3L3VA

Structure of hiv-1 integrase core domain in complex with sucrose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 53
structure length 144
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3vA00
2FBVA 3TWHA 3DLBA 3S3NA 1ASWA 1ZBHA 1RILA 3M8SA 4CJSA 4IG3A 4B9UA 2R7YA 3DLKA 4FW1A 1RCHA 4DFJA 3C94A 4LSLA 2BDPA 2QKKA 4Y1DA 1SKSA 1TVRA 3NAEA 3NGYA 1MU2A 4AHVA 1YTAA 1U47A 1JL2A 1X9SA 4WE1A 4DU4A 4OKEA 4N47A 3G10A 3KLHA 2FBTA 3DMJA 2W42A 1D5AA 4KI6A 2YHBA 3AO2A 1HQEA 4FJNA 2FC0A 1T03A 4K8ZA 1W9HA 5HLFA 2HHTA 4JLHA 1T05A 4DTPA 5CZ2A 3AVFA 2G8IA 3A2FA 4FZXC 2HHSA 1RDAA 2X78A 1NKEA 4OKKA 4FM2A 1FKPA 1X9WA 1Q9YA 3PUFA 3LP2A 3TARA 2HHQA 4OGCA 1RT3A 1SUQA 4LH4A 4KKOA 3E01A 5KRTA 4DG1A 3SV3A 4B9SA 3SCXA 4CK3A 2OPRA 1BL3A 1VSMA 1WSEA 4M3XA 2G8FA 4HVJA 1KFSA 4UQGA 2BANA 5CYQA 3NHGA 2PY5A 3C6TA 4FJGA 4KTQA 4PY5A 4FLZA 1FK9A 1Q9XA 1JKHA 4RG8A 1JLBA 1KLMA 5D3GA 3AA2A 4CJWA 3KK2A 4KB0A 5KTQA 4H4MA 2XRIA 3LAKA 4J2BA 3QEXA 3G0ZA 5CZ1A 4DQRA 5FRNA 2EX3A 2VG6A 2IAJA 4KO0A 4B8AB 3L2UA 3ULDA 4LD0A 1X9MA 1IKYA 2P51A 3BGRA 5HBMA 1ZBFA 5K14A 4CJVA 1RDBA 4FJXA 2ATQA 4JRPA 1RT4A 2HNYA 3V1QA 2XO7A 1CLQA 1D8YA 4I2QA 4OKJA 3V81A 3SQ4A 1XWLA 1KCFA 1UAXA 4M3RA 4DQSA 3MXMA 3SYZA 3CYMA 1HYVA 5EU7A 4CJTA 3SZ2A 2ZQBA 2HHUA 4Y1CA 1KVBA 3VQPA 1S1UA 3VQCA 3O4QA 2B5JA 4J2EA 4CHZA 1RBRA 4AHSA 4CGDA 5KGXA 4I9QA 1L3VA 1BCOA 2HVHA 3V4IA 5HRRA 4IDKA 4DFPA 1S5JA 3RMDA 3L3VA 1BI4A 3HP9A 3ZT1A 3SQ1A 3MAQA 4CF9A 2PYJA 3DOKA 3ZSQA 1A5VA 2D0BA 4B9NA 4CEQA 1TK8A 1U04A 4CF1A 5C25A 3O3HA 1VK0A 3OYJA 3U3GA 3NH2A 3LPUA 3O3GA 1WNSA 2IS3A 3T19A 4H8KA 3WNEA 1WLJA 2NUBA 4E7IA 4KRFA 4ZHRA 4CF8A 2KQ2A 1IKXA 3IG1A 3V9ZA 2E6LA 4M41A 1L3SA 1HRHA 3JYTA 3S3MA 4DTJA 2IGIA 1Z25A 3OVNA 4Z4FA 1RTDA 1ASUA 3WNGA 4DLGA 1S1XA 3WNHA 3L8BA 1T8EA 3ZSRA 3RMCA 1EETA 4CJLA 1TL1A 3AVGA 3AVAA 3P1GA 3MEGA 2PYLA 3NCIA 2ZE2A 1BIZA 1CXUA 4FLYA 2OA8A 3KTQA 4M3TA 2LSNA 5FRMA 1CZBA 3DRPA 2Q3SA 1LV5A 4HUFA 3AO5A 3V9XA 4CEEA 3TAGA 3AVKA 3SJJA 1FKOA 2HHXA 4CHOA 3I8DA 4DTXA 2OPQA 4N76A 3KKRA 3OYFA 3QEPA 4DTUA 1TGOA 4NCAA 1CZ9A 2KTQA 1JLFA 3SPZA 5J2QA 1S9EA 1N5YA 1L3TA 1NK8A 3RMAA 1J9AA 3HSTB 3NF9A 3O4NA 4O5BA 4CGJA 3L2QA 1XHXA 3IRXA 4E7KA 1JLAA 3U3YA 2A1RA 3RWUA 3K57A 2B6AA 1N6QA 4E7JA 4M3ZA 3T3FA 3ISNC 4CJ4A 4CK1A 4OVLA 1EKEA 1JL1A 1RDDA 4O55A 3ZSWA 3MEDA 1U4BA 4FK4A 2DY4A 1WSFA 4DU3A 3QLHA 1EX4A 2VG7A 4DU1A 3QNOA 3LWMA 3ZT3A 4AHRA 3PX0A 4RW4A 2XY6A 1SKWA 3AA3A 2GBZA 1BGXT 1RT6A 4DSLA 1RTHA 4Z0UA 4KHQA 3VQ7A 1DTTA 4CEDA 4ID5A 4N56A 3QESA 4B9TA 1RT7A 3HPHA 4QAGA 3OYAA 4F2SA 3V1RA 4CJQA 1WN7A 3SQ0A 2HNDA 3HVRA 1GOCA 1NJXA 4PWDA 2GUIA 4J2DA 4FJIA 2ITGA 2XHBA 4KTWA 3FFIA 3UIQA 3VQQA 5DMRA 1W0HA 1J54A 4OLAA 5J2PA 3LZIA 1HQUA 1KVAA 2F96A 1WAJA 1IKVA 4IBNA 4DQIA 4PUOA 3AVMA 1HYZA 4N41A 3HK2A 4DQPA 4KHWA 5SWMA 4CIGA 1NOYA 1RBVA 4DS4A 4BWMA 3MXIA 3LALA 1EP4A 3OJSA 1XHZA 2WONA 3U6FA 1S6PA 3CFOA 4J2AA 1NK0A 4CHPA 4OPKA 3K5LA 1JXEA 4FJ5A 1SV5A 1VSJA 3OS0A 3OY9A 2Y1JA 4FYDA 4TSXA 4ID1A 3NDKA 5KI6A 3B6PA 3BDPA 3OS1A 3AVBA 4CGHA 3K58A 4FJMA 3K2PA 1I39A 4W5RA 4RW6A 3OYMA 4JS5A 4CCHA 3DLGA 2FBXA 4GW6A 4MFBA 5C24A 4FLVA 5DK5A 3HXMA 1C0TA 2YHAA 4LY7A 3VQ6A 4DF4A 4B9MA 2F8SA 4CJUA 3NH0A 3VQEA 3LANA 3ZT0A 2OPSA 4B08A 1HNVA 3TI0A 4IKFA 3HJFA 4CJKA 3C95A 4MQ3A 1NK7A 4FW2A 1YTUA 5T7BA 4FJLA 1TKXA 4M42A 4GVMA 3OYIA 3DI6A 1HMVA 4DSIA 1EXQA 1REVA 2Z1JA 3ALYA 1U45A 3QETA 2BGGA 5HRSA 3EY1A 1B9DA 1VRUA 4CGGA 3SUQA 3O3FA 1D9FA 1BIUA 2ETJA 3TR8A 4OJRA 1NOZA 4CHYA 4AH9A 5JS2A 4CEFA 1HYSA 3PY8A 1RT2A 2E6MA 3ZSOA 2G8KA 1WAFA 4FLUA 2Z1HA 4FVMA 3M8QA 3NF6A 2GV9A 3NGIA 3SQ2A 1NK6A 3QIPA 4FZZA 2DFFA 2O4GA 2IC3A 4CIEA 4DSJA 1NK4A 4W5TA 4CECA 3OYGA 5SZTA 4E89A 3WNFA 1RDCA 1IKWA 2DFEA 4RW8A 3NF8A 4BE2A 4FM1A 2QKBA 1B9FA 1LWFA 1VRTA 2HHVA 4BWJA 4KAZA 3SUOA 4KREA 4YFUA 1Z26A 3HYFA 3V6DA 2PZSA 1RBTA 2VWKA 3QEIA 1T7PA 4OLBA 4HHTA 2Y1IA 1VSEA 3AV9A 3K59A 4F4KA 1R0AA 3AVJA 1ZYQA 3VQ8A 3F73A 4EZ9A 4KFBA 4NYNA 4BDPA 2JLEA 3VQ9A 4FJJA 4NCBA 4DTMA 2X74A 4O44A 4RW9A 3ZSVA 4CERA 1DLOA 1TAQA 2YV0X 3OS2A 4O0IA 4B9LA 2A1SA 3HVTA 4C8MA 3PX4A 1ZBUA 1J5OA 3DYAA 3RRHA 1TAUA 3AA5X 2DFHA 4DWIA 4M45A 1QTMA 4DTRA 3CM5A 1YT3A 4HCBA 4DLEA 3K5MA 4CIFA 3S9HA 5KGWA 2KZZA 4CEBA 1C1CA 1Q8IA 4KHSA 3AVIA 1IH7A 2HNZA 4ELUA 3KK3A 3NBPA 2BE2A 2RPIA 1SL0A 1WSIA 2YNHA 3HT3A 3QO9A 1L3UA 1VSFA 3QEVA 1ASVA 3CFRA 5HP1A 4CJ5A 3OYNA 4DMNA 1BI4B 4NCGA 5HRNA 4ZTFA 1WSJA 1BHLA 1B92A 1C1AA 2D5RA 5E41A 3V9SA 3VQBA 1GOBA 4E1NA 3CG7A 4IFYA 4CK2A 3OYDA 4C8NA 2FBYA 3QERA 1LW2A 4BDZA 1UWBA 2XY5A 4M3UA 2G8WA 4B9VA 4FJ7A 4HUEA 4AILC 3OJUA 4FK0A 1RNHA 3P83D 1JXBA 3CQ8A 1SL1A 1VSDA 1SKRA 1RT5A 3MXJA 4I7FA 3ZSZA 4CJRA 5J1EA 1HJRA 2XY7A 1D9DA 3DLHA 4KB1A 1GOAA 3DRRA 1QSSA 4R5PA 4ZTJA 5I42A 1TK0A 3RR8A 4ELVA 1UA1A 1WSHA 3KK1A 1LAWA 4CEZA 4CESA 5CY4A 4W5OA 1QE1A 4CGIA 3QNNA 4KV8A 2YKNA 3TAQA 3V1OA 1QHTA 4KHYA 1C1BA 1X1PA 1WSGA 3T1AA 3EYZA 2HW3A 5KRSA 3V9WA 4EP4A 4OPJA 2OZSA 1NJWA 4CFCA 1DTQA 4BACA 1O1WA 3LDSA 1XC9A 1KRPA 2YNFA 3ITHA 4FLTA 4KPYA 3AVCA 3H08A 3SUPA 1QSLA 3NF7A 3AO4A 1VSIA 3C6UA 4HUGA 4IFVA 1JLCA 1HPZA 3KD5E 3ZT4A 3DRSA 1TV6A 2RN2A 4NYFA 1S9GA 3ZSYA 3P5JA 4FJ9A 3AVHA 5FDLA 1XI1A 3M8RA 3K5OA 1S1VA 1NK5A 4FJ8A 2X6SA 4CHNA 1YVUA 3TAMA 1ITGA 4AHUA 3LZJA 4IG0A 4FLXA 4DFMA 1NJYA 1NJZA 4FJHA 4Z4CA 1C0UA 3NH1A 4F2RA 1TL3A 1C6VA 4JRQA 4E19A 1RBSA 3PO5A 2I5JA 4M3WA 2KZMA 2RF2A 2KW4A 2P5GA 3HO1A 2HB5A 4AHCA 4FM0A 3LWLA 1RTJA 3NFAA 3KIOA 3VQDA 1LWCA 3OYKA 4Z4IA 4CFAA 4FCYA 3MECA 4DTSA 4W5QA 2VG5A 3RMBA 1C0MA 2YNIA 4CGFA 4BE1A 4E3SA 1U49A 4L8RB 3RTVA 2P5OA 4E0DA 3OYEA 1K6YA 4KI4A 4N5SA 4DFKA 4Z4EA 1FXXA 4HCCA 3AVLA 1RTIA 2D0AA 1I3AA 3KLIA 3HM9A 4DTNA 2G8UA 4BDYA 5FROA 4Z4GA 2O4IA 2D0CA 1UOCA 1F21A 4XIUA 4FZYA 4E7LA 4DQQA 3DOLA 4E7HA 4CFDA 1A5XA 3SV4A 3LAMA 3V9UA 5JS1A 4PA1A 1SL2A 4CF0A 1KLNA 3D45A 3CFPA 2HMIA 3QINA 2OZMA 2WOMA 3VN5A 4CEAA 3TABA 1J53A 3PV8A 4QCLA 4CJEA 4H4OA 3ZT2A 3SUNA 5HROA 3F9KA 3QEWA 2KFZA 1A5WA 1RBUA 3NE6A 4M3YA 2IOCA 2Z1GA 1TKZA 3HPOA 3L2VA 1U48A 1QS4A 1NK9A 3IAYA 2Z1IA 3B6OA 4CJPA 4CJ3A 3AA4A 4CF2A 4DSKA 4B3OA 2G8HA 2P1JA 4K8XA 3AVNA 4I9LA 1HNIA 3TAPA 2HVIA 1LWEA 3MEEA 3SPYA 1QQCA 4YNQA 3LP3A 3LPTA 3S3OA 1JLQA 2QK9A 1UA0A 2RKIA 3AO1A 1BCMA 5HRPA 1TKTA 3EZ5A 1NKCA 1QSYA 3SNNA 1BQNA 4FLWA 4QOZB 2DTUA 3KLFA 2ZD1A 1S1TA 4F3OA 4F3TA 3OYBA 1S1WA 3VQAA 3KD1E 3ZCMA 4KHUA 3I0RA 4CFBA 4FXDA 1LAVA 3VQ4A 3VA3A 4DTOA 4ICLA 4C8KA 3HP6A 2QXFA 3L3UA 4RW7A 1ZBLA 2X6NA 3RR7A 4CE9A 4JS4A 2XY8A 3CM6A 2YNGA 1NKBA 3DLRA 4EZ6A 2E4LA 1KVCA 1KSPA 2KFNA 3TAEA 2IDOA 2VWJA 5J2MA 4CJFA 3TANA 4ELTA 4LH5A 2HHWA 1VSHA 4Z4HA 3PX6A 3DM2A 3DLEA 1TKDA 3ZSXA 3AO3A 3OYCA 4C8OA 1JLEA 3K5NA 4CEOA 4PQUA 3RRGA 1VSKA 4DSFA 4BE0A 1RT1A 1TK5A 4G1QA 2AJQA 1IO2A 3IS9A 3VQ5A 5CYMA 3KLGA 4FJKA 4EP5A 2F8TA 2B4JA 3LP0A 1IG9A 4FK2A 1VSLA 4F8RA 3THVA 4E1MA 4KTZA 4KHNA 1LW0A 4OGEA 3KLEA 3PO4A 4DSEA 1BQMA 3L2RA 5J2NA 4CHQA 4W5NA 4LSNA 2OPPA 3M8PA 1BISA 1L5UA 4O4GA 1JLGA 4DS5A 3D0PA 1Y97A 4GMJB 3VA0A 3ASMA 1KFDA 2EHGA 3OYHA 3KJVA 1S6QA 3L2WA 4AHTA 3JSMA 4DF8A 3NGZA 4HTUA 4I2PA 3KKSA 5C42A 1G15A 1KTQA 3HPGA 3QIOA 5I3UA 4Q0BA 4Q5VA 3SI6A 1ZBIA 2JGUA 2YKMA 4C8LA 1CXQA 3I0SA 3HL8A 3OYLA 4B8CA 2G8VA 3TAFA 2OYQA 4O0JA 3LP1A
chains in the Genus database with same CATH superfamily
2FBVA 3TWHA 1ASWA 5CE3A 5DM7L 3GG4A 4M7YA 3SLCA 1NU0A 4IG3A 1W97L 4KH5A 2R7YA 3DLKA 4FW1A 1YXQA 3ATUA 4DFJA 4JNEA 2BDPA 3VGMA 2WTUA 4NCBA 1X9SA 1U47A 1JL2A 3UB5A 5C0YA 4OKEA 4LF4K 2HOEA 1EWQA 4K8ZA 2P9KB 1W9HA 5EOYA 4H0TB 4DTPA 5GINA 3MCPA 1N32K 3SBGA 5M1NA 4FM2A 1RT3A 3DXMB 4KKOA 5LMUK 3VOVA 3SV3A 2EWSA 3SCXA 4BVPA 1HJOA 4BG9A 5C2DA 2IVOA 4JHDA 5KQ8A 5AFUH 4M3XA 4PKGA 5CYQA 2P9LA 2D4WA 5ADXH 3C7NA 4IJAA 4RG8A 1KLMA 4BC3A 5I9EB 2OTLN 4EFHA 3A5MC 4J2BA 4CW7B 3G0ZA 5FRNA 4KO0A 3ZEUB 1QZ6A 1D8YA 4OKJA 1XWLA 4C1NI 5BR8K 5EY4A 1OVYA 2V7YA 4JK8A 2B5JA 3VGLA 1FJGK 1BUPA 4AHSA 1HNXK 1L3VA 3CIPA 2QTDA 5HRRA 3L3VA 1X3NA 3G25A 3DOKA 1ATSA 2OCEA 4CEQA 3O3HA 3JS6A 3NH2A 3KVGA 2IS3A 3SAGA 2NUBA 4CF8A 3V9ZA 2Q31A 1L3SA 1HRHA 3JYTA 2QWMA 1Z25A 2P9PA 3DXKB 3WNHA 3AAPA 4YOTA 5FRMA 3SBTA 2LSNA 1GLLO 3I55N 5AQPA 1LV5A 3V9XA 3CJ9A 1FKOA 4I6MA 2HHXA 3CI5A 4DTXA 4IEIA 4MO5A 3E9OA 4N76A 3KKRA 1CZ9A 3O8MA 5J2QA 4JKFA 4CGJA 3VEVA 3O4NA 3L2QA 3MK6A 2ZGYA 1EKEA 1JL1A 3ZSWA 3MEDA 2DY4A 1EX4A 5GAEP 3H45C 4RW4A 1RTHA 4Z0UA 1NGFA 3VQ7A 1NGJA 4ID5A 4FL9A 2ZJPL 3CJ7A 2W6LA 1VQ4N 4KTWA 3ZETA 4OLAA 5AZIB 3NMUA 4PUOA 4IBNA 1HYZA 4N41A 3HK2A 4DQPA 4KHWA 1YJNN 1NOYA 1RBVA 3QB0A 3R6MA 4UY8O 3K5LA 4FJ5A 1VSJA 5AQSA 3C6HA 4QS8A 3THXA 3K58A 4FJMA 4W5RA 3K9JA 4CCHA 3L0QA 2FBXA 1C0TA 2YHAA 3NH0A 5EVZA 4B3MK 4CVNE 3ENBA 4JN4A 4IKFA 4MQ3A 2E2QA 3U4LA 4GVMA 5H1SQ 2E8AA 3FZMA 3MWPA 3ALYA 4WQ4C 1J6ZA 3J8AA 1B9DA 4CGGA 2E1YA 4YDUA 3TR8A 3W3DA 4K25A 5JS2A 4AH9A 1HYSA 3PY8A 4DR5K 1RT2A 2QXLA 2E2OA 5LMNK 4JYAK 3KWIA 2GV9A 4B1VA 3IUCA 1D4XA 2A6AA 3EKUA 4MO4A 2DFEA 4FM1A 1C0GA 1B9FA 4KREA 4J8FA 2GTDA 2E5LK 1NMNA 1RBTA 2Y1IA 4F4KA 1R0AA 3F9MA 4BQLA 3AGKA 1HUXA 4BVOA 2JLEA 3VQ9A 2X74A 4O44A 4RW9A 3O9RA 3E1YA 3HVTA 3BEXA 5AQKA 5BRHA 3TSPA 5E84A 1BU6O 4HCBA 4O5FA 4ISGA 3K5MA 2F9WA 4CEBA 1Q8IA 3G4SN 3H3NO 1SL0A 1WSIA 5AZJB 2NRWA 3QO9A 1L3UA 2FF3B 5HP1A 3CETA 4DMNA 1BI4B 4ZTFA 1C1AA 4FSVA 4BR4A 1IBLK 3OYDA 1HNZK 4H5TA 1W7AA 4F9OA 2VYPA 3QERA 4M3UA 4AILC 1VAZA 3O08A 4U7BA 1SL1A 3UE5A 3ZSZA 4BGAA 1BG3A 2I7NA 3DXMA 4H0YB 1GOAA 1QSSA 3DLHA 2Q0RA 3ENOA 3TTDA 3RR8A 4BRPA 3R9PA 5CY4A 4CGIA 4KV8A 3V1OA 1QHTA 4BRLA 3T1AA 4WF9L 5KRSA 2OZSA 4CFCA 4DV5K 1O1WA 3HI0A 1XC9A 1KRPA 2YNFA 4FLTA 4KPYA 3AVCA 3AO4A 1VSIA 3C6UA 3P5JA 1XI1A 3M8RA 4FJ8A 2OZMA 4LF5K 3LM2A 1NJZA 1C0UA 3ZYYX 4M3WA 4JRQA 1RBSA 5CHIA 3HO1A 4AHCA 3LWLA 3VQDA 3KIOA 1LWCA 2AA4A 2UYTA 4CFAA 1MDUB 4CZFA 3A0IX 3FFKB 4L8RB 1C0MA 1O13A 1ILYA 4HCCA 4BRFA 4DTNA 4NLCA 4WQ5C 5FROA 2D0CA 1UOCA 4IDHA 3NVKA 4BREA 1A5XA 3D2FB 3DXKA 5AQZA 4CFDA 3KHYA 3BP8A 4K42A 3TPQA 2HMIA 4DB3A 2Q2RA 4QCLA 4H4OA 3ZT2A 3SUNA 5HROA 3F9KA 2KFZA 5AQGA 3CJAA 4JI2K 4M3YA 5AQVA 1TKZA 1U48A 1QS4A 4H0OA 4KHPK 3H1QA 4IZ9A 4K8XA 3AVNA 4I9LA 1HNIA 3TAPA 1LWEA 4B1UB 3SPYA 2HBKA 4JD2B 1GLBG 1UA0A 3THWB 3AO1A 1MWKA 3EZ5A 1NKCA 1BQNA 3QBXA 4FLWA 2DTUA 2PAVA 4CZMA 4JKAA 4F3TA 4CFBA 4FXDA 4ICLA 4C8KA 3HP6A 4DHYA 3O5BA 1EQYA 2XY8A 2YNGA 4JKHA 2E4LA 3HRGA 2J4RA 2YX6A 3GL1A 5AQQA 5BRDA 4ELTA 3T7ZA 4M63C 2HHWA 4B3TK 5GAGP 1TKDA 3OYCA 4C8OA 5AQNA 3K5NA 3RRGA 5AZIA 3IS9A 3KLGA 3LDNA 3I56N 4EP5A 1N33K 4FK2A 3P4IA 4E1MA 4KTZA 3PO4A 2F9TA 4DSEA 3L2RA 4FWPA 1JLGA 3MDQA 3Q7CA 4HTUA 3OW2M 1TUUA 5I3UA 1NBWA 4Q0BA 4ISFA 3SI6A 2JGUA 3HL8A 2G8VA 2OYQA 3LP1A 3S3NA 2Q0UA 1RILA 1Q86O 5GADP 1RCHA 4B1ZA 1H1VA 4Y1DA 1TVRA 3NGYA 4AHVA 3DMJA 2W42A 4FJNA 2A40A 3AO2A 2FC0A 2G8IA 4FZXC 3S41A 1NKEA 3WUHA 4OKKA 1FKPA 1X9WA 3TSQA 3PUFA 1ZBSA 4BGBA 3TARA 1Q9YA 1SUQA 3E01A 4B9SA 4CK3A 2QW9A 1WSEA 3FGUA 5M1QA 2G8FA 1KFSA 4KTQA 1BO5O 3O1BA 4FLZA 1FK9A 3AA2A 2E2NA 4H4MA 2XRIA 5M1OA 5KTQA 1KD1O 3LAKA 3CCJN 2RE2A 1IBMK 2P51A 3BGRA 5JLFA 4FJXA 2HNYA 4BRCA 3EE9A 1CLQA 4I2QA 4M3RA 1KAZA 4DQSA 3SYZA 3CYMA 2HHUA 1NGCA 2E1ZA 4Y1CA 1KVBA 3VQCA 2CH6A 4CHZA 3QFPA 5M1PA 4CGDA 4I9QA 3ZLJA 4PKIA 3EL2A 1S5JA 1BI4A 1GLFO 2CH5A 3HP9A 3ZT1A 2A5XA 5BPMA 2D0BA 1U04A 3E9LA 3OYJA 1MA9B 4JKGB 3MX5A 4B1WB 3EKSA 4BY9C 3WNEA 1WLJA 4M41A 3S3MA 4DTJA 1XNQK 1RTDA 3WNGA 4R79A 4IJNA 3RMCA 3P1GA 3AVAA 1VQ5N 2NRHA 2PYLA 3KTQA 3DRPA 3RSEB 4CEEA 3SJJA 3VPZA 1N8RO 3I8DA 4DV2K 4JKDA 5JVHL 5LL6Z 1JLFA 4CZIA 3MN7A 4EHTA 1L3TA 2P9IB 1NK8A 1J9AA 3SJHA 3M1FA 1ZBHA 2ITMA 3K57A 2B6AA 4CBXA 3VMFB 3VEXA 4CK1A 1RDDA 1YVNA 4JI6K 4DU3A 3QLHA 2VG7A 3T1HK 3QNOA 3LWMA 2XY6A 3HPHA 4CJQA 4FOIA 3HVRA 1GOCA 4FWMA 1K8AO 2YHWA 2GUIA 4FJIA 3FFIA 1M90O 3UIQA 1J54A 3LZIA 1J5EK 4X62K 1TUYA 3QICA 3AVMA 1Q7YO 1YIJN 3D2FA 1VQON 3CXCM 3LALA 3OJSA 1DT9A 3U6FA 4J2AA 3CHWA 2VQFK 3OS0A 3OY9A 3NDKA 4ID1A 3F2KA 3BDPA 3MN9A 3AVBA 4CGHA 3ULEA 3OYMA 5JLHA 2QA4N 4GW6A 4FLVA 5DK5A 2O8DA 4LY7A 4DF4A 2F8SA 1VQ6N 3D2EB 3LANA 2OPSA 1ZC6A 5IT9O 4BR0A 4B08A 5AQXA 4CJKA 3C95A 5T7BA 3OYIA 4BRKA 1REVA 3VTHA 4AF1A 2BGGA 3QETA 5JMVA 1VRUA 3O3FA 4CHYA 4DUZK 4CEFA 4CD1A 2E6MA 3ZSOA 1WAFA 2OTJN 2W41A 4LFAK 4FVMA 2O4GA 4CIEA 4DSJA 1NK4A 5TKYA 3WEEA 1K9MO 5SZTA 3WNFA 1RDCA 1IKWA 4RW8A 3VGKA 3CQXA 3NF8A 4BE2A 1NJIO 1VRTA 2HHVA 4BWJA 2PZSA 3QEIA 2F4VK 3DAWA 2O8FA 3K59A 3EZWA 4CD3A 1FW6A 1V4SA 3VQ8A 4BDPA 2CGKA 3J81O 1DLOA 3HTVA 4O0IA 1BA1A 3WT0A 4B9LA 1ZBUA 3DYAA 1E4GT 2P9UB 4M45A 5AJ3K 2GUPA 3ZX3A 2NRVA 1MWMA 1U6ZA 4CIFA 4C1NK 2O8EA 3AVIA 1IH7A 3KK3A 1NGEA 2BE2A 5F0XA 3LM9A 3HT3A 2UXCK 1VSFA 3QEVA 1ASVA 3C65A 3TTCA 4DV3K 1BHLA 2UUCK 1GOBA 4E1NA 5AR0A 4IFYA 1HPMA 4JI4K 2HSTA 1UWBA 4BDZA 4B9VA 4FJ7A 3OA9A 1KXPA 2NLXA 4FK0A 2DPNA 3UKUB 4Z94A 3CQ8A 1RT5A 4CJRA 2XY7A 3M3ZA 1D9DA 4KB1A 4CZJA 4ELVA 3KK1A 1WUAA 3C0BA 1QE1A 3QNNA 2YKNA 3CMAN 1X1PA 2HW3A 1GLJO 4JKCA 4GNIA 2ASPA 1DTQA 4XH4A 4IOAL 4GKJK 4IO8A 3SUPA 2WUSA 3NF7A 5FPDA 3CCUN 4X65K 4JI0K 3QMLA 4IFVA 1JLCA 3EN9A 1TV6A 2RN2A 4NYFA 4FJ9A 3AVHA 4JAXA 3C6AA 1NJYA 4AHUA 3CQYA 1V4TA 2KZMA 4OPAA 3A8YA 2RF2A 2KW4A 5LJVA 2VGNA 4WFAL 2NZTA 5M1KA 3NFAA 5KQDA 3OYKA 4IOCL 1SS6A 1K8KB 4IOXA 4CZLA 4W5QA 2HHHK 2HMPA 3RMBA 3CCQN 4BE1A 4E0DA 4FWNA 4N5SA 1FXXA 2QWQA 3FLCO 3UKRB 1I3AA 4B3SK 3HM9A 4Z4GA 4BDYA 4FZYA 3BUZB 1GLEG 4FPAA 4H03B 3V9UA 5JS1A 3D7EO 3JXUA 1SL2A 3QINA 2WOMA 4LFBK 1J53A 3PV8A 4V19S 1A5WA 1RBUA 4A62A 1NK9A 4DSKA 4B3OA 2HVIA 4YNQA 1VQNN 2P9IA 3TSUA 2QK9A 5IWAK 2RKIA 3TTFA 4DR2K 3CCEN 1S1TA 1S1WA 3VQAA 4KHUA 3O9TA 2JWLA 1LAVA 3VA3A 4RW7A 1ZBLA 2X6NA 2NNWA 1IV0A 2AP1A 4YDUC 3DLRA 3K0SA 3VERA 2IDOA 4Z4HA 3PX6A 2UUBK 3DLEA 3ZSXA 3AO3A 5JICA 2FSKA 1VSKA 4DSFA 1TK5A 4G1QA 3FZFA 2P9KA 3A5OC 2B4JA 1IG9A 1VSLA 4OGEA 5J2NA 4CHQA 5TKWA 3M8PA 1L5UA 4DS5A 3VA0A 3OYHA 1KFDA 3KJVA 1S6QA 4DF8A 3OBYA 1NM1A 2A42A 3MWTA 1G15A 1KTQA 3QIOA 1GLCG 4Q5VA 1ZBIA 2YKMA 3VESA 4BRIA 1CXQA 3QBWA 4B8CA 3D2EA 4O0JA 2A41A 1HKGA 1NGHA 2NRTA 5AQWA 4CJSA 1QQMA 3HZ6A 5A2QO 3ZEUA 1OH7A 1HKCA 4LSLA 2QKKA 1SKSA 1MU2A 2QEXN 3W0LA 4DU4A 1QVFM 5AQHA 3IDHA 5MLCQ 3KLHA 2FBTA 4KI6A 2YHBA 5KPZA 4DQ8A 4CI6A 5HLFA 4JLHA 3EEQA 5CZ2A 5BN8A 3KK7A 2WFBA 3A2FA 1VQPN 1RDAA 3CC4N 3LDOA 2FF6A 2HHQA 3VEWA 4LH4A 3VETA 3OTOK 5C2FA 1S72N 2P9SB 5FPMA 5ADXA 4HVJA 3J7YP 4UQGA 1DGKN 4IFEA 4DV6K 1Q9XA 1JKHA 1JLBA 5D3GA 4LF7K 1KAXA 4DV0K 2VG6A 3IKMA 2IAJA 4LD0A 1SAZA 2P9UA 1ZBFA 4CJVA 2ATQA 1RT4A 2XO7A 2HF4A 3V81A 2Q36A 1HR0K 1ESVA 4JEPA 5EU7A 4CJTA 3SZ2A 1S1UA 4J2EA 5BPLA 5KGXA 1BCOA 3CERA 2HVHA 3CPWM 3EO3A 4DFPA 3RMDA 3IFRA 4AM6A 4CF9A 2PYJA 4BC4A 1BOTO 3L6QA 1A5VA 4B9NA 4FWKA 5C25A 1M1KO 4JKEA 1VK0A 3WXLA 3LPUA 1NGDA 3T19A 4H8KA 4K0KK 1YF5L 4ZHRA 4JKBA 4JHDB 4FWQA 3UKUA 4JI8K 1QQNA 2P9LB 4MLHA 3CCMN 4JI3K 4DLGA 1S1XA 4OPHA 5DM6L 1T8EA 1I94K 1EETA 1EO1A 1VQ9N 1CXUA 2OA8A 2Q97A 4M3TA 2FSNA 4BRAA 4HUFA 3AO5A 3MN6A 3TAGA 3SAHA 5M1FA 4CHOA 2OPQA 3QFUA 2HBJA 5E26A 3QEPA 4NXNK 4NCAA 2KTQA 2ZM6K 3SPZA 1S9EA 2QWLA 4O5BA 3HSTB 3U3YA 1QHAA 2KFNA 3IRXA 4E7KA 3RWUA 1OH8A 4M3ZA 1QQOA 3DWLA 4OVLA 4FK4A 1U4BA 1ATNA 2O8BB 3R3LA 4BG8A 4DU1A 5AQYA 3ZT3A 4AHRA 3CF5L 4FVUA 4DV4K 1NMDA 1RT6A 4KHQA 4N56A 3QESA 3OYAA 4F2SA 3V1RA 2ZJRL 1K8KA 1RGIA 1C0FA 2HNDA 2IIRA 4J2DA 2ITGA 1RDUA 2XHBA 3WQTA 4RCHA 1HQUA 1K73O 1WAJA 1IKVA 4JI5K 1NG9A 5SWMA 4CIGA 3RVCA 4WCEL 3MXIA 1EP4A 4XH5A 1HNWK 1S6PA 3DJCA 5F1XA 2KKZA 3FR0A 5AQFA 1N36K 3QDKA 2Y1JA 3THYB 2ASOA 4TSXA 5KI6A 1SQKA 3HSCA 4GV3A 1I39A 4JS5A 2IVNA 1NGGA 3DLGA 3Q7BA 5C24A 3HXMA 3VQ6A 4B9MA 4CJUA 4YOXA 1RDWX 3VQEA 3CCRN 3FZLA 5HL7L 3TI0A 2FXUA 3WXIA 4L3QA 4DUYK 4YY3K 4FW2A 4FJLA 4DSIA 1HMVA 1EXQA 2Z1JA 2IVPA 3OBWA 4ISEA 5HRSA 3EY1A 2QM1A 3SUQA 1D9FA 4JI1K 1VQ8N 4B9QA 2ETJA 3ZETB 4O8KA 2ZF5O 4A5BA 3MCAB 4WFBL 5AZJA 3NF6A 4FZZA 1NK6A 2DFFA 4YOUA 4W5TA 4CECA 3OYGA 3R1XA 4BROA 4E89A 1W2BM 1R59O 1LWFA 2HBLA 2V51B 4BC2A 3MMVA 3HBTA 3SUOA 4YFUA 1Z26A 3V6DA 2VWKA 3VEYA 4OLBA 4LC9B 3B8AX 3HOTA 4KH6A 5LJWA 3O1WA 3CC2N 4LF8K 4EZ9A 4KFBA 4NYNA 3AAQA 5HOOA 4EHUA 4FJJA 4DTMA 1JCFA 4ILJA 3ZSVA 3CJ1A 2GEMA 1TAQA 3CPEA 4C23A 2A1SA 4C8MA 1TAUA 3PX4A 3CCSN 3RRHA 3AA5X 2DFHA 4DWIA 3BY5A 4DTRA 1YT3A 1WBBA 4DLEA 4PL7A 3WQUA 4PKHA 3S9HA 4A2BA 2KZZA 2D1KA 1TYQB 3M6GA 2HNZA 4ELUA 3NBPA 2RPIA 2YNHA 2VCPA 1S3XA 2KLAA 1IBKK 4BRHA 5AQUA 4CJ5A 4IXCA 5AQIA 2PFUA 3P38A 3OYNA 3WXMB 1WSJA 5E41A 3V9SA 3K9KA 3U9DA 3P39A 4CK2A 2FBYA 1LW2A 1CZAN 3OJUA 5GIPA 1JXBA 3J80O 4KBOA 1YJ9N 1VSDA 3MXJA 5J1EA 1HJRA 2P9SA 4R5PA 4ZTJA 5I42A 1TK0A 1Q81O 1LAWA 4CEZA 4CESA 3EE8A 2WC9A 3EYZA 3I33A 4EP4A 4OPJA 1NJWA 1RFQA 4BACA 1X3MA 3LDSA 3PSIA 3ITHA 4HTLA 1XMQK 3E66A 3JAMO 1IG8A 1T3VA 4HUGA 1HPZA 4H0XB 4CBWA 3ZT4A 1U2VB 1YITN 5FDLA 5BR9A 4BRQA 1NK5A 4CHNA 3TAMA 5ELZA 4FJHA 4IG0A 4ILHA 4FLXA 4DFMA 3BZKA 3NH1A 4JD2A 1Y64A 2RHKA 1TL3A 1C6VA 1YHQN 4CZKA 2I5JA 3THWA 2P5GA 4BR9A 4A2AA 3CCLN 1P8ZA 4Z4IA 5BN9A 3MECA 4A57A 3ATVA 1NNEA 4DTSA 4H5RA 2VG5A 2YNIA 4BRDA 1Q18A 3RTVA 4KI4A 3OYEA 1K6YA 4Z4EA 2KHOA 3AVLA 1RTIA 2G8UA 3ID6A 2O4IA 4XIUA 3CD6N 4E7LA 4NXMK 3SV4A 3LDPA 1LCUA 5B8HA 1KLNA 1HX1A 4CEAA 1GLAG 4BRGA 3TABA 1JJ2M 2NRXA 5BREA 5CR4A 4HWIA 3QEWA 4CZGA 2IOCA 3HPOA 2UU9K 3B6OA 4CJ3A 3AA4A 4GY2B 2PBDA 4YORA 4MDAA 4IO9L 3MEEA 3SMPA 1JLQA 3KZBA 1BCMA 2VWBA 2QWNA 3SNNA 1QSYA 3FE1A 4H0VB 3AARA 3KLFA 2O8BA 3OYBA 3KD1E 2QWRA 3LDLA 3I0RA 1P90A 3G6EN 4DTOA 2QXFA 3F5TA 3L3UA 3RR7A 4JS4A 2ZJQL 1KSPA 2E88A 3TAEA 4CJFA 4O8UA 3DM2A 5C10A 5AQJA 4H0PA 4CEOA 4PQUA 1XC3A 2QWPA 4IWVA 1RT1A 2AJQA 2BH1A 3VQ5A 2CGJA 4E1JA 2V7ZA 3THVA 1LW0A 3KWGA 1BQMA 3NVMA 4LSNA 4GKKK 3THYA 1Y97A 1SZ2A 4GMJB 2EHGA 3L2WA 3NGZA 4I2PA 3KKSA 3O80A 4XH1A 5AQLA 1QVGM 4C8LA 3VEOA 3TAFA 4CJ7A 4MLEA 3DLBA 2VGMA 2P9NB 1XUPO 3M8SA 3T1YK 3O9UA 4FWLA 4B9UA 2BUPA 4WQ4A 3C94A 3NAEA 1YTAA 4XEIA 4WE1A 3N4PA 4N47A 3G10A 1JCGA 4OX9K 4BR7A 1D5AA 1HQEA 1T03A 3CCVN 2HHTA 4JV5K 4PL8A 1XMOK 3WXKA 1T05A 3AVFA 2HHSA 2X78A 2WBNA 3LP2A 4OGCA 1E4FT 1KQSM 5AQMA 5KRTA 4JKGA 4DG1A 1HLUA 1Q82O 2OPRA 1BL3A 1VSMA 2CGLA 2V52B 2BANA 3NHGA 2PY5A 3C6TA 4FJGA 4PY5A 1VQ7N 2O8CB 4CJWA 3KK2A 3FZHA 4WYBA 4KB0A 3QEXA 5CZ1A 4DQRA 2EX3A 4B8AB 3L2UA 3ULDA 1X9MA 1HKBA 1IKYA 3PIPL 5HBMA 5K14A 1RDBA 3RSEA 4JRPA 3V1QA 3SK3A 3SQ4A 3MXMA 1KCFA 1UAXA 1HYVA 4A5AA 4BR5A 1TYQA 2ZQBA 3VQPA 5GAHP 1GLDG 3O4QA 4QS7A 1RBRA 3V4IA 4IDKA 5BPNA 4U67L 3GE1A 3SQ1A 3MAQA 3ZSQA 1TK8A 4CF1A 3U3GA 1NGIA 3O3GA 1WNSA 3AGRA 4FWOA 4E7IA 4KRFA 2E20A 2KQ2A 1IKXA 3IG1A 2E6LA 3TU5A 2QWOA 2IGIA 3OVNA 4Z4FA 4GVEA 1ASUA 3L8BA 1Z6RA 3ZSRA 4CJLA 1TL1A 3AVGA 3O4WA 3ENHA 5AQRA 3MEGA 3NCIA 3D6RA 2Q1NA 1BIZA 2ZE2A 4B1YB 3ZX0A 4FLYA 2HF3A 4GV6A 1CZBA 1BDGA 2Q3SA 3AVKA 3PLAA 4YOWA 2ZGZA 2QI2A 2ZWHA 3OYFA 4DTUA 1TGOA 4FWSA 4AM7A 4YOYA 5JVGL 1N5YA 3DLLL 4A61A 3HOSA 3NF9A 1U2VA 3RMAA 2A1RA 5EX5A 1XHXA 1JLAA 3CJBA 1N6QA 1VQMN 4E7JA 1YI2N 3T3FA 3ISNC 4CJ4A 3O9QA 4O55A 1WSFA 4A59A 4M7XA 3J7ZO 1SKWA 3PX0A 3AA3A 2GBZA 1BGXT 4KH4A 4DSLA 2OANA 3J7AP 1DTTA 4CEDA 4B9TA 4BRNA 1RT7A 3VF4A 4QAGA 1WN7A 4JK7A 3SQ0A 1NJXA 4PWDA 2NRRA 4LF9K 1NLVA 4X64K 1KC8O 3VQQA 5DMRA 1W0HA 2FLOA 4WQ5A 5J2PA 1LOTB 5C15A 1KVAA 2F96A 3AY9A 4GV9A 4DQIA 1E3MA 4K43A 3U9ZA 4DS4A 4JI7K 4BWMA 1XHZA 3N4QA 2WONA 3CFOA 1NK0A 4CHPA 2HBMA 1ZXOA 1XQSC 4OPKA 1JXEA 1SV5A 1DEJA 4FYDA 3VEZA 3B6PA 4H5VA 1OKJA 3VF6A 3OS1A 2E2PA 3A5LC 5AFUA 3K2PA 3VF2A 3E9PA 3L4QA 1VHXA 4RW6A 2NRZA 1N34K 4MFBA 4FPBA 3BF3A 3CMEN 3ZT0A 1YAGA 1HNVA 3HJFA 2UXBK 4OO1J 5KPRA 4X66K 1T6CA 1NK7A 1YTUA 2W40A 1TKXA 4M42A 3DI6A 1T6DA 3R8EA 3OHRA 1U45A 1KAYA 2JWKA 1BIUA 4OJRA 1NOZA 1IJJA 4AQYK 2G8KA 3L4IA 2YJFA 3ID8A 4FLUA 3WXJA 2Z1HA 3M8QA 3NGIA 3SQ2A 3O9SA 3QIPA 2IC3A 4FWRA 3P31A 4RWTA 2H3GX 3I8BA 1YUWA 3PSFA 5GIOA 2QKBA 1OVQA 5FPEA 5FPNA 4KAZA 3HYFA 1T7PA 1JCEA 3ULEB 4HHTA 1VSEA 3AV9A 4DR7K 3AVJA 1ZYQA 2O8DB 3F73A 3PIOL 3GDQA 4B3RK 3C7NB 1X9JA 4CERA 4RTFD 2YV0X 3OS2A 2D0PA 1XNRK 4CBUA 1J5OA 4BR2A 1QTMA 2FSJA 2GWJA 3CM5A 1VQLN 3H3OB 2P9NA 2ASMA 5KGWA 5F2RA 3SMSA 4DV7K 1C1CA 4KHSA 1NGBA 2UXDK 4LF6K 3BF1A 4H5WA 1BA0A 3SAFA 5AQOA 5EXWA 4NB4A 3CFRA 3WEEB 3CJCA 4NCGA 5HRNA 2D5RA 1B92A 4Y0WA 3VQBA 4DKWA 3CG7A 4C8NA 1ATRA 2XY5A 5AQTA 2G8WA 2O8FB 4HUEA 3O6WA 2YJEA 1WBDA 1RNHA 3P83D 2GWKA 1SKRA 3T69A 4I7FA 2BTFA 3DRRA 3H6EA 4NO7A 3VENA 2P9PB 1UA1A 1WSHA 2UUAK 4QS9A 3UKRA 4WFNL 2W6KA 4W5OA 1OH6A 4PHTX 2O8CA 3TAQA 4KHYA 1C1BA 1WSGA 3G71N 2VQEK 1BWFO 3V9WA 4I6MB 4BC5A 4DCHA 2O8EB 4EAHD 3H08A 1QSLA 1NWKA 4BRMA 4K41A 3KD5E 3DRSA 1QZ5A 1S9GA 3ZSYA 1DKGD 3K5OA 1S1VA 3A5NC 2X6SA 3GOIA 1YVUA 1ITGA 3LZJA 4Z4CA 4F2RA 4E19A 4ILGB 3PO5A 2HB5A 4FM0A 1Z05A 1RTJA 3ZX2A 3BZCA 5BRFA 2GX9A 4FCYA 3FZKA 1U49A 4CGFA 1VQKN 4E3SA 2P5OA 4DFKA 1WOQA 2YCHA 2D0AA 3KLIA 1F21A 4DQQA 3DOLA 4E7HA 4DR3K 3LAMA 4PA1A 2I7PA 2D0OA 2YHXA 3D45A 4CF0A 3CFPA 1WB9A 1NGAA 3VN5A 1OH5A 4MDBA 4CJEA 1T44A 4LFCK 3NE6A 2Z1GA 3L2VA 3IAYA 3THXB 4FO0A 2Z1IA 2YI1A 3MX2A 4CJPA 4CF2A 3IMXA 3GBTA 2G8HA 2P1JA 3MN5A 4IEEA 1QQCA 4B1XB 3LP3A 3LPTA 3S3OA 1S22A 5HRPA 1TKTA 4DR6K 4NLBA 4QOZB 4EIAA 4CZHA 2ZD1A 4F3OA 3ZCMA 3H46O 2YHYA 3LL3A 3VQ4A 4BQZA 3H1VX 3U8XA 1G99A 4DV1K 4CE9A 3CM6A 1EWRA 1NKBA 4G9ZA 4EZ6A 1KVCA 2A3ZA 3HM8A 2VWJA 5J2MA 3TANA 4LH5A 1VSHA 4DR4K 5KPTA 4CZEA 4YOVA 1JLEA 4BE0A 1YJWN 3CC7N 1IO2A 5CYMA 4FJKA 2F8TA 5FLXO 3LP0A 4F8RA 4KHNA 3KLEA 3LDQA 4W5NA 2OPPA 1BISA 2F7TA 4O4GA 3D0PA 3ASMA 3M5RA 5C12A 3JSMA 4AHTA 3VTIA 4DR1K 5C42A 3HPGA 4H5NA 4FOEA 4JK9A 3I0SA 5LY3A 3OYLA 2GELA 4YHHK
chains in the Genus database with same CATH topology
2FBVA 3TWHA 3DLBA 3S3NA 1ASWA 1ZBHA 1RILA 3M8SA 4CJSA 4IG3A 4B9UA 2R7YA 3DLKA 4FW1A 1RCHA 4DFJA 3C94A 4LSLA 2BDPA 2QKKA 4Y1DA 1SKSA 1TVRA 3NAEA 3NGYA 1MU2A 4AHVA 1YTAA 1U47A 1JL2A 1X9SA 4WE1A 4DU4A 4OKEA 4N47A 3G10A 3KLHA 2FBTA 3DMJA 2W42A 1D5AA 4KI6A 2YHBA 3AO2A 1HQEA 4FJNA 2FC0A 1T03A 4K8ZA 1W9HA 5HLFA 2HHTA 4JLHA 1T05A 4DTPA 5CZ2A 3AVFA 2G8IA 3A2FA 4FZXC 2HHSA 1RDAA 2X78A 1NKEA 4OKKA 4FM2A 1FKPA 1X9WA 1Q9YA 3PUFA 3LP2A 3TARA 2HHQA 4OGCA 1RT3A 1SUQA 4LH4A 4KKOA 3E01A 5KRTA 4DG1A 3SV3A 4B9SA 3SCXA 4CK3A 2OPRA 1BL3A 1VSMA 1WSEA 4M3XA 2G8FA 4HVJA 1KFSA 4UQGA 2BANA 5CYQA 3NHGA 2PY5A 3C6TA 4FJGA 4KTQA 4PY5A 4FLZA 1FK9A 1Q9XA 1JKHA 4RG8A 1JLBA 1KLMA 5D3GA 3AA2A 4CJWA 3KK2A 4KB0A 5KTQA 4H4MA 2XRIA 3LAKA 4J2BA 3QEXA 3G0ZA 5CZ1A 4DQRA 5FRNA 2EX3A 2VG6A 2IAJA 4KO0A 4B8AB 3L2UA 3ULDA 4LD0A 1X9MA 1IKYA 2P51A 3BGRA 5HBMA 1ZBFA 5K14A 4CJVA 1RDBA 4FJXA 2ATQA 4JRPA 1RT4A 2HNYA 3V1QA 2XO7A 1CLQA 1D8YA 4I2QA 4OKJA 3V81A 3SQ4A 1XWLA 1KCFA 1UAXA 4M3RA 4DQSA 3MXMA 3SYZA 3CYMA 1HYVA 5EU7A 4CJTA 3SZ2A 2ZQBA 2HHUA 4Y1CA 1KVBA 3VQPA 1S1UA 3VQCA 3O4QA 2B5JA 4J2EA 4CHZA 1RBRA 4AHSA 4CGDA 5KGXA 4I9QA 1L3VA 1BCOA 2HVHA 3V4IA 5HRRA 4IDKA 4DFPA 1S5JA 3RMDA 3L3VA 1BI4A 3HP9A 3ZT1A 3SQ1A 3MAQA 4CF9A 2PYJA 3DOKA 3ZSQA 1A5VA 2D0BA 4B9NA 4CEQA 1TK8A 1U04A 4CF1A 5C25A 3O3HA 1VK0A 3OYJA 3U3GA 3NH2A 3LPUA 3O3GA 1WNSA 2IS3A 3T19A 4H8KA 3WNEA 1WLJA 2NUBA 4E7IA 4KRFA 4ZHRA 4CF8A 2KQ2A 1IKXA 3IG1A 3V9ZA 2E6LA 4M41A 1L3SA 1HRHA 3JYTA 3S3MA 4DTJA 2IGIA 1Z25A 3OVNA 4Z4FA 1RTDA 1ASUA 3WNGA 4DLGA 1S1XA 3WNHA 3L8BA 1T8EA 3ZSRA 3RMCA 1EETA 4CJLA 1TL1A 3AVGA 3AVAA 3P1GA 3MEGA 2PYLA 3NCIA 2ZE2A 1BIZA 1CXUA 4FLYA 2OA8A 3KTQA 4M3TA 2LSNA 5FRMA 1CZBA 3DRPA 2Q3SA 1LV5A 4HUFA 3AO5A 3V9XA 4CEEA 3TAGA 3AVKA 3SJJA 1FKOA 2HHXA 4CHOA 3I8DA 4DTXA 2OPQA 4N76A 3KKRA 3OYFA 3QEPA 4DTUA 1TGOA 4NCAA 1CZ9A 2KTQA 1JLFA 3SPZA 5J2QA 1S9EA 1N5YA 1L3TA 1NK8A 3RMAA 1J9AA 3HSTB 3NF9A 3O4NA 4O5BA 4CGJA 3L2QA 1XHXA 3IRXA 4E7KA 1JLAA 3U3YA 2A1RA 3RWUA 3K57A 2B6AA 1N6QA 4E7JA 4M3ZA 3T3FA 3ISNC 4CJ4A 4CK1A 4OVLA 1EKEA 1JL1A 1RDDA 4O55A 3ZSWA 3MEDA 1U4BA 4FK4A 2DY4A 1WSFA 4DU3A 3QLHA 1EX4A 2VG7A 4DU1A 3QNOA 3LWMA 3ZT3A 4AHRA 3PX0A 4RW4A 2XY6A 1SKWA 3AA3A 2GBZA 1BGXT 1RT6A 4DSLA 1RTHA 4Z0UA 4KHQA 3VQ7A 1DTTA 4CEDA 4ID5A 4N56A 3QESA 4B9TA 1RT7A 3HPHA 4QAGA 3OYAA 4F2SA 3V1RA 4CJQA 1WN7A 3SQ0A 2HNDA 3HVRA 1GOCA 1NJXA 4PWDA 2GUIA 4J2DA 4FJIA 2ITGA 2XHBA 4KTWA 3FFIA 3UIQA 3VQQA 5DMRA 1W0HA 1J54A 4OLAA 5J2PA 3LZIA 1HQUA 1KVAA 2F96A 1WAJA 1IKVA 4IBNA 4DQIA 4PUOA 3AVMA 1HYZA 4N41A 3HK2A 4DQPA 4KHWA 5SWMA 4CIGA 1NOYA 1RBVA 4DS4A 4BWMA 3MXIA 3LALA 1EP4A 3OJSA 1XHZA 2WONA 3U6FA 1S6PA 3CFOA 4J2AA 1NK0A 4CHPA 4OPKA 3K5LA 1JXEA 4FJ5A 1SV5A 1VSJA 3OS0A 3OY9A 2Y1JA 4FYDA 4TSXA 4ID1A 3NDKA 5KI6A 3B6PA 3BDPA 3OS1A 3AVBA 4CGHA 3K58A 4FJMA 3K2PA 1I39A 4W5RA 4RW6A 3OYMA 4JS5A 4CCHA 3DLGA 2FBXA 4GW6A 4MFBA 5C24A 4FLVA 5DK5A 3HXMA 1C0TA 2YHAA 4LY7A 3VQ6A 4DF4A 4B9MA 2F8SA 4CJUA 3NH0A 3VQEA 3LANA 3ZT0A 2OPSA 4B08A 1HNVA 3TI0A 4IKFA 3HJFA 4CJKA 3C95A 4MQ3A 1NK7A 4FW2A 1YTUA 5T7BA 4FJLA 1TKXA 4M42A 4GVMA 3OYIA 3DI6A 1HMVA 4DSIA 1EXQA 1REVA 2Z1JA 3ALYA 1U45A 3QETA 2BGGA 5HRSA 3EY1A 1B9DA 1VRUA 4CGGA 3SUQA 3O3FA 1D9FA 1BIUA 2ETJA 3TR8A 4OJRA 1NOZA 4CHYA 4AH9A 5JS2A 4CEFA 1HYSA 3PY8A 1RT2A 2E6MA 3ZSOA 2G8KA 1WAFA 4FLUA 2Z1HA 4FVMA 3M8QA 3NF6A 2GV9A 3NGIA 3SQ2A 1NK6A 3QIPA 4FZZA 2DFFA 2O4GA 2IC3A 4CIEA 4DSJA 1NK4A 4W5TA 4CECA 3OYGA 5SZTA 4E89A 3WNFA 1RDCA 1IKWA 2DFEA 4RW8A 3NF8A 4BE2A 4FM1A 2QKBA 1B9FA 1LWFA 1VRTA 2HHVA 4BWJA 4KAZA 3SUOA 4KREA 4YFUA 1Z26A 3HYFA 3V6DA 2PZSA 1RBTA 2VWKA 3QEIA 1T7PA 4OLBA 4HHTA 2Y1IA 1VSEA 3AV9A 3K59A 4F4KA 1R0AA 3AVJA 1ZYQA 3VQ8A 3F73A 4EZ9A 4KFBA 4NYNA 4BDPA 2JLEA 3VQ9A 4FJJA 4NCBA 4DTMA 2X74A 4O44A 4RW9A 3ZSVA 4CERA 1DLOA 1TAQA 2YV0X 3OS2A 4O0IA 4B9LA 2A1SA 3HVTA 4C8MA 3PX4A 1ZBUA 1J5OA 3DYAA 3RRHA 1TAUA 3AA5X 2DFHA 4DWIA 4M45A 1QTMA 4DTRA 3CM5A 1YT3A 4HCBA 4DLEA 3K5MA 4CIFA 3S9HA 5KGWA 2KZZA 4CEBA 1C1CA 1Q8IA 4KHSA 3AVIA 1IH7A 2HNZA 4ELUA 3KK3A 3NBPA 2BE2A 2RPIA 1SL0A 1WSIA 2YNHA 3HT3A 3QO9A 1L3UA 1VSFA 3QEVA 1ASVA 3CFRA 5HP1A 4CJ5A 3OYNA 4DMNA 1BI4B 4NCGA 5HRNA 4ZTFA 1WSJA 1BHLA 1B92A 1C1AA 2D5RA 5E41A 3V9SA 3VQBA 1GOBA 4E1NA 3CG7A 4IFYA 4CK2A 3OYDA 4C8NA 2FBYA 3QERA 1LW2A 4BDZA 1UWBA 2XY5A 4M3UA 2G8WA 4B9VA 4FJ7A 4HUEA 4AILC 3OJUA 4FK0A 1RNHA 3P83D 1JXBA 3CQ8A 1SL1A 1VSDA 1SKRA 1RT5A 3MXJA 4I7FA 3ZSZA 4CJRA 5J1EA 1HJRA 2XY7A 1D9DA 3DLHA 4KB1A 1GOAA 3DRRA 1QSSA 4R5PA 4ZTJA 5I42A 1TK0A 3RR8A 4ELVA 1UA1A 1WSHA 3KK1A 1LAWA 4CEZA 4CESA 5CY4A 4W5OA 1QE1A 4CGIA 3QNNA 4KV8A 2YKNA 3TAQA 3V1OA 1QHTA 4KHYA 1C1BA 1X1PA 1WSGA 3T1AA 3EYZA 2HW3A 5KRSA 3V9WA 4EP4A 4OPJA 2OZSA 1NJWA 4CFCA 1DTQA 4BACA 1O1WA 3LDSA 1XC9A 1KRPA 2YNFA 3ITHA 4FLTA 4KPYA 3AVCA 3H08A 3SUPA 1QSLA 3NF7A 3AO4A 1VSIA 3C6UA 4HUGA 4IFVA 1JLCA 1HPZA 3KD5E 3ZT4A 3DRSA 1TV6A 2RN2A 4NYFA 1S9GA 3ZSYA 3P5JA 4FJ9A 3AVHA 5FDLA 1XI1A 3M8RA 3K5OA 1S1VA 1NK5A 4FJ8A 2X6SA 4CHNA 1YVUA 3TAMA 1ITGA 4AHUA 3LZJA 4IG0A 4FLXA 4DFMA 1NJYA 1NJZA 4FJHA 4Z4CA 1C0UA 3NH1A 4F2RA 1TL3A 1C6VA 4JRQA 4E19A 1RBSA 3PO5A 2I5JA 4M3WA 2KZMA 2RF2A 2KW4A 2P5GA 3HO1A 2HB5A 4AHCA 4FM0A 3LWLA 1RTJA 3NFAA 3KIOA 3VQDA 1LWCA 3OYKA 4Z4IA 4CFAA 4FCYA 3MECA 4DTSA 4W5QA 2VG5A 3RMBA 1C0MA 2YNIA 4CGFA 4BE1A 4E3SA 1U49A 4L8RB 3RTVA 2P5OA 4E0DA 3OYEA 1K6YA 4KI4A 4N5SA 4DFKA 4Z4EA 1FXXA 4HCCA 3AVLA 1RTIA 2D0AA 1I3AA 3KLIA 3HM9A 4DTNA 2G8UA 4BDYA 5FROA 4Z4GA 2O4IA 2D0CA 1UOCA 1F21A 4XIUA 4FZYA 4E7LA 4DQQA 3DOLA 4E7HA 4CFDA 1A5XA 3SV4A 3LAMA 3V9UA 5JS1A 4PA1A 1SL2A 4CF0A 1KLNA 3D45A 3CFPA 2HMIA 3QINA 2OZMA 2WOMA 3VN5A 4CEAA 3TABA 1J53A 3PV8A 4QCLA 4CJEA 4H4OA 3ZT2A 3SUNA 5HROA 3F9KA 3QEWA 2KFZA 1A5WA 1RBUA 3NE6A 4M3YA 2IOCA 2Z1GA 1TKZA 3HPOA 3L2VA 1U48A 1QS4A 1NK9A 3IAYA 2Z1IA 3B6OA 4CJPA 4CJ3A 3AA4A 4CF2A 4DSKA 4B3OA 2G8HA 2P1JA 4K8XA 3AVNA 4I9LA 1HNIA 3TAPA 2HVIA 1LWEA 3MEEA 3SPYA 1QQCA 4YNQA 3LP3A 3LPTA 3S3OA 1JLQA 2QK9A 1UA0A 2RKIA 3AO1A 1BCMA 5HRPA 1TKTA 3EZ5A 1NKCA 1QSYA 3SNNA 1BQNA 4FLWA 4QOZB 2DTUA 3KLFA 2ZD1A 1S1TA 4F3OA 4F3TA 3OYBA 1S1WA 3VQAA 3KD1E 3ZCMA 4KHUA 3I0RA 4CFBA 4FXDA 1LAVA 3VQ4A 3VA3A 4DTOA 4ICLA 4C8KA 3HP6A 2QXFA 3L3UA 4RW7A 1ZBLA 2X6NA 3RR7A 4CE9A 4JS4A 2XY8A 3CM6A 2YNGA 1NKBA 3DLRA 4EZ6A 2E4LA 1KVCA 1KSPA 2KFNA 3TAEA 2IDOA 2VWJA 5J2MA 4CJFA 3TANA 4ELTA 4LH5A 2HHWA 1VSHA 4Z4HA 3PX6A 3DM2A 3DLEA 1TKDA 3ZSXA 3AO3A 3OYCA 4C8OA 1JLEA 3K5NA 4CEOA 4PQUA 3RRGA 1VSKA 4DSFA 4BE0A 1RT1A 1TK5A 4G1QA 2AJQA 1IO2A 3IS9A 3VQ5A 5CYMA 3KLGA 4FJKA 4EP5A 2F8TA 2B4JA 3LP0A 1IG9A 4FK2A 1VSLA 4F8RA 3THVA 4E1MA 4KTZA 4KHNA 1LW0A 4OGEA 3KLEA 3PO4A 4DSEA 1BQMA 3L2RA 5J2NA 4CHQA 4W5NA 4LSNA 2OPPA 3M8PA 1BISA 1L5UA 4O4GA 1JLGA 4DS5A 3D0PA 1Y97A 4GMJB 3VA0A 3ASMA 1KFDA 2EHGA 3OYHA 3KJVA 1S6QA 3L2WA 4AHTA 3JSMA 4DF8A 3NGZA 4HTUA 4I2PA 3KKSA 5C42A 1G15A 1KTQA 3HPGA 3QIOA 5I3UA 4Q0BA 4Q5VA 3SI6A 1ZBIA 2JGUA 2YKMA 4C8LA 1CXQA 3I0SA 3HL8A 3OYLA 4B8CA 2G8VA 3TAFA 2OYQA 4O0JA 3LP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBV A;  3TWH A;  3DLB A;  3S3N A;  1ASW A;  1ZBH A;  1RIL A;  3M8S A;  4CJS A;  4IG3 A;  4B9U A;  2R7Y A;  3DLK A;  4FW1 A;  1RCH A;  4DFJ A;  3C94 A;  4LSL A;  2BDP A;  2QKK A;  4Y1D A;  1SKS A;  1TVR A;  3NAE A;  3NGY A;  1MU2 A;  4AHV A;  1YTA A;  1U47 A;  1JL2 A;  1X9S A;  4WE1 A;  4DU4 A;  4OKE A;  4N47 A;  3G10 A;  3KLH A;  2FBT A;  3DMJ A;  2W42 A;  1D5A A;  4KI6 A;  2YHB A;  3AO2 A;  1HQE A;  4FJN A;  2FC0 A;  1T03 A;  4K8Z A;  1W9H A;  5HLF A;  2HHT A;  4JLH A;  1T05 A;  4DTP A;  5CZ2 A;  3AVF A;  2G8I A;  3A2F A;  4FZX C;  2HHS A;  1RDA A;  2X78 A;  1NKE A;  4OKK A;  4FM2 A;  1FKP A;  1X9W A;  1Q9Y A;  3PUF A;  3LP2 A;  3TAR A;  2HHQ A;  4OGC A;  1RT3 A;  1SUQ A;  4LH4 A;  4KKO A;  3E01 A;  5KRT A;  4DG1 A;  3SV3 A;  4B9S A;  3SCX A;  4CK3 A;  2OPR A;  1BL3 A;  1VSM A;  1WSE A;  4M3X A;  2G8F A;  4HVJ A;  1KFS A;  4UQG A;  2BAN A;  5CYQ A;  3NHG A;  2PY5 A;  3C6T A;  4FJG A;  4KTQ A;  4PY5 A;  4FLZ A;  1FK9 A;  1Q9X A;  1JKH A;  4RG8 A;  1JLB A;  1KLM A;  5D3G A;  3AA2 A;  4CJW A;  3KK2 A;  4KB0 A;  5KTQ A;  4H4M A;  2XRI A;  3LAK A;  4J2B A;  3QEX A;  3G0Z A;  5CZ1 A;  4DQR A;  5FRN A;  2EX3 A;  2VG6 A;  2IAJ A;  4KO0 A;  4B8A B;  3L2U A;  3ULD A;  4LD0 A;  1X9M A;  1IKY A;  2P51 A;  3BGR A;  5HBM A;  1ZBF A;  5K14 A;  4CJV A;  1RDB A;  4FJX A;  2ATQ A;  4JRP A;  1RT4 A;  2HNY A;  3V1Q A;  2XO7 A;  1CLQ A;  1D8Y A;  4I2Q A;  4OKJ A;  3V81 A;  3SQ4 A;  1XWL A;  1KCF A;  1UAX A;  4M3R A;  4DQS A;  3MXM A;  3SYZ A;  3CYM A;  1HYV A;  5EU7 A;  4CJT A;  3SZ2 A;  2ZQB A;  2HHU A;  4Y1C A;  1KVB A;  3VQP A;  1S1U A;  3VQC A;  3O4Q A;  2B5J A;  4J2E A;  4CHZ A;  1RBR A;  4AHS A;  4CGD A;  5KGX A;  4I9Q A;  1L3V A;  1BCO A;  2HVH A;  3V4I A;  5HRR A;  4IDK A;  4DFP A;  1S5J A;  3RMD A;  3L3V A;  1BI4 A;  3HP9 A;  3ZT1 A;  3SQ1 A;  3MAQ A;  4CF9 A;  2PYJ A;  3DOK A;  3ZSQ A;  1A5V A;  2D0B A;  4B9N A;  4CEQ A;  1TK8 A;  1U04 A;  4CF1 A;  5C25 A;  3O3H A;  1VK0 A;  3OYJ A;  3U3G A;  3NH2 A;  3LPU A;  3O3G A;  1WNS A;  2IS3 A;  3T19 A;  4H8K A;  3WNE A;  1WLJ A;  2NUB A;  4E7I A;  4KRF A;  4ZHR A;  4CF8 A;  2KQ2 A;  1IKX A;  3IG1 A;  3V9Z A;  2E6L A;  4M41 A;  1L3S A;  1HRH A;  3JYT A;  3S3M A;  4DTJ A;  2IGI A;  1Z25 A;  3OVN A;  4Z4F A;  1RTD A;  1ASU A;  3WNG A;  4DLG A;  1S1X A;  3WNH A;  3L8B A;  1T8E A;  3ZSR A;  3RMC A;  1EET A;  4CJL A;  1TL1 A;  3AVG A;  3AVA A;  3P1G A;  3MEG A;  2PYL A;  3NCI A;  2ZE2 A;  1BIZ A;  1CXU A;  4FLY A;  2OA8 A;  3KTQ A;  4M3T A;  2LSN A;  5FRM A;  1CZB A;  3DRP A;  2Q3S A;  1LV5 A;  4HUF A;  3AO5 A;  3V9X A;  4CEE A;  3TAG A;  3AVK A;  3SJJ A;  1FKO A;  2HHX A;  4CHO A;  3I8D A;  4DTX A;  2OPQ A;  4N76 A;  3KKR A;  3OYF A;  3QEP A;  4DTU A;  1TGO A;  4NCA A;  1CZ9 A;  2KTQ A;  1JLF A;  3SPZ A;  5J2Q A;  1S9E A;  1N5Y A;  1L3T A;  1NK8 A;  3RMA A;  1J9A A;  3HST B;  3NF9 A;  3O4N A;  4O5B A;  4CGJ A;  3L2Q A;  1XHX A;  3IRX A;  4E7K A;  1JLA A;  3U3Y A;  2A1R A;  3RWU A;  3K57 A;  2B6A A;  1N6Q A;  4E7J A;  4M3Z A;  3T3F A;  3ISN C;  4CJ4 A;  4CK1 A;  4OVL A;  1EKE A;  1JL1 A;  1RDD A;  4O55 A;  3ZSW A;  3MED A;  1U4B A;  4FK4 A;  2DY4 A;  1WSF A;  4DU3 A;  3QLH A;  1EX4 A;  2VG7 A;  4DU1 A;  3QNO A;  3LWM A;  3ZT3 A;  4AHR A;  3PX0 A;  4RW4 A;  2XY6 A;  1SKW A;  3AA3 A;  2GBZ A;  1BGX T;  1RT6 A;  4DSL A;  1RTH A;  4Z0U A;  4KHQ A;  3VQ7 A;  1DTT A;  4CED A;  4ID5 A;  4N56 A;  3QES A;  4B9T A;  1RT7 A;  3HPH A;  4QAG A;  3OYA A;  4F2S A;  3V1R A;  4CJQ A;  1WN7 A;  3SQ0 A;  2HND A;  3HVR A;  1GOC A;  1NJX A;  4PWD A;  2GUI A;  4J2D A;  4FJI A;  2ITG A;  2XHB A;  4KTW A;  3FFI A;  3UIQ A;  3VQQ A;  5DMR A;  1W0H A;  1J54 A;  4OLA A;  5J2P A;  3LZI A;  1HQU A;  1KVA A;  2F96 A;  1WAJ A;  1IKV A;  4IBN A;  4DQI A;  4PUO A;  3AVM A;  1HYZ A;  4N41 A;  3HK2 A;  4DQP A;  4KHW A;  5SWM A;  4CIG A;  1NOY A;  1RBV A;  4DS4 A;  4BWM A;  3MXI A;  3LAL A;  1EP4 A;  3OJS A;  1XHZ A;  2WON A;  3U6F A;  1S6P A;  3CFO A;  4J2A A;  1NK0 A;  4CHP A;  4OPK A;  3K5L A;  1JXE A;  4FJ5 A;  1SV5 A;  1VSJ A;  3OS0 A;  3OY9 A;  2Y1J A;  4FYD A;  4TSX A;  4ID1 A;  3NDK A;  5KI6 A;  3B6P A;  3BDP A;  3OS1 A;  3AVB A;  4CGH A;  3K58 A;  4FJM A;  3K2P A;  1I39 A;  4W5R A;  4RW6 A;  3OYM A;  4JS5 A;  4CCH A;  3DLG A;  2FBX A;  4GW6 A;  4MFB A;  5C24 A;  4FLV A;  5DK5 A;  3HXM A;  1C0T A;  2YHA A;  4LY7 A;  3VQ6 A;  4DF4 A;  4B9M A;  2F8S A;  4CJU A;  3NH0 A;  3VQE A;  3LAN A;  3ZT0 A;  2OPS A;  4B08 A;  1HNV A;  3TI0 A;  4IKF A;  3HJF A;  4CJK A;  3C95 A;  4MQ3 A;  1NK7 A;  4FW2 A;  1YTU A;  5T7B A;  4FJL A;  1TKX A;  4M42 A;  4GVM A;  3OYI A;  3DI6 A;  1HMV A;  4DSI A;  1EXQ A;  1REV A;  2Z1J A;  3ALY A;  1U45 A;  3QET A;  2BGG A;  5HRS A;  3EY1 A;  1B9D A;  1VRU A;  4CGG A;  3SUQ A;  3O3F A;  1D9F A;  1BIU A;  2ETJ A;  3TR8 A;  4OJR A;  1NOZ A;  4CHY A;  4AH9 A;  5JS2 A;  4CEF A;  1HYS A;  3PY8 A;  1RT2 A;  2E6M A;  3ZSO A;  2G8K A;  1WAF A;  4FLU A;  2Z1H A;  4FVM A;  3M8Q A;  3NF6 A;  2GV9 A;  3NGI A;  3SQ2 A;  1NK6 A;  3QIP A;  4FZZ A;  2DFF A;  2O4G A;  2IC3 A;  4CIE A;  4DSJ A;  1NK4 A;  4W5T A;  4CEC A;  3OYG A;  5SZT A;  4E89 A;  3WNF A;  1RDC A;  1IKW A;  2DFE A;  4RW8 A;  3NF8 A;  4BE2 A;  4FM1 A;  2QKB A;  1B9F A;  1LWF A;  1VRT A;  2HHV A;  4BWJ A;  4KAZ A;  3SUO A;  4KRE A;  4YFU A;  1Z26 A;  3HYF A;  3V6D A;  2PZS A;  1RBT A;  2VWK A;  3QEI A;  1T7P A;  4OLB A;  4HHT A;  2Y1I A;  1VSE A;  3AV9 A;  3K59 A;  4F4K A;  1R0A A;  3AVJ A;  1ZYQ A;  3VQ8 A;  3F73 A;  4EZ9 A;  4KFB A;  4NYN A;  4BDP A;  2JLE A;  3VQ9 A;  4FJJ A;  4NCB A;  4DTM A;  2X74 A;  4O44 A;  4RW9 A;  3ZSV A;  4CER A;  1DLO A;  1TAQ A;  2YV0 X;  3OS2 A;  4O0I A;  4B9L A;  2A1S A;  3HVT A;  4C8M A;  3PX4 A;  1ZBU A;  1J5O A;  3DYA A;  3RRH A;  1TAU A;  3AA5 X;  2DFH A;  4DWI A;  4M45 A;  1QTM A;  4DTR A;  3CM5 A;  1YT3 A;  4HCB A;  4DLE A;  3K5M A;  4CIF A;  3S9H A;  5KGW A;  2KZZ A;  4CEB A;  1C1C A;  1Q8I A;  4KHS A;  3AVI A;  1IH7 A;  2HNZ A;  4ELU A;  3KK3 A;  3NBP A;  2BE2 A;  2RPI A;  1SL0 A;  1WSI A;  2YNH A;  3HT3 A;  3QO9 A;  1L3U A;  1VSF A;  3QEV A;  1ASV A;  3CFR A;  5HP1 A;  4CJ5 A;  3OYN A;  4DMN A;  1BI4 B;  4NCG A;  5HRN A;  4ZTF A;  1WSJ A;  1BHL A;  1B92 A;  1C1A A;  2D5R A;  5E41 A;  3V9S A;  3VQB A;  1GOB A;  4E1N A;  3CG7 A;  4IFY A;  4CK2 A;  3OYD A;  4C8N A;  2FBY A;  3QER A;  1LW2 A;  4BDZ A;  1UWB A;  2XY5 A;  4M3U A;  2G8W A;  4B9V A;  4FJ7 A;  4HUE A;  4AIL C;  3OJU A;  4FK0 A;  1RNH A;  3P83 D;  1JXB A;  3CQ8 A;  1SL1 A;  1VSD A;  1SKR A;  1RT5 A;  3MXJ A;  4I7F A;  3ZSZ A;  4CJR A;  5J1E A;  1HJR A;  2XY7 A;  1D9D A;  3DLH A;  4KB1 A;  1GOA A;  3DRR A;  1QSS A;  4R5P A;  4ZTJ A;  5I42 A;  1TK0 A;  3RR8 A;  4ELV A;  1UA1 A;  1WSH A;  3KK1 A;  1LAW A;  4CEZ A;  4CES A;  5CY4 A;  4W5O A;  1QE1 A;  4CGI A;  3QNN A;  4KV8 A;  2YKN A;  3TAQ A;  3V1O A;  1QHT A;  4KHY A;  1C1B A;  1X1P A;  1WSG A;  3T1A A;  3EYZ A;  2HW3 A;  5KRS A;  3V9W A;  4EP4 A;  4OPJ A;  2OZS A;  1NJW A;  4CFC A;  1DTQ A;  4BAC A;  1O1W A;  3LDS A;  1XC9 A;  1KRP A;  2YNF A;  3ITH A;  4FLT A;  4KPY A;  3AVC A;  3H08 A;  3SUP A;  1QSL A;  3NF7 A;  3AO4 A;  1VSI A;  3C6U A;  4HUG A;  4IFV A;  1JLC A;  1HPZ A;  3KD5 E;  3ZT4 A;  3DRS A;  1TV6 A;  2RN2 A;  4NYF A;  1S9G A;  3ZSY A;  3P5J A;  4FJ9 A;  3AVH A;  5FDL A;  1XI1 A;  3M8R A;  3K5O A;  1S1V A;  1NK5 A;  4FJ8 A;  2X6S A;  4CHN A;  1YVU A;  3TAM A;  1ITG A;  4AHU A;  3LZJ A;  4IG0 A;  4FLX A;  4DFM A;  1NJY A;  1NJZ A;  4FJH A;  4Z4C A;  1C0U A;  3NH1 A;  4F2R A;  1TL3 A;  1C6V A;  4JRQ A;  4E19 A;  1RBS A;  3PO5 A;  2I5J A;  4M3W A;  2KZM A;  2RF2 A;  2KW4 A;  2P5G A;  3HO1 A;  2HB5 A;  4AHC A;  4FM0 A;  3LWL A;  1RTJ A;  3NFA A;  3KIO A;  3VQD A;  1LWC A;  3OYK A;  4Z4I A;  4CFA A;  4FCY A;  3MEC A;  4DTS A;  4W5Q A;  2VG5 A;  3RMB A;  1C0M A;  2YNI A;  4CGF A;  4BE1 A;  4E3S A;  1U49 A;  4L8R B;  3RTV A;  2P5O A;  4E0D A;  3OYE A;  1K6Y A;  4KI4 A;  4N5S A;  4DFK A;  4Z4E A;  1FXX A;  4HCC A;  3AVL A;  1RTI A;  2D0A A;  1I3A A;  3KLI A;  3HM9 A;  4DTN A;  2G8U A;  4BDY A;  5FRO A;  4Z4G A;  2O4I A;  2D0C A;  1UOC A;  1F21 A;  4XIU A;  4FZY A;  4E7L A;  4DQQ A;  3DOL A;  4E7H A;  4CFD A;  1A5X A;  3SV4 A;  3LAM A;  3V9U A;  5JS1 A;  4PA1 A;  1SL2 A;  4CF0 A;  1KLN A;  3D45 A;  3CFP A;  2HMI A;  3QIN A;  2OZM A;  2WOM A;  3VN5 A;  4CEA A;  3TAB A;  1J53 A;  3PV8 A;  4QCL A;  4CJE A;  4H4O A;  3ZT2 A;  3SUN A;  5HRO A;  3F9K A;  3QEW A;  2KFZ A;  1A5W A;  1RBU A;  3NE6 A;  4M3Y A;  2IOC A;  2Z1G A;  1TKZ A;  3HPO A;  3L2V A;  1U48 A;  1QS4 A;  1NK9 A;  3IAY A;  2Z1I A;  3B6O A;  4CJP A;  4CJ3 A;  3AA4 A;  4CF2 A;  4DSK A;  4B3O A;  2G8H A;  2P1J A;  4K8X A;  3AVN A;  4I9L A;  1HNI A;  3TAP A;  2HVI A;  1LWE A;  3MEE A;  3SPY A;  1QQC A;  4YNQ A;  3LP3 A;  3LPT A;  3S3O A;  1JLQ A;  2QK9 A;  1UA0 A;  2RKI A;  3AO1 A;  1BCM A;  5HRP A;  1TKT A;  3EZ5 A;  1NKC A;  1QSY A;  3SNN A;  1BQN A;  4FLW A;  4QOZ B;  2DTU A;  3KLF A;  2ZD1 A;  1S1T A;  4F3O A;  4F3T A;  3OYB A;  1S1W A;  3VQA A;  3KD1 E;  3ZCM A;  4KHU A;  3I0R A;  4CFB A;  4FXD A;  1LAV A;  3VQ4 A;  3VA3 A;  4DTO A;  4ICL A;  4C8K A;  3HP6 A;  2QXF A;  3L3U A;  4RW7 A;  1ZBL A;  2X6N A;  3RR7 A;  4CE9 A;  4JS4 A;  2XY8 A;  3CM6 A;  2YNG A;  1NKB A;  3DLR A;  4EZ6 A;  2E4L A;  1KVC A;  1KSP A;  2KFN A;  3TAE A;  2IDO A;  2VWJ A;  5J2M A;  4CJF A;  3TAN A;  4ELT A;  4LH5 A;  2HHW A;  1VSH A;  4Z4H A;  3PX6 A;  3DM2 A;  3DLE A;  1TKD A;  3ZSX A;  3AO3 A;  3OYC A;  4C8O A;  1JLE A;  3K5N A;  4CEO A;  4PQU A;  3RRG A;  1VSK A;  4DSF A;  4BE0 A;  1RT1 A;  1TK5 A;  4G1Q A;  2AJQ A;  1IO2 A;  3IS9 A;  3VQ5 A;  5CYM A;  3KLG A;  4FJK A;  4EP5 A;  2F8T A;  2B4J A;  3LP0 A;  1IG9 A;  4FK2 A;  1VSL A;  4F8R A;  3THV A;  4E1M A;  4KTZ A;  4KHN A;  1LW0 A;  4OGE A;  3KLE A;  3PO4 A;  4DSE A;  1BQM A;  3L2R A;  5J2N A;  4CHQ A;  4W5N A;  4LSN A;  2OPP A;  3M8P A;  1BIS A;  1L5U A;  4O4G A;  1JLG A;  4DS5 A;  3D0P A;  1Y97 A;  4GMJ B;  3VA0 A;  3ASM A;  1KFD A;  2EHG A;  3OYH A;  3KJV A;  1S6Q A;  3L2W A;  4AHT A;  3JSM A;  4DF8 A;  3NGZ A;  4HTU A;  4I2P A;  3KKS A;  5C42 A;  1G15 A;  1KTQ A;  3HPG A;  3QIO A;  5I3U A;  4Q0B A;  4Q5V A;  3SI6 A;  1ZBI A;  2JGU A;  2YKM A;  4C8L A;  1CXQ A;  3I0S A;  3HL8 A;  3OYL A;  4B8C A;  2G8V A;  3TAF A;  2OYQ A;  4O0J A;  3LP1 A; 
#chains in the Genus database with same CATH topology
 2FBV A;  3TWH A;  1ASW A;  5CE3 A;  5DM7 L;  3GG4 A;  4M7Y A;  3SLC A;  1NU0 A;  4IG3 A;  1W97 L;  4KH5 A;  2R7Y A;  3DLK A;  4FW1 A;  1YXQ A;  3ATU A;  4DFJ A;  4JNE A;  2BDP A;  3VGM A;  2WTU A;  4NCB A;  1X9S A;  1U47 A;  1JL2 A;  3UB5 A;  5C0Y A;  4OKE A;  4LF4 K;  2HOE A;  1EWQ A;  4K8Z A;  2P9K B;  1W9H A;  5EOY A;  4H0T B;  4DTP A;  5GIN A;  3MCP A;  1N32 K;  3SBG A;  5M1N A;  4FM2 A;  1RT3 A;  3DXM B;  4KKO A;  5LMU K;  3VOV A;  3SV3 A;  2EWS A;  3SCX A;  4BVP A;  1HJO A;  4BG9 A;  5C2D A;  2IVO A;  4JHD A;  5KQ8 A;  5AFU H;  4M3X A;  4PKG A;  5CYQ A;  2P9L A;  2D4W A;  5ADX H;  3C7N A;  4IJA A;  4RG8 A;  1KLM A;  4BC3 A;  5I9E B;  2OTL N;  4EFH A;  3A5M C;  4J2B A;  4CW7 B;  3G0Z A;  5FRN A;  4KO0 A;  3ZEU B;  1QZ6 A;  1D8Y A;  4OKJ A;  1XWL A;  4C1N I;  5BR8 K;  5EY4 A;  1OVY A;  2V7Y A;  4JK8 A;  2B5J A;  3VGL A;  1FJG K;  1BUP A;  4AHS A;  1HNX K;  1L3V A;  3CIP A;  2QTD A;  5HRR A;  3L3V A;  1X3N A;  3G25 A;  3DOK A;  1ATS A;  2OCE A;  4CEQ A;  3O3H A;  3JS6 A;  3NH2 A;  3KVG A;  2IS3 A;  3SAG A;  2NUB A;  4CF8 A;  3V9Z A;  2Q31 A;  1L3S A;  1HRH A;  3JYT A;  2QWM A;  1Z25 A;  2P9P A;  3DXK B;  3WNH A;  3AAP A;  4YOT A;  5FRM A;  3SBT A;  2LSN A;  1GLL O;  3I55 N;  5AQP A;  1LV5 A;  3V9X A;  3CJ9 A;  1FKO A;  4I6M A;  2HHX A;  3CI5 A;  4DTX A;  4IEI A;  4MO5 A;  3E9O A;  4N76 A;  3KKR A;  1CZ9 A;  3O8M A;  5J2Q A;  4JKF A;  4CGJ A;  3VEV A;  3O4N A;  3L2Q A;  3MK6 A;  2ZGY A;  1EKE A;  1JL1 A;  3ZSW A;  3MED A;  2DY4 A;  1EX4 A;  5GAE P;  3H45 C;  4RW4 A;  1RTH A;  4Z0U A;  1NGF A;  3VQ7 A;  1NGJ A;  4ID5 A;  4FL9 A;  2ZJP L;  3CJ7 A;  2W6L A;  1VQ4 N;  4KTW A;  3ZET A;  4OLA A;  5AZI B;  3NMU A;  4PUO A;  4IBN A;  1HYZ A;  4N41 A;  3HK2 A;  4DQP A;  4KHW A;  1YJN N;  1NOY A;  1RBV A;  3QB0 A;  3R6M A;  4UY8 O;  3K5L A;  4FJ5 A;  1VSJ A;  5AQS A;  3C6H A;  4QS8 A;  3THX A;  3K58 A;  4FJM A;  4W5R A;  3K9J A;  4CCH A;  3L0Q A;  2FBX A;  1C0T A;  2YHA A;  3NH0 A;  5EVZ A;  4B3M K;  4CVN E;  3ENB A;  4JN4 A;  4IKF A;  4MQ3 A;  2E2Q A;  3U4L A;  4GVM A;  5H1S Q;  2E8A A;  3FZM A;  3MWP A;  3ALY A;  4WQ4 C;  1J6Z A;  3J8A A;  1B9D A;  4CGG A;  2E1Y A;  4YDU A;  3TR8 A;  3W3D A;  4K25 A;  5JS2 A;  4AH9 A;  1HYS A;  3PY8 A;  4DR5 K;  1RT2 A;  2QXL A;  2E2O A;  5LMN K;  4JYA K;  3KWI A;  2GV9 A;  4B1V A;  3IUC A;  1D4X A;  2A6A A;  3EKU A;  4MO4 A;  2DFE A;  4FM1 A;  1C0G A;  1B9F A;  4KRE A;  4J8F A;  2GTD A;  2E5L K;  1NMN A;  1RBT A;  2Y1I A;  4F4K A;  1R0A A;  3F9M A;  4BQL A;  3AGK A;  1HUX A;  4BVO A;  2JLE A;  3VQ9 A;  2X74 A;  4O44 A;  4RW9 A;  3O9R A;  3E1Y A;  3HVT A;  3BEX A;  5AQK A;  5BRH A;  3TSP A;  5E84 A;  1BU6 O;  4HCB A;  4O5F A;  4ISG A;  3K5M A;  2F9W A;  4CEB A;  1Q8I A;  3G4S N;  3H3N O;  1SL0 A;  1WSI A;  5AZJ B;  2NRW A;  3QO9 A;  1L3U A;  2FF3 B;  5HP1 A;  3CET A;  4DMN A;  1BI4 B;  4ZTF A;  1C1A A;  4FSV A;  4BR4 A;  1IBL K;  3OYD A;  1HNZ K;  4H5T A;  1W7A A;  4F9O A;  2VYP A;  3QER A;  4M3U A;  4AIL C;  1VAZ A;  3O08 A;  4U7B A;  1SL1 A;  3UE5 A;  3ZSZ A;  4BGA A;  1BG3 A;  2I7N A;  3DXM A;  4H0Y B;  1GOA A;  1QSS A;  3DLH A;  2Q0R A;  3ENO A;  3TTD A;  3RR8 A;  4BRP A;  3R9P A;  5CY4 A;  4CGI A;  4KV8 A;  3V1O A;  1QHT A;  4BRL A;  3T1A A;  4WF9 L;  5KRS A;  2OZS A;  4CFC A;  4DV5 K;  1O1W A;  3HI0 A;  1XC9 A;  1KRP A;  2YNF A;  4FLT A;  4KPY A;  3AVC A;  3AO4 A;  1VSI A;  3C6U A;  3P5J A;  1XI1 A;  3M8R A;  4FJ8 A;  2OZM A;  4LF5 K;  3LM2 A;  1NJZ A;  1C0U A;  3ZYY X;  4M3W A;  4JRQ A;  1RBS A;  5CHI A;  3HO1 A;  4AHC A;  3LWL A;  3VQD A;  3KIO A;  1LWC A;  2AA4 A;  2UYT A;  4CFA A;  1MDU B;  4CZF A;  3A0I X;  3FFK B;  4L8R B;  1C0M A;  1O13 A;  1ILY A;  4HCC A;  4BRF A;  4DTN A;  4NLC A;  4WQ5 C;  5FRO A;  2D0C A;  1UOC A;  4IDH A;  3NVK A;  4BRE A;  1A5X A;  3D2F B;  3DXK A;  5AQZ A;  4CFD A;  3KHY A;  3BP8 A;  4K42 A;  3TPQ A;  2HMI A;  4DB3 A;  2Q2R A;  4QCL A;  4H4O A;  3ZT2 A;  3SUN A;  5HRO A;  3F9K A;  2KFZ A;  5AQG A;  3CJA A;  4JI2 K;  4M3Y A;  5AQV A;  1TKZ A;  1U48 A;  1QS4 A;  4H0O A;  4KHP K;  3H1Q A;  4IZ9 A;  4K8X A;  3AVN A;  4I9L A;  1HNI A;  3TAP A;  1LWE A;  4B1U B;  3SPY A;  2HBK A;  4JD2 B;  1GLB G;  1UA0 A;  3THW B;  3AO1 A;  1MWK A;  3EZ5 A;  1NKC A;  1BQN A;  3QBX A;  4FLW A;  2DTU A;  2PAV A;  4CZM A;  4JKA A;  4F3T A;  4CFB A;  4FXD A;  4ICL A;  4C8K A;  3HP6 A;  4DHY A;  3O5B A;  1EQY A;  2XY8 A;  2YNG A;  4JKH A;  2E4L A;  3HRG A;  2J4R A;  2YX6 A;  3GL1 A;  5AQQ A;  5BRD A;  4ELT A;  3T7Z A;  4M63 C;  2HHW A;  4B3T K;  5GAG P;  1TKD A;  3OYC A;  4C8O A;  5AQN A;  3K5N A;  3RRG A;  5AZI A;  3IS9 A;  3KLG A;  3LDN A;  3I56 N;  4EP5 A;  1N33 K;  4FK2 A;  3P4I A;  4E1M A;  4KTZ A;  3PO4 A;  2F9T A;  4DSE A;  3L2R A;  4FWP A;  1JLG A;  3MDQ A;  3Q7C A;  4HTU A;  3OW2 M;  1TUU A;  5I3U A;  1NBW A;  4Q0B A;  4ISF A;  3SI6 A;  2JGU A;  3HL8 A;  2G8V A;  2OYQ A;  3LP1 A;  3S3N A;  2Q0U A;  1RIL A;  1Q86 O;  5GAD P;  1RCH A;  4B1Z A;  1H1V A;  4Y1D A;  1TVR A;  3NGY A;  4AHV A;  3DMJ A;  2W42 A;  4FJN A;  2A40 A;  3AO2 A;  2FC0 A;  2G8I A;  4FZX C;  3S41 A;  1NKE A;  3WUH A;  4OKK A;  1FKP A;  1X9W A;  3TSQ A;  3PUF A;  1ZBS A;  4BGB A;  3TAR A;  1Q9Y A;  1SUQ A;  3E01 A;  4B9S A;  4CK3 A;  2QW9 A;  1WSE A;  3FGU A;  5M1Q A;  2G8F A;  1KFS A;  4KTQ A;  1BO5 O;  3O1B A;  4FLZ A;  1FK9 A;  3AA2 A;  2E2N A;  4H4M A;  2XRI A;  5M1O A;  5KTQ A;  1KD1 O;  3LAK A;  3CCJ N;  2RE2 A;  1IBM K;  2P51 A;  3BGR A;  5JLF A;  4FJX A;  2HNY A;  4BRC A;  3EE9 A;  1CLQ A;  4I2Q A;  4M3R A;  1KAZ A;  4DQS A;  3SYZ A;  3CYM A;  2HHU A;  1NGC A;  2E1Z A;  4Y1C A;  1KVB A;  3VQC A;  2CH6 A;  4CHZ A;  3QFP A;  5M1P A;  4CGD A;  4I9Q A;  3ZLJ A;  4PKI A;  3EL2 A;  1S5J A;  1BI4 A;  1GLF O;  2CH5 A;  3HP9 A;  3ZT1 A;  2A5X A;  5BPM A;  2D0B A;  1U04 A;  3E9L A;  3OYJ A;  1MA9 B;  4JKG B;  3MX5 A;  4B1W B;  3EKS A;  4BY9 C;  3WNE A;  1WLJ A;  4M41 A;  3S3M A;  4DTJ A;  1XNQ K;  1RTD A;  3WNG A;  4R79 A;  4IJN A;  3RMC A;  3P1G A;  3AVA A;  1VQ5 N;  2NRH A;  2PYL A;  3KTQ A;  3DRP A;  3RSE B;  4CEE A;  3SJJ A;  3VPZ A;  1N8R O;  3I8D A;  4DV2 K;  4JKD A;  5JVH L;  5LL6 Z;  1JLF A;  4CZI A;  3MN7 A;  4EHT A;  1L3T A;  2P9I B;  1NK8 A;  1J9A A;  3SJH A;  3M1F A;  1ZBH A;  2ITM A;  3K57 A;  2B6A A;  4CBX A;  3VMF B;  3VEX A;  4CK1 A;  1RDD A;  1YVN A;  4JI6 K;  4DU3 A;  3QLH A;  2VG7 A;  3T1H K;  3QNO A;  3LWM A;  2XY6 A;  3HPH A;  4CJQ A;  4FOI A;  3HVR A;  1GOC A;  4FWM A;  1K8A O;  2YHW A;  2GUI A;  4FJI A;  3FFI A;  1M90 O;  3UIQ A;  1J54 A;  3LZI A;  1J5E K;  4X62 K;  1TUY A;  3QIC A;  3AVM A;  1Q7Y O;  1YIJ N;  3D2F A;  1VQO N;  3CXC M;  3LAL A;  3OJS A;  1DT9 A;  3U6F A;  4J2A A;  3CHW A;  2VQF K;  3OS0 A;  3OY9 A;  3NDK A;  4ID1 A;  3F2K A;  3BDP A;  3MN9 A;  3AVB A;  4CGH A;  3ULE A;  3OYM A;  5JLH A;  2QA4 N;  4GW6 A;  4FLV A;  5DK5 A;  2O8D A;  4LY7 A;  4DF4 A;  2F8S A;  1VQ6 N;  3D2E B;  3LAN A;  2OPS A;  1ZC6 A;  5IT9 O;  4BR0 A;  4B08 A;  5AQX A;  4CJK A;  3C95 A;  5T7B A;  3OYI A;  4BRK A;  1REV A;  3VTH A;  4AF1 A;  2BGG A;  3QET A;  5JMV A;  1VRU A;  3O3F A;  4CHY A;  4DUZ K;  4CEF A;  4CD1 A;  2E6M A;  3ZSO A;  1WAF A;  2OTJ N;  2W41 A;  4LFA K;  4FVM A;  2O4G A;  4CIE A;  4DSJ A;  1NK4 A;  5TKY A;  3WEE A;  1K9M O;  5SZT A;  3WNF A;  1RDC A;  1IKW A;  4RW8 A;  3VGK A;  3CQX A;  3NF8 A;  4BE2 A;  1NJI O;  1VRT A;  2HHV A;  4BWJ A;  2PZS A;  3QEI A;  2F4V K;  3DAW A;  2O8F A;  3K59 A;  3EZW A;  4CD3 A;  1FW6 A;  1V4S A;  3VQ8 A;  4BDP A;  2CGK A;  3J81 O;  1DLO A;  3HTV A;  4O0I A;  1BA1 A;  3WT0 A;  4B9L A;  1ZBU A;  3DYA A;  1E4G T;  2P9U B;  4M45 A;  5AJ3 K;  2GUP A;  3ZX3 A;  2NRV A;  1MWM A;  1U6Z A;  4CIF A;  4C1N K;  2O8E A;  3AVI A;  1IH7 A;  3KK3 A;  1NGE A;  2BE2 A;  5F0X A;  3LM9 A;  3HT3 A;  2UXC K;  1VSF A;  3QEV A;  1ASV A;  3C65 A;  3TTC A;  4DV3 K;  1BHL A;  2UUC K;  1GOB A;  4E1N A;  5AR0 A;  4IFY A;  1HPM A;  4JI4 K;  2HST A;  1UWB A;  4BDZ A;  4B9V A;  4FJ7 A;  3OA9 A;  1KXP A;  2NLX A;  4FK0 A;  2DPN A;  3UKU B;  4Z94 A;  3CQ8 A;  1RT5 A;  4CJR A;  2XY7 A;  3M3Z A;  1D9D A;  4KB1 A;  4CZJ A;  4ELV A;  3KK1 A;  1WUA A;  3C0B A;  1QE1 A;  3QNN A;  2YKN A;  3CMA N;  1X1P A;  2HW3 A;  1GLJ O;  4JKC A;  4GNI A;  2ASP A;  1DTQ A;  4XH4 A;  4IOA L;  4GKJ K;  4IO8 A;  3SUP A;  2WUS A;  3NF7 A;  5FPD A;  3CCU N;  4X65 K;  4JI0 K;  3QML A;  4IFV A;  1JLC A;  3EN9 A;  1TV6 A;  2RN2 A;  4NYF A;  4FJ9 A;  3AVH A;  4JAX A;  3C6A A;  1NJY A;  4AHU A;  3CQY A;  1V4T A;  2KZM A;  4OPA A;  3A8Y A;  2RF2 A;  2KW4 A;  5LJV A;  2VGN A;  4WFA L;  2NZT A;  5M1K A;  3NFA A;  5KQD A;  3OYK A;  4IOC L;  1SS6 A;  1K8K B;  4IOX A;  4CZL A;  4W5Q A;  2HHH K;  2HMP A;  3RMB A;  3CCQ N;  4BE1 A;  4E0D A;  4FWN A;  4N5S A;  1FXX A;  2QWQ A;  3FLC O;  3UKR B;  1I3A A;  4B3S K;  3HM9 A;  4Z4G A;  4BDY A;  4FZY A;  3BUZ B;  1GLE G;  4FPA A;  4H03 B;  3V9U A;  5JS1 A;  3D7E O;  3JXU A;  1SL2 A;  3QIN A;  2WOM A;  4LFB K;  1J53 A;  3PV8 A;  4V19 S;  1A5W A;  1RBU A;  4A62 A;  1NK9 A;  4DSK A;  4B3O A;  2HVI A;  4YNQ A;  1VQN N;  2P9I A;  3TSU A;  2QK9 A;  5IWA K;  2RKI A;  3TTF A;  4DR2 K;  3CCE N;  1S1T A;  1S1W A;  3VQA A;  4KHU A;  3O9T A;  2JWL A;  1LAV A;  3VA3 A;  4RW7 A;  1ZBL A;  2X6N A;  2NNW A;  1IV0 A;  2AP1 A;  4YDU C;  3DLR A;  3K0S A;  3VER A;  2IDO A;  4Z4H A;  3PX6 A;  2UUB K;  3DLE A;  3ZSX A;  3AO3 A;  5JIC A;  2FSK A;  1VSK A;  4DSF A;  1TK5 A;  4G1Q A;  3FZF A;  2P9K A;  3A5O C;  2B4J A;  1IG9 A;  1VSL A;  4OGE A;  5J2N A;  4CHQ A;  5TKW A;  3M8P A;  1L5U A;  4DS5 A;  3VA0 A;  3OYH A;  1KFD A;  3KJV A;  1S6Q A;  4DF8 A;  3OBY A;  1NM1 A;  2A42 A;  3MWT A;  1G15 A;  1KTQ A;  3QIO A;  1GLC G;  4Q5V A;  1ZBI A;  2YKM A;  3VES A;  4BRI A;  1CXQ A;  3QBW A;  4B8C A;  3D2E A;  4O0J A;  2A41 A;  1HKG A;  1NGH A;  2NRT A;  5AQW A;  4CJS A;  1QQM A;  3HZ6 A;  5A2Q O;  3ZEU A;  1OH7 A;  1HKC A;  4LSL A;  2QKK A;  1SKS A;  1MU2 A;  2QEX N;  3W0L A;  4DU4 A;  1QVF M;  5AQH A;  3IDH A;  5MLC Q;  3KLH A;  2FBT A;  4KI6 A;  2YHB A;  5KPZ A;  4DQ8 A;  4CI6 A;  5HLF A;  4JLH A;  3EEQ A;  5CZ2 A;  5BN8 A;  3KK7 A;  2WFB A;  3A2F A;  1VQP N;  1RDA A;  3CC4 N;  3LDO A;  2FF6 A;  2HHQ A;  3VEW A;  4LH4 A;  3VET A;  3OTO K;  5C2F A;  1S72 N;  2P9S B;  5FPM A;  5ADX A;  4HVJ A;  3J7Y P;  4UQG A;  1DGK N;  4IFE A;  4DV6 K;  1Q9X A;  1JKH A;  1JLB A;  5D3G A;  4LF7 K;  1KAX A;  4DV0 K;  2VG6 A;  3IKM A;  2IAJ A;  4LD0 A;  1SAZ A;  2P9U A;  1ZBF A;  4CJV A;  2ATQ A;  1RT4 A;  2XO7 A;  2HF4 A;  3V81 A;  2Q36 A;  1HR0 K;  1ESV A;  4JEP A;  5EU7 A;  4CJT A;  3SZ2 A;  1S1U A;  4J2E A;  5BPL A;  5KGX A;  1BCO A;  3CER A;  2HVH A;  3CPW M;  3EO3 A;  4DFP A;  3RMD A;  3IFR A;  4AM6 A;  4CF9 A;  2PYJ A;  4BC4 A;  1BOT O;  3L6Q A;  1A5V A;  4B9N A;  4FWK A;  5C25 A;  1M1K O;  4JKE A;  1VK0 A;  3WXL A;  3LPU A;  1NGD A;  3T19 A;  4H8K A;  4K0K K;  1YF5 L;  4ZHR A;  4JKB A;  4JHD B;  4FWQ A;  3UKU A;  4JI8 K;  1QQN A;  2P9L B;  4MLH A;  3CCM N;  4JI3 K;  4DLG A;  1S1X A;  4OPH A;  5DM6 L;  1T8E A;  1I94 K;  1EET A;  1EO1 A;  1VQ9 N;  1CXU A;  2OA8 A;  2Q97 A;  4M3T A;  2FSN A;  4BRA A;  4HUF A;  3AO5 A;  3MN6 A;  3TAG A;  3SAH A;  5M1F A;  4CHO A;  2OPQ A;  3QFU A;  2HBJ A;  5E26 A;  3QEP A;  4NXN K;  4NCA A;  2KTQ A;  2ZM6 K;  3SPZ A;  1S9E A;  2QWL A;  4O5B A;  3HST B;  3U3Y A;  1QHA A;  2KFN A;  3IRX A;  4E7K A;  3RWU A;  1OH8 A;  4M3Z A;  1QQO A;  3DWL A;  4OVL A;  4FK4 A;  1U4B A;  1ATN A;  2O8B B;  3R3L A;  4BG8 A;  4DU1 A;  5AQY A;  3ZT3 A;  4AHR A;  3CF5 L;  4FVU A;  4DV4 K;  1NMD A;  1RT6 A;  4KHQ A;  4N56 A;  3QES A;  3OYA A;  4F2S A;  3V1R A;  2ZJR L;  1K8K A;  1RGI A;  1C0F A;  2HND A;  2IIR A;  4J2D A;  2ITG A;  1RDU A;  2XHB A;  3WQT A;  4RCH A;  1HQU A;  1K73 O;  1WAJ A;  1IKV A;  4JI5 K;  1NG9 A;  5SWM A;  4CIG A;  3RVC A;  4WCE L;  3MXI A;  1EP4 A;  4XH5 A;  1HNW K;  1S6P A;  3DJC A;  5F1X A;  2KKZ A;  3FR0 A;  5AQF A;  1N36 K;  3QDK A;  2Y1J A;  3THY B;  2ASO A;  4TSX A;  5KI6 A;  1SQK A;  3HSC A;  4GV3 A;  1I39 A;  4JS5 A;  2IVN A;  1NGG A;  3DLG A;  3Q7B A;  5C24 A;  3HXM A;  3VQ6 A;  4B9M A;  4CJU A;  4YOX A;  1RDW X;  3VQE A;  3CCR N;  3FZL A;  5HL7 L;  3TI0 A;  2FXU A;  3WXI A;  4L3Q A;  4DUY K;  4YY3 K;  4FW2 A;  4FJL A;  4DSI A;  1HMV A;  1EXQ A;  2Z1J A;  2IVP A;  3OBW A;  4ISE A;  5HRS A;  3EY1 A;  2QM1 A;  3SUQ A;  1D9F A;  4JI1 K;  1VQ8 N;  4B9Q A;  2ETJ A;  3ZET B;  4O8K A;  2ZF5 O;  4A5B A;  3MCA B;  4WFB L;  5AZJ A;  3NF6 A;  4FZZ A;  1NK6 A;  2DFF A;  4YOU A;  4W5T A;  4CEC A;  3OYG A;  3R1X A;  4BRO A;  4E89 A;  1W2B M;  1R59 O;  1LWF A;  2HBL A;  2V51 B;  4BC2 A;  3MMV A;  3HBT A;  3SUO A;  4YFU A;  1Z26 A;  3V6D A;  2VWK A;  3VEY A;  4OLB A;  4LC9 B;  3B8A X;  3HOT A;  4KH6 A;  5LJW A;  3O1W A;  3CC2 N;  4LF8 K;  4EZ9 A;  4KFB A;  4NYN A;  3AAQ A;  5HOO A;  4EHU A;  4FJJ A;  4DTM A;  1JCF A;  4ILJ A;  3ZSV A;  3CJ1 A;  2GEM A;  1TAQ A;  3CPE A;  4C23 A;  2A1S A;  4C8M A;  1TAU A;  3PX4 A;  3CCS N;  3RRH A;  3AA5 X;  2DFH A;  4DWI A;  3BY5 A;  4DTR A;  1YT3 A;  1WBB A;  4DLE A;  4PL7 A;  3WQU A;  4PKH A;  3S9H A;  4A2B A;  2KZZ A;  2D1K A;  1TYQ B;  3M6G A;  2HNZ A;  4ELU A;  3NBP A;  2RPI A;  2YNH A;  2VCP A;  1S3X A;  2KLA A;  1IBK K;  4BRH A;  5AQU A;  4CJ5 A;  4IXC A;  5AQI A;  2PFU A;  3P38 A;  3OYN A;  3WXM B;  1WSJ A;  5E41 A;  3V9S A;  3K9K A;  3U9D A;  3P39 A;  4CK2 A;  2FBY A;  1LW2 A;  1CZA N;  3OJU A;  5GIP A;  1JXB A;  3J80 O;  4KBO A;  1YJ9 N;  1VSD A;  3MXJ A;  5J1E A;  1HJR A;  2P9S A;  4R5P A;  4ZTJ A;  5I42 A;  1TK0 A;  1Q81 O;  1LAW A;  4CEZ A;  4CES A;  3EE8 A;  2WC9 A;  3EYZ A;  3I33 A;  4EP4 A;  4OPJ A;  1NJW A;  1RFQ A;  4BAC A;  1X3M A;  3LDS A;  3PSI A;  3ITH A;  4HTL A;  1XMQ K;  3E66 A;  3JAM O;  1IG8 A;  1T3V A;  4HUG A;  1HPZ A;  4H0X B;  4CBW A;  3ZT4 A;  1U2V B;  1YIT N;  5FDL A;  5BR9 A;  4BRQ A;  1NK5 A;  4CHN A;  3TAM A;  5ELZ A;  4FJH A;  4IG0 A;  4ILH A;  4FLX A;  4DFM A;  3BZK A;  3NH1 A;  4JD2 A;  1Y64 A;  2RHK A;  1TL3 A;  1C6V A;  1YHQ N;  4CZK A;  2I5J A;  3THW A;  2P5G A;  4BR9 A;  4A2A A;  3CCL N;  1P8Z A;  4Z4I A;  5BN9 A;  3MEC A;  4A57 A;  3ATV A;  1NNE A;  4DTS A;  4H5R A;  2VG5 A;  2YNI A;  4BRD A;  1Q18 A;  3RTV A;  4KI4 A;  3OYE A;  1K6Y A;  4Z4E A;  2KHO A;  3AVL A;  1RTI A;  2G8U A;  3ID6 A;  2O4I A;  4XIU A;  3CD6 N;  4E7L A;  4NXM K;  3SV4 A;  3LDP A;  1LCU A;  5B8H A;  1KLN A;  1HX1 A;  4CEA A;  1GLA G;  4BRG A;  3TAB A;  1JJ2 M;  2NRX A;  5BRE A;  5CR4 A;  4HWI A;  3QEW A;  4CZG A;  2IOC A;  3HPO A;  2UU9 K;  3B6O A;  4CJ3 A;  3AA4 A;  4GY2 B;  2PBD A;  4YOR A;  4MDA A;  4IO9 L;  3MEE A;  3SMP A;  1JLQ A;  3KZB A;  1BCM A;  2VWB A;  2QWN A;  3SNN A;  1QSY A;  3FE1 A;  4H0V B;  3AAR A;  3KLF A;  2O8B A;  3OYB A;  3KD1 E;  2QWR A;  3LDL A;  3I0R A;  1P90 A;  3G6E N;  4DTO A;  2QXF A;  3F5T A;  3L3U A;  3RR7 A;  4JS4 A;  2ZJQ L;  1KSP A;  2E88 A;  3TAE A;  4CJF A;  4O8U A;  3DM2 A;  5C10 A;  5AQJ A;  4H0P A;  4CEO A;  4PQU A;  1XC3 A;  2QWP A;  4IWV A;  1RT1 A;  2AJQ A;  2BH1 A;  3VQ5 A;  2CGJ A;  4E1J A;  2V7Z A;  3THV A;  1LW0 A;  3KWG A;  1BQM A;  3NVM A;  4LSN A;  4GKK K;  3THY A;  1Y97 A;  1SZ2 A;  4GMJ B;  2EHG A;  3L2W A;  3NGZ A;  4I2P A;  3KKS A;  3O80 A;  4XH1 A;  5AQL A;  1QVG M;  4C8L A;  3VEO A;  3TAF A;  4CJ7 A;  4MLE A;  3DLB A;  2VGM A;  2P9N B;  1XUP O;  3M8S A;  3T1Y K;  3O9U A;  4FWL A;  4B9U A;  2BUP A;  4WQ4 A;  3C94 A;  3NAE A;  1YTA A;  4XEI A;  4WE1 A;  3N4P A;  4N47 A;  3G10 A;  1JCG A;  4OX9 K;  4BR7 A;  1D5A A;  1HQE A;  1T03 A;  3CCV N;  2HHT A;  4JV5 K;  4PL8 A;  1XMO K;  3WXK A;  1T05 A;  3AVF A;  2HHS A;  2X78 A;  2WBN A;  3LP2 A;  4OGC A;  1E4F T;  1KQS M;  5AQM A;  5KRT A;  4JKG A;  4DG1 A;  1HLU A;  1Q82 O;  2OPR A;  1BL3 A;  1VSM A;  2CGL A;  2V52 B;  2BAN A;  3NHG A;  2PY5 A;  3C6T A;  4FJG A;  4PY5 A;  1VQ7 N;  2O8C B;  4CJW A;  3KK2 A;  3FZH A;  4WYB A;  4KB0 A;  3QEX A;  5CZ1 A;  4DQR A;  2EX3 A;  4B8A B;  3L2U A;  3ULD A;  1X9M A;  1HKB A;  1IKY A;  3PIP L;  5HBM A;  5K14 A;  1RDB A;  3RSE A;  4JRP A;  3V1Q A;  3SK3 A;  3SQ4 A;  3MXM A;  1KCF A;  1UAX A;  1HYV A;  4A5A A;  4BR5 A;  1TYQ A;  2ZQB A;  3VQP A;  5GAH P;  1GLD G;  3O4Q A;  4QS7 A;  1RBR A;  3V4I A;  4IDK A;  5BPN A;  4U67 L;  3GE1 A;  3SQ1 A;  3MAQ A;  3ZSQ A;  1TK8 A;  4CF1 A;  3U3G A;  1NGI A;  3O3G A;  1WNS A;  3AGR A;  4FWO A;  4E7I A;  4KRF A;  2E20 A;  2KQ2 A;  1IKX A;  3IG1 A;  2E6L A;  3TU5 A;  2QWO A;  2IGI A;  3OVN A;  4Z4F A;  4GVE A;  1ASU A;  3L8B A;  1Z6R A;  3ZSR A;  4CJL A;  1TL1 A;  3AVG A;  3O4W A;  3ENH A;  5AQR A;  3MEG A;  3NCI A;  3D6R A;  2Q1N A;  1BIZ A;  2ZE2 A;  4B1Y B;  3ZX0 A;  4FLY A;  2HF3 A;  4GV6 A;  1CZB A;  1BDG A;  2Q3S A;  3AVK A;  3PLA A;  4YOW A;  2ZGZ A;  2QI2 A;  2ZWH A;  3OYF A;  4DTU A;  1TGO A;  4FWS A;  4AM7 A;  4YOY A;  5JVG L;  1N5Y A;  3DLL L;  4A61 A;  3HOS A;  3NF9 A;  1U2V A;  3RMA A;  2A1R A;  5EX5 A;  1XHX A;  1JLA A;  3CJB A;  1N6Q A;  1VQM N;  4E7J A;  1YI2 N;  3T3F A;  3ISN C;  4CJ4 A;  3O9Q A;  4O55 A;  1WSF A;  4A59 A;  4M7X A;  3J7Z O;  1SKW A;  3PX0 A;  3AA3 A;  2GBZ A;  1BGX T;  4KH4 A;  4DSL A;  2OAN A;  3J7A P;  1DTT A;  4CED A;  4B9T A;  4BRN A;  1RT7 A;  3VF4 A;  4QAG A;  1WN7 A;  4JK7 A;  3SQ0 A;  1NJX A;  4PWD A;  2NRR A;  4LF9 K;  1NLV A;  4X64 K;  1KC8 O;  3VQQ A;  5DMR A;  1W0H A;  2FLO A;  4WQ5 A;  5J2P A;  1LOT B;  5C15 A;  1KVA A;  2F96 A;  3AY9 A;  4GV9 A;  4DQI A;  1E3M A;  4K43 A;  3U9Z A;  4DS4 A;  4JI7 K;  4BWM A;  1XHZ A;  3N4Q A;  2WON A;  3CFO A;  1NK0 A;  4CHP A;  2HBM A;  1ZXO A;  1XQS C;  4OPK A;  1JXE A;  1SV5 A;  1DEJ A;  4FYD A;  3VEZ A;  3B6P A;  4H5V A;  1OKJ A;  3VF6 A;  3OS1 A;  2E2P A;  3A5L C;  5AFU A;  3K2P A;  3VF2 A;  3E9P A;  3L4Q A;  1VHX A;  4RW6 A;  2NRZ A;  1N34 K;  4MFB A;  4FPB A;  3BF3 A;  3CME N;  3ZT0 A;  1YAG A;  1HNV A;  3HJF A;  2UXB K;  4OO1 J;  5KPR A;  4X66 K;  1T6C A;  1NK7 A;  1YTU A;  2W40 A;  1TKX A;  4M42 A;  3DI6 A;  1T6D A;  3R8E A;  3OHR A;  1U45 A;  1KAY A;  2JWK A;  1BIU A;  4OJR A;  1NOZ A;  1IJJ A;  4AQY K;  2G8K A;  3L4I A;  2YJF A;  3ID8 A;  4FLU A;  3WXJ A;  2Z1H A;  3M8Q A;  3NGI A;  3SQ2 A;  3O9S A;  3QIP A;  2IC3 A;  4FWR A;  3P31 A;  4RWT A;  2H3G X;  3I8B A;  1YUW A;  3PSF A;  5GIO A;  2QKB A;  1OVQ A;  5FPE A;  5FPN A;  4KAZ A;  3HYF A;  1T7P A;  1JCE A;  3ULE B;  4HHT A;  1VSE A;  3AV9 A;  4DR7 K;  3AVJ A;  1ZYQ A;  2O8D B;  3F73 A;  3PIO L;  3GDQ A;  4B3R K;  3C7N B;  1X9J A;  4CER A;  4RTF D;  2YV0 X;  3OS2 A;  2D0P A;  1XNR K;  4CBU A;  1J5O A;  4BR2 A;  1QTM A;  2FSJ A;  2GWJ A;  3CM5 A;  1VQL N;  3H3O B;  2P9N A;  2ASM A;  5KGW A;  5F2R A;  3SMS A;  4DV7 K;  1C1C A;  4KHS A;  1NGB A;  2UXD K;  4LF6 K;  3BF1 A;  4H5W A;  1BA0 A;  3SAF A;  5AQO A;  5EXW A;  4NB4 A;  3CFR A;  3WEE B;  3CJC A;  4NCG A;  5HRN A;  2D5R A;  1B92 A;  4Y0W A;  3VQB A;  4DKW A;  3CG7 A;  4C8N A;  1ATR A;  2XY5 A;  5AQT A;  2G8W A;  2O8F B;  4HUE A;  3O6W A;  2YJE A;  1WBD A;  1RNH A;  3P83 D;  2GWK A;  1SKR A;  3T69 A;  4I7F A;  2BTF A;  3DRR A;  3H6E A;  4NO7 A;  3VEN A;  2P9P B;  1UA1 A;  1WSH A;  2UUA K;  4QS9 A;  3UKR A;  4WFN L;  2W6K A;  4W5O A;  1OH6 A;  4PHT X;  2O8C A;  3TAQ A;  4KHY A;  1C1B A;  1WSG A;  3G71 N;  2VQE K;  1BWF O;  3V9W A;  4I6M B;  4BC5 A;  4DCH A;  2O8E B;  4EAH D;  3H08 A;  1QSL A;  1NWK A;  4BRM A;  4K41 A;  3KD5 E;  3DRS A;  1QZ5 A;  1S9G A;  3ZSY A;  1DKG D;  3K5O A;  1S1V A;  3A5N C;  2X6S A;  3GOI A;  1YVU A;  1ITG A;  3LZJ A;  4Z4C A;  4F2R A;  4E19 A;  4ILG B;  3PO5 A;  2HB5 A;  4FM0 A;  1Z05 A;  1RTJ A;  3ZX2 A;  3BZC A;  5BRF A;  2GX9 A;  4FCY A;  3FZK A;  1U49 A;  4CGF A;  1VQK N;  4E3S A;  2P5O A;  4DFK A;  1WOQ A;  2YCH A;  2D0A A;  3KLI A;  1F21 A;  4DQQ A;  3DOL A;  4E7H A;  4DR3 K;  3LAM A;  4PA1 A;  2I7P A;  2D0O A;  2YHX A;  3D45 A;  4CF0 A;  3CFP A;  1WB9 A;  1NGA A;  3VN5 A;  1OH5 A;  4MDB A;  4CJE A;  1T44 A;  4LFC K;  3NE6 A;  2Z1G A;  3L2V A;  3IAY A;  3THX B;  4FO0 A;  2Z1I A;  2YI1 A;  3MX2 A;  4CJP A;  4CF2 A;  3IMX A;  3GBT A;  2G8H A;  2P1J A;  3MN5 A;  4IEE A;  1QQC A;  4B1X B;  3LP3 A;  3LPT A;  3S3O A;  1S22 A;  5HRP A;  1TKT A;  4DR6 K;  4NLB A;  4QOZ B;  4EIA A;  4CZH A;  2ZD1 A;  4F3O A;  3ZCM A;  3H46 O;  2YHY A;  3LL3 A;  3VQ4 A;  4BQZ A;  3H1V X;  3U8X A;  1G99 A;  4DV1 K;  4CE9 A;  3CM6 A;  1EWR A;  1NKB A;  4G9Z A;  4EZ6 A;  1KVC A;  2A3Z A;  3HM8 A;  2VWJ A;  5J2M A;  3TAN A;  4LH5 A;  1VSH A;  4DR4 K;  5KPT A;  4CZE A;  4YOV A;  1JLE A;  4BE0 A;  1YJW N;  3CC7 N;  1IO2 A;  5CYM A;  4FJK A;  2F8T A;  5FLX O;  3LP0 A;  4F8R A;  4KHN A;  3KLE A;  3LDQ A;  4W5N A;  2OPP A;  1BIS A;  2F7T A;  4O4G A;  3D0P A;  3ASM A;  3M5R A;  5C12 A;  3JSM A;  4AHT A;  3VTI A;  4DR1 K;  5C42 A;  3HPG A;  4H5N A;  4FOE A;  4JK9 A;  3I0S A;  5LY3 A;  3OYL A;  2GEL A;  4YHH K; 
#chains in the Genus database with same CATH homology
 2FBV A;  3TWH A;  3DLB A;  3S3N A;  1ASW A;  1ZBH A;  1RIL A;  3M8S A;  4CJS A;  4IG3 A;  4B9U A;  2R7Y A;  3DLK A;  4FW1 A;  1RCH A;  4DFJ A;  3C94 A;  4LSL A;  2BDP A;  2QKK A;  4Y1D A;  1SKS A;  1TVR A;  3NAE A;  3NGY A;  1MU2 A;  4AHV A;  1YTA A;  1U47 A;  1JL2 A;  1X9S A;  4WE1 A;  4DU4 A;  4OKE A;  4N47 A;  3G10 A;  3KLH A;  2FBT A;  3DMJ A;  2W42 A;  1D5A A;  4KI6 A;  2YHB A;  3AO2 A;  1HQE A;  4FJN A;  2FC0 A;  1T03 A;  4K8Z A;  1W9H A;  5HLF A;  2HHT A;  4JLH A;  1T05 A;  4DTP A;  5CZ2 A;  3AVF A;  2G8I A;  3A2F A;  4FZX C;  2HHS A;  1RDA A;  2X78 A;  1NKE A;  4OKK A;  4FM2 A;  1FKP A;  1X9W A;  1Q9Y A;  3PUF A;  3LP2 A;  3TAR A;  2HHQ A;  4OGC A;  1RT3 A;  1SUQ A;  4LH4 A;  4KKO A;  3E01 A;  5KRT A;  4DG1 A;  3SV3 A;  4B9S A;  3SCX A;  4CK3 A;  2OPR A;  1BL3 A;  1VSM A;  1WSE A;  4M3X A;  2G8F A;  4HVJ A;  1KFS A;  4UQG A;  2BAN A;  5CYQ A;  3NHG A;  2PY5 A;  3C6T A;  4FJG A;  4KTQ A;  4PY5 A;  4FLZ A;  1FK9 A;  1Q9X A;  1JKH A;  4RG8 A;  1JLB A;  1KLM A;  5D3G A;  3AA2 A;  4CJW A;  3KK2 A;  4KB0 A;  5KTQ A;  4H4M A;  2XRI A;  3LAK A;  4J2B A;  3QEX A;  3G0Z A;  5CZ1 A;  4DQR A;  5FRN A;  2EX3 A;  2VG6 A;  2IAJ A;  4KO0 A;  4B8A B;  3L2U A;  3ULD A;  4LD0 A;  1X9M A;  1IKY A;  2P51 A;  3BGR A;  5HBM A;  1ZBF A;  5K14 A;  4CJV A;  1RDB A;  4FJX A;  2ATQ A;  4JRP A;  1RT4 A;  2HNY A;  3V1Q A;  2XO7 A;  1CLQ A;  1D8Y A;  4I2Q A;  4OKJ A;  3V81 A;  3SQ4 A;  1XWL A;  1KCF A;  1UAX A;  4M3R A;  4DQS A;  3MXM A;  3SYZ A;  3CYM A;  1HYV A;  5EU7 A;  4CJT A;  3SZ2 A;  2ZQB A;  2HHU A;  4Y1C A;  1KVB A;  3VQP A;  1S1U A;  3VQC A;  3O4Q A;  2B5J A;  4J2E A;  4CHZ A;  1RBR A;  4AHS A;  4CGD A;  5KGX A;  4I9Q A;  1L3V A;  1BCO A;  2HVH A;  3V4I A;  5HRR A;  4IDK A;  4DFP A;  1S5J A;  3RMD A;  3L3V A;  1BI4 A;  3HP9 A;  3ZT1 A;  3SQ1 A;  3MAQ A;  4CF9 A;  2PYJ A;  3DOK A;  3ZSQ A;  1A5V A;  2D0B A;  4B9N A;  4CEQ A;  1TK8 A;  1U04 A;  4CF1 A;  5C25 A;  3O3H A;  1VK0 A;  3OYJ A;  3U3G A;  3NH2 A;  3LPU A;  3O3G A;  1WNS A;  2IS3 A;  3T19 A;  4H8K A;  3WNE A;  1WLJ A;  2NUB A;  4E7I A;  4KRF A;  4ZHR A;  4CF8 A;  2KQ2 A;  1IKX A;  3IG1 A;  3V9Z A;  2E6L A;  4M41 A;  1L3S A;  1HRH A;  3JYT A;  3S3M A;  4DTJ A;  2IGI A;  1Z25 A;  3OVN A;  4Z4F A;  1RTD A;  1ASU A;  3WNG A;  4DLG A;  1S1X A;  3WNH A;  3L8B A;  1T8E A;  3ZSR A;  3RMC A;  1EET A;  4CJL A;  1TL1 A;  3AVG A;  3AVA A;  3P1G A;  3MEG A;  2PYL A;  3NCI A;  2ZE2 A;  1BIZ A;  1CXU A;  4FLY A;  2OA8 A;  3KTQ A;  4M3T A;  2LSN A;  5FRM A;  1CZB A;  3DRP A;  2Q3S A;  1LV5 A;  4HUF A;  3AO5 A;  3V9X A;  4CEE A;  3TAG A;  3AVK A;  3SJJ A;  1FKO A;  2HHX A;  4CHO A;  3I8D A;  4DTX A;  2OPQ A;  4N76 A;  3KKR A;  3OYF A;  3QEP A;  4DTU A;  1TGO A;  4NCA A;  1CZ9 A;  2KTQ A;  1JLF A;  3SPZ A;  5J2Q A;  1S9E A;  1N5Y A;  1L3T A;  1NK8 A;  3RMA A;  1J9A A;  3HST B;  3NF9 A;  3O4N A;  4O5B A;  4CGJ A;  3L2Q A;  1XHX A;  3IRX A;  4E7K A;  1JLA A;  3U3Y A;  2A1R A;  3RWU A;  3K57 A;  2B6A A;  1N6Q A;  4E7J A;  4M3Z A;  3T3F A;  3ISN C;  4CJ4 A;  4CK1 A;  4OVL A;  1EKE A;  1JL1 A;  1RDD A;  4O55 A;  3ZSW A;  3MED A;  1U4B A;  4FK4 A;  2DY4 A;  1WSF A;  4DU3 A;  3QLH A;  1EX4 A;  2VG7 A;  4DU1 A;  3QNO A;  3LWM A;  3ZT3 A;  4AHR A;  3PX0 A;  4RW4 A;  2XY6 A;  1SKW A;  3AA3 A;  2GBZ A;  1BGX T;  1RT6 A;  4DSL A;  1RTH A;  4Z0U A;  4KHQ A;  3VQ7 A;  1DTT A;  4CED A;  4ID5 A;  4N56 A;  3QES A;  4B9T A;  1RT7 A;  3HPH A;  4QAG A;  3OYA A;  4F2S A;  3V1R A;  4CJQ A;  1WN7 A;  3SQ0 A;  2HND A;  3HVR A;  1GOC A;  1NJX A;  4PWD A;  2GUI A;  4J2D A;  4FJI A;  2ITG A;  2XHB A;  4KTW A;  3FFI A;  3UIQ A;  3VQQ A;  5DMR A;  1W0H A;  1J54 A;  4OLA A;  5J2P A;  3LZI A;  1HQU A;  1KVA A;  2F96 A;  1WAJ A;  1IKV A;  4IBN A;  4DQI A;  4PUO A;  3AVM A;  1HYZ A;  4N41 A;  3HK2 A;  4DQP A;  4KHW A;  5SWM A;  4CIG A;  1NOY A;  1RBV A;  4DS4 A;  4BWM A;  3MXI A;  3LAL A;  1EP4 A;  3OJS A;  1XHZ A;  2WON A;  3U6F A;  1S6P A;  3CFO A;  4J2A A;  1NK0 A;  4CHP A;  4OPK A;  3K5L A;  1JXE A;  4FJ5 A;  1SV5 A;  1VSJ A;  3OS0 A;  3OY9 A;  2Y1J A;  4FYD A;  4TSX A;  4ID1 A;  3NDK A;  5KI6 A;  3B6P A;  3BDP A;  3OS1 A;  3AVB A;  4CGH A;  3K58 A;  4FJM A;  3K2P A;  1I39 A;  4W5R A;  4RW6 A;  3OYM A;  4JS5 A;  4CCH A;  3DLG A;  2FBX A;  4GW6 A;  4MFB A;  5C24 A;  4FLV A;  5DK5 A;  3HXM A;  1C0T A;  2YHA A;  4LY7 A;  3VQ6 A;  4DF4 A;  4B9M A;  2F8S A;  4CJU A;  3NH0 A;  3VQE A;  3LAN A;  3ZT0 A;  2OPS A;  4B08 A;  1HNV A;  3TI0 A;  4IKF A;  3HJF A;  4CJK A;  3C95 A;  4MQ3 A;  1NK7 A;  4FW2 A;  1YTU A;  5T7B A;  4FJL A;  1TKX A;  4M42 A;  4GVM A;  3OYI A;  3DI6 A;  1HMV A;  4DSI A;  1EXQ A;  1REV A;  2Z1J A;  3ALY A;  1U45 A;  3QET A;  2BGG A;  5HRS A;  3EY1 A;  1B9D A;  1VRU A;  4CGG A;  3SUQ A;  3O3F A;  1D9F A;  1BIU A;  2ETJ A;  3TR8 A;  4OJR A;  1NOZ A;  4CHY A;  4AH9 A;  5JS2 A;  4CEF A;  1HYS A;  3PY8 A;  1RT2 A;  2E6M A;  3ZSO A;  2G8K A;  1WAF A;  4FLU A;  2Z1H A;  4FVM A;  3M8Q A;  3NF6 A;  2GV9 A;  3NGI A;  3SQ2 A;  1NK6 A;  3QIP A;  4FZZ A;  2DFF A;  2O4G A;  2IC3 A;  4CIE A;  4DSJ A;  1NK4 A;  4W5T A;  4CEC A;  3OYG A;  5SZT A;  4E89 A;  3WNF A;  1RDC A;  1IKW A;  2DFE A;  4RW8 A;  3NF8 A;  4BE2 A;  4FM1 A;  2QKB A;  1B9F A;  1LWF A;  1VRT A;  2HHV A;  4BWJ A;  4KAZ A;  3SUO A;  4KRE A;  4YFU A;  1Z26 A;  3HYF A;  3V6D A;  2PZS A;  1RBT A;  2VWK A;  3QEI A;  1T7P A;  4OLB A;  4HHT A;  2Y1I A;  1VSE A;  3AV9 A;  3K59 A;  4F4K A;  1R0A A;  3AVJ A;  1ZYQ A;  3VQ8 A;  3F73 A;  4EZ9 A;  4KFB A;  4NYN A;  4BDP A;  2JLE A;  3VQ9 A;  4FJJ A;  4NCB A;  4DTM A;  2X74 A;  4O44 A;  4RW9 A;  3ZSV A;  4CER A;  1DLO A;  1TAQ A;  2YV0 X;  3OS2 A;  4O0I A;  4B9L A;  2A1S A;  3HVT A;  4C8M A;  3PX4 A;  1ZBU A;  1J5O A;  3DYA A;  3RRH A;  1TAU A;  3AA5 X;  2DFH A;  4DWI A;  4M45 A;  1QTM A;  4DTR A;  3CM5 A;  1YT3 A;  4HCB A;  4DLE A;  3K5M A;  4CIF A;  3S9H A;  5KGW A;  2KZZ A;  4CEB A;  1C1C A;  1Q8I A;  4KHS A;  3AVI A;  1IH7 A;  2HNZ A;  4ELU A;  3KK3 A;  3NBP A;  2BE2 A;  2RPI A;  1SL0 A;  1WSI A;  2YNH A;  3HT3 A;  3QO9 A;  1L3U A;  1VSF A;  3QEV A;  1ASV A;  3CFR A;  5HP1 A;  4CJ5 A;  3OYN A;  4DMN A;  1BI4 B;  4NCG A;  5HRN A;  4ZTF A;  1WSJ A;  1BHL A;  1B92 A;  1C1A A;  2D5R A;  5E41 A;  3V9S A;  3VQB A;  1GOB A;  4E1N A;  3CG7 A;  4IFY A;  4CK2 A;  3OYD A;  4C8N A;  2FBY A;  3QER A;  1LW2 A;  4BDZ A;  1UWB A;  2XY5 A;  4M3U A;  2G8W A;  4B9V A;  4FJ7 A;  4HUE A;  4AIL C;  3OJU A;  4FK0 A;  1RNH A;  3P83 D;  1JXB A;  3CQ8 A;  1SL1 A;  1VSD A;  1SKR A;  1RT5 A;  3MXJ A;  4I7F A;  3ZSZ A;  4CJR A;  5J1E A;  1HJR A;  2XY7 A;  1D9D A;  3DLH A;  4KB1 A;  1GOA A;  3DRR A;  1QSS A;  4R5P A;  4ZTJ A;  5I42 A;  1TK0 A;  3RR8 A;  4ELV A;  1UA1 A;  1WSH A;  3KK1 A;  1LAW A;  4CEZ A;  4CES A;  5CY4 A;  4W5O A;  1QE1 A;  4CGI A;  3QNN A;  4KV8 A;  2YKN A;  3TAQ A;  3V1O A;  1QHT A;  4KHY A;  1C1B A;  1X1P A;  1WSG A;  3T1A A;  3EYZ A;  2HW3 A;  5KRS A;  3V9W A;  4EP4 A;  4OPJ A;  2OZS A;  1NJW A;  4CFC A;  1DTQ A;  4BAC A;  1O1W A;  3LDS A;  1XC9 A;  1KRP A;  2YNF A;  3ITH A;  4FLT A;  4KPY A;  3AVC A;  3H08 A;  3SUP A;  1QSL A;  3NF7 A;  3AO4 A;  1VSI A;  3C6U A;  4HUG A;  4IFV A;  1JLC A;  1HPZ A;  3KD5 E;  3ZT4 A;  3DRS A;  1TV6 A;  2RN2 A;  4NYF A;  1S9G A;  3ZSY A;  3P5J A;  4FJ9 A;  3AVH A;  5FDL A;  1XI1 A;  3M8R A;  3K5O A;  1S1V A;  1NK5 A;  4FJ8 A;  2X6S A;  4CHN A;  1YVU A;  3TAM A;  1ITG A;  4AHU A;  3LZJ A;  4IG0 A;  4FLX A;  4DFM A;  1NJY A;  1NJZ A;  4FJH A;  4Z4C A;  1C0U A;  3NH1 A;  4F2R A;  1TL3 A;  1C6V A;  4JRQ A;  4E19 A;  1RBS A;  3PO5 A;  2I5J A;  4M3W A;  2KZM A;  2RF2 A;  2KW4 A;  2P5G A;  3HO1 A;  2HB5 A;  4AHC A;  4FM0 A;  3LWL A;  1RTJ A;  3NFA A;  3KIO A;  3VQD A;  1LWC A;  3OYK A;  4Z4I A;  4CFA A;  4FCY A;  3MEC A;  4DTS A;  4W5Q A;  2VG5 A;  3RMB A;  1C0M A;  2YNI A;  4CGF A;  4BE1 A;  4E3S A;  1U49 A;  4L8R B;  3RTV A;  2P5O A;  4E0D A;  3OYE A;  1K6Y A;  4KI4 A;  4N5S A;  4DFK A;  4Z4E A;  1FXX A;  4HCC A;  3AVL A;  1RTI A;  2D0A A;  1I3A A;  3KLI A;  3HM9 A;  4DTN A;  2G8U A;  4BDY A;  5FRO A;  4Z4G A;  2O4I A;  2D0C A;  1UOC A;  1F21 A;  4XIU A;  4FZY A;  4E7L A;  4DQQ A;  3DOL A;  4E7H A;  4CFD A;  1A5X A;  3SV4 A;  3LAM A;  3V9U A;  5JS1 A;  4PA1 A;  1SL2 A;  4CF0 A;  1KLN A;  3D45 A;  3CFP A;  2HMI A;  3QIN A;  2OZM A;  2WOM A;  3VN5 A;  4CEA A;  3TAB A;  1J53 A;  3PV8 A;  4QCL A;  4CJE A;  4H4O A;  3ZT2 A;  3SUN A;  5HRO A;  3F9K A;  3QEW A;  2KFZ A;  1A5W A;  1RBU A;  3NE6 A;  4M3Y A;  2IOC A;  2Z1G A;  1TKZ A;  3HPO A;  3L2V A;  1U48 A;  1QS4 A;  1NK9 A;  3IAY A;  2Z1I A;  3B6O A;  4CJP A;  4CJ3 A;  3AA4 A;  4CF2 A;  4DSK A;  4B3O A;  2G8H A;  2P1J A;  4K8X A;  3AVN A;  4I9L A;  1HNI A;  3TAP A;  2HVI A;  1LWE A;  3MEE A;  3SPY A;  1QQC A;  4YNQ A;  3LP3 A;  3LPT A;  3S3O A;  1JLQ A;  2QK9 A;  1UA0 A;  2RKI A;  3AO1 A;  1BCM A;  5HRP A;  1TKT A;  3EZ5 A;  1NKC A;  1QSY A;  3SNN A;  1BQN A;  4FLW A;  4QOZ B;  2DTU A;  3KLF A;  2ZD1 A;  1S1T A;  4F3O A;  4F3T A;  3OYB A;  1S1W A;  3VQA A;  3KD1 E;  3ZCM A;  4KHU A;  3I0R A;  4CFB A;  4FXD A;  1LAV A;  3VQ4 A;  3VA3 A;  4DTO A;  4ICL A;  4C8K A;  3HP6 A;  2QXF A;  3L3U A;  4RW7 A;  1ZBL A;  2X6N A;  3RR7 A;  4CE9 A;  4JS4 A;  2XY8 A;  3CM6 A;  2YNG A;  1NKB A;  3DLR A;  4EZ6 A;  2E4L A;  1KVC A;  1KSP A;  2KFN A;  3TAE A;  2IDO A;  2VWJ A;  5J2M A;  4CJF A;  3TAN A;  4ELT A;  4LH5 A;  2HHW A;  1VSH A;  4Z4H A;  3PX6 A;  3DM2 A;  3DLE A;  1TKD A;  3ZSX A;  3AO3 A;  3OYC A;  4C8O A;  1JLE A;  3K5N A;  4CEO A;  4PQU A;  3RRG A;  1VSK A;  4DSF A;  4BE0 A;  1RT1 A;  1TK5 A;  4G1Q A;  2AJQ A;  1IO2 A;  3IS9 A;  3VQ5 A;  5CYM A;  3KLG A;  4FJK A;  4EP5 A;  2F8T A;  2B4J A;  3LP0 A;  1IG9 A;  4FK2 A;  1VSL A;  4F8R A;  3THV A;  4E1M A;  4KTZ A;  4KHN A;  1LW0 A;  4OGE A;  3KLE A;  3PO4 A;  4DSE A;  1BQM A;  3L2R A;  5J2N A;  4CHQ A;  4W5N A;  4LSN A;  2OPP A;  3M8P A;  1BIS A;  1L5U A;  4O4G A;  1JLG A;  4DS5 A;  3D0P A;  1Y97 A;  4GMJ B;  3VA0 A;  3ASM A;  1KFD A;  2EHG A;  3OYH A;  3KJV A;  1S6Q A;  3L2W A;  4AHT A;  3JSM A;  4DF8 A;  3NGZ A;  4HTU A;  4I2P A;  3KKS A;  5C42 A;  1G15 A;  1KTQ A;  3HPG A;  3QIO A;  5I3U A;  4Q0B A;  4Q5V A;  3SI6 A;  1ZBI A;  2JGU A;  2YKM A;  4C8L A;  1CXQ A;  3I0S A;  3HL8 A;  3OYL A;  4B8C A;  2G8V A;  3TAF A;  2OYQ A;  4O0J A;  3LP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...