 2DS4A 4Z7UB 3WYRA 4YXHH 1S78C 3V8OA 3WL9A 1I3RB 4ZFZA 2NY4C 3HRPA 1BPVA 2XTLA 5CHNB 1XF3B 5HDLA 3C08H 3EJYD 3HC4L 1CF8H 5CJQH 3DV6A 3O6LL 1A7BA 5A2JH 5E8PA 4WTWA 3U46A 2L7UA 5K59F 2Y36L 4N0RA 4FXKA 5SX4I 4Q58C 4KJPC 4LAQH 3KPMA 1K85A 4XNZC 5ENWA 5GGVY 1QNZL 4WTXA 4GAJL 1UJ3C 1J12A 2YD5A 2BZDA 3C6LA 4M6OL 4ZYKA 3V4UH 4UIMB 2XYCA 4BFGA 3QI9B 4PJDF 1XH3A 1HH6B 4KZDH 4A6YL 5KAQG 1YEJH 1OAXL 2QL1A 2ZOKB 4ZUVB 1FNGB 4ZUTA 1TVBA 2CIKA 4F9LC 4LLYB 4N9GA 1X6LA 2BFVH 5HSFA 4NKOA 1WEJL 3CD4A 4I48A 1EMTL 2B39A 1G7IA 2W60A 4MAYB 2CK2A 5EUKB 4ODSL 1TCMA 1XAUA 3GSRB 4HWEL 1GJIA 1C5DA 4O58L 3BE1H 3W5NA 4HJ0C 3GJFB 4HULB 4PRHB 2C3GA 3B5TA 3QPQC 2LU7A 4QRQA 2VAAB 4PGJA 1PW3A 1I85C 5HHOB 1CFNA 3OHXA 3MLWH 4FXGA 2AJVL 2G5BB 4P0DA 3RY6C 3KYKH 3NH7H 3QHZL 4X8JA 2XTJB 1GGBH 4NBXB 3QFJE 3OX8B 3CFCL 4LPWA 3WIHH 3WFHB 2EECA 1UC6A 5F1NB 3VRLE 4M4RA 3TFKD 3LKOA 3HUJB 3ZKNC 4PJFF 4K7PY 3HZKB 2BVEA 3QCTH 2FSEA 3M8OL 3UJJH 3CVHL 4OCNC 5TJWK 2VLJD 4OUUA 3WDJA 5FEBA 3VWJD 5DJ6A 5HBBA 1OP9A 3C5ZC 4KJWD 1KB5L 4N1HB 5D5MF 4RRPG 5TDOA 4LDOB 4IS6B 4RAUB 3T0EE 2PW1A 3S37X 2CO7B 3LDBC 1P4LA 5FGSA 2EIBA 1BZ9B 4LSSH 4JZOB 3M45A 4P2RA 1S7SA 3HFMH 4FNLH 5GGSB 1XIWC 1CT8A 3F7VA 3D25A 4ODXA 4JFEE 2ICES 4G8FB 4PJBE 4XPAL 1KV3A 3OGCB 2GCYA 4Q9BA 3CFDB 4Y4FB 5J0BA 3Q5TA 4JFFA 5C0BE 1VFBA 5D2NA 3T0WA 2VXUL 1EJOL 2CSPA 1QHOA 4TUJA 2VLKB 4JPIB 5GSVB 3RY4A 4NZTH 4KKLD 1J0JA 5HGHB 1JZ7A 3LD8C 4HS8H 3CMOH 1T0MB 1HYRC 3O4OC 2GITB 3I9GL 4ALAL 3RIFK 2P44B 5D7JC 5FYLD 4X6CE 5DS8A 3F58L 1PKQB 3ISWA 1T5WB 4G6JL 4CRPA 5FYJU 1GZQB 1UWXH 4K3GA 1RIUL 5IB2A 5FF6A 5T3ZL 5C09A 2IF7A 4UQ3A 4OLUH 2OSLA 25C8L 1YY9C 2W9EH 3K74B 3QDMB 1YZZA 2H2SD 3S3JA 5F71A 5FIEA 4CJ0A 4LRIA 4QHMB 2IAND 1JGVH 1M05A 4YPGB 5JW4Q 1VFOA 4WCYL 4Z7NE 4LK4A 2D7PA 3ARGA 4DAGL 3VU2A 4U3HA 3IJYB 3QO1B 4G42B 3QHFL 4XNYL 4TTGA 4ZTOH 1FLRL 3EJJX 4PGBA 1FL3B 3O2DA 1I1YA 4X6DB 3V5KB 1E6JL 1DVFC 5D6CB 3UO1L 4GO6B 2HFGH 3LSOA 5E5MB 2HVJA 3OKYA 3SE9L 1N5YH 2EDOA 3DVGB 1RUAH 4MD4B 1ZSDB 2NY5H 4O00A 4LOUC 4HHAA 2P5WB 1MH5A 5IIEB 3L3JB 4XRCB 4N68A 5GXBB 1NCWL 1FL6B 1PX4A 2GAZA 3Q2CA 1S8DA 4QCIA 1YYMH 4ZS6C 1UB5B 2XN9E 4NRZB 3ULUE 2O5YH 2OR8A 2BDNH 1YY8B 2JCCA 4QYOB 5E5RB 1T20B 4WFGD 4KHTL 1T5XB 5HI4C 2IBZX 3QDGA 1F6FB 4Z77A 4U7KA 5F7KC 4E0RA 4YDJB 5EIQA 3LV3B 3ARGD 2DLEA 2I60H 4OQTH 4C57C 5IESL 3NFNA 4IRJB 5D1QD 4FQ1H 4XWGL 3DBXA 2MHAB 5C9JA 3TCXA 2YD1A 1X4YA 1CFTB 1ZHBA 5E2UL 5F6HJ 1B0RA 5J8OA 1G6RA 4RNRB 2BNRB 4B7IA 5KS9B 3MLPA 3EOTH 1XGYH 4AEIH 1QYGL 1A3RH 4ENED 1LEKB 4XMKL 4L8DA 4PJGE 3IXAB 4RWYL 5IMMB 2EYSB 3A67H 1IAIH 1NCDH 5FKPB 5JW5A 4MJ5A 4ODUA 2FIKA 1YC7A 1MCOH 1IEBA 2R1XB 1R3LB 4CADA 3IRPX 3OJDB 3WE6A 4EXKA 1N7ML 1NLBL 4I77L 1JPGB 1KB9K 4B41A 4GKSA 5JTWA 3JV6B 4N90D 3OG6B 1U8NA 3CAFA 4WHTB 4NZRL 1N4XH 5AYQA 1CE6B 2R69H 3S37L 1A14H 5KJRH 1P4IH 4MDIB 1MIEH 4R96B 3IU3B 3AGVA 5TF1L 4I0PA 4PJ5A 4Y4KD 2VDPH 5F9WC 4AEEA 4MQTB 1GGYA 3FOMA 4E41E 3IDGB 5I1KL 3T8XB 4OLXL 2JLLA 5HDBE 4ODTL 3HB3C 4JFPA 4XCNA 1INDL 1G1CA 5DRWA 5IHBA 1MFCH 2GT9B 3S36X 2XT1B 4RGMC 5JHDD 3PWUB 4XVUC 1EIBA 2ED9A 1I7ZB 3DX9A 4KWUA 3MV7E 4HLJA 4U6XA 2BRRL 3ZKQD 4PJAF 5ESAA 1AH1A 4D2NA 2R9HD 1N0LA 1DLHA 1WQVT 4HEPG 1UXSA 1EEZB 2VLRD 3P4NA 2J12B 4ELME 1Q9LB 3LN5A 4QF1A 3GGWB 3TJHC 2Z0BA 1T3FA 2Q87A 1IKNA 3ZKMD 3D85D 1QFUL 1S7QB 5I17A 5E2JA 1RZKC 5CZKA 1I1FB 3WIIL 2F74A 2FEDD 3WFCL 3ILQC 1BVKA 3WFDL 1AKJB 5MEPB 3P4OB 3QIBD 4PJCE 1DFBH 1OARH 5I9QC 4MDJA 3I02B 3NCMA 1WAAF 2Z31A 1ES0B 4P49A 5DWUH 4GMTL 4ZDHA 4X0KA 3RWGB 5D1XB 1BD2D 1CFVL 1A9BA 5C0AA 2IBGA 5D71L 3AMKA 5DDHA 4AJ0A 3S3PA 4HV8A 4X4MA 5FA4B 2XA8H 1DUZB 3KYNB 4UT6H 1M7IA 2CDEB 3NTCH 4ONHA 2X4OB 3FFCA 1RIHH 2KKQA 4HZAA 4RGOL 1JPFA 3L6FA 4ZOAA 3OGOE 4RAVA 4KTYA 4MJ2A 5M7QA 3NGBB 5ILTL 1W8NA 3MUGA 1QRKA 4ZTPL 2HKHH 3DLQR 3MLVL 1TPXC 2MNUA 3OXRB 5D8JH 4MNHB 5EO9A 4PJXA 3VWJB 2V5SA 3U79A 2XACC 1D5MB 2VISB 1QQDA 1UQSB 3ULSA 1FNEB 2XV6B 1Z9MA 2IQAA 3BSZL 3MJ7B 3R06B 4LSVH 5ETUA 5KOMC 4J3VA 4G3YL 4EVNA 2Q1EA 4DTGH 2X10A 3VE0A 3ARVA 2ICWB 4WI4A 3BGFB 5KANI 4JFDB 4YXKL 1BZQK 3MRFB 2AJUL 4MVBC 3P73B 4AY0A 3MRLB 3TT1H 5CZVL 4HKJB 4CUCA 4Z0XA 4X4YA 2BXYA 4M48L 1EO5A 1FVDB 5DEZA 4ZPVA 5SX5H 1T22A 4KKAD 5I1LA 4G8GD 4UV7L 2C4XA 1FV1A 4NQTA 3TO4D 1CLYH 1P9MA 1QA9B 1YEIH 1WFTA 4UNVA 3KLDA 3VGDA 3L7FA 2IJ0C 3HS0A 4E9LA 3K2UH 1Z9SA 4X5XB 4X83A 2VLME 1NC4D 2CLZA 4HUWA 1HNGA 4Y1AA 1CTNA 5HHNB 1CZ8L 5I1GL 1TITA 3O41A 4WFFE 1IGIL 1E4JA 4POYA 1J10A 1J1XH 3T1WA 2XG5A 4KRPD 2CMRL 2NCMA 5MENA 5I1IL 4APQC 3KPRE 4JG1L 3U0PB 5EUOB 3RWFA 1D5ZB 1NBVL 1I8IA 2UZIL 3EZ8A 3KPOA 4A2MA 3G5YA 4QRRB 1JNNH 2YUWA 1RUQH 4P46A 5EC1B 1JF6A 3P77A 5HYEA 2Q6WA 5IFJA 1DBKH 4CU8A 4JFOA 5EZIH 3GUTA 4N0FB 2F54A 1RMFL 4XC3L 4OZIE 1A22B 1K2DA 2IANB 4FZ8H 4S10A 1I9IL 3MUZ1 1KELH 5LBSH 4PGEB 5AG9A 4L29A 3UTSA 3RNKA 5IG7B 2VABA 1MI5D 3T3PF 5I0DA 1PG7W 3S36L 4TQEH 2FWOA 4X80H 4CU7A 4C56E 1W72B 3TN0A 3SDAD 3ZE2F 4CN4A 1QFWM 1LO0H 5F7WC 4PJIA 2HKFL 5C0ND 5BXFA 3HPJB 2VZSA 5KSBF 4KKBC 5CSZA 2BVOB 4HH9B 3UDWC 2FJHA 4HQQL 3FRPG 5C6TH 1INEH 3RI5K 2IH3A 4U1GC 2QADB 3GKZA 3QUKA 2CXGA 2X1QA 4QTIH 1OSZB 5I1JH 1K8IB 3KPQA 4ONFL 4RZCA 1MJJB 3UC0H 4F7TB 2DI8A 3WXWL 3QUXC 1N3NB 3H9HA 1A4JB 2I24N 1LK3L 2XY1A 1NAKH 3Q0HA 3STZA 3RFZC 3BKJH 3AFLA 1NFDE 5HI5D 3ARUA 1KC5H 4L5FH 4PG2A 1YYLL 4QHLB 4U7SA 2K9UA 5DMKB 5GGVH 2DQDH 4NQCA 1MHEA 4QKXB 3KNBA 4ZO9A 1QFPA 1LO4H 5FOJA 3QQ9C 4AMKH 1AJ7L 2NY6C 1ZGLM 3UTSD 2OS7A 2YD9A 4IMKC 5D1QB 3BQUB 4NM8H 4OCYH 3MJGX 1ZA3A 3QDJE 3C60D 5IB3B 1MFDL 4YDIH 5E9DE 1D9KD 3GMLB 3HR5B 4MMXC 1RJLA 3KLSA 2ORBL 3ZSTA 3SGJC 1I1AC 5C0RH 1JWUA 5FO8B 2LV4A 4GRMB 4BSVA 2YK1H 1K6QH 3LKPB 4YFDB 5HGDA 5D93C 2JB5H 3V0WL 2RBLA 1LO2L 2NY5C 4OCSL 1OT1A 1I7RA 4H0GA 2NQCA 4F80A 4HWUA 4Y16D 2X9XA 1AD0A 3PWPD 4UT7H 1QPPA 3CXHJ 3F7PC 5C0GA 1MHPH 4HDIB 1MFEH 4AH2B 1RZ7H 1Q1JL 5LQBH 5IQ9A 2F58L 4ACPA 1Y6NR 1ZT7B 5K59E 4YWGL 3LKRA 4Y4KB 2DF3A 3QUZA 4EDXB 4OF0A 2PTTA 4DGIL 5H37G 1MHHA 3GIZH 4JQIH 2C26A 4XH2B 4ZQKB 3UMTA 5I8CB 2PYFA 4O4YH 1AP2A 2R56H 4EUPA 4K7PH 3UTPD 4H26B 2R2EB 1T1ZA 3BPLB 2EH8L 2Z8WC 5E6IB 3VXQA 2CIIB 3GSUB 3WO4B 4F7CA 1V8HA 3EYQD 4ZAKD 2OXGA 3BT2L 1YN6B 1MY7A 2D7MA 3ARYA 5HGBA 4PRIE 4ZXBB 3QEUA 3RP1A 4WV1B 4R97C 3OF6A 2EEAA 1PDKA 1HSBB 2B5IB 4XX1E 3D85B 2AJ3B 2YC1B 2YA0A 5FAAA 1A6ZB 3RIAF 4WW2A 1RZJH 4P4KD 3MA9H 1CU4H 5FUZH 1X4XA 3LEVH 2I5YL 1VPOH 3U0WL 5F6HI 4LVHC 4N1EA 3QIBB 3KVQA 1E4XH 1ZVSA 3PWJB 4NHUB 1J1OL 3LHPH 2YEZB 3GMOA 4JFYB 3LN4B 4Z7UA 2FX9H 2CLRB 1RHHB 4EOWH 1IMHC 2QJDA 1JGDA 4C4KT 1I3RA 4N0YL 3KLHD 4WI7A 3C2SA 3M1BB 1KN4L 4DVBB 2A6DB 3G5VB 5J6HA 5CHNA 3Q6FA 1LMKA 4PRPA 3UTQB 4XVTL 5BO1H 4KVNL 4GLRI 2FB4H 2FO1A 4WU5B 2EXWD 5E4EC 4HIEB 3SQOL 5KZCB 3BYTA 5DD1L 3BXNB 4XPHL 3DXAD 1KUMA 2WQRA 1ZA6B 4IOSD 2DIAA 4TOYL 2FGWL 2Y1VA 3Q5OA 4GRLC 2H8PA 5JORA 4KQ4H 4UIMA 2DQTL 3LPGA 1HH6A 3BYYA 1MCRA 3QUMB 1U36A 4HUUB 4HBCL 3QNYA 4I4WB 1IT9L 2W38A 1JPST 3O2DH 4I3SL 2CK0L 4X9IA 2ZUYA 3MCKB 4G9FE 3NACH 1E4WH 4AM0A 3HZMB 5L6YH 4MNGB 3ZTNL 7FABH 4BSJA 1BGXH 4TUOA 3QA3A 5L0QB 1W0WA 1U91B 3GBNL 4MAYA 4P2CG 1F3DH 1EAPA 3OB8A 5EUKA 5T5NF 3GSRA 2DD8H 4OI9A 5D7LE 1M6OA 1C08A 3KS0H 3O4LD 1A4KB 1MFBL 4ZO6A 5E0QA 2FH8A 2VAAA 1AGFB 4ZSOE 1L0QA 2OJZL 4PRNB 4JFZH 5HHOA 2WMPA 4NSKB 3G9VA 3H9YA 4PJEE 1L0XA 2FEEL 4Y19E 3D0LB 4G8GB 5IJKA 2ZNWA 1RUKL 1JF1B 2CLVA 1TNMA 5DJ2B 1FVCB 4TNWK 3OX8A 2VSCA 2VZ1A 1H3XA 3WS6C 3O6FC 3WFHA 5CD3B 4KMTL 3L5XH 4FTVE 1YQVH 4J3OC 5KSUB 4JPVH 4H20L 1BFOA 4C54A 3HUJA 4FZEH 2FJGA 3V52L 4ZFGL 4KJQD 3HZKA 5GZOC 3BPOC 1IM9D 3H6JA 2DJ4A 1PSKH 2EDNA 4W6YB 3VDAA 2COQA 4C4KO 5ACMA 1OP3H 1X5KA 3JSSA 2IALB 3ULUL 5BS0E 3K4DA 1XF4A 1KFAH 1QLFA 4IIQC 1D5XA 4ZOBA 2ZOLA 1G6RH 4K94L 5DFWH 4P9ML 2BSRB 2KPNA 2BVUA 1KCLA 2O61A 3L3HB 2V5RA 1CICD 5CILL 5EFIB 4JO3H 4MXVF 4ETQB 3T0EB 3VI3E 1UVQA 1FP5A 5DC0A 2DAVA 5I1EL 2PXYD 3B9EA 2E7LC 4PLOB 1H0DB 2H32B 3KPSE 3BPNC 3U1SH 3OGCA 5HD8D 1RJZB 4Y4FA 3SGDI 4TSAH 3UCRA 3DSFL 2IEPA 2K3TA 4M7LT 3BO8B 4PJBB 5C0JA 4YHZL 2VLKA 1A47A 2Q3AA 4JPIA 4K3DH 5GSVA 5C0BB 1UM5L 3EJYC 3VFVA 4OTXL 5B8CB 3H9ZA 5HGHA 4MB3A 1KNOB 5F1OB 5IP4A 1T0MA 3ECBB 4JANA 4IRSA 4JRXD 4CDGC 2GITA 2EO1A 4WDIB 5I74B 4CDHA 4Y7MA 3QCVL 1MCCA 1T5WA 3RX7A 2ZP0T 3QJHA 4Q7DA 1MNUL 4H8WL 4C58B 4P4RB 5TE6H 1LEGB 1MRCH 5ESQB 3W9DA 3LIZL 4QRUB 3RGVC 3DUSB 3X3GL 4AIOA 2UVFA 1CGVA 2XZZA 1CDYA 3D0VB 5IFHH 1FZMB 2OR9H 2DLIA 3CSGA 5EU3A 4JHWL 3BP5A 4OM1L 4A6YA 2RB8A 1A0QL 3GMQA 4G5ZH 2J88H 2QHRL 4LKXA 1J1PH 1IGFL 3W0WA 1NMCB 2QKIB 5J57B 2VQTA 5E8NA 4V1DA 4XCFH 4P5MB 3ARFC 3IRZA 1P4BL 4DVRH 1CBVH 2NY2B 3LKNB 4JDZA 1X44A 2EDEA 5IMOB 1FL3A 3OAZH 5J6GB 4U2ZA 4X6DA 3C60B 5EU6D 5D6CA 4K3EL 4G8IA 1MJ8H 1T89A 4PR5B 5T1LA 2RJMA 4KTEH 2OBGA 1ZSDA 2P5WA 3H3PL 4G43A 5IIEA 3L3JA 1V05A 1I9RL 4AIZB 5LVEA 2V17L 5B39A 3V6FA 3K1DA 1X5AA 1UM4L 2J7LA 2J8UB 4Y16B 3TFKC 1T03L 4M9PA 4MNQE 1OT2A 3IDYB 2A9NL 2XY2A 4LMQE 3V8CA 1UB5A 3FT3A 4NRZA 3C6LC 2FBJH 3VD5A 2EC9T 1RURH