3L3OB

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
184
structure length
184
Chain Sequence
b'LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
molecule tags Immune system
source organism Staphylococcus aureus
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
total genus 26
structure length 184
sequence length 184
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00207 A2M Alpha-2-macroglobulin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.130.20 Mainly Beta Single Sheet S-adenosyl-L-methionine-dependent methyltransferases S-adenosyl-L-methionine-dependent methyltransferases 3l3oB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3oB02
3STBA 2X6MA 1GRWA 4GKOA 1IAKA 4OJFH 4BKLB 1H8SA 2X4SB 4XNUH 4XBGA 1HIMH 2HJFA 4NHUA 3VA2C 5HVFB 5I66B 1K6QH 3F7RA 4U6YA 5T3XL 3TVMA 5C08D 3UROR 3W81A 4N0RA 3MYJB 4YGAB 4QRRE 4Y2DB 1AC6A 5A2LH 5EZLB 1FBIL 4YFEA 4R90H 4TSAH 1WZKA 3PXHA 4KJWD 1XF3A 5MEPA 4R4FL 3SDDD 1IAOB 4MDJB 1ZTXL 4NQDE 4QHMB 3T2NH 5DI8A 1WICA 2ESVD 4J6RL 4UV4H 5CBAA 1K8DB 1RSFA 3IF1A 1QBMH 4LLQB 5ANMB 5D1XA 3SN6N 2GT9A 4G9FE 4U0RC 4Y19B 3L5XL 5E24E 4K94C 4WDIA 3IDNB 5F9JB 1BIHA 2DBLL 2EYRB 2CLZB 1BEYH 4YK4C 3T1WA 2EDBA 2D31A 4OI8A 4JRXB 1FVCA 2YD3A 1AD9A 1NCCH 4JFPB 4UIMA 3VFWA 4HFUH 3ILQD 4FQLH 2ICCA 4NQXA 3MBED 5D7JC 2H45A 5JXAH 2CQVA 1CYGA 2Y36L 1MI5E 5CD3A 4BA8A 1MH5B 3QIWC 3QUMH 1RUML 3KPOA 4L8SA 2BOCA 4NCDA 2XT1B 3VXQB 3LEVH 4OZIF 2BK8A 2XZQL 4IEFB 1BJMA 4J3SA 4GMTL 3OSKA 4I13B 5DURD 4PGJA 1R0AH 2N56A 5DK2B 1XR9A 4ZYKB 1CDGA 1JF1A 2V7HB 4HXBH 5DHVB 4UUJB 3SOBL 5I75B 2ITDA 5KVDH 3QHTC 1KENL 4N8VG 3STLA 1DQJB 5C09E 2OQJB 2NYYD 3VXOA 3WO4B 2ID5A 5EN2B 3OB0H 2E9IA 3QUXB 1VFAB 1UQSB 2EDFA 1ZT1A 3VXUE 4UOW1 5I1DB 1KJ2L 2CMRH 2DKUA 5I1DA 4L4VA 1KIRA 1IGML 1GCFA 3O6LH 3QJFA 5F7WC 3GKZA 2EDTA 2XY2A 1I8MB 2D0GA 4X6DB 2VO5A 3QO0B 2CIKB 2AXJA 4Z7QF 4QXTA 2A83B 5CSBA 3CFBA 3VFGH 3G6JA 4PB9H 1RIHL 5L8KB 3GRWA 1H8OA 2J8UB 5DC4B 4Y19D 2CXKA 5JW5B 1S7VB 3RWDB 3GRWL 4QT5A 4LCCC 1F4XL 2Q6WB 3RWFA 5JOEA 3FB8A 4WENB 3UBXA 1FJ1B 3SDXB 3RU8H 3C60D 5HXMA 2OXGA 4U3CA 4ZPVB 4CMMA 2AAVA 3BD4A 1XF1A 4APQC 3WEXA 2ICEA 1RI8A 4WFHE 1BAFH 1WFOA 2WBJD 2ZKHH 1DVFC 4GMSL 2WBJC 4NQXB 1F4WL 5FO7A 5B3NA 1U91A 5IFJB 2H32B 2ZUUA 3BPLC 4UQ2B 3QISA 4FMKA 3CFKA 2A6KB 4QF1B 2XZCL 4H20L 3UJTH 1MJUL 2XYCA 3TBTB 3H3PL 2XNAA 4LF3A 4XVSH 1BQHB 3MREB 2W0LA 2AJUL 2ADFH 1QLEH 1BIIB 5DEFB 2OBGA 1VENA 4QXUL 3WUWG 1KN4H 3LKOA 4GW5B 4PJIB 4JY4B 3JSSA 1YN6B 1QQDB 4TPRL 3RVXC 5D7KE 4LP5A 4BKLA 4PJBB 3HG1D 1CLCA 1WCQA 2HH0L 2W0KA 4ZUVB 3VFPB 1UEMA 1I8IA 3ZHDA 2V5SA 4TULL 3QDJB 5F97E 4HCRH 4C4KT 1A7QL 3EJZD 3TIDA 3TO4B 3LQAC 1IM9D 4KQ3L 2AEIT 2V7NA 1Z2KA 1BLNA 5C0DB 2E9JA 1JCKA 2J6EH 4HUUB 3LKPB 1K4CA 4PP2B 4Z7OF 3C60B 3VW3L 4W4OC 2HT4D 3S36X 4XBGB 2A0LD 2HKHL 3LEXA 3NFPA 3CVIL 3D85D 3EOTL 4JKMA 2C3XA 1MNUH 4PJHF 5KSVA 3PHQA 4JJHA 1IAKB 3DV6B 2Z8WC 1U8QB 1Q0YL 1FL6A 4P5KB 2FLBT 5HHQA 4CJ1A 3V4UH 4RMQA 2X4OB 4KMLB 2NTFB 5I9QB 1OARH 4XTRC 3KYMA 1Y0LB 3IDMA 2W9LA 1VCAA 5DJAB 5C0GB 3ZE0E 1J05B 5I1KL 5I8KH 2FGWL 3KPSB 4KDWA 4YHKL 3OR6B 3D85B 2W9EL 3R8QA 1PY4A 3B9DA 4HWEH 3DSFL 4YE4L 3B2UC 3QJHB 1Z5LA 1SBSL 1A7NL 5L7XH 1HKFA 1D5XA 4ODSH 2A73B 4LSTL 1RZIB 4PJBF 1UXSA 5D7LB 2PTTB 5JIKA 3HG1E 4WUKL 4MCZB 3PXJA 1KCVH 2WINA 3QDHA 3NAAL 3SY0A 4LCWD 3TJEH 4PJHA 3ZT6A 3BGMB 5E08H 3MOBL 1LDPL 4X5XA 5HI5C 1A6TA 3I3BA 4OKVB 2B4CL 4X4ZA 4N0UB 1U8HA 3G6AA 1EFXA 3QIUD 2X1WL 2BXZA 2WQRA 2AK4E 1I9RL 5TE7L 2Y23A 4IOIB 4F7PA 4PG2A 1GC1L 4XCFL 4PJHE 3JV6B 1DQML 1RMFH 2QSTA 4F7EA 3MRQB 1ZK9A 5L0QC 1L4IA 3WD5L 3UJJL 3HN3A 1CXKA 1UACH 3U36B 3UPCA 4D3CH 4RQQA 4NKMB 2CJUL 1HK6A 4CNIB 5IB1B 5E5UB 3UPRA 3TBYA 4N8CL 5JQ6L 3I6LD 3QEQD 2D9QB 3HAEH 2D9CA 3ULVL 3MQIA 4QEGA 5DSCA 1CZ8H 1EDQA 1YEEH 4YHNB 2FR4B 1KC5L 3LHPH 4OCRL 1HSAB 5DT1L 1D5MA 1LO0L 4BFIB 1EBAA 3TT1L 5EU6D 4NO2B 4QRPE 1NBVL 4KUCF 2RJMA 3FL7A 5GS1C 5I18L 3MO1B 4NRYA 4NDMB 3RZCD 1OF2A 3RPIB 3T77B 4PJAA 3SKMA 5IMLB 2FR4A 2NY6D 3SO3C 1HI6B 3S3SA 4HUWB 4A2MA 1UGNA 4PJBA 3S4SA 5BZWB 2AP2A 1FL5B 4JPKL 1LGVA 2QQQA 3SGKA 5EULV 3VGGA 5HD8D 4XXDB 1C16B 1YEGH 2ZUXA 4NDMA 1LE5B 3BVNA 4LSVL 3BQUA 3D2UD 4GS7C 1OPGH 1IFHL 5E2TH 2BRRL 3QZWA 4I0PD 5LCVH 5FYJH 1FYTE 3S88L 1I1AA 2P8MA 2QQLH 4HLJA 4YHNA 4JM2D 5GIRA 3FQRB 3FQTA 3SDXE 1FGNL 1RJYA 4NNPL 4F37K 3CU1A 4WHTB 4N0YH 3FQUB 4K23L 4JFYA 2FL5A 5D2NA 6FABL 4J3OC 4JVPA 4NQUA 5KTEH 3DRTB 4X5XB 1S7UA 3EFFB 4YZFF 2PN5A 3V5KB 2H6PA 2BVOA 3D2UA 1SJEB 3U7YH 5BZDB 4L4JA 5AUMA 1BVLB 1JZ7A 3VWKA 4YDLB 5I76A 3F58L 4NJ9L 4KV5E 3HRZA 4BH7B 3B9EA 2A1WH 3BDYL 1BQHG 1JNLH 1I3GL 4Y5VB 2AJSH 4JRXD 5EU3A 3JTTA 2C4XA 3PV6B 2L7UA 3FB5A 4DK6A 4LNVA 3UTSD 5D7JD 1B2WL 1FG2B 5D7IA 3IJHA 4LCYA 4FFZL 1IAIM 2VXQL 4K7PH 1B0GA 4N0CD 3G9AB 5KVGL 5MEOA 1P4IL 4DN4L 3OKKB 3CLFL 2FECI 4OZGA 4L8BB 4JDVB 4MD4A 2PF6A 5D7SH 1WC7A 4NN6C 1UXSB 3LN5A 1E4WL 1N64L 4GG8B 2QADC 5IK3A 3RX5A 4IMLA 2VDLL 1L0YA 4P5KA 1WT5A 5HHXL 4IRSC 1NCWL 2JIXB 4LLUB 3T0BA 4FFYL 4ZYKA 4X6FA 2A6DB 4CN6A 1C5DA 3VWJB 5CBEB 3BYTA 3WNNA 1O5DT 4S1RH 5J1AA 2ARJQ 4XC1H 3ARVA 4H25A 5IIEA 3PDOB 3PGFH 3LKSB 2DL2A 5I17B 1FL6B 2IH1A 4Q6IA 4OCYH 5F1OB 1FVEA 4LCUA 4J1UB 5IBUB 2ITCB 3OJMB 5TDOA 4PJXE 1HYRC 5CEXA 4JY4A 4PJ8C 2RGSA 32C2A 4R0LB 3RI5K 3RTQC 3BFOA 5TGBB 5I8EB 3MOQA 1OW0C 1GH7A 4HIXL 4HUKB 1ERNA 3WLBA 1C08A 2PYFB 4WHDA 5JIHA 3EZ8A 2F54E 3WJJA 3QFDB 4BK5A 2VLME 3TO4A 3WDJA 2Y07H 4ESKA 1VESA 1FPTH 1T22B 5EFIA 5ESVB 4BUGA 4LLQA 5ANMA 4JHAH 1F8TL 4IIQC 4TSCH 1JUFA 1M6OA 3PDDA 3NN8A 3PWUB 2NNAB 1Q9OA 1IGJA 4R4FH 4QKXB 1J8HB 2R0KL 3HE6D 1X6NA 3NABL 3DX7A 2DQDL 3IGAA 2VZSA 4ELME 4AIZB 4P46B 5DEFA 3WNKA 1G7HA 4M7KL 3RAJL 5E0QA 3UX9B 3NPSC 3SE9H 5JOFB 5HGHA 3WN5B 5B38G 2XRAH 4GG6F 2B1AH 3OTTA 1FFOB 4FP8H 1SQ2N 3CVHH 1I9IL 4LLWB 1MJJA 3E8UH 3QXWA 5CZVL 2C4FU 2ICEB 3ZKMC 3D39D 9CGTA 1R5IB 4GLRI 3B9KD 4QRRA 3QA3A 2P8LA 2PO6C 2VLJE 4M1DH 3I6KA 3G5VB 4F33B 3WLBB 2G2RB 4HCRA 3TC9A 4PRBA 1MIEH 3OJ2C 3V6OE 1RURL 5I9QC 1INEH 1FAIH 3GSOB 5F8RC 2IADB 4OQTH 4K94H 4GMTH 5SV3A 2H9GB 3T1FA 1LO4L 2YUVA 1SM3L 2BX5A 2J88L 3U48A 4P2QE 4TVPE 5D2LA 2HG5A 2FBOJ 4X9BA 4HGWB 1R24B 2YKLH 1VB9A 3OXRB 4KTDH 3MGTA 1WGOA 1BM3H 1AR2A 1JWUB 1HINH 1GGIL 4JQVC 1OCWL 3T8XB 3O4LE 3L6FB 5IM7B 4D9QE 3MJGX 2G9HB 4NKOA 4WUUE 3UTTD 4XI5D 2FSEA 1NFDF 5DD0L 4PJAF 2DL9A 1IGMH 2Q8BH 5CINL 4ZTOL 2NLJB 1VGKA 3HMWH 1DN0A 3HG1B 4JE4B 3OKMB 4MJIE 4QGYA 4KK6C 4WFHD 1FVCB 4HXAH 4YO0A 4RIRA 1JI2A 3SE3C 4CU6A 1TXKA 2YD2A 5D1ZD 3VFGL 5J56B 1CF8H 2APWA 5E03A 2XQYK 3I6KB 2ENSA 4QRRD 3VGFA 1BHGA 4Y19A 5F7HA 1I85A 5HHMB 3SKJL 2X1XR 1R5IA 1CK0H 1K8DA 2CO7B 4CKVX 4Y16D 4UNVA 1EEYA 1VSCA 3FQUA 5AD0B 4XCEB 3V6BR 3ZE1F 1CLZH 2VKWA 4L5FH 1UB6B 2VDNL 1TQBC 5ESVA 1RZKL 2P5WA 3SPVA 1JRHL 3BH8B 3AAZB 4OTXL 5AUMB 4HC1A 3FMGH 4HZLB 3BISA 1T5WB 3HE6A 4DGIL 3UC0H 4NHUB 2X1OA 4JN1L 2GSGB 5EZJA 4B7IA 2OR9L 5HSFA 5I6XB 3ULVF 5KVEL 4WGWB 2APBA 4M3JA 1KCRH 2ITCA 1TVBA 1CFVH 1NCDL 4OF0A 3MCG1 4Y4HA 1CFSA 4G9DB 3PJSA 1TZHA 3NTCL 5ALCH 4X4MA 3NGBB 3C6LA 5J0BA 4J2XA 2EKSB 1WIPA 2GJJA 3X14B 1RK1A 1BF8A 4ONGL 1NC2B 5IFHH 3AFLA 3NZ8A 1S7XB 4U6YB 4EIZC 4JHBA 3HI1B 4JZJC 3S35H 4PRNA 4LLMB 2A77H 4H5SA 3TNNA 5B39A 3ULUD 15C8H 3O6FB 4RFOL 3PL6C 2I9TA 2R69L 4HS6A 2IAND 3LV3B 5DWUL 1EK3A 2R4SH 5EWIH 1KPRB 5IIEB 1T2XA 1W72H 1OAYH 2VSCA 3ARDD 4J12A 4RQQB 3UTPE 1CGWA 4LCWB 5C0JB 1AJ7L 4MMZC 5EU4A 2HVJA 2AJXL 1UJ3C 3REVB 4BFIA 2QV2A 5AG8A 5ISZA 3WE6A 3NGBC 4XCNB 3DX9B 2AK4B 3LN4A 5J06A 2ZCLL 5HHOB 5ILTH 3IJHB 3QEQE 43C9B 3W9DA 3TZVC 3QWRD 1QHOA 4PJ5A 3A6BH 3TT3L 1LD9A 4PJ5E 5EH1A 1YNLL 1BP3B 4MLSA 2X9XA 5CCKH 4ZO8A 4D9RE 3M1BB 4HZAA 4ZUTA 4LSTH 3GBML 4HT1L 1G7LA 4NBXB 3UCRA 5ISZE 2F74B 1PDKA 1MHEA 4IJ3B 2C7UB 2R0ZL 1Z0MA 3NH7H 5IGXL 3VGAC 2WP3T 1G7PA 3QCVL 3VXRB 1LD9B 3ZDXF 3IU3A 1X5XA 1EFXB 1K3ZA 1Z5LB 5DMGC 3OF6D 3QEQB 5BMFL 1RJYB 3GSNH 4L9LB 4QHKJ 5JW4M 4AMKH 2B1HL 4I3SL 2Y06H 5TE7H 3DX8A 2QQKL 4HFWB 4NCC1 1GZPB 2V6HA 3GFUA 3SQOH 5T1KD 3WYRA 1DQMH 2VXTH 3OX8B 4YBQC 4KMTH 2I26N 4RMRA 2DQTH 3QFJE 3KLDA 3ARDC 2NTFA 3QPQC 4XC3L 4U1IB 2OZ4H 3B5GA 1MLBA 4LPTA 1NKOA 4X4ME 4D3CL 2MOVA 3LV3A 5EUOF 3Q3GB 2JB6B 4OCSH 2AV1A 3VXSD 3TIEB 5IROC 1AGEA 5HHVL 2GUOB 4TVPD 3WE6B 2DQUH 3B9VA 5FF6B 4KZDL 3WKMH 1NGZA 3HB3C 1S9WA 5E2WH 2BCKB 2D03H 3MRLB 3LHPL 3FQNA 4JFED 3OAYH 4NNXB 4ZQKA 2RCSL 4OM1L 1ES0A 3ARXA 3QIWD 4W6WB 1H0DA 1C16A 3O4LD 4UAOC 4DKEL 3O9WB 3ZSTA 5I18H 1FE8H 5HTSA 5HHQB 1FL3B 2XA8H 1QSFB 3MBEC 4L3CB 4D9LH 5ID1A 5F7NC 1N8ZA 5E4EC 1UM5H 2YA1A 3TBWB 5C0AB 5E2VH 1MY7A 4PJAB 4X5LA 4PJ7F 1PYWA 1DQLL 3IRZA 3ZTNH 4ORZC 5ADPL 3N1MC 1MFEH 1S7XA 3MREA 1EEQA 3O4OC 3C6LB 3MXVL 3H3KA 1NC4D 1YNKH 1DLHB 1FSKB 3FN0H 4ZUVA 5TDPB 4HKXB 4MQ7B 4Y4HB 5GGUB 5L8JB 1EEUA 3HC4L 1L0QA 4KJYB 4ZAKB 5TE6L 4Z8FH 2DN7A 3CUPA 1MUJA 2X5PA 5FUOL 2IFFL 3G5ZB 4O58H 1XF5B 4QHUA 2JTDA 1JGVH 1R3HB 5L2KD 5DJCA 4GKSA 1U8NA 2RBLA 4JO4L 5I74B 5SWZE 1ORSA 1ZLSH 4LDLB 4QF1A 3CFKB 4G80A 1DBMH 4KI5F 3G08B 4FG6D 1JNJA 1TCRA 4JDZB 4QXTB 5MENB 4OCWL 4K3GA 3OKYA 3UP1A 1OB1A 5I0DA 4JQXC 3TN0A 1NDGA 4OKVA 1LE9A 2B5IB 1TQCC 1L6XA 3GO1H 1N0XL 3SKOA 5IM7A 1BVKB 1G7QB 1J88A 2OX5A 3FB8B 4FFZH 3F12B 4PTTB 4LLDB 2BHUA 4GLRH 3KPTA 3LSOB 5DRWB 2GJ6E 3HAEA 5D71H 5E94B 4TRPL 4G8FB 3PUCA 3U4EA 2QSQA 5D7SL 1ZHKB 2Q1EA 3F62A 2XWJB 2HVKB 4JFOA 1W72B 1DQJA 2OTWB 1RUQH 4K7FA 3T1FB 4O4YL 4E42A 4YHLL 5HPOA 3SKNB 2ATPA 4X7DC 4WWKB 2AK4A 4HW6A 4S0SD 4YXLH 4DGYH 2W07A 4JFHE 2CKBL 4URTB 3AY4C 1F4YL 1E4JA 3T0ED 3F7YA 1IBGH 4OM0H 3WMSA 1JWUA 1BLNB 1BZ7A 2VLJB 3OG4B 1XGRA 4ZS7L 1V8HA 1X5YA 2FBJH 3CX2A 4YXHL 3JBG7 5FA3B 4P3WA 1ZXQA 2HG5B 4XP1H 1U58A 1K4DA 5DR5L 2HT2C 1OD9A 4YC2C 3SDDB 3HKFA 1FZKB 4TQEL 3TPUA 3DETC 3DV4B 4HX1A 4UUJA 3CGTA 4WJ5A 4NN6B 4YDKH 1R3IH 5HGHB 5LXGH 4YXKH 1UWXK 3G04B 5LGJB 3V9FA 4Z7UA 2VJXA 2VE6B 1U8OA 4DOHE 5I1JL 3DX7B 3MV9E 3QP3A 4G9DA 4DZBA 4O51B 4R90L 2ADJB 1XGYL 3OPZL 5E6IB 1IAIL 4Y5VC 4BFGA 4O51A 1MCHA 1GJIA 4M6ML 3S96B 3LKOB 2IGFH 2UZIL 3VI4E 2E3VA 5I1IL 4OGZA 3UBXB 2R0KH 5AZEH 2FJHA 3TYFB 3GI9L 2VDKL 1KEMH 4M9PA 4TOYL 5I66A 2YPLA 2W9DH 4LGSB 2P5WD 3GNMH 4RCAA 5JW5A 1S3KL 3OGCB 1V3MA 1UB6A 1JHKH 4WJ5B 2EIEA 1DBJL 3U83A 3H42H 1BMGA 5EORL 1Q9OB 5T5NF 4KDVA 5I1LA 1M6OB 4P4KC 3QQ9C 2VLKB 1HH9B 3LB6C 4RGMB 4MAYD 2F9BT 4LLYB 1CDCA 4DUWA 4OLUL 2D4FA 2ZG1A 1XGQB 4ALAL 1T0PB 5HDQH 3MRMA 1TENA 3Q6GH 1C5DB 3VWJA 2X4PB 3ZKSD 4U1JA 4U0QB 3RWEA 2VR4A 4GBXC 3D5OF 5D5ME 4JZOA 3ARYA 3UTQA 3VXOB 2FH8A 1T5XA 4ZOEA 1LK2A 4I18B 1WAAF 5SWSB 3QCUL 3EAKA 1FAIL 3NA4A 4Y0GA 1BFVH 3CK0H 1Z9SA 3BAEL 5DK2A 3MGAA 5FYLL 1Z3GL 3FRPA 4XNMB 3MLRL 3QZWG 4Z0XA 2V5YA 3IJSA 4C58B 3OWEA 1Q72L 3C2SA 1XGPB 5DK0B 1R24A 3OXRA 4MA7L 2DQGL 3FOMB 5K9JH 2P5EE 2WUCL 2VAAB 3MV7B 4YFDB 3Q5YA 5MERB 5KSAA 3EBAA 2BVQB 1MHCB 4YBLB 5A3ID 5I1CH 4FFWC 1AO7A 1QA9A 3H9SD 1KULA 3TZVD 5EUOA 3PV6A 5DRZB 5IESH 1KELH 4UT9H 5CSZA 5K9KB 3MLWH 3HRZB 5EOTB 1KTKE 4PB9L 4ODUA 1OWRM 4J3UA 1FNGB 3SCMB 2DLEA 5DJDA 4NHCH 3KLHC 4FQ2L 3BZEA 4L9LC 1B6DA 4YH6A 2YPKB 3DMMA 3IXTA 4JGJA 4Z5RB 5TE4L 3UTSB 1TLKA 3O2VL 5IVXF 1TJHH 3QQ3B 1FLRH 3BPOC 4U31A 4JREC 2HFEB 3IKCB 4K55A 4G80B 2X4NB 5C09A 3V5DB 1VFBB 4KUCD 4F7CB 5J13C 5JOFA 3MUHL 3BDBA 2P24A 5ACZB 1R3HA 5GZNC 3QRGL 4MXWH 3MYJA 2VDNH 4XP6H 1MJUH 1TJGL 3QUYB 1S7RA 4QRPA 3MRKB 5I71C 2XXMB 3IF1B 2IPTH 5A2KH 2FWOB 1AR1C 4NOBA 1TITA 4H0IA 5IMOB 5F3BA 4N90E 2EIBA 1QYGL 4IRJD 5DGQA 4XP9H 4WO4B 4DN3L 4ERSL 3MRJB 4MNQB 5IEKA 1CGSH 3CX5J 4TPRH 2Y7QA 5KN5A 2Y4SA 3GMOB 4Y7MA 1CFVL 5FO8A 5EBGA 3DO7B 2P1YA 1N6QL 2ED7A 4RA3A 4UT7L 2FEDD 4RDQG 2BC4B 1EERB 1S9WB 4PJGB 4JM2F 3QDMB 4ZXBB 3SJVD 2GEEA 2NY7H 1MIML 2E6PA 1TTGA 2AJZA 2CR3A 1S9VA 3VDBA 5JW4Q 4LVHB 5FGBA 3TBWA 4MJ5A 3SDCB 3RGVA 5KSUB 5JHDA 4XP4H 4OZHA 1QSFA 3LKSA 3OV6A 4F8QA 4L8DA 4PIRF 3IFPB 4UOJA 3B2VH 5F7UA 3SKMB 5IB5A 5IMLA 4NN7B 3BO8B 5EWIL 4E41D 1KJ3H 2XTJC 1YDPB 3I85A 4OCNC 3TA3A 5C0CD 3MRQA 4LHUB 1T7YA 3VMPA 3RWHA 1HSAA 1QSFE 1D9KB 5A40E 3GJFH 4OZHE 4IBLT 2RFXA 1K85A 4NJAH 5ELIA 5DSCB 5ITBH 3CDGB 1XGTB 2BY2A 5J3HC 5I8KL 2AJVL 4G3YH 4Y1AA 4UIKH 5KW9H 1S5HB 4A6YB 4NO3A 5FDWA 1PSKH 1H8NA 3BQUC 3FCTB 3AREC 4YNYB 4ODSL 5CJXC 1HDMB 2AEPL 4M4PA 2ZSWA 1X5HA 1R3LB 4L1HA 4NQEA 3ULUH 2DQJL 2V5RA 4F7EB 5E99H 3T4YA 3PHSA 1XF4B 1WIUA 2NZ9C 3KGRA 3UXFA 1NANH 1T3FA 2DQFA 4UT6L 5L88L 3PF2A 3S8WA 1IGCL 1RZIA 3QRFM 3BPOB 2CDFB 4EEEA 4JLRA 4LDEB 1LDPH 1RZ7H 2DQCL 5D2NC 4G9FD 1O7SA 2CDFA 2O5ZH 4J4PA 1GPOH 1C5BL 5IV2B 1MQKL 2W0FA 5F7YC 2G60H 5F89A 3I3DA 4KRMB 3LN4B 1TZIA 1XF4A 2FATL 5FCUH 2E6JA 3SE8H 3WNMA 2VC2L 2CGRL 2B1HH 4I3SH 2O61A 1HXYA 2QQKH 3N9GL 4ZDHA 5C0NC 8FABB 1CDJA 2V2XB 1EV2E 3UJJH 3EO0B 3SQOL 5CEZL 2PCPA 1A9EB 1KLGB 4LPWA 5I1HH 1MWAL 1QPXA 2J8UE 3MJ9H 2DLTA 1DBAL 3WL9B 2EZ0C 2FIRT 5TFSH 3FQRA 2AK1H 2W65B 3G6DH 4L3AA 1G7IA 3WSQL 2DTMH 3ARBD 3J7HA 1FGVL 4RISL 1CLOH 1EUUA 2BNRB 1YY8A 2HVJB 3T0EC 3T3ME 1A7RL 3IDMB 1NC4B 1LO0H 1QZ1A 2WUBL 3DO3A 5C0EB 4LIQL 2DLFH 4Z7QE 4O2EB 1ZVHA 1U3HC 3LDBC 4HHAA 3F5WB 1MVFA 3O4LB 5IOPB 1AO7E 2VQUA 4M6OH 2EDNA 1Q8MA 2PYEB 3EJYD 3MA7A 3NIDF 4X5WB 5KSUA 3RGVB 5BS0E 1RZJC 5E9DE 2GITA 4P2QA 1U0QA 3DUUA 4GBXB 3MRNA 4WI3A 5GRWA 2ZUVA 5FOJA 5FYKU 1X5GA 2I60L 3JUZA 4P2CG 4NM4H 1MVUB 2NY4B 4XH2B 1DQLH 1J0HA 4YHOL 3AAZA 5GRUH 1KACB 5D6CB 2D7NA 1L9NA 3QIWB 4UQ3A 1IQDB 1I7RA 4R4BB 4X7TB 4APQA 3QHZL 3D39E 1AGBA 3O41B 1CFSB 3BESR 4F8TA 4P4KB 4NZJA 3TEUA 3C87A 5D5MA 1Q9LA 1ZT7A 3RX8A 1QR4A 3GJEB 1HE7A 4ZO9A 5DRNA 2JJUA 3RTQA 1I7TA 3FN0L 2WK2A 3H9HB 4XBEH 4QTIL 2PR4L 3BSZL 3Q1SL 1KOAA 1KJVB 2EYTA 1UCBH 4L4VE 1IM3A 2BMKA 4KTEH 4F7CA 3I9GH 3FONB 3TH2T 3RIFK 4P2QD 4NPYB 1JWSB 2LTQC 4NO0D 5IFJA 1BQUA 3CMOH 4UU9A 4JO4H 4IOSD 1Z9MA 2A1WL 4N0UA 1QKZH 2ZPKH 4ELMB 1DBML 4JJ5A 3L9RB 5HDBF 4D0DA 2WW8A 1XZ0B 4OCWH 1OGAE 5BS0D 2XZAH 3T65A 4TNWK 5B8CB 4YQXH 4HWNA 1TZGL 4QT5B 4R7NB 3T0EB 3PV7A 4AEFA 5I15H 3A67L 4G8GA 4U1KA 1FZOA 1NGWA 3D9AH 1SJHB 2OZ4A 3MRRA 1G0XA 4U1NB 6CGTA 2MPAH 5FO9B 4Z95L 4YR6B 5GS2D 3HPLB 3TFKC 1D5IH 3O6ML 3RIAF 4HS3A 3ZE2F 2PW2A 1XR9B 1BVZA 4YDJB 5C8JA 4JHWH 3KDMA 5JPNB 1A4JA 1AIFA 3GSNA 1FN4A 1GOHA 1NFIA 2H26A 1OHQA 4EDWH 1VGEH 1SHMA 4M02A 2MFNA 4G6MH 1Y18A 4YHMH 2NXZD 4N1HB 2H2PD 1WISA 5DD6A 2NY1C 2BNUA 3ZL4H 1CDIA 4JZOB 3C09C 3W11C 3WS6C 1PD6A 4MA1B 1GGCL 5DJXA 1X44A 5IWLA 5L6YH 2IF7A 5GGRA 3MFFA 4POYA 4HUUA 2EEDA 3PWPD 4AQ1B 1Q9WB 3BUTA 5IKCB 4TQEH 4OT1H 3D87B 4WWID 1AQKL 5LXGL 4JFZL 1CFBA 4AEIL 4N8VB 1K6QL 4MD5B 2X4UB 3VGBA 1YQVH 4D9RD 5MHSE 2EIDA 4MB3A 5GHWH 2EH8H 1E4XH 3MODH 4TSAL 3ROLB 1OWWA 5E00B 3HUJB 3L3DB 1G84A 3OGCA 2NMSA 4GSDH 3MRCA 4GAJL 4D8PA 1J1PL 3TO2A 2EYRA 4Z7WE 1BBDH 1GVIA 2DM7A 4PRHD 2C4FT 5FYKE 2D4DA 3P0YH 5DMJB 4U1HA 3RAJH 5GGVY 1A64A 2VISA 4GUPA 4UQ2A 3RA7L 3CLEL 1BEYL 1R5WA 2VDOL 4OZFA 2ARWA 3BMVA 4F9PC 2R2HB 2FHFA 2YK1H 3GK8L 3O3BB 4RMSA 5C07D 3O8XB 1IAOA 3VRIB 2YMXL 4FQLL 2F5AH 4H25B 1IM9B 1FJ1A 3FZUC 3SDXA 3QFDA 4G42B 2VN4A 4UNUA 1BD2A 5GS1A 4PJGF 3PIQA 2IBBA 1A4KA 4K8RC 1WF5A 4KUZH 1X7QA 3LEVL 3EZJB 5FYJE 1LK3H 3QXDB 32C2B 2Q3ZA 2FNBA 1OGTB 2R1XA 3N1QC 5DTFB 43CAB 4LU5H 1H3GA 3T4AA 1ONQB 3QWOA 1QLRB 5D72L 3EYVB 4PRDB 5ESAA 3O9WC 1INEL 1QUNA 4X6CE 2ERJC 4NKIL 3IAGC 2A74B 4HJGB 2G5RA 4HC1H 5DVLA 4KKBC 4UILH 5EO9B 3HE7A 4N0FB 3QUYC 4FQJH 5DUBA 5DVMA 4K9EC 3ZZ1A 1D6EB 3KYKL 3CZJA 5LG1A 4JPWH 1WBZB 3UTTB 5JZ7C 3VFUA 1IT9L 1MCIA 1VFAA 2J4WL 4LLUA 1B0GB 3ES6A 4MGXA 3BRDA 1T2QH 4MXQD 1NBZB 5FM5M 1O7VA 3ULUF 4JFQA 3BGFB 3ZHLA 3QEGL 4WU5B 5K9JL 3RWCA 1KPVA 4NUJB 2KZ1B 4JG1L 3W2DH 2V7HA 3MNVB 4L29A 3U82B 1NMCC 3I3EA 5CINH 4KRPD 4NO5B 4QRSA 3BJ91 4OLYH 3WFEL 5BZDA 4ZXBD 5IW6B 2XN9A 4D94A 3ULVC 3G5XA 3GSVB 4KKBD 3VXQA 5GZND 1MFAL 3D6GA 3EJZC 1OVZA 4Y5YB 3TN0B 2FL5B 4FQ2H 5D2NB 4YHZH 4HPOL 4Q0XH 2H8PB 1UJTA 1XR8A 3SDCD 3NACL 3X17A 2BSSB 3BGFC 1JFQL 1JWMB 3QFJA 2OL3L 3O0RL 1A3RL 1MOEA 4FQCH 5GIRB 5BOZG 4TSBH 2A0LC 5CMAA 3VFTB 3WKNA 3GMMA 1RJLB 3AUVA 4GKNB 1CLZL 3VWKB 5I76B 3CXDL 1A4JB 1AIFB 4HJJH 3WFCL 4DKDC 1V7NL 3BQUB 1S7WB 4PV8A 4JKKA 4YWGL 5HVHB 4LNRA 5C71A 1EA9C 2B4CC 4EXPX 4XRCB 5BV7L 2GI7A 4NQTA 5DYOA 3U4BH 1J0KA 5FO9A 1U93A 4Y1AD 4DQOH 4QHMA 2L4OA 4ODXA 1YEIL 3FQTB 1JV5B 4M93C 4FQIL 4N9OB 1FZOB 3TNMB 3OJDB 3MXWH 1QYGH 1ZHBB 3KWWA 1MHPL 3QHFL 3FT3B 3QZWB 1KNOB 2CDEB 3TA3D 1N2RA 5C0CA 1NSNL 1CGXA 4QHNA 4LBEB 3VRJA 3MLVH 3ARQA 3QDGA 3REWB 3HI6H 4Z7WA 1DQTA 3BIAX 4PJXF 4XXDA 5J8OA 5BW7A 1L6ZA 3CVHA 4BELD 3MACH 1MCWM 3LD8C 1MIMH 4GAFB 4OAWA 5IROA 5CIPH 2VITB 3SE4A 4RFOH 4UTAL 5I19L 2J8OA 1JPFA 1UT9A 3P73B 4JY5H 4Z7VF 3TO4C 4RAVA 3GBNH 1S7SB 2Z4QB 3ECBB 1U2CA 2DLGA 4NFBA 5IW1B 4MNHB 3W11D 1MCPL 1MFDH 1T0NB 1RUAL 1SY6L 5A2FA 4ORGB 3V6FA 3I6GB 5E8OB 2ZSVA 5SWSD 3G6AB 3LCYA 1T6WA 4IRJA 1Q9LB 1JK8B 2ZCLH 5I6XC 3PL6D 2J1KA 2V17L 4K3DH 5HGAB 5IB4A 1JPGA 1UZ6F 3MV9D 1ETZB 5T5FH 5L7XL 1I7RB 4MS8D 3WFZA 1CE6B 2YD8A 4PRHB 5DA4A 5EBLB 2NPLX 4XZUB 1CTNA 4U1GB 5KAQF 1RZFL 4MLIA 4OGAD 1T0MB 5J13B 4ETQB 2V9QA 2IQAA 2HWZL 4MCYB 2BNRE 2WWMD 2BSRA 3BPLB 2WAHA 4JN2B 2C3VB 5D7LA 4KRPC 4ZFZB 1T6VN 2D7TL 2DS4A 3BHBA 4EN3B 4P2OD 1CFNB 3WJLA 1U8HB 4PLNC 4XBPA 2NY1B 5I30H 2F15A 2PO6A 4PJFE 4HULB 4MXQC 2R15A 4JRYA 2VOTA 1KG0A 3TLRA 3GBLA 5DF0A 1KB5A 4M8QB 1GPOL 5KSBA 2LU7A 4PJHB 1QACA 1RMFL 3LQZB 1JNHB 1HHGA 5FAAA 5FCUL 4PJ8D 4NZTL 4D2NA 2B7DT 3C5ZC 1EIBA 1UXWB 1DUZA 5C08E 2YWZA 3X12A 3QIBA 4KMTL 2ENYA 3L3JB 3W9DB 1DDHB 1VACA 4XC3H 3G6JE 1HQRB 4X7FC 5K33A 4XHJC 4QTHB 3LKNA 2VABB 3ULSB 2X7LA 2X70A 5ISZB 1ZKAA 5TFSL 1HHGB 3MGOB 5CZXD 5DJAA 4PRIA 1F45A 4PGDB 3ZYOA 1UZ6E 4UI2A 3U7AA 3UYRL 5JPMB 2DQUL 5DJYB 3MJ8B 3MPCA 4NKDB 3TT1H 5ESQB 3TN0D 4LQ1A 2ZOLB 1P7KA 4LKXB 3RZCB 4CVZA 3W9EB 4GG6B 4LIQH 1TJIH 4OUUB 5KSVB 4BZ1H 4WUUA 4M6NL 1OTSD 3SE3A 1E0OB 3C8KB 3PWJB 4HK3J 2YS4A 2BJMH 2N7BA 4PJ9D 1FYTD 2Z35A 1OP3K 2VLJD 4F37F 4KZEL 3IVKB 3L95A 1DLFH 5CSGA 1FRGH 4TNVF 5C0FB 3UAJD 2OSLB 4ZD3L 1IFHH 4NM4L 1IL1B 2A6KA 3LQMA 5HGAA 3ALPA 4X83A 1NL0H 2HYMA 1CR9L 3ARFA 3BIKB 3KAAA 3IDIB 4U6XA 3SGDH 5DD1L 1CDHA 3MXVH 1KBGL 4XNQB 2XG5A 3V6FB 1MI5A 3HZKB 5EOCH 1DBBL 4NC1E 1I1CA 3IRPX 2JJWA 1QSZA 2APFA 1G7MA 5F21B 2QKIB 3LRSA 1TTUA 3MLUL 3VE0A 3G6JF 4X6DF 3BKYL 2XFXB 3BKJL 4AM0A 3TESA 3K2UL 1EJOH 4LF3B 4EQ3A 2GCYB 4XAWL 2AVGA 1HEZA 4X4XA 1CFTB 2DIJA 4MJ6B 3MLTB 2Z92B 4NP4L 1UH3A 2DF3A 1N5AA 2CO6B 2XICA 4WW2B 1KTRL 4QRTA 3R06A 4JO1L 3DRQB 4LRIA 1ZLSL 3K1KC 4UINH 1YEHH 1PX3A 1JHTA 4MD0A 2C1PA 1GGBH 1FC2D 5HYJE 5DMIH 3U0PB 4OIBA 4RFEB 2IG2L 2XQBL 4OD1H 3ECBA 4ZTPH 4NQDA 1LEGB 2WLZA 1B2WH 2NY4D 3ARTA 3EW3B 4LASH 4FQHA 2Q3AA 3ILPB 2C9AA 1HHHA 3S98A 3FT3A 2XZAL 3SEPA 1JPFB 3F8UB 1SMOA 4Q58C 2VXUL 5I8OH 2X41A 4LQFH 2R0LL 2BNQA 5DZOA 3QR2A 2LQRA 2ZUTA 2R39A 1EHLL 2OQJA 1CXIA 2BY3A 4GRWH 3BYYA 3DVNB 4OBSA 2PTVA 4FZEL 1CICC 4PJCB 5TH2A 3HS0B 1PX4A 4NCC2 3VFNB 4ZFFA 5MP6L 4H88H 2WP3O 1BFOB 5HHXH 2NY2C 3O8XD 2IWGA 4P23D 4P2RB 3O45A 1I8LC 3BUYB 4N1EA 5KSBE 4PV8B 4HIJB 5DJ6A 3V0WH 2BNRD 2IALB 5AAMA 3WXVH 1UJ3A 4DGYL 4AQOA 4XPGL 5KS9F 1P84J 5LGHL 4QOKE 1T7XA 2GKIA 4PJFA 5CP7B 4I77L 1VADA 1IKFH 4WEBL 1OAQL 4NQEE 1TVHB 1RJLA 2ED8A 4XCCL 1H3WM 1ZSDB 4M7LT 1UM6H 3TWCL 4UZGA 1JV5A 2FBJL 1YMMB 2I9LA 1AY1L 1FORL 1VGEL 4PS4H 5KANG 4EN3C 1AD9B 4JFPA 4UIMB 3KS0H 3PWPB 5HHPB 4OCYL 4P2YA 4NBZB 2X42A 1S7WA 3EFDH 1AFVL 3L3OA 4IJ3C 5CEYB 2HTLC 2PETA 4MQXD 4G6KL 3P0VL 4I5BA 4ONOA 4YDKL 4F2MB 4P3DB 1NUGA 4U1GC 1MRFH 2GT9B 2GSIA 4R96B 2X1QA 1NFDA 1CCZA 5I16B 3HNSL 3SGEI 5CLWA 2Y5TA 3VMOA 3QIUC 1FBIH 3WO3B 3BP7A 2DYPD 1A5FL 4M03A 2AS5M 2HRPH 1L0XA 4NZRH 4LAQL 5EC2A 3WXWL 3RDTB 3FFCE 4TYUA 3QDJD 2EH8L 1EHNA 1N7ML 2ZCHL 1IAIH 4OZGE 4OSUL 2Q7NA 5FHAH 4Z7VA 1WCBA 3AVEA 5DUBB 1UJ3B 4GAJH 3EO9L 4RX4A 3ARDA 4QCIB 4BQ6A 3L5XH 1QPPA 3WIFA 2JJTC 1HSBB 1WTGT 3QO1B 5L2KE 3GMNB 4U4BA 2IANA 3HFML 3DHMA 3TV3H 1S3KH 3UTZA 1P1ZB 3UTQB 3EYQC 4H1LB 5HI3D 4FP8L 2R8SH 3BKMH 4PLJD 1NGQL 1WBZA 3SGJA 4U1JB 4MQTB 2E9BA 4EDXA 3O81A 4KHTL 1C08B 2PYFA 3IS1X 1S9XB 2NXYC 1RUMH 1R3JA 1I7UB 5GZOD 5F7MC 3V52H 4ALAH 5B3JF 4NQDB 4LPCA 5GGVL 5E4EB 1I1AC 1U6AH 5C7XH 2G5BB 4CDGC 2Z8VC 1FDLH 1BJ1J 3O6KL 3O3EA 4R26H 4Q9QH 4IRZH 5E5MA 5KVDL 3CCHB 3LKRB 3QUXD 5F1KC 3Q5OA 5GZOC 1A4KB 2EEAA 5IT2H 4RSVA 5IHUH 3TYFA 5FYLH 2AEWA 3VWKC 4D8PB 1DE4A 5J9PA 4JFFA 5DMGD 2A6IB 2Y9RT 1WJ3A 4L4TB 4JPWL 5JOPE 4MJID 1IGFL 4FFWD 3EYOA 1BFSA 5ACLA 5T3XD 2IANB 4OD3H 5I1EL 3KJ4B 1TTFA 2NY6C 2R0WL 3VH8A 4YHPA 4UDUA 4EUPB 5F1IB 1U8OB 2DDQL 5EOQL 4TVSa 1RIHH 3LAFA 4L1DA 1MQ8A 3FAWA 2VIRB 5IVXE 4CN1A 4Y4FB 5E70A 4Y4FC 2KKQA 3MLYH 3OKKA 3OKLA 2J3SA 4ODTH 5EIVA 4TUKH 1FNEB 1DQQA 1SMAA 4HWBH 3ZKND 1MAJA 4XPBL 5JORA 1QG3A 4OLYL 3U0TA 3HUJA 3L3DA 1UC6A 4R4NC 5F9OL 3LPWA 3UTTE 1A2YB 3D3VA 3KJ4C 4Y5XB 1QFWM 4CADA 5I1AA 3BP7B 1YMMA 5AAWA 3JTTB 5KOMC 4ZNEE 5FA4A 1IQWL 4GBXD 4DWHA 1QNZL 2WLYA 5J6GA 5KVMC 3VFSA 5KZCB 3SCMD 3QPXH 4OZIA 12E8H 2V2WA 2JCCB 1QTYT 3UJTL 3FN9A 2XXCB 4YPGB 3MFFB 4J23A 5D9SA 1FNAA 2EDRA 2CK0L 3QUKB 1OGAD 1V7NH 2V9TA 5C0BA 4MJ2A 3TZVB 3PDGA 1QRNA 3CAFA 4P9HL 4PUBH 3AU1B 3MUJA 3QWRA 2P46B 3FT2A 3FJTA 1RPQA 2P8MB 1F11A 2FX8H 4C59B 5ICYB 2WWKT 4PJ8A 3D69B 5SWZB 3GJFA 3MRFB 4EOWL 3CU7A 3QUMA 4PP1C 4DTGH 3V5HB 5KSBB 1MCKA 2DQIL 1RJZA 1MCSA 1O0VA 1I9EA 4RWHA 3FQWA 2FO4B 4M5ZL 4MD0B 1OB1B 2A9NL 4ZUUB 3O6FC 3HI6L 1ADQL 3G08A 5HY9B 1UG9A 1N5AB 3KPPA 3RNQA 4I0KA 3RPIA 3T77A 3FQXA 4I3RH 3KXFA 1A1NB 1K8IB 2YD9A 4OGXL 1U8NB 4GKSB 2Z0BA 3T65B 4CJ0A 3O2DL 4HK0A 4RZCA 1JGDB 3AXLB 1HNFA 4XGZA 1LEGA 3GB7A 4ETYA 1AJ7H 3EDEA 4P57A 5T3XH 1CXLA 4AENB 1JPGB 5GGQL 3CUPB 4F15C 1CD8A 1CVRA 3B9KC 2BNQE 5J6HB 3GJEA 1FV1B 2OP4L 3WHXA 3C2AH 1D3CA 5ITBL 4PRPB 5E9DB 5KVFH 3M17A 1XCQA 4ZUSB 2HT4C 2GCYA 3FFCD 3CC5A 1PSKL 1D7FA 4CL7A 3GM8A 4KJQC 1N3NA 4BQCA 5CCKL 5T5FL 2DIBA 2MMXA 4PJ9B 5HYJA 4P5MA 3QI9A 4L3ED 4MWFA 2H1PL 3FHAA 3C8KA 4TVPL 3FQXB 4JHZA 1OAXL 3WHXB 1JI1A 5J12C 5C6WH 1KJ2B 3D39B 1IC7H 4HGMA 3L3HA 4M5YH 3SDDC 2BVYA 2PYEA 2AKRB 2GQHA 3BDXA 3QDGD 4TNVK 2QQNL 3N85L 3QH3B 5I30L 1C5BH 4P9MH 2GJ6A 5D5MF 3OR7A 2BCKA 4EVNA 1EJ6A 1TFHA 4Q2ZB 4ZNEA 4V1DD 1QSEE 1YEDA 5IHBA 1WAAE 2VC2H 5IHZA 2GUOA 2NR6C 2NY2B 1MREH 4XP5L 3CH1A 1LNUA 2YBRA 5SX5H 2P7TB 1LHZA 3Q3GA 4NZTH 1CICB 3K0WA 5C6TH 3OBAA 2YBRB 4OCMC 1A9EA 1QLFA 1SBBA 4HD9A 3MJ9L 5JQ6H 3JWOL 4PRAA 3ULVH 5C0EA 1CZ8L 5CUSH 3E0GA 1YEEL 1UM4L 1J9CT 4PJDA 3D69A 3K4AA 2UVEA 5SWZA 7FABL 4Z0BH 4NQCB 3VDAA 2YC1B 2FDBP 1FFPB 5KSAC 3RKDD 3C6SA 3OZ9L 5E8DH 5IV2A 5DGRA 3RUGB 4KI5C 4PLKC 1U8QA 3LB6D 2YD7A 5HJ3A 4QRQA 5IBLC 4DKEH 3N1FC 2PCPB 4TN9A 3CPLB 4N9GB 2MQCA 2OI9B 3GIVA 1EEZA 2D0FA 1YEDB 2LTQB 5DK3A 3QUZB 4P5MB 1MHEB 4M6NH 2P47B 4D0CA 5C0DA 4WFED 1AP2B 3QH3A 2KDGA 1XEDA 5EBLA 5ID0A 5EU5A 2ILLA 5DUPL 3UYOD 3DMMC 5ADOH 3FCTA 5ADPH 3MNVA 3QAZB 5MEND 4FOMA 3CX5K 4NT6A 5GGTL 5I1AB 1CBVH 1VKXB 3D39A 1SJXA 4K7PX 4HF5H 3UO1H 1SEQH 3EKCA 4JPIB 3GMRB 2ZKHL 1P9MA 2YZ1A 5BRZB 1QBLH 1WBXB 2IQAB 2Z4QA 3QXVA 3ZDYE 3C6LC 4AK1A 1U8PB 3DBXB 1YY9C 3KYNB 2PW1B 3KJ6L 4P46C 5I1GH 2CDGA 3PQYB 2XZCH 5GS0H 1HCFX 1LO5B 3H3PH 4M61A 2DQHH 5HGBB 5E9DA 2R1WA 3VXMA 3RWJA 1W0VB 1K5NB 4M7ZC 4RGNB 5JUEH 1KPRA 1A3LL 1U91B 5F7LB 3I9GL 1ZWIA 4OZHB 4PRPE 4DEPB 4UOW0 1JNLL 3RKPA 2I9TB 1T0NA 4JFFB 5DTFA 3H7LA 4OI9A 4YAQA 1ZHNA 4DW2H 1FNSH 4X6EA 1EZVY 2FLRT 4HK0B 2IAMD 3QUMB 2BC4A 4F7MA 3PE9A 5KZCD 4JGMA 4KVCH 4J3TA 1KXTB 4PJ8B 1OTSC 3ARUA 4LSRL 4XAKE 1UA6L 1J0ZA 4YZFE 3IFNH 1G9NL 1G0YR 5BJTB 1T03H 5IEKB 3PGCA 1YJDH 3MRJA 2ARJB 4KAQH 4ZUUA 4FQQA 5I15L 4Q6YA 1NCBL 4PJ7B 4X6DA 3EOTH 3MCKB 4CGTA 3BRGC 5F7DA 1S9VB 4PBXA 4GUPB 2VISB 2VZVA 4FXKA 5A2JH 2D3VA 3LQAH 4LEOA 3C5ZB 3QDMA 4WNQB 3U6RB 4ZO6A 4PJGA 4KK9C 1GIGL 3NCJH 5C9JA 4HKBB 5MP6H 4X4YA 4FFYH 4KGJA 1WCBB 3P4OB 1F4YH 1LP9E 1S8DB 5J6GB 1W2KT 4I2XE 4M7LL 3D0LA 3F7VA 2JK5A 5B38B 5EN2A 4IRSB 5TF1H 1VFOA 2GTWA 5JNYA 4MJIB 1UKTA 4WFGE 3LMJL 3QDGE 2DWDA 4XP1L 2HT3C 3UMTA 3AREA 1PKQA 1U3HD 4BYHA 1A7NH 4R96A 3VGAB 5HGDB 4YPGA 4N8VA 1RUPL 2VNCA 2VWEE 5T3ZH 2EDHA 2Q86B 2XN9B 5L6YL 1FO0L 3VFSB 3OB8A 1R3IL 3LH2H 4HQQH 1AFVH 5CMAB 5D2LF 3VFTA 1WEJH 3NAAH 1MRDH 1JGUH 3JTSB 1NMBH 3AREB 4G6KH 5E08L 4JFZH 3RWCB 4AEIH 3BN9C 1XR8B 5I1JH 1NGXA 2VDRL 4NM8H 3UTSA 4Z5RA 1JGLH 2Y5EA 4YFLI 1YYMH 4JRXA 4YDLC 1FFQA 5GXBB 1NFIB 2Z31A 2YPVL 2NY0B 3L6FA 4PTUA 2VH5L 4XCFH 5DVNA 1SVZA 3GM0A 4ODHL 2J8UF 2X9WA 4S1QH 1DP0A 1FFRA 2ZZUT 5IVXB 5JIPA 3GI9H 5EBMB 4HS3B 2Z93B 3B83A 5TQ2H 4LVOC 4TOYH 2APVA 3WNLA 1LP9F 5HPMA 3N0PB 1T5XB 2CJUH 1CXEA 1AGFB 5E7BA 4DVRH 1MJ7H 2VLKE 4LVHC 5DJ0A 4L8CB 3WS3A 5GISH 3X3FL 4Y2DA 1D6EA 1RUKH 3ZHKA 4P99A 5IQ7H 3GUTB 5ETUB 4POUB 4ZFOL 1U3HA 1AQDA 3BQUD 1C5CL 2B2XH 3BGAA 5TH2B 4X6CB 1LK2B 2VLKA 3SJVE 5C07B 2EE6A 4WO4C 2DM2A 3ZDZE 3O6FD 4LLWA 4HBCH 4H8WH 43CAA 1R5WB 3LRHA 4X80H 1IARB 5GRYA 3V6ZB 2EECA 2J88H 3IDGB 1CFQB 4Y4KD 4X7SH 3MRMB 1LO5A 4OFVA 2CDGB 4MAUH 1BD2B 2O5YH 2P43B 1VPOH 2DBJA 2Q87A 1G7HB 4OGYL 5GSRA 5D1QB 1OPGL 1A7PH 3F6IA 1OCWH 2BRRH 2LABA 5B39G 1XT5A 4O9HL 3S88H 1UB5B 1T2JA 1X9QA 3R06B 3IDIA 3K3QA 3ARGA 4U6XB 3VXTA 3AGVA 4R2GD 1NANI 3PWNA 5T3ZD 1T2QL 3BE1H 3RWJB 4JQXA 3TN0C 5JDJA 1PFCA 1NGYB 1T66C 3TH4T 1BD2E 4JPVH 3MLXL 4F57H 2VYRE 2JJSC 4I5BB 3VH8G 5L0QB 5IKCA 2VZ1A 3L7FA 5EOQH 1A6WH 1OAUL 1EO7A 3DLQR 2Y25A 1KB5H 1UCTA 3O3DA 1FG9C 4FTVA 4GXVL 2P5EA 2HJKB 1MFAH 4LCUB 4LVNB 4RGOL 4DZBB 1B4RA 4M62L 3C6SB 4HPOH 4Q0XL 5DDHA 3OJVC 3B3IA 5MEQA 4X0KB 5ESQA 3S4SG 4LPYA 5D4QA 2HAZA 1WFNA 3WLWC 3VXSB 4MZ3A 1LP9A 1Q1JL 1A1MA 3VCLA 3QUZA 2Q7YB 12E8L 2YN3A 3GEWB 3TPUB 3WJLC 4RMTA 3WFDL 5CD5D 5IVNA 5T1LA 5KG9B 1DDHA 4U05A 3S36H 1OTUC 3RUGA 2P7TA 1K4DB 4FN0A 2K7PA 4Z18A 1ZVSA 1F00I 1TNNA 2UWEB 5MENE 2V2XA 3DHJA 5CZKA 1VFUA 1BWMA 5CWSA 4X6BB 4R7NA 5IF0A 3LQZA 3WIHA 3H6JA 1PQZA 5FUZH 5IG7B 4XPTH 1JVKA 2DD8L 2P49B 5SV4A 1AE6L 3R0NA 4LRNH 2PW2B 2BRQA 2EDXA 4UT7H 4G7VH 3HR5B 3H9ZA 1QLFB 4ELMA 1W72A 1DBKL 3DI2B 4RGMC 5IHLB 4JDZA 3C08H 1B0WA 1ACYH 4U1KB 4EBQH 2EIZB 3OQ3B 4PD4K 5DRWA 4Z7OE 4Q9BA 4AT6B 3MBXL 4BH7A 2BMKB 1FYTB 4OF5A 1YQ2A 1W72L 3HNVH 3M8OH 4TUOA 5IQ9B 3D18B 2A9MH 4KROD 4OGXH 4P3CH 3TBSA 3LRSB 4MXVF 4RFEA 3SJVB 5HYQB 3QXUA 1MCWW 3R1GL 2HTKC 5F44A 1DVFD 5JTWA 2F19L 4OUOA 1TCRB 1NCAL 1FPTL 3WIHL 1Y6MR 5GS3A 1M7XA 4P4KA 3ILQC 2Z92A 1J1OL 2UYLB 4HS8H 1YNTA 4XWOD 3QI9B 5LKNA 4Y4FD 4G3YL 3D0VA 3Q48A 1ZE3C 5IQ9A 4K3DL 1MRCL 4WI5A 4ZS6D 1PLGH 5GS0C 3QT2A 3PNWA 1QFPA 1WFTA 3L3IA 1DL7H 4YX2L 4EKXA 5TDNA 2YD5A 4FABL 3MX0A 4GBXA 5C2BH 1T1YB 4MA1C 4Q7DA 1RIUL 4F9PA 1R3KB 3LEYL 1V7MH 1IJ9A 1N8ZB 2QEJA 2H1PH 1ZT7B 4H0HB 4ONFH 2XG4A 3CDCA 3RGVD 5F1SA 2B1AL 4HUWA 3VG0H 4MJ5B 5IW3A 1PKOA 4HFUL 4H26B 2FECL 1RFDH 5EU5B 1JL8A 4G8IA 4RAUB 1L7IH 1ES0B 1UKQA 1JGDA 1FFNA 3WIIH 3ETBF 2IAMC 4W70A 4D0CB 2EDYA 2JB5H 1C1EL 2CLRA 5AG9A 3CFJB 5FF6A 3KXFB 4ODVH 2F8OA 3OJDA 2NYYC 4DJMA 2NY1D 2KL6A 5C0AA 3T09A 4MAYC 5CIPB 4EN3D 5HVGB 5I73B 2MQ0A 2XKUA 2R23B 2XV6B 8CGTA 4UNTA 5CP3H 5TQ0L 5CEZH 1MREL 1H3TA 5IB1A 4HHAB 2XN9E 4XNYH 3EO0A 3HE7C 3PQYE 5LQBL 2DJSA 2CLVB 3QUYA 2LVEA 3H0TA 1YY8B 1UFUA 4M8QA 4QOKD 5CUSL 3BOVA 1G7IB 2EH7L 1ODAA 1KJ2H 2CMRL 2VRAA 3AROA 4L9LA 1A7RH 1ZLWK 3MLSL 5FA4B 5K9QI 4KMQA 4F7PB 3ESVF 4I48A 3VGHA 1Q94A 4LVOB 2EZ0D 5IFAH 1JNNH 3D3VB 4Y5XA 4NUGL 2ZJSH 5E8DL 1PEWA 1UYWL 2OXHA 5JO5B 2NX5A 4OQTA 4I0PC 5C0ND 4HIHB 5DD5H 4FZ8H 3IKKA 2V2WB 4OZIB 2UY6A 4ODUB 3P4NA 3ZTNL 2BJML 4FXGB 1W0WB 3VD3A 1NGYA 1WV7T 3B3IB 5MEQB 3IDJA 2MQ3A 2C3WA 4EUPA 1MFEL 3P9LA 3VH8B 3E6HB 2P42B 5D7JB 4NO3B 4ZFOA 2NY5C 1PBYA 3VFMB 3E6FA 4ORGA 4M9OA 2RQ8A 1I7ZB 1FZMA 1U8LA 5JORB 4YK4B 1F3DJ 4OZFH 4O2FB 5HYJB 3GSVA 5EOCL 1AD0B 5D1QA 3TA3B 1N3NB 3T2PA 4PJAE 1II4E 4U0RB 5EU4B 4XZUA 2DLHA 5FUCC 4XBEL 4U7SA 5I8CB 3IDGA 2BHZA 3AS1A 2X40A 3S3PA 5IB4B 2A38A 3QCTL 3KYAA 1JHLL 1YMMD 4NQVA 4Y1AB 3DGGA 1ZOXA 4PGCB 1XGTA 3UDWA 2P5ED 3PHQB 4EI6A 1F6AA 4YDIL 4QY8A 4R2GB 1NJ9A 3CMOL 5B39B 5IJKC 5GSRB 3SDAC 1AGDA 5E1AB 4U1LA 2NY2D 3WUWB 4G42A 4KK9D 4DW2L 4R7DA 3THMH 2CIIB 3CDFA 5A16A 1U9KA 3X13A 5E2UH 1BD2D 2Y7QB 2J6EL 2JELH 1FO0A 4GOSA 5KSBF 1IC4L 3FAXA 2AERT 2WZPD 3A67H 1DEEA 2PXYA 2X44D 5KS9E 2M8XA 3B5HA 1AHWC 4W68A 3TNNB 5KOVC 2X4QB 4N5ED 1JP5A 1P53A 2YPLD 4O4YH 5K9OB 1P84K 3HE6B 3SDAB 3MRPB 2YUXA 1EMTL 4JRXE 5HHME 4NFCA 3RQ3A 2YRPA 1CQYA 1QO3B 2Z8SA 5JR1H 1X4YA 1CLYL 3X11A 3WDHA 3V0WL 1VFBA 4Y4KA 4ENEC 4OV6F 1X5AA 2O5XL 3CSYB 3S96A 4MNQE 1OAQH 4NWUH 4IRJC 4Q9RH 5IMOA 1I1YB 2OK0H 2JCCF 1A6AB 3TWCH 4WV1A 1EAPA 5C6PB 4U1HB 4GQ9H 1F4HA 1IGIH 3NIFE 3A6BL 1S9YB 1DSFL 3VFRA 4KROC 4MDIA 1V3KA 1SYVA 5EPMA 4HH9A 4MX7A 1INDH 3MRCB 5EO1A 4GW4A 4AIOA 4R8WH 1H5BB 3PWPA 4JFDD 4HSQA 1DQDL 3CFBB 3IS0X 4AL8H 3UJIH 2ADGB 1U92A 1YQVL 2AI0H 1RZGA 5MERA 3UAJC 3KLAB 2X4UA 1IGYA 1P7QB 4OF7A 4MX7B 2HRPL 3U46A 1VADB 2MCG1 1KIRB 3WV0A 1I75A 1GC1H 2WM0A 1AXIB 1BX2B 1KN2H 2YA2A 3I02A 3HB3D 5K9KA 3C5ZA 4FQPA 3QQNA 4WNQA 1QFUH 5F1IA 2VH5H 1FIGH 4LSPL 4I3GA 3NFSH 1A1OA 4YUEL 1UZ8A 1KEML 4P59L 5EUKB 4TTDD 1MI5D 2OTWA 4HV8A 3NCEB 3Q2CA 4PG9A 5CGYD 1CD1A 2HVKA 2A6IA 2VAAA 3MV7A 5BJTA 2VDOH 1HHKA 2NQCA 3CLEH 5T1DH 2JIXD 4PJEF 4YBQD 5FB8A 2YR3A 4G8GD 4N0FA 4HIJA 1G6RB 1NQBA 1XGQA 3FO0H 4K9EH 3CH8A 2NY5L 1J0JA 1ZHNB 2FYYB 4A2LA 4HGWA 3EOBA 1MH5A 2RCSH 1ROWA 3EYVA 4M43H 5DLML 3VFWB 1FH5H 4FQXA 1YEKL 3X13B 3ZYZA 4PPTA 2RR3A 3FONA 4X9GA 4OD2B 4H8WL 5DJCB 1DFBL 1MCJA 1MWAB 1NUFA 3C9NB 5F9WC 1A6ZA 3DBXA 4I0CC 4LAJH 4QNPF 1Z3GH 4U33A 5JXEA 3VE0B 4QHUB 4FQJL 2RHEA 1KCSL 1IGTB 4JFXB 3OMZA 5LCVL 3BZ4B 2NXZB 5CGYC 4MA7H 2F53A 1MFNA 5E1HB 1FGNH 4BZYA 2EE2A 1DLHA 4O00A 3MJ9A 1G1YA 4O9HH 1QFHA 4JB9L 1RU9L 4UQ3B 5D1XC 1DANU 5HI5D 1G9MC 4Z8FL 3KPNB 4EJ1C 2R0WH 1NFDE 3BE1L 4PJIF 4XH2A 4KJQD 1Q9WA 4PJEE 2DDQH 2EDEA 4V2CB 1WVZA 4X8JA 3WFEH 3GMRA 3MRNB 4WY7H 3HZKA 1YPZE 4W6XB 4WUUB 5SX4I 4M3KB 1ZLVK 1G6RL 1J0YA 4UV7H 2YRZA 4PGBB 1G9ML 4HJ0C 5F9OH 1TJHL 3O4LA 5IOPA 3QIWA 4K3JH 4L8SC 3QDAA 4FFVC 3FO1B 5B21A 1E4XI 1N59B 2VL4A 3G04A 2L0DA 3L3GB 1G0DA 3ALXA 5I8EA 5CBEA 2ATKB 5JO5A 3DYPA 5E8PA 3GSXB 5HHPA 4S11A 3O2WH 2OCFD 3HCVB 4G7YL 5GGSB 2R2BA 3IXAA 1OSZB 3T0VA 3U79A 4UBDC 3QNXB 1CICA 1WAAA 1Y18B 4HAGA 3EYSH 4F7TA 2ORBL 5I75C 3U4EB 5J89A 1I8LA 4ENED 4POZC 1QOKA 5J1SC 4OLZH 1MAML 1XIWA 5EBWB 2VLJA 5F6HI 5IWLC 2V2TB 4FQIH 1YJDC 3H9YA 4G6JL 4TUJB 4M1GL 4BQ8A 3ELAT 5B8CA 1MFBH 3EOAB 3HHRB 2FX8L 1RZJL 2CLVA 2HLFC 4OZGB 4YDJA 2FX9H 3GMPA 1YYLH 3DIFB 1H9VA 4PRAB 4P2RA 3NIGE 5CLTA 5JA8B 3EYUH 5DUMH 3LKQA 4KK6D 1U42A 3GKWL 4G6AC 3RVVC 3ZMRA 4S1RL 2PO6B 2DD8H 3GDBA 2NW2A 3DYOA 2NY7L 1CFNA 3PP4L 4IMLB 2AXFB 2MKWA 5CIPA 1ZHKA 5DEGA 4DCQB 2F58H 1QVOB 1JWSA 2C3VA 4ONHA 4HPYL 1ORSB 1LEKA 3GSUB 1JJUA 4PRID 4EVNB 3VD4A 5I19H 2J12B 2XWTB 2EICA 2VZTA 3ROOB 5KS9A 4KROB 1RD6A 4V1DB 1U8MA 1YPZB 4KJPC 3O2DH 1NDGB 4P5TB 1LE9B 5FDWB 4ZAKA 4Z7NE 5FKPB 3QUML 3K8MA 4C57C 3I6GA 1LQSR 3JWDC 2F54A 4ZOAA 1CFTA 3GB7B 2AJVH 1NCAH 2I27N 1YEJH 1GHFL 1CU4L 2C1OB 3WUZA 5AYUL 2DWEB 2V17H 3ZKNC 4I2XB 3MV01 3MLZL 3NCCB 4GAGH 5H94B 4OFYD 1NMCB 1S7UB 2DI9A 3DRTA 3H9HA 5E8EB 2HRLA 5ACMA 4NN5C 2VDQL 1U41A 4FA8A 5E99L 1NMAH 2HWZH 1YA5A 1S5IL 3SDCA 4PRPD 1OAXH 5DJ2A 1ZLVH 5IW1A 1QSFD 4PB0L 1I9IH 3SGJC 1P6AB 4Y8AA 5C0FA 4JM4L 4Q74A 3GI8H 4TUOB 4RA0C 5B3JE 4DGVL 5IB3A 4LBEA 3V4VL 5H35A 2W59A 2EDLA 3V8CA 5HYJD 3N1PC 2KUTA 1EX0A 2EEBA 2NCMA 3ZDXE 2EKJA 1F2XK 3DETD 3CMGA 1D5ZA 3KWWB 2CH8A 1AGEB 2ED9A 1R0AL 3Q6GL 1KSRA 4K7PY 3T3PF 1KJMB 3K2MC 5B4MC 1KIUA 2V5TA 4K94L 5DYOB 2NY3B 4HWZB 3PABB 4QRPB 5E8EA 3FQNB 3G6DL 4RNRB 1KLUB 4K3EH 1HN1A 3RX7A 5JQHC 1IZKA 3DX8B 4HFWA 4RISH 5EUOE 4KC3B 2VABA 1OT2A 1YMME 1KB9J 5KN5B 2FHCA 2OJZL 3DVGA 5F96H 4FTVD 5AD0A 3U7WH 3TBYB 5DD0H 5HBBA 2FWOA 1S9KC 1MCBA 5I1CL 4CW1A 3MA9H 2F8XC 1TJIL 1QRKA 5F88A 1HXYB 4C56B 4QXUH 3DMMD 2JCCA 4Y4FA 1DJSA 1LO3L 3IDYB 3I75B 4GKNA 4N1CA 5I0ZA 1JF5A 5K9QG 1CF8L 3MRBB 3DX6B 5F89B 3FKUS 4GXUN 1HILB 1E6OL 4LPXA 1WWAX 2F54D 4NHCL 4OIAA 3GJFK 4PJ7E 2HFEA 3ZDYF 2E7BA 4YLQT 5FCSH 1J5OH 4U3HA 1NFKA 4LARH 4QRUB 4JLRB 2QADD 3VXRE 3PGDA 4MSWA 2ICWI 1BAFL 3O2VH 4PG2C 5GGTH 5DD1H 1AO7D 3VFUB 3DX9A 3UZEA 3VW3H 3P11H 3O4OB 3GMPB 1J86A 5ENWB 5JXED 2BZDA 2ZUSA 1QBLL 4NRXB 4PRHA 1MNUL 4ZSOE 3B4NA 4XPHH 1IRAY 3FRPG 1MPAL 1JRHH 3IFOA 4XWOC 3C09B 1XGUA 4P5TD 5EA0L 3S37X 1EJOL 3FHQA 1QLEL 3L3KB 4IRJB 4PJ5B 3O3EB 5EUOB 3U0WL 3B5TA 1X4XA 2DQHL 2AXHA 4TTDC 5BW7C 1NKRA 3QWOB 2OR9H 1UWGH 1ZHLA 1GGYA 5HHOA 1XAUA 2VR9A 2XACC 3SO3B 3K8LA 3LEXB 3DXAA 3NFPB 1KYOJ 4AJ0A 4XCNA 4HKZB 4UAOB 3KR3H 1QKZL 4RAVB 5DS8A 4ZXBA 2FGWH 3KPQA 2G2RA 5C0JA 5SX4H 4C56E 2XKNB 3RIAK 3V6ZA 2B20A 3DVFA 3LIZL 2FD6H 4PV9B 2QLVB 4G6FD 4RFNC 3VFPA 1DANT 1ZVYA 3LS4H 4NC1C 4XVTH 4OQ1A 1G9NH 3MJ7B 2R69H 4KAQL 4LLMA 3RBSA 5ALBH 3WIFB 2X4PA 1T04A 3AS0A 5IBTH 3GUTA 2CDEA 3QEHA 2DIAA 3IDXH 1DUYA 2FJHB 1ND0A 3ME0A 1JN6B 3FO2A 4MS8C 3HC0B 2B4CH 4RGNE 2PYEE 3ARRA 3VD5A 3TO2B 1T83A 2Q8AL 1GIGH 5GJSH 4KY1H 1EMTH 1IE5A 1T1XA 2R2HA 3H9SB 5IB2A 2AW2A 1QFWH 2X05A 5F1NA 4M7JL 1JYNA 4LHJB 5D6DC 1NCNA 2DKSA 2OLDA 5I16A 4ZPTA 1UACL 1JZ8A 2Y6SD 3BZEB 3P4MA 3FOLB 2EXWD 4HZLA 2R4RL 4FNLH 1TPXB 1UWEH 4MA8L 4OLXH 4X8XA 1NBYA 4N8CH 2GAZA 2AEPH 2APXA 1PG7X 2QJDA 3MSPA 3IKCA 3LH2L 3GMQB 3HRPA 3QAZC 5GHWL 3PWLA 4PD4J 4XNXL 1DQDH 4AL8L 4BUHA 1IC1A 1YMHB 5BMFH 3X3GH 2G60L 1F02I 2Y06L 4XNMA 4ZFGH 2LVCA 3SE8L 3QG6B 4P49A 3G5YB 4G43A 4NQCE 4LKCB 2VLKD 4FTVE 4WIQA 3K4ZA 1F4AA 1REIA 3DVNA 1QFUL 1H3XA 25C8L 1WT5C 1N5YH 1EO8H 2FSEB 4E0RA 4PJDF 3HFMH 4P59H 1G9EA 5D70H 3MOAL 1XGRB 4PRBB 2EC9U 3KNBA 3AB0B 3ZTJH 3VXUB 4LDOB 2JJVA 3WSQH 5C8JB 3QQ4A 2IPKA 2D7MA 1BVKA 1ULVA 3BXNA 3MRHB 4LPVA 3HA0A 1ZT1B 2BOCB 5MEOB 5J57B 1P7QA 2ZCKL 1VEPA 3BP5B 3WFHA 4OCXH 5KANI 3PWLB 4LP4A 5I73C 1JHTB 4K7FB 4OM1H 5E6ID 4Z7WF 4EXKA 1FG2A 3MUZ1 2IPUG 2LV4A 2ARJA 4Q6IC 3ARFC 4P23B 2B2XL 4G8GB 5K59E 1AXSA 1X5LA 1E27A 4WW1B 5H37H 4GT7A 4MJ6A 4UB0L 3TH3T 1KEGH 1UM5L 4LLDA 3BDYH 5ICXB 1KJVA 2EYTB 2D2OA 5HHMD 1NAMH 1PZUB 3C5JB 4LK4A 3KPOB 1LEIB 3L5WB 4QRRB 3O8XA 5F7FA 1P7HL 3HZVA 3IETB 3UZVB 1ZWIB 3NN8B 5KVGH 1A7PL 4UBDD 4KRPB 3ZKXC 3NA9H 4OKDA 2E7HA 2J7LA 4JAMB 4NPYA 1CD0A 5EFIB 2Y1VA 3MROA 1RVFL 4OF6A 3NZHL 2GHWB 2PW1A 4IMKA 2Z35B 2IFFH 1L7TL 1X5FA 5F9WB 4FFVD 5BRZA 4LFHD 1MFCL 4MNGA 3OAUH 5SX5K 4BZ2H 3GSWB 4KTEL 1A6WL 1OAUH 4XPBH 1JUFB 4MQ7A 5GGUA 4LFHG 4TNWF 1EVTC 4DKFL 1P7KB 2ZP0T 1N4XL 1HXMA 2GK0B 3VJ6B 4O2EA 4IHOA 4M1CD 4PJEB 1DUYB 1G9MH 1FQ9C 5EZIL 3OL2A 4DN4H 2HJFB 2A6DA 3QPXL 3O3AB 4R0LA 4WTZG 3KPRE 3RTQD 2EDOA 2P44B 3WFCH 1MCDA 4LL9A 2ATPB 2X4SA 1LDSA 1IKNC 4YWGH 4JFOB 3VGDA 3RVVD 5FGRA 1GYAA 4IOFC 4NC0B 4GG8A 5IK3B 2F8VA 4U6HA 4NC2B 4PUBL 2N4IA 1EPFA 3BN3B 1KXQE 2DM4A 2IAMA 2MPAL 4ISVA 4MYWB 3EYSL 4PGDA 1JYVA 1BBJB 1IC5H 2YD6A 2Z9TA 4QYOB 2YUWA 3HZMB 2FEEL 1CVSC 3RI5F 1U8JA 5FUZL 3K7UA 1FZMB 1U8LB 4J7RA 2W65A 2HJLA 4DTGL 2FX9L 2IANE 3SBWC 1H15A 5EO0A 2F5BL 2VL5A 2YSSA 3IAQA 2QHRL 3ARZA 1EVUA 3OHXB 4IRSD 2I5YH 5E9DD 1NGWB 1B4JL 5DQ9B 1XGUB 3OF6A 3E6HA 1T3FB 4L3EA 4LSUH 1AI1H 3W0WD 4MXVE 3PP4H 3OX8A 1OSPL 3WN5C 2E27L 4UMGA 2GJ6B 1EGJH 5D7IF 3FFCA 4RBPK 1ED3A 4ZUTB 1GAFL 4YXKL 4GW1A 3V4PL 5CZVH 1IEAA 3ZE2E 2Y36H 3PGDB 5D7IB 3I6LE 4CN4A 4Y5XC 4YFLF 5MENA 1EO5A 1CG9A 3RVUC 3KPRD 3VXRA 43C9A 5HI4C 4JHAL 2B0SH 2C5DC 4QRPD 1EHAA 4J6RH 2F74A 3MNWA 1R3LA 3B9AA 4NQEB 2DQDH 2IBZX 1JMZA 2CRMA 5I1IH 1YEJL 5HHNA 1LO4H 3BWAB 3HE6C 4HEPG 1HZHL 2DBLH 4PRPA 1RZFH 2AABH 1I7TB 5GRJL 3F7QA 3PABA 7CGTA 1JK8A 4OI7A 3CFDA 1FV1A 4HIIA 2W9DL 1BFTA 5FYLD 4RGND 4HS6B 1A6VL 3BP6A 4AENA 2RFXB 1BOGA 5EORH 3VXPA 1PW3A 4RFNB 1IQDA 5D1QC 4HKJB 4Z7WB 4K07A 5C0CE 5JXAL 3DURB 4WFFE 4Y2OA 3T04D 5SWQB 4WCYH 5JZ7D 4GRMB 5F9DC 5MI0B 1QSVA 2E6QA 2F5AL 1OGAB 4NKQB 1A1NA 4JZJA 5FO8B 3CFEA 4ZTOH 1V3LA 4DGVH 2K7QA 2ZUYA 3VXPB 3FFDB 2JB5L 4OLWH 1C1EH 4L8DB 2AV1B 4WTWA 3RBGA 4WO4A 4B41A 4NQSA 4HXAL 4ODVL 2MSPA 3KPRA 1BQLH 4ZAKD 3VXRD 1TVBB 2K3TA 1FL3A 3I2CH 1F90H 2IJ0C 4Y4HD 1KENH 4QO1A 3TGXA 4CVUA 3L3IB 4NNXA 4ZQKB 2WNGA 5CAYB 1N2RB 5DQJA 5H35B 4NO2A 1QFWI 4JFDE 5E2JA 1X5JA 5C0IA 4UILL 1GGIH 4XVUC 3MROB 3MLRH 2HA1A 2I25N 1EAJA 3KYKH 5JHDD 4IOIA 5CGTA 3S35X 4H20H 2EH7H 5BRZE 3CFDB 4KKAC 4XVSL 3QXAB 3SJVA 4XI5C 4ZPVA 2ADFL 4CMMB 4DVBA 4Y16A 5HHNB 4PY8J 3QEGH 4N68A 4HG4J 4JG1H 1MLCB 1KFAL 5EIIB 2P24B 4JFEB 1HWHB 3GSUA 1NLBL 4I0PB 1CICD 1WZMA 2VMFA 4WU5A 4XCEA 1A7QH 1BREA 3MUY1 4LSDA 4ZD3H 1AO7B 1E6JH 1QA9B 4Y1AE 4GG6E 2R2EA 1JBJA 2ZUQB 3FOMA 3FT4A 1MEXH 5L9DH 3BXNB 4L5FL 4XMLH 5C0RL 1RHHA 4TUJA 1A22B 1K2DA 1B9ZA 4ZUWA 4Z78A 4OFIA 5DWUH 5DRXA 4HJJL 3RNKB 4NYLA 2A74A 5GS0L 1OQOA 1U8IB 5L2JA 5KAQG 1OARL 5INDB 4LSSH 5KVEH 3O6FA 4ODWA 4YPJA 5F72S 1KCRL 4JO2H 4UINL 1HOCB 2HH0H 3VCLB 1A1MB 3NTCH 1GXEA 5GS1B 4N5EC 2V2TA 3BO8A 5DZLA 3MFGB 4XPAH 3ARPA 1NC2A 1NEZB 1N6QH 5E5RB 1CGYA 3QA3B 4Y2DD 1QRND 3RWIA 4JFEE 4B5EA 3TFKD 5EZOH 2CD0A 3S35L 3BN9D 5IMMA 3GMQA 3T4AB 3B9KA 1OSZA 1HH6A 3IFNL 2R0LH 5EOCJ 1KCVL 5CHNA 5DD3L 5EC1A 4KK5D 1Q0YH 1NBYB 1P5UA 2M26A 2G75B 5E95B 3V4UL 2CLZA 1N59A 4PJ9C 4AEEA 4H88L 3IDNA 5F9JA 1RK1B 2FX7H 2GK0A 3VJ6A 2P48B 5FYKH 2X4RA 1F6LL 1PY9A 3QDJA 1P4LB 2Z31D 3QI9C 2HT3D 3QDME 1BZQK 2FRGP 3GBNL 5CBAB 2ESVA 3F65A 3NCBB 4M7LH 4WVRA 3RVUD 2ZUWA 4OZFB 1EEYB 1WWWX 4KJPD 4XCYB 2O5XH 4KKCC 5ILTL 2LAGB 3EUUA 3KPMA 2DYPB 5ERWB 4H1LG 4P5TC 4M7JH 1SVCP 1JF6A 4UIKL 5KW9L 4K2UL 1JN6A 3FO2B 3ZE1E 3QEHB 2OZ4L 2X2YA 2ZOKA 3EDKA 1V3JA 5GGRB 1T7ZA 4LHUD 2CKBB 3ABZA 4JAMA 3HUJF 3KPMB 4CU8A 3DV4A 5EC2B 4ACPA 4XCYA 3G6JB 2MHAA 2R1YB 5TDOB 4JFFD 3TYGH 5DD6B 3QULB 5C07A 5DT1H 3HNSH 1FSKC 3IXTB 2HTKD 2YPKA 3DMMB 4JKPH 3S97C 5J4MA 1I8MA 1RZ7L 3JVGA 4KI1A 1NEZA 3S5LA 2LU4A 1FN4B 3GSNB 5J1AB 1G6RA 1MQKH 3VXME 1N7MH 2JLLA 4KPHH 3DROB 3OXSA 5GRVK 4WI4A 1S7VA 3S34L 3WD5H 5FHAL 4N0CC 3VFVB 4HX1B 3D3VE 3EO9H 5E2VL 1CDYA 1EFQA 1OP5K 1DR9A 2IPUK 5FGCB 4ZFGL 3FB6A 3IFLH 3P40A 1B88A 4LSPH 1SJHA 1J18A 3LDBB 1UZ8B 2IH3B 3A0OA 3BP5A 4H8WC 5E2TL 2G9HA 1PG7L 4NKOB 3MRHA 5IVXA 4JVUA 3H8NA 2CRZA 5HHVH 4OCRH 1JPTL 4F33A 1G7QA 3RL2B 2DLIA 2R29H 5HHOE 3MV8A 4XVJL 3WHE1 5BCAA 1NBVH 2YEZB 2IH3A 4LCYB 3CJJA 4YGVA 3UYRH 5GRZA 5HYSA 2NY5H 5KTEL 2BOBA 1P5VA 4XXCA 1FE8L 2MHAB 2R1YA 4LCWE 3VXSE 1XIWC 4KKLC 1KCKA 3R0MA 4D9LL 1FDLL 5IMKA 3F58H 2D31B 4R26L 1RHHB 4U1SA 2R56H 1I3GH 4X80L 2DMCA 3V5KA 1WZ1L 3MV8E 4AZ8A 1YMHA 3P4MB 4PFEA 2IQ9H 3E2HB 2P8LB 3FT4B 1XF5A 1DTUA 5D1XB 1CE1H 4XB8A 3L9RA 2DYPA 4ELMF 2FB4L 1A9BB 1IGJB 4Z76B 1I1YA 4GRLD 4UU9B 1JRHI 1N0XH 1P4IH 2ESVB 3BPNB 3K8KA 1QHPA 4LMQI 5TDPA 1F6FB 4NNPH 4HMCA 3MRIB 1P4LA 4GW4B 4KKNA 4APQB 4CVWA 5E4IA 2YPLB 1KBGH 4EI5C 4OD3L 1MHHB 2NZ9D 3OG6B 4JO3L 1E4WH 3QEUA 3VI4F 1PEZA 5JIIA 2UWEF 3STZA 1BECA 3BKYH 3ARED 4XPFL 5CEXB 1OOAA 1L7TH 4XNQA 2W1NA 5IEHB 1HH6B 4S1SH 2AQ2A 3B9KB 3S4SB 5HHOD 1CIUA 3UDWC 4NFDA 3FB7B 5D5MB 1C8PA 4Q6IB 3OAUL 5DMKA 4HBQA 4AEHL 2AJSL 5CS7A 2VE6A 4OM0L 4X7TA 3GHBL 5LAXB 2X4RB 1MCLA 1I1AB 1BWWA 2EO1A 1G6RH 4ZS7H 5C0IB 1MCOH 1I8KB 1NAMB 1FCCA 4YXHH 4OD1L 1WUNT 4GRMA 3KPQB 5TGBA 1KLFA 1HOCA 1D5MB 1N0LA 4DAGH 3DXAB 3MJ7A 1EHXA 4EI6B 3EGSB 2BNQD 5IMMB 3SDCC 3SGKC 5AWNL 1NDMB 3NFNB 2IH1B 1J8HD 2VN7A 1OP5H 4EIGB 1AHWA 1KT2A 3WDIA 5F8QC 5H2BB 1V05A 2MJWA 4CNIA 3NIGF 4BJLA 3LN5B 4JZJB 2R1WB 5BO1L 3WUWA 1X6LA 5H94A 1MJ8L 1BGXH 1ZGLP 3MGOA 3SDXF 1CL7L 4PY8I 5DVKA 2GW5A 2C1OA 4TSCL 1KB9K 4EOWH 1IC5L 1M7DB 5INDA 4WU7A 4XCCH 3T2QA 4OIIH 1RAMA 5ICZA 3MV9B 4OBRA 4WV1C 2EDKA 5FKPA 4QOKA 4N5UA 3RNKA 3BWAA 5BV7B 1BZ9A 2VDKH 1K2DB 1ADQH 1EXUB 4JFEA 1FORH 1WK0A 3ROOA 2XRAL 3WHE0 2R9HD 4EBQL 1E4KA 2E7MA 3D2UB 2R9HC 3TCXA 1DBJH 5IVZA 1R6VA 4EI5B 1HDMA 4HIHA 4XTRD 2J6EA 3EFDL 1OSPH 1QP1A 3QYCA 5L8LB 3VU2A 3OKEA 3BPNC 3HNVL 1GGTA 4EQ2A 1A47A 1Q94B 5GGQH 1IEAB 4XNZC 1E4XL 4OB5H 2BSRB 1XGYH 1QRNE 3FN3A 3RWHB 5IBUG 3ULVE 1JTTA 3DIFA 2IMNA 2B0SL 1OP9A 3REVA 5EU6B 2BVOB 35C8L 2IC2A 2IGFL 5DQJB 1Z9LA 5MHSD 1A7OL 1EXUA 3FZUD 4ZOCA 1GHFH 1UH4A 1ETZA 3VG9C 1LE5A 4OSUH 5AZEL 4LCIH 5H2BA 2H3NA 3SDYL 4JFYB 4GAGL 5CKGA 3Q6FA 3KXFD 1BFVL 3KPRB 2VTFA 5CGMA 4P2RE 3RY5A 1HINL 5DQDH 4WWKD 2J5LB 1U8JB 3LEYH 3CFEB 3TV3L 4K71C 2UUDH 4PB0H 2DM3A 1MCNA 4OLUH 1KTLB 3UYPA 5FUCE 4P9ML 3GMOA 2X4OA 3TIDB 3VDCA 4PJFF 5CJQL 2QBWA 1MIEL 5TJWK 5FGBC 3NVQA 2R23A 2QSCL 5F3BB 4DEPC 3GRWH 4F80A 3CVHB 4OQTL 1WITA 5FGCE 5C9KA 1GZQB 4GRWB 4U3XA 4QNPE 2EXYC 3BT2H 5C0AE 1OP3H 3VRJB 2I07B 1OGAA 4JFFE 1EZVX 1CK0L 5JXEC 4HG4K 3CC5B 3T0DA 2COQA 3D0VB 3BEVA 4GMSH 4RAUA 3TBTA 2O26U 3ZT5A 4H26A 3ZKMD 1JTOA 4DKAA 4P2OA 4C4KO 1TZHB 1U95B 4YDVA 5DJ2B 4J3XA 4RMVA 5D8JH 3FB7A 4WEMB 3GSWA 2DKMA 3MRKA 1LEIA 1X4ZA 1GL4B 4LLAA 4NUGH 4D0BA 3FFCB 5CJXA 3V95A 4P46D 4RZCB 3IDYC 4NZDA 4JZNB 2DWEA 2WINB 4UT9L 3ALWA 1CT8B 1I3RA 2L7JA 4NSKA 3C6LD 3OKDB 4AT6A 2CKNA 3RDTC 1XIWD 3JV6A 4KKLD 3GSQB 3QUZC 5T1LD 5FO7B 2H8PA 3CXHK 5D6DA 3HZVB 3IETA 1E6OH 2CIKA 4J4PC 2OMNA 4QXGL 4S0TD 3FQWB 1U8MB 1FLRL 5DZNA 3NACH 1XGPA 5DK0A 1PJ9A 4OFPA 2A77L 5ICXA 3EOAA 1RZKH 1MF2L 2Q6WA 4X6BA 5IF0B 5CSZB 3HR6A 3RWDA 4XMLL 2BVPA 3QUXA 1M05A 5DQ9A 5F93C 4DGIH 4WU7B 4LVEA 2RB8A 5D7LE 1NBZA 4CVXB 1H15B 5EO0B 3O11A 3QO0A 2HT2D 1KJ3L 3QPQD 4BH8B 4LKCA 5B22A 2AJXH 3HLAA 5DHVA 2Q7YA 4DQOL 5CJOH 4XP9L 5I1KH 1K4CB 1SYSB 4LSSL