3L3OM

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
84
structure length
84
Chain Sequence
TSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 35
structure length 84
sequence length 84
chains with identical sequence P
ec nomenclature
pdb deposition date 2009-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3l3oM00
3OHXM 4EZTA 5TKYA 4F01A 4H6IA 4EZOA 4E81A 1DKZA 3T49A 3T4AG 4R5KA 4EZPA 1DKYA 4EZQA 3C7NA 2WINM 4JWIA 4EZYA 4EZZA 4JWEA 3D2EA 4JNFA 5E84A 4EZWA 4HYBA 3T48A 4EZXA 4JWDA 4JNEA 4EZVA 4R5GA 2QFFA 4EZRA 1DKXA 4EZUA 2QXLA 3DPOA 3L3OM 4EZSA 3D2FA 4EZNA 4R5LA 3QNJA 4JWCA 4HY9A 1U00A 4B9QA 3T47A 4F00A 2KHOA 4JN4A 4H6HA 3DPQA 3DPPA 4R5IA 4R5JA 4PO2A 3T46A
chains in the Genus database with same CATH superfamily
3D4YA 3T4AG 2LM0A 1GN9A 1O7DC 2O0I1 2YL6A 3O3NB 4EZXA 2Z8YA 1I4DA 3DX0A 4EZUA 2EFLA 3RV1A 3L3OM 4EZSA 2JNSA 1U00A 3BVVA 1UPXA 4E81A 4EZQA 3L3PA 1X03A 4JWIA 3O3OB 3BUPA 1QWNA 2F7PA 4EZWA 2WYIA 3HAJA 1SU6A 4JWDA 4FZOA 4ATMA 3OWGA 1DKXA 1I4TA 3QNJA 3QE6A 2GA9D 2Z0OA 2YL8A 2F7OA 4JN4A 3UITA 2F1BA 3DX3A 3D52A 2Q13A 3BVUA 3KDRA 3BUDA 1SU7A 5FLEX 2N3KA 4AZBA 3EJRA 1E1DA 2F7QA 3CZSA 2ND0A 4AVMA 3SOGA 1R33A 2C08A 2PY6A 3BVXA 4M0MA 4EZYA 1GNLA 4IM0A 3BVTA 4UDXX 4EZNA 2F7RA 4HR1A 3DDFA 2JNKA 4EZOA 1HXKA 3G9GA 2ELBA 3BUIA 3T48A 4JNEA 1ZWWA 5C5BB 4EZVA 1X04A 2RAKA 3ERCC 3I01A 2Z0VA 3DX2A 3ACOA 3D51A 3D4ZA 2X3WA 4DYLA 3B52X 3EJQA 1URUA 4NPHA 1E2UA 4KIKA 1MJGA 5C5BA 2Z0NA 3I2WA 3RV0A 2MI7A 2ZXQA 2QXLA 1YWMA 3CZNA 2YI8A 4HY9A 3I39X 3DX1A 1ZYLA 3DX4A 3QWEA 2RAJA 1JQKA 4I1QA 3CKDA 1PS3A 3DDGA 1OA0A 2PMRA 4R5IA 2EWFA 3EJPA 4D8JA 2D1LA 2LXYA 1R34A 4NSWA 1GNTA 3PLTA 4FZPA 1O7DB 4AZ5A 3BLBA 3KAVA 4F00A 4HR1B 2EX3B 4E3CA 1LQ7A 1TQVA 1TQUA 2OW7A 4EZZA 4AZ7A 5E84A 2WYHA 4IWOA 2X5CA 4H8SA 3B53X 4JWCA 4FZSA 3HAIA 4R5JA 1SUFA 3T46A 2ND1A 1OAOA 3T49A 1DKYA 1R5EA 4JNFA 3CVRA 4KIKB 2F1AA 4IWPA 4JLCA 4FM3A 3T47A 4AZGA 2YLLA 3SYVA 4AKVA 3Q84A 4F01A 3B51X 2YIBA 2NCZA 2V0OA 2FYVA 3ABHA 1TQSA 3EJUA 1QX1A 4NQIA 3D50A 2QFFA 2F18A 4EZRA 3DPOA 3D2FA 3ER9B 3QA8A 3M3WA 2OO2A 2KHOA 2YL5A 3LLLA 2YIVX 3C7NA 3KAWA 3LVTA 2OZNB 1HWWA 4R5GA 1TQTA 1SU8A 2GAFD 4G6QA 1E9VA 3BVWA 3Q0KA 3DPQA 3FD9A 3OHXM 1TQWA 3VEAA 1OA1A 2EFKA 3D2EA 4JL9A 4IM3A 2OBMA 2FICA 2GF4A 3A98A 4R5LA 2RT6A 3BUQA 4BNEA 3DPPA 4PO2A 4EZTA 5TKYA 1DKZA 1QWUA 3ER8C 2Q12A 4JWEA 4IM2A 3VEBA 3EJSA 4IWQA 4IW0A 1WDZA 2X3VA 4AZIA 3CAZA 3F7WA 5FIGA 3BUBA 4UDYX 2RAIA 3DYTA 4AZHA 4AZCB 3VKHA 2YL9A 4H6IA 4R5KA 1W9MA 2WINM 3RPMA 4HYBA 2YIAA 1HTYA 2ALWA 1I4LA 5KBPA 4WPEA 3ZEDA 2OW6A 1I49A 4AZCA 2OBLA 3QNIA 3EJTA 3GI7A 2YKTA 4EZPA 3OK8A 3I04A 3O3MB 2YI9A 4AZ6A 3HAHA 3LMFA 4WPCA 2QKWA 3CV5A 2D4CA 4B9QA 1Y2OA 4H6HA 2YLAA 4DCNC 2X3XA
chains in the Genus database with same CATH topology
3OHXM 2EX3B 4E3CA 3VEAA 3T4AG 1OA1A 2LM0A 1GN9A 4EZZA 3D2EA 5E84A 3O3NB 4JL9A 4IM3A 3T48A 2OBMA 4EZXA 4JNEA 4EZVA 2Z8YA 3ERCC 4EZUA 3RV1A 3I01A 3L3OM 4IWOA 4EZSA 2X5CA 3A98A 4R5LA 3B53X 4JWCA 2JNSA 2RT6A 1U00A 3DPPA 4R5JA 1SUFA 3B52X 4PO2A 3T46A 4EZTA 2ND1A 1UPXA 1OAOA 5TKYA 4NPHA 4E81A 1DKZA 3T49A 1E2UA 4EZQA 1DKYA 4JWIA 3ER8C 3O3OB 4JWEA 4JNFA 4EZWA 4KIKA 1MJGA 1SU6A 4JWDA 3RV0A 4IM2A 4KIKB 3VEBA 3OWGA 1DKXA 2QXLA 4IWQA 4IW0A 4IWPA 3QNJA 3F7WA 2YI8A 5FIGA 2GA9D 4JLCA 4HY9A 3I39X 4FM3A 4UDYX 3T47A 4JN4A 3VKHA 1ZYLA 3UITA 4F01A 4H6IA 3B51X 4R5KA 2YIBA 2NCZA 1W9MA 2WINM 3KDRA 1JQKA 4HYBA 2YIAA 1SU7A 5FLEX 2N3KA 2QFFA 4EZRA 3DPOA 3D2FA 1E1DA 3ER9B 3ZEDA 1OA0A 3QA8A 2ND0A 2KHOA 2OBLA 4R5IA 2EWFA 2PY6A 2YIVX 3GI7A 4D8JA 4EZPA 4M0MA 3C7NA 4EZYA 3KAWA 3I04A 3O3MB 1GNLA 1GNTA 4IM0A 2YI9A 4R5GA 1SU8A 4UDXX 3KAVA 2GAFD 3LMFA 4G6QA 1E9VA 4EZNA 4HR1A 4B9QA 4F00A 4H6HA 3DPQA 4HR1B 3FD9A 4EZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHX M;  4EZT A;  5TKY A;  4F01 A;  4H6I A;  4EZO A;  4E81 A;  1DKZ A;  3T49 A;  3T4A G;  4R5K A;  4EZP A;  1DKY A;  4EZQ A;  3C7N A;  2WIN M;  4JWI A;  4EZY A;  4EZZ A;  4JWE A;  3D2E A;  4JNF A;  5E84 A;  4EZW A;  4HYB A;  3T48 A;  4EZX A;  4JWD A;  4JNE A;  4EZV A;  4R5G A;  2QFF A;  4EZR A;  1DKX A;  4EZU A;  2QXL A;  3DPO A;  3L3O M;  4EZS A;  3D2F A;  4EZN A;  4R5L A;  3QNJ A;  4JWC A;  4HY9 A;  1U00 A;  4B9Q A;  3T47 A;  4F00 A;  2KHO A;  4JN4 A;  4H6H A;  3DPQ A;  3DPP A;  4R5I A;  4R5J A;  4PO2 A;  3T46 A; 
#chains in the Genus database with same CATH topology
 3D4Y A;  3T4A G;  2LM0 A;  1GN9 A;  1O7D C;  2O0I 1;  2YL6 A;  3O3N B;  4EZX A;  2Z8Y A;  1I4D A;  3DX0 A;  4EZU A;  2EFL A;  3RV1 A;  3L3O M;  4EZS A;  2JNS A;  1U00 A;  3BVV A;  1UPX A;  4E81 A;  4EZQ A;  3L3P A;  1X03 A;  4JWI A;  3O3O B;  3BUP A;  1QWN A;  2F7P A;  4EZW A;  2WYI A;  3HAJ A;  1SU6 A;  4JWD A;  4FZO A;  4ATM A;  3OWG A;  1DKX A;  1I4T A;  3QNJ A;  3QE6 A;  2GA9 D;  2Z0O A;  2YL8 A;  2F7O A;  4JN4 A;  3UIT A;  2F1B A;  3DX3 A;  3D52 A;  2Q13 A;  3BVU A;  3KDR A;  3BUD A;  1SU7 A;  5FLE X;  2N3K A;  4AZB A;  3EJR A;  1E1D A;  2F7Q A;  3CZS A;  2ND0 A;  4AVM A;  3SOG A;  1R33 A;  2C08 A;  2PY6 A;  3BVX A;  4M0M A;  4EZY A;  1GNL A;  4IM0 A;  3BVT A;  4UDX X;  4EZN A;  2F7R A;  4HR1 A;  3DDF A;  2JNK A;  4EZO A;  1HXK A;  3G9G A;  2ELB A;  3BUI A;  3T48 A;  4JNE A;  1ZWW A;  5C5B B;  4EZV A;  1X04 A;  2RAK A;  3ERC C;  3I01 A;  2Z0V A;  3DX2 A;  3ACO A;  3D51 A;  3D4Z A;  2X3W A;  4DYL A;  3B52 X;  3EJQ A;  1URU A;  4NPH A;  1E2U A;  4KIK A;  1MJG A;  5C5B A;  2Z0N A;  3I2W A;  3RV0 A;  2MI7 A;  2ZXQ A;  2QXL A;  1YWM A;  3CZN A;  2YI8 A;  4HY9 A;  3I39 X;  3DX1 A;  1ZYL A;  3DX4 A;  3QWE A;  2RAJ A;  1JQK A;  4I1Q A;  3CKD A;  1PS3 A;  3DDG A;  1OA0 A;  2PMR A;  4R5I A;  2EWF A;  3EJP A;  4D8J A;  2D1L A;  2LXY A;  1R34 A;  4NSW A;  1GNT A;  3PLT A;  4FZP A;  1O7D B;  4AZ5 A;  3BLB A;  3KAV A;  4F00 A;  4HR1 B;  2EX3 B;  4E3C A;  1LQ7 A;  1TQV A;  1TQU A;  2OW7 A;  4EZZ A;  4AZ7 A;  5E84 A;  2WYH A;  4IWO A;  2X5C A;  4H8S A;  3B53 X;  4JWC A;  4FZS A;  3HAI A;  4R5J A;  1SUF A;  3T46 A;  2ND1 A;  1OAO A;  3T49 A;  1DKY A;  1R5E A;  4JNF A;  3CVR A;  4KIK B;  2F1A A;  4IWP A;  4JLC A;  4FM3 A;  3T47 A;  4AZG A;  2YLL A;  3SYV A;  4AKV A;  3Q84 A;  4F01 A;  3B51 X;  2YIB A;  2NCZ A;  2V0O A;  2FYV A;  3ABH A;  1TQS A;  3EJU A;  1QX1 A;  4NQI A;  3D50 A;  2QFF A;  2F18 A;  4EZR A;  3DPO A;  3D2F A;  3ER9 B;  3QA8 A;  3M3W A;  2OO2 A;  2KHO A;  2YL5 A;  3LLL A;  2YIV X;  3C7N A;  3KAW A;  3LVT A;  2OZN B;  1HWW A;  4R5G A;  1TQT A;  1SU8 A;  2GAF D;  4G6Q A;  1E9V A;  3BVW A;  3Q0K A;  3DPQ A;  3FD9 A;  3OHX M;  1TQW A;  3VEA A;  1OA1 A;  2EFK A;  3D2E A;  4JL9 A;  4IM3 A;  2OBM A;  2FIC A;  2GF4 A;  3A98 A;  4R5L A;  2RT6 A;  3BUQ A;  4BNE A;  3DPP A;  4PO2 A;  4EZT A;  5TKY A;  1DKZ A;  1QWU A;  3ER8 C;  2Q12 A;  4JWE A;  4IM2 A;  3VEB A;  3EJS A;  4IWQ A;  4IW0 A;  1WDZ A;  2X3V A;  4AZI A;  3CAZ A;  3F7W A;  5FIG A;  3BUB A;  4UDY X;  2RAI A;  3DYT A;  4AZH A;  4AZC B;  3VKH A;  2YL9 A;  4H6I A;  4R5K A;  1W9M A;  2WIN M;  3RPM A;  4HYB A;  2YIA A;  1HTY A;  2ALW A;  1I4L A;  5KBP A;  4WPE A;  3ZED A;  2OW6 A;  1I49 A;  4AZC A;  2OBL A;  3QNI A;  3EJT A;  3GI7 A;  2YKT A;  4EZP A;  3OK8 A;  3I04 A;  3O3M B;  2YI9 A;  4AZ6 A;  3HAH A;  3LMF A;  4WPC A;  2QKW A;  3CV5 A;  2D4C A;  4B9Q A;  1Y2O A;  4H6H A;  2YLA A;  4DCN C;  2X3X A; 
#chains in the Genus database with same CATH homology
 3OHX M;  2EX3 B;  4E3C A;  3VEA A;  3T4A G;  1OA1 A;  2LM0 A;  1GN9 A;  4EZZ A;  3D2E A;  5E84 A;  3O3N B;  4JL9 A;  4IM3 A;  3T48 A;  2OBM A;  4EZX A;  4JNE A;  4EZV A;  2Z8Y A;  3ERC C;  4EZU A;  3RV1 A;  3I01 A;  3L3O M;  4IWO A;  4EZS A;  2X5C A;  3A98 A;  4R5L A;  3B53 X;  4JWC A;  2JNS A;  2RT6 A;  1U00 A;  3DPP A;  4R5J A;  1SUF A;  3B52 X;  4PO2 A;  3T46 A;  4EZT A;  2ND1 A;  1UPX A;  1OAO A;  5TKY A;  4NPH A;  4E81 A;  1DKZ A;  3T49 A;  1E2U A;  4EZQ A;  1DKY A;  4JWI A;  3ER8 C;  3O3O B;  4JWE A;  4JNF A;  4EZW A;  4KIK A;  1MJG A;  1SU6 A;  4JWD A;  3RV0 A;  4IM2 A;  4KIK B;  3VEB A;  3OWG A;  1DKX A;  2QXL A;  4IWQ A;  4IW0 A;  4IWP A;  3QNJ A;  3F7W A;  2YI8 A;  5FIG A;  2GA9 D;  4JLC A;  4HY9 A;  3I39 X;  4FM3 A;  4UDY X;  3T47 A;  4JN4 A;  3VKH A;  1ZYL A;  3UIT A;  4F01 A;  4H6I A;  3B51 X;  4R5K A;  2YIB A;  2NCZ A;  1W9M A;  2WIN M;  3KDR A;  1JQK A;  4HYB A;  2YIA A;  1SU7 A;  5FLE X;  2N3K A;  2QFF A;  4EZR A;  3DPO A;  3D2F A;  1E1D A;  3ER9 B;  3ZED A;  1OA0 A;  3QA8 A;  2ND0 A;  2KHO A;  2OBL A;  4R5I A;  2EWF A;  2PY6 A;  2YIV X;  3GI7 A;  4D8J A;  4EZP A;  4M0M A;  3C7N A;  4EZY A;  3KAW A;  3I04 A;  3O3M B;  1GNL A;  1GNT A;  4IM0 A;  2YI9 A;  4R5G A;  1SU8 A;  4UDX X;  3KAV A;  2GAF D;  3LMF A;  4G6Q A;  1E9V A;  4EZN A;  4HR1 A;  4B9Q A;  4F00 A;  4H6H A;  3DPQ A;  4HR1 B;  3FD9 A;  4EZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...