3L3VA

Structure of hiv-1 integrase core domain in complex with sucrose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords POL polyprotein
total genus 53
structure length 144
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3vA00
2G8WA 4CJRA 3VA0A 1BGXT 4KHUA 1L5UA 4ELUA 4DTRA 4B9UA 4FJ9A 4IDKA 4BDPA 3OYNA 1JXBA 3AO2A 1T05A 2YHBA 1FK9A 3HPGA 2PYJA 4JRQA 1SV5A 1QHTA 3VQPA 1EP4A 2EHGA 3TANA 1QSYA 1GOBA 3RMDA 1TVRA 2IS3A 4QCLA 1VSIA 4B9TA 2AJQA 1LAWA 2FBYA 2G8UA 4PA1A 4OPKA 3K5LA 4DLEA 3RRHA 1U47A 2G8VA 4KI6A 5KTQA 1O1WA 4E0DA 2XO7A 3KLHA 3ZSYA 1RBVA 4CJ4A 3QETA 5HP1A 1L3UA 3AVJA 3AO1A 2FBVA 4O4GA 4FZXC 1X9WA 3O3HA 4CECA 3NHGA 4Z4IA 4CEOA 3T3FA 3QEWA 3NDKA 1I39A 1VSKA 3NF6A 4CHNA 3QEXA 1T03A 3AO4A 4GVMA 1IKYA 4EP4A 3TWHA 4CEZA 3ZSZA 1BI4A 1TAUA 4KFBA 2HNZA 4FJNA 3D45A 3NBPA 3ZSXA 4OKKA 1RDBA 4M3WA 3AVBA 4NYNA 2OPPA 1ASWA 3IRXA 1U48A 1QTMA 4EZ9A 3OVNA 4FXDA 3VQ4A 4IFYA 1GOAA 1N5YA 1ASVA 4R5PA 3KJVA 3K58A 2BDPA 1BIUA 1R0AA 2E6LA 4M3ZA 2OPRA 3OYEA 5HRRA 4HCCA 4I9QA 4KO0A 4E7LA 3K5MA 1RDDA 4CE9A 4M3YA 4KV8A 2X78A 1Z26A 3AVFA 4O0JA 5KI6A 3OYGA 4KPYA 4N41A 4GW6A 4B9MA 1S1WA 3BGRA 4ZTJA 2DY4A 1S5JA 2XRIA 4CK3A 4WE1A 2Y1IA 1SL1A 3V9SA 1RBSA 3SV4A 4FJJA 1IKWA 1NOZA 3PUFA 1JLFA 4CGJA 1NJZA 1NJWA 3TI0A 2KQ2A 2G8HA 4ID1A 2YHAA 1D5AA 4CJWA 4GMJB 3C6UA 3CM6A 4CEAA 4HVJA 3KLIA 4W5RA 2FBTA 4IG3A 4BWJA 3HJFA 4Y1CA 5SZTA 2E4LA 3CQ8A 4DFMA 4NYFA 1TGOA 1J9AA 1F21A 4XIUA 4W5QA 4HTUA 1DTQA 1NK9A 1WAJA 4OKEA 1Q8IA 3NH0A 4FLXA 1NJXA 4FZZA 4DTNA 1I3AA 3RRGA 1FXXA 3V9UA 4AILC 1G15A 3DLEA 5D3GA 1Q9XA 1WSIA 1HJRA 3AA5X 3I0SA 3KLGA 1TK0A 5HRNA 3L2QA 3LPTA 4M3UA 2D0BA 3E01A 1A5WA 3L2UA 1VSHA 4F3TA 1RT7A 3G0ZA 5J2NA 3RMBA 4LSNA 5HRPA 3HPHA 4BE0A 3HK2A 4FJMA 3MECA 5CZ1A 3VQBA 4CJLA 4DTOA 1VSFA 5DK5A 3OYLA 4JRPA 3SYZA 5JS2A 4DQRA 1HMVA 1ZYQA 2OYQA 1TL1A 1BQNA 1QSSA 4ZHRA 3ZSWA 3CFOA 1KLMA 4FJXA 3QIOA 4IG0A 4DF8A 3SUOA 2HB5A 4CFAA 4E3SA 4CIFA 3I0RA 3THVA 4RW8A 3RWUA 1RTDA 4FK2A 1HYSA 3KKSA 4W5OA 3NE6A 3QESA 1JLEA 5HRSA 4RG8A 1RBRA 1NKEA 3ULDA 1XWLA 4DSFA 4EP5A 1XHZA 1C1CA 1IH7A 4OKJA 4AHTA 2HHUA 1C1AA 1BI4B 4OVLA 4DS5A 4PUOA 4C8OA 3PX0A 4G1QA 4AH9A 5JS1A 1LAVA 1TL3A 3V6DA 4O5BA 3IAYA 2A1RA 4LY7A 4MQ3A 3SQ2A 3NFAA 2D5RA 4FK0A 2PYLA 3ISNC 3LZIA 4ELTA 2HVHA 4B3OA 1BISA 2PZSA 3C6TA 1T7PA 3QNOA 4KHYA 1TAQA 3AVKA 4IBNA 4CIEA 1HYVA 1D8YA 1XI1A 2HMIA 1C1BA 4E7JA 3NGIA 3LP3A 1L3TA 2QKKA 4NCGA 5KGWA 4CF8A 1LW0A 1KVCA 3OJSA 1TK5A 2IGIA 5FRNA 1VSLA 3O3GA 1HRHA 2D0CA 4FW2A 2IC3A 4E1MA 4E89A 3QEVA 1J5OA 3QEPA 3SPZA 1RTIA 3QO9A 3S9HA 4N56A 5KGXA 3OYCA 3L2VA 1X9SA 4B9LA 2O4GA 3MXJA 3AVHA 4FYDA 3ZCMA 4FM0A 1NK4A 3PX4A 4CHOA 3EYZA 4CERA 3VQ7A 3ZT2A 4M3TA 4AHSA 2G8IA 3VQ9A 1JLCA 1VK0A 4KKOA 3ZT0A 1LW2A 1QS4A 3M8SA 4CJEA 4E7HA 3VQ5A 3VQDA 5C42A 3HO1A 4UQGA 3OYJA 1BCOA 1X9MA 4F2SA 1S9EA 3LAMA 4CJ5A 3DM2A 4RW6A 1QQCA 3K59A 4B9NA 4C8KA 4CJFA 4CK2A 1Y97A 3KIOA 1RTHA 1LWCA 2B4JA 3O4NA 5SWMA 4HCBA 3LANA 2RF2A 3DOKA 3O4QA 2FC0A 4CJSA 1NJYA 4C8LA 4FJ5A 1KRPA 3ALYA 4RW4A 4Z0UA 4LD0A 3V81A 4JS5A 4J2BA 3B6PA 5CY4A 1NK6A 1RT4A 4FJHA 1W0HA 4DU4A 2Y1JA 2VG6A 3DRRA 3CFPA 3DLBA 3RR8A 2P5OA 1U49A 1WSFA 3UIQA 4M45A 4HUFA 4BE1A 4OLBA 3ZT3A 3HP6A 1EXQA 3SNNA 2BANA 3SQ1A 4MFBA 4AHUA 3ZSOA 4FM1A 4H4OA 4CF9A 3HT3A 4CHZA 1VSMA 5K14A 2BE2A 3NF7A 1CZ9A 1VRTA 3AVNA 3VQEA 2O4IA 3KKRA 3L2WA 3K2PA 2HHQA 5DMRA 4Z4FA 4O0IA 1VSJA 1YT3A 4YNQA 3S3OA 4F2RA 4CGDA 5KRSA 1XC9A 4FLWA 3BDPA 5I42A 3DRSA 1KFSA 2WOMA 4FCYA 1CZBA 1JL2A 1JXEA 1QE1A 1SL0A 3MAQA 3AVGA 4NCAA 4JLHA 2VWKA 1JLBA 3SQ0A 4NCBA 3S3NA 3VQCA 3HSTB 3RMAA 4DF4A 1B9FA 5J2MA 3KK1A 1NK0A 4CHQA 3V9ZA 1HNVA 1UA1A 2XY6A 2W42A 4K8ZA 4CJVA 2VG5A 3LAKA 1RDCA 3MEGA 2KZZA 3CFRA 3LP2A 2RKIA 5CZ2A 2FBXA 3JYTA 2QKBA 2IAJA 2HW3A 3L3VA 3SJJA 2P5GA 4KTQA 3NH2A 3SZ2A 2VWJA 3RMCA 1S6PA 1YVUA 4ICLA 4FLYA 1A5VA 4KREA 3V4IA 1MU2A 2P1JA 5FDLA 4DSJA 3ZT4A 1UA0A 3LWMA 4IKFA 4H4MA 4DTPA 4FJ8A 1ZBHA 1WSEA 1TKXA 2DTUA 5C25A 3TAEA 2ZD1A 3ASMA 2ZE2A 2JLEA 3TAMA 3OYIA 1REVA 2D0AA 4I2QA 4K8XA 1X1PA 4J2AA 3H08A 4PWDA 3WNEA 2E6MA 1DTTA 1J53A 1C0TA 3AA4A 1GOCA 1IG9A 3PO4A 4B08A 1WAFA 2IOCA 3V1RA 4CGIA 4CHYA 3VA3A 3TAGA 1HQEA 3PO5A 4DS4A 3ZSVA 3F73A 1VSEA 4KRFA 3L8BA 3AVLA 4KHNA 1JLQA 1RNHA 4DU3A 3C94A 4LSLA 3VQQA 4PY5A 1DLOA 1WSHA 3PX6A 2QXFA 3HL8A 4OGEA 3MEDA 4HUGA 5E41A 4C8NA 4CESA 4DTSA 4DFPA 1EX4A 1A5XA 3AVIA 1K6YA 3HXMA 4CGGA 2NUBA 4KB0A 3VQ8A 3HPOA 1SKRA 1LV5A 4KTWA 4CF1A 4CFBA 1C6VA 3KK2A 3OY9A 3LPUA 3M8QA 4Z4EA 4CJUA 4FM2A 4BDYA 1RT6A 4E1NA 1RBTA 3NH1A 4KI4A 1S1VA 1SL2A 3C95A 2KFNA 1WSGA 4KB1A 4M3XA 1CLQA 3QINA 2Z1IA 4CFDA 1JLAA 3KLEA 4ELVA 3DLKA 4CK1A 1NKBA 1UWBA 5HROA 3OYHA 4CGFA 1NOYA 1EKEA 2VG7A 3K57A 2OZSA 4I2PA 4Z4CA 3OS1A 2YKNA 1KSPA 5EU7A 4DWIA 2EX3A 4M42A 4QOZB 3SCXA 3CG7A 4DU1A 1BCMA 4L8RB 1LWEA 1WNSA 4N76A 4DTUA 5J2QA 1YTAA 1C0MA 3ZSRA 3V1OA 2HHXA 1UAXA 3QLHA 3LP0A 2R7YA 1IKXA 2P51A 4C8MA 2HHWA 4M41A 3T19A 3AO3A 1VSDA 3HVRA 2A1SA 3L3UA 4CFCA 1NK7A 4BE2A 3KK3A 5C24A 1SKSA 1S1UA 4FJ7A 3HVTA 1KTQA 1FKPA 3I8DA 5I3UA 1BHLA 4HHTA 3OYMA 2ETJA 2YKMA 3HM9A 1XHXA 1RT5A 1RT1A 3DRPA 1CXQA 2IDOA 1J54A 3ZT1A 1RT3A 4CEDA 4W5TA 3NAEA 4JS4A 2ZQBA 4FLVA 3U6FA 2Z1HA 3LALA 4E7KA 3HYFA 3SUNA 2ATQA 1TKDA 2HNYA 4CF2A 1NK8A 3OJUA 2OPSA 3OYAA 3KLFA 4N47A 4H8KA 3U3YA 1S1TA 4N5SA 2RPIA 4O55A 4ZTFA 3TABA 4CJTA 4Z4GA 2DFEA 1UOCA 1D9DA 1ZBLA 4DSKA 3U3GA 4OJRA 2X74A 3WNHA 3NF8A 2YNIA 1C0UA 4AHCA 4CJKA 3NGZA 3ZSQA 3AO5A 2Z1GA 3KD5E 4DSLA 1BQMA 1JLGA 4DMNA 3OYDA 3T1AA 4J2EA 4E19A 1HQUA 3IG1A 2XY7A 4Q0BA 3P1GA 4DQSA 3CYMA 3NGYA 5CYQA 3OYFA 2XY8A 2KW4A 3JSMA 3LZJA 1Q9YA 4J2DA 1Z25A 3DMJA 3MXIA 3LDSA 4FLZA 3A2FA 3V9WA 1NK5A 3RR7A 3P83D 1ASUA 1QSLA 4ID5A 4KAZA 2F8TA 1BL3A 1RT2A 4I7FA 3EZ5A 3TAFA 4CF0A 3D0PA 1IO2A 4QAGA 4FLUA 1B92A 1JL1A 3F9KA 4B9SA 3S3MA 1RTJA 1S6QA 2GUIA 3SUQA 1TKTA 3VN5A 2HVIA 3TR8A 3KD1E 4B8AB 5HLFA 1RBUA 4DQQA 2KZMA 3SV3A 1EETA 3AA3A 3FFIA 1FKOA 4B8CA 4KTZA 3MXMA 2WONA 3AVCA 4LH5A 5J1EA 1D9FA 1VRUA 1RCHA 4M3RA 4BWMA 1HNIA 1U04A 3ITHA 1S1XA 3L2RA 5HBMA 4Y1DA 4CEEA 3QEIA 4BACA 1U4BA 3DYAA 4RW7A 2Q3SA 4FVMA 3G10A 4RW9A 3DLHA 2GV9A 3DI6A 1CXUA 2YV0X 3MEEA 2ITGA 4CEQA 3AA2A 4Q5VA 3OYBA 1SKWA 2OA8A 3PY8A 2KFZA 1L3SA 4B9VA 2F8SA 1KFDA 2F96A 2XY5A 3K5OA 4YFUA 1T8EA 4W5NA 1LWFA 4CHPA 2RN2A 3SUPA 4KHWA 3M8RA 3V1QA 3HP9A 1ITGA 1WN7A 2YNFA 3QNNA 3KTQA 1W9HA 4DQIA 2HHSA 1RDAA 2LSNA 2B6AA 2HHTA 3NF9A 5T7BA 1JKHA 1RILA 1SUQA 3SI6A 2B5JA 4DTXA 4FJIA 3OS0A 2OPQA 3B6OA 4TSXA 4CIGA 4CJPA 4E7IA 4PQUA 3RTVA 3O3FA 5FRMA 4DSIA 4IFVA 4CEFA 4DSEA 3CM5A 4CJ3A 1ZBUA 3VQAA 3QIPA 3TAPA 2JGUA 3K5NA 3TARA 4DLGA 3V9XA 1NKCA 4DQPA 3OS2A 4DFJA 4AHVA 4LH4A 1BIZA 1HYZA 1IKVA 5J2PA 4FK4A 1S9GA 3AVMA 1KVAA 3WNGA 3TAQA 4I9LA 4CEBA 1ZBFA 3LP1A 4BDZA 1N6QA 2DFHA 4DFKA 2BGGA 1KCFA 3NCIA 2G8FA 2X6SA 2Z1JA 1TV6A 5FROA 3QERA 1YTUA 2X6NA 1TKZA 1KVBA 2GBZA 4CJQA 3LWLA 3SQ4A 3M8PA 1KLNA 2HNDA 4DTMA 4F3OA 2YNGA 4FW1A 4KHQA 4CGHA 2G8KA 1HPZA 3AV9A 4FJGA 5KRTA 2YNHA 3SPYA 3IS9A 4OLAA 2XHBA 3P5JA 1WLJA 3OYKA 1WSJA 4HUEA 1ZBIA 4DG1A 4FLTA 4O44A 3VQ6A 4F4KA 1U45A 4CCHA 4EZ6A 4KHSA 2HHVA 4OPJA 4OGCA 3DLRA 1TK8A 2PY5A 2OZMA 3PV8A 4FJKA 2DFFA 2KTQA 4DTJA 1L3VA 1B9DA 4Z4HA 3WNFA 3DOLA 3DLGA 3AVAA 4AHRA 4FZYA 2I5JA 4F8RA 5CYMA 2QK9A 3EY1A 4FJLA
chains in the Genus database with same CATH superfamily
2QA4N 3VA0A 4KHUA 3CJBA 3C0BA 1EWQA 2VGNA 3OYNA 1T05A 2PYJA 1FK9A 5AQWA 4JRQA 3VQPA 1EP4A 4JK7A 1TVRA 2UXBK 4C1NK 5ADXH 1RGIA 2G8UA 1BDGA 3A5LC 4OPAA 2GX9A 3HOSA 2G8VA 4E0DA 3DXKB 3KLHA 2E1ZA 2E2NA 3AO1A 2FBVA 1X9WA 2H3GX 1XC3A 3H1QA 3NHGA 4Z4IA 3T69A 1I39A 1VSKA 1T03A 3TWHA 4FWQA 2Q36A 2HNZA 5AQLA 3GOIA 3ZSXA 4DV1K 4M3WA 4EZ9A 3BZKA 1ESVA 1J6ZA 2P9IB 4UY8O 2BDPA 1BIUA 2NRVA 2OPRA 2CGKA 5AZJB 1IBMK 3K5MA 2HOEA 2X78A 3AVFA 1X3MA 3OYGA 3W3DA 2NZTA 5JICA 4GW6A 3NMUA 4B9MA 1NGGA 3THWA 2DY4A 1S5JA 4CK3A 4WE1A 4JI4K 2ZM6K 1NJWA 5BPMA 2G8HA 4BRNA 3LDPA 1OVQA 2YHAA 3HZ6A 4NO7A 4DV2K 3HBTA 3CM6A 1Z6RA 2O8CB 4DFMA 1TYQA 1M1KO 1J9AA 1DTQA 5AQJA 1GLDG 1MA9B 3D6RA 1YJ9N 3L2QA 3E01A 4LF8K 1A5WA 3UKUA 3CIPA 1RT7A 3G0ZA 1VQ7N 1BUPA 5HRPA 3VGKA 1S3XA 3VQBA 4DTOA 3CCQN 5JS2A 1TL1A 2QI2A 1NU0A 4B1VA 5M1NA 1XQSC 3QICA 4ZHRA 2KKZA 4FJXA 3QIOA 4BREA 3TSUA 4CFAA 4CIFA 3I0RA 4A61A 3KKSA 3NE6A 3P4IA 1RBRA 1Q81O 3O9QA 3VF2A 1XHZA 2HHUA 3IMXA 1BI4B 3L6QA 4AH9A 1LAVA 1DT9A 2HHHK 4K41A 4MQ3A 1RDWX 1NGJA 2E5LK 2PYLA 3LZIA 1NGAA 2PZSA 2HBMA 5LL6Z 1TAQA 3AVKA 3AY9A 4IBNA 4CIEA 1HYVA 4NCGA 5FRNA 1HJOA 3O3GA 2D0CA 2IC3A 1J5OA 1RTIA 4N56A 3D2FB 3OTOK 3L2VA 4FYDA 4FM0A 3EYZA 4M3TA 3VQ7A 5AQNA 3CF5L 1VK0A 4IWVA 3ZT0A 4A2AA 4CJEA 2E8AA 3VQ5A 3VQDA 4BRKA 4UQGA 5M1KA 3WQTA 1S9EA 5BN9A 3K59A 4O8UA 4RW6A 1QQCA 1Y64A 4CJFA 3H45C 4CJ7A 3M5RA 1LWCA 3ZLJA 5SWMA 1JJ2M 2QWNA 3DOKA 5CE3A 2FC0A 1NJYA 4RW4A 4LD0A 4CZGA 4J2BA 4FJHA 4JHDA 3BY5A 3DLBA 3RR8A 3UIQA 1WSFA 3DAWA 4BE1A 2UUCK 4DR7K 4MLHA 3VEYA 2P9SB 4AHUA 2YCHA 4FM1A 4H4OA 3VF6A 3HT3A 3G71N 3NF7A 3KKRA 3L2WA 2HHQA 5DMRA 4O0IA 1VSJA 2A40A 4FOIA 1YI2N 4FLWA 1XC9A 5I42A 1KFSA 2WOMA 2QWOA 2WTUA 3MAQA 2OCEA 3CCSN 1JLBA 3VQCA 3HSTB 3RMAA 4DF4A 3KK1A 1NK0A 4K8ZA 1HNVA 1UA1A 3C7NA 2W42A 4BROA 1VHXA 5CZ2A 4DUYK 3L3VA 4BG9A 2VGMA 3GG4A 3SZ2A 2QWMA 4BR4A 4CBXA 3TSQA 4ICLA 3MDQA 3VEZA 1XNRK 4FJ8A 4IKFA 4DR1K 3WEEA 4DTPA 1WSEA 5C25A 3ASMA 3O9UA 3TAMA 3CCEN 3ZX2A 3OYIA 1REVA 2D0AA 1X1PA 4BC2A 1KAYA 1VQ8N 2E6MA 4FVUA 1GOCA 3PO4A 1WAFA 3QFPA 2A42A 3V1RA 3VGMA 3ZSVA 3FZLA 4KHNA 1RNHA 4LSLA 1N8RO 1DLOA 4DFPA 3MEDA 1C0GA 2NLXA 4CESA 4HUGA 1N36K 1A5XA 4JKBA 4CGGA 1NGFA 2O8DA 2FSKA 3HPOA 3C7NB 1SKRA 3EO3A 4FL9A 3LPUA 4PKGA 4E1NA 2KFNA 4KB1A 4B3RK 1CLQA 1M90O 1JLAA 4YOUA 4ELVA 1EKEA 3THYB 2OZSA 5FPNA 3SMSA 1FW6A 4Z4CA 4CI6A 4DWIA 3WXKA 2EX3A 3HRGA 4M42A 3CG7A 4DU1A 1YJWN 1WNSA 3ZEUB 3MWTA 4YOWA 3ZX3A 1ATSA 4BR7A 3LP0A 2R7YA 1NGBA 4CZIA 4MDAA 4JV5K 3L3UA 1XUPO 1O13A 3KK3A 5MLCQ 2ZJPL 5BRHA 4CEDA 3K58A 3DRPA 3U6FA 1RT3A 2UUBK 4B9NA 3CHWA 2Z1HA 4M7XA 5C0YA 2P9PA 4A59A 4YORA 4WCEL 3U3YA 3ZX0A 5GIOA 3EE8A 3TABA 1U6ZA 4WYBA 4CJTA 2DFEA 1UOCA 1D9DA 1ZBLA 4B1ZA 2X74A 1BOTO 4ISGA 3NGZA 3VETA 5B8HA 3OYDA 1QHAA 2XY7A 1YJNN 3A5MC 4HWIA 4JKGB 5AQUA 1Z25A 3MXIA 3LDSA 1BU6O 1ASUA 1QSLA 4ID5A 2F8TA 1RT2A 1BA1A 4CF0A 3TAFA 1IO2A 2GUPA 2PFUA 5AQQA 4A57A 3ULEB 3SAFA 4IXCA 2WBNA 3SUQA 4BR2A 3VN5A 3LDOA 2RHKA 3FZHA 5AZJA 3GE1A 1RBUA 4DQQA 3F2KA 5F2RA 3MXMA 4G9ZA 4JK9A 4I6MA 1LCUA 1VRUA 1VQLN 1HNIA 1S1XA 5HBMA 3QEIA 4LF4K 1X9JA 1E3MA 3G10A 3DLHA 4NXMK 4BGBA 4IOCL 3MEEA 2OA8A 3PY8A 2F8SA 3JAMO 5BR9A 4YFUA 1T8EA 3O9TA 3SUPA 3ID8A 4H0YB 1ITGA 4B3MK 2UU9K 1RDAA 3C6AA 3NF9A 3FLCO 3R1XA 1SUQA 4DTXA 5BRDA 1EQYA 4TSXA 4CJPA 4PQUA 5FRMA 5LMUK 3VTHA 4IFVA 4YOTA 3VEVA 1ZBUA 1BA0A 3MN7A 4DQPA 3OS2A 1BIZA 1OH7A 3I8BA 1KVAA 3HTVA 4ISEA 1ZBFA 4A5AA 4GV3A 2DFHA 3OW2M 3LL3A 5FROA 4BRQA 2X6SA 1TV6A 4J8FA 4JN4A 4KBOA 1KLNA 3R8EA 4WFAL 1TUYA 2JWKA 4CGHA 4ILGB 1WLJA 2QM1A 1U45A 4CCHA 2HHVA 4OPJA 4H03B 5HL7L 2PY5A 3PV8A 1HKCA 5JLHA 1ZBSA 2NRTA 3WNFA 4FWNA 4FJLA 1JCEA 4H5NA 4ELUA 4DTRA 4B9UA 3P39A 4FJ9A 1W97L 4GV9A 4PL8A 4DHYA 1GLCG 2EHGA 3TANA 1GOBA 4DCHA 2IS3A 4QCLA 1VSIA 3M6GA 4PA1A 4OPKA 3K5LA 4DLEA 3RRHA 2FLOA 4BRMA 2XO7A 3QETA 5HP1A 4CJ4A 4BRHA 2F4VK 3VEWA 3A8YA 3O3HA 3O5BA 2KLAA 4CHNA 5LY3A 3OBYA 5TKYA 3HI0A 5BPNA 2OPPA 1ASWA 3OVNA 4DV5K 2I7NA 3THXB 4JHDB 4R5PA 4FO0A 2E6LA 4KO0A 4E7LA 4M3YA 4DR6K 2YJEA 4KPYA 4RWTA 2YHYA 5E84A 3CJ9A 1S1WA 1T6DA 3JXUA 1VQ4N 3SV4A 2AA4A 1NOZA 4CGJA 1JLFA 4DV7K 2KQ2A 3VEOA 4XH1A 2QWQA 4CJWA 3HJFA 5SZTA 4IEIA 3CQ8A 1BO5O 4NYFA 1F21A 3J8AA 1KQSM 1NJXA 1WAJA 1NGHA 3MCPA 1NWKA 5IWAK 4AILC 4MDBA 1G15A 5GADP 4WQ4A 4A5BA 1Q9XA 3AA5X 2IVPA 4PL7A 1QQOA 4LSNA 3GL1A 2FSNA 3HPHA 3B8AX 1XMQK 4WQ5A 3O9SA 1VSFA 4DQRA 1HMVA 4IZ9A 3KWIA 3G4SN 3NVMA 2NRRA 4IG0A 4DF8A 3HM8A 3THVA 4FK2A 3QESA 2F7TA 4EP5A 1C1CA 4OKJA 4AHTA 4OVLA 4G1QA 1TL3A 3ZEUA 3J80O 2A1RA 3SQ2A 3NFAA 2D5RA 4FK0A 4B3OA 1NMDA 2W41A 1GLBG 2CH6A 1NG9A 3C6TA 5EVZA 3QNOA 4KHYA 3CMEN 4KH5A 2JWLA 2HMIA 5GAEP 4IOXA 1XI1A 3NGIA 3QB0A 5EY4A 1LW0A 1TK5A 5M1FA 4BVOA 5AQSA 3QEVA 2YHXA 3QO9A 5KGXA 3OYCA 3MXJA 4BRAA 4X64K 1KAXA 4CERA 3WXIA 3VQ9A 3CJ1A 4V19S 1LW2A 3O4WA 3HO1A 3LAMA 3P31A 3KIOA 1RTHA 3Q7CA 4BG8A 2V51B 3JS6A 3O4QA 2W6KA 5AZIB 4C8LA 4FJ5A 1KRPA 4IO9L 3B6PA 1NK6A 4DU4A 2VG6A 3CFPA 1U49A 1BWFO 4HUFA 4LC9B 2O8FB 3ZT3A 4CZEA 2HBKA 1EXQA 3SNNA 3ZSOA 1VSMA 1CZ9A 1VRTA 2O4IA 5DM6L 3DXKA 4Z4FA 2HF4A 1YT3A 3S3OA 1WOQA 1CZBA 1JXEA 1QE1A 3A5NC 4IEEA 3AVGA 4NCAA 4BRIA 2O8FA 4NCBA 1SZ2A 3S3NA 1VQKN 3L4IA 4BR5A 2O8DB 5J2MA 2ITMA 2XY6A 4CJVA 3O80A 2NRWA 2KZZA 3CFRA 3LP2A 4H0PA 3JYTA 1RDUA 3QBXA 3SJJA 2P5GA 2VWJA 3CJCA 4CZLA 3RMCA 1YVUA 4CZKA 2CH5A 4FLYA 1A5VA 2P1JA 5E26A 5FDLA 4H4MA 1U2VA 1TKXA 4LFAK 3TAEA 2ZD1A 1VQMN 2ZE2A 3P38A 4LF5K 3IUCA 1DTTA 1C0TA 3AA4A 2IOCA 1CZAN 4CHYA 3VA3A 3TAGA 4JK8A 3U8XA 3L8BA 5BR8K 1P8ZA 3PX6A 2P9LB 3HL8A 3E66A 3J81O 3TARA 5E41A 3VQ8A 3EEQA 3MWPA 3G6EN 4CF1A 4CFBA 2AP1A 3RVCA 3UB5A 3M8QA 1RT6A 1RBTA 3C95A 4HTLA 2Z1IA 4CFDA 4JI0K 4CK1A 1NKBA 1UWBA 3OYHA 3FZMA 3GBTA 3F5TA 3K57A 4I2PA 5ADXA 2GELA 4BRPA 1T3VA 4QOZB 4L8RB 4JNEA 4N76A 5J2QA 1K8AO 3ZSRA 4JI3K 2HHXA 3WXMB 1IKXA 2P51A 5TKWA 5CHIA 1ILYA 4M41A 3T19A 3ZETA 4DB3A 3HVRA 2WC9A 1NK7A 4BE2A 1GLAG 5C24A 1SKSA 1U2VB 2E20A 1KTQA 1FKPA 3GDQA 5I3UA 3CCRN 3RSEA 3OYMA 2ETJA 4FOEA 3UKRA 1CXQA 1J54A 2HBJA 3NAEA 1HPMA 3CCUN 4FLVA 1TKDA 3AGRA 3MN9A 3HYFA 4CF2A 1VQ5N 1NK8A 3W0LA 4R79A 4Y0WA 4CZMA 4N5SA 4ZTFA 4Z4GA 1R59O 4OJRA 3D2EB 2YNIA 5KPRA 4CJKA 3ZSQA 3AO5A 3KD5E 4DSLA 1BQMA 1JLGA 3QMLA 3IDHA 1HQUA 1Q18A 4Q0BA 4JKHA 5KQDA 5CYQA 3JSMA 3SMPA 2F9WA 2KW4A 3CPWM 3DMJA 1YF5L 3M3ZA 1W7AA 4KAZA 3EZ5A 4QAGA 4CBUA 1T44A 3S3MA 2ZGZA 3BF3A 3J7YP 1C0FA 1S6QA 1W2BM 3CI5A 3FZKA 1QZ6A 4JYAK 2HVIA 3KD1E 1VQ9N 3VERA 4NXNK 3UE5A 3PSFA 4B1YB 3AVCA 4LH5A 4X66K 1RCHA 4M3RA 1U04A 3L2RA 1I94K 5KPZA 3DYAA 2Q3SA 4FVMA 4RW9A 3DI6A 2HMPA 2ITGA 3OYBA 1K8KB 3TTDA 1L3SA 4B9VA 2KFZA 2XY5A 3K5OA 4M63C 3EE9A 4CHPA 2RN2A 3M8RA 3HP9A 1W9HA 2HHSA 2LSNA 2HHTA 4JEPA 4XH5A 5T7BA 1JKHA 5M1QA 1JCFA 3B6OA 1QQMA 4CIGA 4AM6A 3UKUB 3O3FA 3FGUA 4DSIA 3LDQA 2FSJA 3CM5A 4CJ3A 3TAPA 2JGUA 3K5NA 5AFUA 1NKCA 4JAXA 1K73O 4AHVA 4JD2A 1IKVA 1S9GA 3PIOL 5FPMA 5H1SQ 3TAQA 4CEBA 3N4QA 2BGGA 4AQYK 3QERA 1YTUA 2GBZA 1KVBA 4CJQA 3M8PA 4KHQA 4OPHA 1HPZA 2YNHA 5JVHL 3SPYA 2QWPA 1Q7YO 4OLAA 2ASPA 4IFEA 5LMNK 4HUEA 4DG1A 2ZJRL 3VQ6A 4FLTA 4FPAA 4F4KA 4FWOA 3DLRA 3MX2A 5AQMA 2OZMA 2DFFA 2KTQA 4DTJA 3SAHA 1L3VA 3DLGA 2ZGYA 1N32K 4F8RA 5CYMA 2QK9A 3EY1A 1L3UA 1DGKN 1L5UA 3MN5A 4BR0A 5I9EB 2PAVA 3M1FA 4A2BA 3J7ZO 3BP8A 2E1YA 4JI6K 2YHBA 3HPGA 1RFQA 1QSYA 2YHWA 5GAGP 4KI6A 3ZSYA 3DLLL 4FWMA 5BREA 2DPNA 3I56N 3CETA 3QEXA 4AF1A 3AO4A 4GVMA 5KQ8A 1OKJA 4JD2B 4EP4A 4CEZA 3SBTA 1BI4A 1TAUA 4KFBA 3D45A 2Q0UA 3O9RA 1RDBA 1YAGA 3AVBA 1U48A 3IRXA 1QTMA 4FXDA 3TPQA 3VQ4A 1MWMA 4IFYA 2O8BA 1N5YA 4GKJK 2CGJA 4M3ZA 3OYEA 4HCCA 1RDDA 1Z26A 1N33K 4N41A 3BGRA 2ZF5O 4PHTX 3SK3A 1HLUA 3V9SA 1RBSA 1IKWA 2QEXN 3PUFA 3D2FA 4EHUA 1S22A 4FWLA 4ID1A 1HKBA 1DKGD 4YY3K 1S72N 2Q1NA 1D5AA 3C6UA 2P9NA 4CEAA 4W5RA 3KLIA 4IG3A 4BWJA 5AQYA 4Y1CA 2E2QA 4FWKA 4LFCK 4B3TK 4W5QA 5ELZA 3MMVA 3WXLA 4JKFA 4FZZA 1I3AA 3RRGA 3CC7N 3CCLN 3DLEA 5D3GA 1WSIA 3CC4N 3I0SA 1TK0A 3LPTA 4M3UA 1Q82O 1VSHA 5J2NA 3RMBA 3SLCA 3HK2A 4BVPA 2GEMA 3THYA 4CD3A 4CJLA 5DK5A 3OYLA 4JRPA 1YUWA 2O8EA 4EIAA 3DXMA 3ZSWA 3CFOA 1WBDA 3VF4A 2D0OA 3SUOA 4E3SA 5AQGA 3TTFA 4RW8A 3RWUA 5HRSA 4RG8A 1HNXK 2J4RA 4O5FA 3KWGA 4IJAA 4DSFA 1IH7A 1C1AA 4PUOA 5JMVA 1NGIA 3PX0A 2E2OA 4WFBL 4WQ5C 3IAYA 1WUAA 4LY7A 3ISNC 4ELTA 2HVHA 1BISA 1KXPA 3NVKA 4H5TA 3I33A 4O8KA 1L3TA 2QKKA 4CF8A 3PSIA 3MK6A 4YDUA 1VSLA 1HRHA 4E89A 3MCAB 3SPZA 4Z94A 4H0OA 3S9HA 2O4GA 3ZCMA 3PX4A 4CHOA 3WQUA 4AHSA 2G8IA 3M8SA 1WBBA 5C42A 1X9MA 3QDKA 4F2SA 4CJ5A 4CK2A 1Y97A 3O4NA 5M1PA 3LANA 4BRDA 3E1YA 1VQON 1E4GT 3ALYA 5EX5A 5CY4A 1OH5A 1RT4A 2P9PB 4B1UB 2Y1JA 3DRRA 4M45A 2HBLA 4OLBA 2Q97A 3K9JA 2UYTA 3HP6A 3OBWA 1NGEA 2BANA 3BUZB 1ATRA 3LDNA 4RTFD 3SQ1A 4CF9A 5K14A 4MO5A 2RE2A 4RCHA 4DR4K 3E9PA 4YNQA 1T6CA 3MN6A 3DRSA 2OTLN 3VEXA 2P9LA 4JLHA 5BPLA 5EOYA 3ENOA 3THWB 4CHQA 4DV6K 2VG5A 1RDCA 2RKIA 2FBXA 4MO4A 4KTQA 2D4WA 1S6PA 3PLAA 4IOAL 5GIPA 4L3QA 3V4IA 4DSJA 1ZBHA 3ZT4A 1UA0A 1BG3A 2DTUA 2V7YA 4BY9C 4K8XA 3ENBA 2YI1A 1J53A 4B08A 2A3ZA 4XEIA 5LJWA 4B1WB 4A62A 1HQEA 4DS4A 3H3OB 4X62K 1VSEA 2FF3B 1JLQA 4DU3A 5AQZA 1WSHA 2QXFA 4OGEA 5AQOA 1EX4A 1GLLO 2IVOA 4KHPK 1LV5A 4KTWA 1C6VA 2GWKA 4Z4EA 5JVGL 3VENA 3NH1A 1S1VA 1WSGA 1KD1O 3CJAA 3QINA 3O8MA 3DLKA 1NOYA 3TSPA 3D2EA 1KSPA 1JCGA 4C23A 3AAPA 5HOOA 2QW9A 3SCXA 4JKCA 1LWEA 2V52B 1IBKK 3C65A 5DM7L 2ASMA 1YTAA 1C0MA 3V1OA 3QLHA 2VQFK 1VSDA 4YOXA 5FLXO 4K25A 1VQ6N 1NM1A 1S1UA 3HVTA 4GNIA 4K42A 3I8DA 1BHLA 3K0SA 2BH1A 1EO1A 2YJFA 2YKMA 5F0XA 1RT5A 2QTDA 3ZT1A 2IDOA 4B1XB 1QVGM 4JS4A 3LALA 2HNYA 2YX6A 2KHOA 3OJUA 5AR0A 2OPSA 3OYAA 2PBDA 1S1TA 2RPIA 4O55A 2O8CA 4DSKA 4ILJA 3NF8A 3R3LA 1C0UA 4AHCA 2Z1GA 2VWBA 2NRZA 4GY2B 4DMNA 3BZCA 4J2EA 3RSEB 4H5RA 3P1GA 3CCVN 1D4XA 4DQSA 3LM9A 4GVEA 3OYFA 1K8KA 2XY8A 1Q9YA 1NGDA 4NB4A 4FLZA 3A2FA 3RR7A 1NK5A 3P83D 1HUXA 3D0PA 2GWJA 1XMOK 3J7AP 2GUIA 2I7PA 3OA9A 4KH4A 3TR8A 4JI1K 4YDUC 2UXDK 4QS8A 1EETA 2V7ZA 5F1XA 3T1HK 2WONA 5FPEA 5J1EA 3AGKA 3ITHA 4Y1DA 4RW7A 2E88A 4DKWA 3A0IX 1Z05A 3O1BA 2GV9A 1CXUA 1NGCA 1SKWA 4FSVA 3OHRA 1KFDA 2GTDA 3IKMA 3L0QA 1SS6A 3CCMN 4C1NI 4DQIA 3C6HA 4F3TA 1WN7A 2IVNA 2HSTA 2YNFA 2ASOA 3IFRA 3U9ZA 2B6AA 4YOYA 4BRGA 5C2FA 1RILA 4FJIA 1QQNA 3THXA 3E9OA 4E7IA 4BR9A 3T7ZA 3RTVA 4JI7K 4DSEA 4CEFA 4DLGA 2IIRA 3WT0A 5A2QO 1HYZA 1VAZA 3WNGA 4I9LA 3LP1A 4BDZA 1N6QA 4QS7A 1K9MO 3BEXA 4BRCA 4BQLA 2FXUA 4JKGA 3NCIA 2X6NA 1TKZA 3SQ4A 3H6EA 3QBWA 4DTMA 2VCPA 3AV9A 5KRTA 5AQPA 3IS9A 4GKKK 3OYKA 4BRFA 1WSJA 4O44A 1QZ5A 3CQYA 2QWLA 2P9UB 4FJKA 2BUPA 3AVAA 4AHRA 4K0KK 4CW7B 2I5JA 3FE1A 3PIPL 2G8WA 4CJRA 1BGXT 3EZWA 1IBLK 3CERA 3EN9A 4IDKA 3FZFA 4I6MB 4BDPA 1JXBA 3AO2A 1MWKA 1SV5A 1QHTA 3U9DA 4IJNA 1QVFM 1YIJN 4FWRA 2O8EB 3RMDA 3DXMB 4BC4A 4B9TA 3H46O 4JI2K 2AJQA 1LAWA 2FBYA 3A5OC 1U47A 2P9IA 1HX1A 5KTQA 1O1WA 5AQXA 1RBVA 3AVJA 4O4GA 1ZC6A 4PKHA 4FZXC 2UXCK 5C2DA 4QS9A 4JKAA 4CECA 4CEOA 3T3FA 3QEWA 3NDKA 3NF6A 1IKYA 3LDLA 3ZSZA 3WEEB 5KPTA 4FJNA 3NBPA 3R6MA 4OKKA 2EWSA 1NJIO 4NYNA 4BC5A 3CC2N 3ULEA 1GOAA 3FFKB 1ASVA 3KJVA 3CCJN 1R0AA 1V4SA 4DR2K 5HRRA 4I9QA 4CE9A 4KV8A 4FPBA 4O0JA 5KI6A 1TYQB 2VYPA 1WB9A 4ZTJA 2XRIA 3U4LA 4MLEA 4DR5K 2HF3A 1SL1A 2Y1IA 4FJJA 1NJZA 3TI0A 5AQFA 4DUZK 4GMJB 3CXCM 4HVJA 4U7BA 2FBTA 4IDHA 4H5WA 2E4LA 1X3NA 1NMNA 4LF9K 4LF6K 2D1KA 1TGOA 4XIUA 4HTUA 5AFUH 1NK9A 4OKEA 3VPZA 1Q8IA 3NH0A 4FLXA 2WFBA 4DTNA 1IJJA 1FXXA 3ID6A 3V9UA 3VMFB 3KLGA 1HJRA 4JI8K 4B3SK 5C10A 5HRNA 4DV3K 2D0BA 1NBWA 3L2UA 4CD1A 4EAHD 4OO1J 4CBWA 4BE0A 4FJMA 3MECA 5CZ1A 3SYZA 2OYQA 3ENHA 1ZYQA 1BQNA 3HSCA 1KAZA 3VOVA 1QSSA 1KLMA 2HB5A 2Q31A 3O1WA 1HYSA 1RTDA 4W5OA 1JLEA 3ZETB 1NKEA 5AQRA 4YHHK 3ULDA 1XWLA 4DS5A 4C8OA 5JS1A 1YVNA 1OH6A 3V6DA 4O5BA 3CJ7A 4B9QA 4ILHA 2A5XA 3EKSA 3DWLA 4YOVA 3L4QA 1T7PA 1D8YA 1C1BA 2NNWA 4E7JA 3LP3A 5KGWA 3OJSA 1KVCA 3O08A 2IGIA 4FW2A 4E1MA 3QEPA 2A6AA 3UKRB 2UUAK 3CQXA 1X9SA 4B9LA 3AVHA 1NK4A 1HR0K 4LFBK 3ZT2A 1JLCA 4KKOA 5C12A 1QS4A 5AQIA 4E7HA 3OYJA 1BCOA 5CR4A 4C8KA 3DM2A 3ATVA 2P9SA 2B4JA 4HCBA 4NLBA 2RF2A 4FWSA 3AARA 4CJSA 3V81A 4Z0UA 4JS5A 1W0HA 3KHYA 2P5OA 1E4FT 3VTIA 4X65K 5AQHA 5BN8A 4MFBA 1DEJA 1SAZA 1N34K 1J5EK 4CHZA 2BE2A 3KVGA 1OVYA 3AVNA 3VQEA 4WF9L 3K2PA 3CD6N 3TU5A 4F2RA 4CGDA 5KRSA 3BDPA 3T1YK 4FCYA 3Q7BA 1JL2A 5LJVA 1SL0A 1YITN 1ATNA 2VWKA 3SQ0A 3ATUA 1YXQA 1B9FA 1HNZK 3V9ZA 1GLJO 3LAKA 3MEGA 1HNWK 4DV4K 2QKBA 2IAJA 2HW3A 2VQEK 3NH2A 3WXJA 1ZXOA 4KREA 1MU2A 2ZWHA 3LWMA 2JLEA 1YHQN 4I2QA 4J2AA 4PWDA 3H08A 3WNEA 1NNEA 3N4PA 3VGLA 5AQTA 4CZHA 5FPDA 1IG9A 4CGIA 1EWRA 3PO5A 3CMAN 3F73A 4KRFA 2CGLA 3D7EO 3AVLA 5AQVA 3SBGA 3C94A 3VQQA 4PY5A 4BGAA 3FR0A 4DTSA 4C8NA 4H0TB 5AJ3K 3AVIA 1K6YA 3HXMA 4F9OA 2NUBA 4KB0A 1H1VA 3F9MA 3KK2A 3OY9A 4CJUA 4FM2A 2Q2RA 4BDYA 5M1OA 4KI4A 1SL2A 4CZFA 4M3XA 4EHTA 3KLEA 4H0XB 5HROA 4CGFA 2VG7A 3OS1A 4DV0K 2YKNA 5EU7A 2P9UA 3LM2A 1BCMA 2WUSA 2A41A 4DTUA 4OX9K 3ZYYX 1UAXA 3SAGA 1TUUA 4C8MA 2HHWA 1IV0A 1SQKA 3AO3A 2A1SA 4CFCA 1IG8A 2Q0RA 4FJ7A 1LOTB 5GINA 3O6WA 4CZJA 1KC8O 4HHTA 3HM9A 1GLEG 1XHXA 1GLFO 1RT1A 2QWRA 4W5TA 4XH4A 2ZQBA 3SUNA 4E7KA 2ATQA 2W6LA 2D0PA 3KLFA 2OTJN 4N47A 2FF6A 4JKDA 4BRLA 4H8KA 1Q86O 4PKIA 3EKUA 2OANA 3U3GA 3WNHA 4GV6A 1FJGK 3T1AA 2E2PA 1HKGA 4E19A 3IG1A 4CVNE 1VQNN 5IT9O 3CYMA 3NGYA 3LZJA 4J2DA 2P9NB 3V9WA 1BL3A 4I7FA 4K43A 3DJCA 3I55N 3CPEA 4FLUA 1B92A 1JL1A 3F9KA 4B9SA 4AM7A 2O8BB 5EXWA 1RTJA 1TKTA 3BF1A 5BRFA 4B8AB 5AQKA 5HLFA 3MX5A 2KZMA 3QFUA 3SV3A 5GAHP 4DQ8A 3AA3A 4WFNL 3FFIA 1FKOA 4B8CA 4KTZA 2W40A 2P9KB 1D9FA 4JI5K 4BWMA 1V4TA 4CEEA 4BQZA 5AZIA 4BACA 1U4BA 3HOTA 4ISFA 4FWPA 4E1JA 2NRXA 3TTCA 4LF7K 1G99A 4CEQA 2YV0X 4Q5VA 3AA2A 2F96A 3H1VX 2NRHA 4EFHA 4W5NA 1LWFA 3H3NO 3K9KA 3VESA 4KH6A 2P9KA 4KHWA 3V1QA 4M7YA 3QNNA 3KTQA 3SI6A 2B5JA 3OS0A 2OPQA 3KZBA 3R9PA 2ZJQL 3AAQA 4IO8A 3VQAA 3QIPA 3V9XA 4DFJA 4LH4A 5J2PA 1MDUB 4FK4A 3EL2A 4U67L 3AVMA 1VQPN 4NLCA 4BC3A 4WQ4C 4DFKA 4DR3K 1KCFA 1NLVA 2G8FA 3SJHA 2Z1JA 3LWLA 2HNDA 4F3OA 2YNGA 4FW1A 4H0VB 2G8KA 2BTFA 4FJGA 4JKEA 1XNQK 3G25A 5JLFA 2XHBA 3P5JA 1ZBIA 4H5VA 3WUHA 4KHSA 4EZ6A 3S41A 4OGCA 2F9TA 3E9LA 3KK7A 1TK8A 1OH8A 1B9DA 4Z4HA 2QXLA 5C15A 3DOLA 4FZYA 1P90A
chains in the Genus database with same CATH topology
2G8WA 4CJRA 3VA0A 1BGXT 4KHUA 1L5UA 4ELUA 4DTRA 4B9UA 4FJ9A 4IDKA 4BDPA 3OYNA 1JXBA 3AO2A 1T05A 2YHBA 1FK9A 3HPGA 2PYJA 4JRQA 1SV5A 1QHTA 3VQPA 1EP4A 2EHGA 3TANA 1QSYA 1GOBA 3RMDA 1TVRA 2IS3A 4QCLA 1VSIA 4B9TA 2AJQA 1LAWA 2FBYA 2G8UA 4PA1A 4OPKA 3K5LA 4DLEA 3RRHA 1U47A 2G8VA 4KI6A 5KTQA 1O1WA 4E0DA 2XO7A 3KLHA 3ZSYA 1RBVA 4CJ4A 3QETA 5HP1A 1L3UA 3AVJA 3AO1A 2FBVA 4O4GA 4FZXC 1X9WA 3O3HA 4CECA 3NHGA 4Z4IA 4CEOA 3T3FA 3QEWA 3NDKA 1I39A 1VSKA 3NF6A 4CHNA 3QEXA 1T03A 3AO4A 4GVMA 1IKYA 4EP4A 3TWHA 4CEZA 3ZSZA 1BI4A 1TAUA 4KFBA 2HNZA 4FJNA 3D45A 3NBPA 3ZSXA 4OKKA 1RDBA 4M3WA 3AVBA 4NYNA 2OPPA 1ASWA 3IRXA 1U48A 1QTMA 4EZ9A 3OVNA 4FXDA 3VQ4A 4IFYA 1GOAA 1N5YA 1ASVA 4R5PA 3KJVA 3K58A 2BDPA 1BIUA 1R0AA 2E6LA 4M3ZA 2OPRA 3OYEA 5HRRA 4HCCA 4I9QA 4KO0A 4E7LA 3K5MA 1RDDA 4CE9A 4M3YA 4KV8A 2X78A 1Z26A 3AVFA 4O0JA 5KI6A 3OYGA 4KPYA 4N41A 4GW6A 4B9MA 1S1WA 3BGRA 4ZTJA 2DY4A 1S5JA 2XRIA 4CK3A 4WE1A 2Y1IA 1SL1A 3V9SA 1RBSA 3SV4A 4FJJA 1IKWA 1NOZA 3PUFA 1JLFA 4CGJA 1NJZA 1NJWA 3TI0A 2KQ2A 2G8HA 4ID1A 2YHAA 1D5AA 4CJWA 4GMJB 3C6UA 3CM6A 4CEAA 4HVJA 3KLIA 4W5RA 2FBTA 4IG3A 4BWJA 3HJFA 4Y1CA 5SZTA 2E4LA 3CQ8A 4DFMA 4NYFA 1TGOA 1J9AA 1F21A 4XIUA 4W5QA 4HTUA 1DTQA 1NK9A 1WAJA 4OKEA 1Q8IA 3NH0A 4FLXA 1NJXA 4FZZA 4DTNA 1I3AA 3RRGA 1FXXA 3V9UA 4AILC 1G15A 3DLEA 5D3GA 1Q9XA 1WSIA 1HJRA 3AA5X 3I0SA 3KLGA 1TK0A 5HRNA 3L2QA 3LPTA 4M3UA 2D0BA 3E01A 1A5WA 3L2UA 1VSHA 4F3TA 1RT7A 3G0ZA 5J2NA 3RMBA 4LSNA 5HRPA 3HPHA 4BE0A 3HK2A 4FJMA 3MECA 5CZ1A 3VQBA 4CJLA 4DTOA 1VSFA 5DK5A 3OYLA 4JRPA 3SYZA 5JS2A 4DQRA 1HMVA 1ZYQA 2OYQA 1TL1A 1BQNA 1QSSA 4ZHRA 3ZSWA 3CFOA 1KLMA 4FJXA 3QIOA 4IG0A 4DF8A 3SUOA 2HB5A 4CFAA 4E3SA 4CIFA 3I0RA 3THVA 4RW8A 3RWUA 1RTDA 4FK2A 1HYSA 3KKSA 4W5OA 3NE6A 3QESA 1JLEA 5HRSA 4RG8A 1RBRA 1NKEA 3ULDA 1XWLA 4DSFA 4EP5A 1XHZA 1C1CA 1IH7A 4OKJA 4AHTA 2HHUA 1C1AA 1BI4B 4OVLA 4DS5A 4PUOA 4C8OA 3PX0A 4G1QA 4AH9A 5JS1A 1LAVA 1TL3A 3V6DA 4O5BA 3IAYA 2A1RA 4LY7A 4MQ3A 3SQ2A 3NFAA 2D5RA 4FK0A 2PYLA 3ISNC 3LZIA 4ELTA 2HVHA 4B3OA 1BISA 2PZSA 3C6TA 1T7PA 3QNOA 4KHYA 1TAQA 3AVKA 4IBNA 4CIEA 1HYVA 1D8YA 1XI1A 2HMIA 1C1BA 4E7JA 3NGIA 3LP3A 1L3TA 2QKKA 4NCGA 5KGWA 4CF8A 1LW0A 1KVCA 3OJSA 1TK5A 2IGIA 5FRNA 1VSLA 3O3GA 1HRHA 2D0CA 4FW2A 2IC3A 4E1MA 4E89A 3QEVA 1J5OA 3QEPA 3SPZA 1RTIA 3QO9A 3S9HA 4N56A 5KGXA 3OYCA 3L2VA 1X9SA 4B9LA 2O4GA 3MXJA 3AVHA 4FYDA 3ZCMA 4FM0A 1NK4A 3PX4A 4CHOA 3EYZA 4CERA 3VQ7A 3ZT2A 4M3TA 4AHSA 2G8IA 3VQ9A 1JLCA 1VK0A 4KKOA 3ZT0A 1LW2A 1QS4A 3M8SA 4CJEA 4E7HA 3VQ5A 3VQDA 5C42A 3HO1A 4UQGA 3OYJA 1BCOA 1X9MA 4F2SA 1S9EA 3LAMA 4CJ5A 3DM2A 4RW6A 1QQCA 3K59A 4B9NA 4C8KA 4CJFA 4CK2A 1Y97A 3KIOA 1RTHA 1LWCA 2B4JA 3O4NA 5SWMA 4HCBA 3LANA 2RF2A 3DOKA 3O4QA 2FC0A 4CJSA 1NJYA 4C8LA 4FJ5A 1KRPA 3ALYA 4RW4A 4Z0UA 4LD0A 3V81A 4JS5A 4J2BA 3B6PA 5CY4A 1NK6A 1RT4A 4FJHA 1W0HA 4DU4A 2Y1JA 2VG6A 3DRRA 3CFPA 3DLBA 3RR8A 2P5OA 1U49A 1WSFA 3UIQA 4M45A 4HUFA 4BE1A 4OLBA 3ZT3A 3HP6A 1EXQA 3SNNA 2BANA 3SQ1A 4MFBA 4AHUA 3ZSOA 4FM1A 4H4OA 4CF9A 3HT3A 4CHZA 1VSMA 5K14A 2BE2A 3NF7A 1CZ9A 1VRTA 3AVNA 3VQEA 2O4IA 3KKRA 3L2WA 3K2PA 2HHQA 5DMRA 4Z4FA 4O0IA 1VSJA 1YT3A 4YNQA 3S3OA 4F2RA 4CGDA 5KRSA 1XC9A 4FLWA 3BDPA 5I42A 3DRSA 1KFSA 2WOMA 4FCYA 1CZBA 1JL2A 1JXEA 1QE1A 1SL0A 3MAQA 3AVGA 4NCAA 4JLHA 2VWKA 1JLBA 3SQ0A 4NCBA 3S3NA 3VQCA 3HSTB 3RMAA 4DF4A 1B9FA 5J2MA 3KK1A 1NK0A 4CHQA 3V9ZA 1HNVA 1UA1A 2XY6A 2W42A 4K8ZA 4CJVA 2VG5A 3LAKA 1RDCA 3MEGA 2KZZA 3CFRA 3LP2A 2RKIA 5CZ2A 2FBXA 3JYTA 2QKBA 2IAJA 2HW3A 3L3VA 3SJJA 2P5GA 4KTQA 3NH2A 3SZ2A 2VWJA 3RMCA 1S6PA 1YVUA 4ICLA 4FLYA 1A5VA 4KREA 3V4IA 1MU2A 2P1JA 5FDLA 4DSJA 3ZT4A 1UA0A 3LWMA 4IKFA 4H4MA 4DTPA 4FJ8A 1ZBHA 1WSEA 1TKXA 2DTUA 5C25A 3TAEA 2ZD1A 3ASMA 2ZE2A 2JLEA 3TAMA 3OYIA 1REVA 2D0AA 4I2QA 4K8XA 1X1PA 4J2AA 3H08A 4PWDA 3WNEA 2E6MA 1DTTA 1J53A 1C0TA 3AA4A 1GOCA 1IG9A 3PO4A 4B08A 1WAFA 2IOCA 3V1RA 4CGIA 4CHYA 3VA3A 3TAGA 1HQEA 3PO5A 4DS4A 3ZSVA 3F73A 1VSEA 4KRFA 3L8BA 3AVLA 4KHNA 1JLQA 1RNHA 4DU3A 3C94A 4LSLA 3VQQA 4PY5A 1DLOA 1WSHA 3PX6A 2QXFA 3HL8A 4OGEA 3MEDA 4HUGA 5E41A 4C8NA 4CESA 4DTSA 4DFPA 1EX4A 1A5XA 3AVIA 1K6YA 3HXMA 4CGGA 2NUBA 4KB0A 3VQ8A 3HPOA 1SKRA 1LV5A 4KTWA 4CF1A 4CFBA 1C6VA 3KK2A 3OY9A 3LPUA 3M8QA 4Z4EA 4CJUA 4FM2A 4BDYA 1RT6A 4E1NA 1RBTA 3NH1A 4KI4A 1S1VA 1SL2A 3C95A 2KFNA 1WSGA 4KB1A 4M3XA 1CLQA 3QINA 2Z1IA 4CFDA 1JLAA 3KLEA 4ELVA 3DLKA 4CK1A 1NKBA 1UWBA 5HROA 3OYHA 4CGFA 1NOYA 1EKEA 2VG7A 3K57A 2OZSA 4I2PA 4Z4CA 3OS1A 2YKNA 1KSPA 5EU7A 4DWIA 2EX3A 4M42A 4QOZB 3SCXA 3CG7A 4DU1A 1BCMA 4L8RB 1LWEA 1WNSA 4N76A 4DTUA 5J2QA 1YTAA 1C0MA 3ZSRA 3V1OA 2HHXA 1UAXA 3QLHA 3LP0A 2R7YA 1IKXA 2P51A 4C8MA 2HHWA 4M41A 3T19A 3AO3A 1VSDA 3HVRA 2A1SA 3L3UA 4CFCA 1NK7A 4BE2A 3KK3A 5C24A 1SKSA 1S1UA 4FJ7A 3HVTA 1KTQA 1FKPA 3I8DA 5I3UA 1BHLA 4HHTA 3OYMA 2ETJA 2YKMA 3HM9A 1XHXA 1RT5A 1RT1A 3DRPA 1CXQA 2IDOA 1J54A 3ZT1A 1RT3A 4CEDA 4W5TA 3NAEA 4JS4A 2ZQBA 4FLVA 3U6FA 2Z1HA 3LALA 4E7KA 3HYFA 3SUNA 2ATQA 1TKDA 2HNYA 4CF2A 1NK8A 3OJUA 2OPSA 3OYAA 3KLFA 4N47A 4H8KA 3U3YA 1S1TA 4N5SA 2RPIA 4O55A 4ZTFA 3TABA 4CJTA 4Z4GA 2DFEA 1UOCA 1D9DA 1ZBLA 4DSKA 3U3GA 4OJRA 2X74A 3WNHA 3NF8A 2YNIA 1C0UA 4AHCA 4CJKA 3NGZA 3ZSQA 3AO5A 2Z1GA 3KD5E 4DSLA 1BQMA 1JLGA 4DMNA 3OYDA 3T1AA 4J2EA 4E19A 1HQUA 3IG1A 2XY7A 4Q0BA 3P1GA 4DQSA 3CYMA 3NGYA 5CYQA 3OYFA 2XY8A 2KW4A 3JSMA 3LZJA 1Q9YA 4J2DA 1Z25A 3DMJA 3MXIA 3LDSA 4FLZA 3A2FA 3V9WA 1NK5A 3RR7A 3P83D 1ASUA 1QSLA 4ID5A 4KAZA 2F8TA 1BL3A 1RT2A 4I7FA 3EZ5A 3TAFA 4CF0A 3D0PA 1IO2A 4QAGA 4FLUA 1B92A 1JL1A 3F9KA 4B9SA 3S3MA 1RTJA 1S6QA 2GUIA 3SUQA 1TKTA 3VN5A 2HVIA 3TR8A 3KD1E 4B8AB 5HLFA 1RBUA 4DQQA 2KZMA 3SV3A 1EETA 3AA3A 3FFIA 1FKOA 4B8CA 4KTZA 3MXMA 2WONA 3AVCA 4LH5A 5J1EA 1D9FA 1VRUA 1RCHA 4M3RA 4BWMA 1HNIA 1U04A 3ITHA 1S1XA 3L2RA 5HBMA 4Y1DA 4CEEA 3QEIA 4BACA 1U4BA 3DYAA 4RW7A 2Q3SA 4FVMA 3G10A 4RW9A 3DLHA 2GV9A 3DI6A 1CXUA 2YV0X 3MEEA 2ITGA 4CEQA 3AA2A 4Q5VA 3OYBA 1SKWA 2OA8A 3PY8A 2KFZA 1L3SA 4B9VA 2F8SA 1KFDA 2F96A 2XY5A 3K5OA 4YFUA 1T8EA 4W5NA 1LWFA 4CHPA 2RN2A 3SUPA 4KHWA 3M8RA 3V1QA 3HP9A 1ITGA 1WN7A 2YNFA 3QNNA 3KTQA 1W9HA 4DQIA 2HHSA 1RDAA 2LSNA 2B6AA 2HHTA 3NF9A 5T7BA 1JKHA 1RILA 1SUQA 3SI6A 2B5JA 4DTXA 4FJIA 3OS0A 2OPQA 3B6OA 4TSXA 4CIGA 4CJPA 4E7IA 4PQUA 3RTVA 3O3FA 5FRMA 4DSIA 4IFVA 4CEFA 4DSEA 3CM5A 4CJ3A 1ZBUA 3VQAA 3QIPA 3TAPA 2JGUA 3K5NA 3TARA 4DLGA 3V9XA 1NKCA 4DQPA 3OS2A 4DFJA 4AHVA 4LH4A 1BIZA 1HYZA 1IKVA 5J2PA 4FK4A 1S9GA 3AVMA 1KVAA 3WNGA 3TAQA 4I9LA 4CEBA 1ZBFA 3LP1A 4BDZA 1N6QA 2DFHA 4DFKA 2BGGA 1KCFA 3NCIA 2G8FA 2X6SA 2Z1JA 1TV6A 5FROA 3QERA 1YTUA 2X6NA 1TKZA 1KVBA 2GBZA 4CJQA 3LWLA 3SQ4A 3M8PA 1KLNA 2HNDA 4DTMA 4F3OA 2YNGA 4FW1A 4KHQA 4CGHA 2G8KA 1HPZA 3AV9A 4FJGA 5KRTA 2YNHA 3SPYA 3IS9A 4OLAA 2XHBA 3P5JA 1WLJA 3OYKA 1WSJA 4HUEA 1ZBIA 4DG1A 4FLTA 4O44A 3VQ6A 4F4KA 1U45A 4CCHA 4EZ6A 4KHSA 2HHVA 4OPJA 4OGCA 3DLRA 1TK8A 2PY5A 2OZMA 3PV8A 4FJKA 2DFFA 2KTQA 4DTJA 1L3VA 1B9DA 4Z4HA 3WNFA 3DOLA 3DLGA 3AVAA 4AHRA 4FZYA 2I5JA 4F8RA 5CYMA 2QK9A 3EY1A 4FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8W A;  4CJR A;  3VA0 A;  1BGX T;  4KHU A;  1L5U A;  4ELU A;  4DTR A;  4B9U A;  4FJ9 A;  4IDK A;  4BDP A;  3OYN A;  1JXB A;  3AO2 A;  1T05 A;  2YHB A;  1FK9 A;  3HPG A;  2PYJ A;  4JRQ A;  1SV5 A;  1QHT A;  3VQP A;  1EP4 A;  2EHG A;  3TAN A;  1QSY A;  1GOB A;  3RMD A;  1TVR A;  2IS3 A;  4QCL A;  1VSI A;  4B9T A;  2AJQ A;  1LAW A;  2FBY A;  2G8U A;  4PA1 A;  4OPK A;  3K5L A;  4DLE A;  3RRH A;  1U47 A;  2G8V A;  4KI6 A;  5KTQ A;  1O1W A;  4E0D A;  2XO7 A;  3KLH A;  3ZSY A;  1RBV A;  4CJ4 A;  3QET A;  5HP1 A;  1L3U A;  3AVJ A;  3AO1 A;  2FBV A;  4O4G A;  4FZX C;  1X9W A;  3O3H A;  4CEC A;  3NHG A;  4Z4I A;  4CEO A;  3T3F A;  3QEW A;  3NDK A;  1I39 A;  1VSK A;  3NF6 A;  4CHN A;  3QEX A;  1T03 A;  3AO4 A;  4GVM A;  1IKY A;  4EP4 A;  3TWH A;  4CEZ A;  3ZSZ A;  1BI4 A;  1TAU A;  4KFB A;  2HNZ A;  4FJN A;  3D45 A;  3NBP A;  3ZSX A;  4OKK A;  1RDB A;  4M3W A;  3AVB A;  4NYN A;  2OPP A;  1ASW A;  3IRX A;  1U48 A;  1QTM A;  4EZ9 A;  3OVN A;  4FXD A;  3VQ4 A;  4IFY A;  1GOA A;  1N5Y A;  1ASV A;  4R5P A;  3KJV A;  3K58 A;  2BDP A;  1BIU A;  1R0A A;  2E6L A;  4M3Z A;  2OPR A;  3OYE A;  5HRR A;  4HCC A;  4I9Q A;  4KO0 A;  4E7L A;  3K5M A;  1RDD A;  4CE9 A;  4M3Y A;  4KV8 A;  2X78 A;  1Z26 A;  3AVF A;  4O0J A;  5KI6 A;  3OYG A;  4KPY A;  4N41 A;  4GW6 A;  4B9M A;  1S1W A;  3BGR A;  4ZTJ A;  2DY4 A;  1S5J A;  2XRI A;  4CK3 A;  4WE1 A;  2Y1I A;  1SL1 A;  3V9S A;  1RBS A;  3SV4 A;  4FJJ A;  1IKW A;  1NOZ A;  3PUF A;  1JLF A;  4CGJ A;  1NJZ A;  1NJW A;  3TI0 A;  2KQ2 A;  2G8H A;  4ID1 A;  2YHA A;  1D5A A;  4CJW A;  4GMJ B;  3C6U A;  3CM6 A;  4CEA A;  4HVJ A;  3KLI A;  4W5R A;  2FBT A;  4IG3 A;  4BWJ A;  3HJF A;  4Y1C A;  5SZT A;  2E4L A;  3CQ8 A;  4DFM A;  4NYF A;  1TGO A;  1J9A A;  1F21 A;  4XIU A;  4W5Q A;  4HTU A;  1DTQ A;  1NK9 A;  1WAJ A;  4OKE A;  1Q8I A;  3NH0 A;  4FLX A;  1NJX A;  4FZZ A;  4DTN A;  1I3A A;  3RRG A;  1FXX A;  3V9U A;  4AIL C;  1G15 A;  3DLE A;  5D3G A;  1Q9X A;  1WSI A;  1HJR A;  3AA5 X;  3I0S A;  3KLG A;  1TK0 A;  5HRN A;  3L2Q A;  3LPT A;  4M3U A;  2D0B A;  3E01 A;  1A5W A;  3L2U A;  1VSH A;  4F3T A;  1RT7 A;  3G0Z A;  5J2N A;  3RMB A;  4LSN A;  5HRP A;  3HPH A;  4BE0 A;  3HK2 A;  4FJM A;  3MEC A;  5CZ1 A;  3VQB A;  4CJL A;  4DTO A;  1VSF A;  5DK5 A;  3OYL A;  4JRP A;  3SYZ A;  5JS2 A;  4DQR A;  1HMV A;  1ZYQ A;  2OYQ A;  1TL1 A;  1BQN A;  1QSS A;  4ZHR A;  3ZSW A;  3CFO A;  1KLM A;  4FJX A;  3QIO A;  4IG0 A;  4DF8 A;  3SUO A;  2HB5 A;  4CFA A;  4E3S A;  4CIF A;  3I0R A;  3THV A;  4RW8 A;  3RWU A;  1RTD A;  4FK2 A;  1HYS A;  3KKS A;  4W5O A;  3NE6 A;  3QES A;  1JLE A;  5HRS A;  4RG8 A;  1RBR A;  1NKE A;  3ULD A;  1XWL A;  4DSF A;  4EP5 A;  1XHZ A;  1C1C A;  1IH7 A;  4OKJ A;  4AHT A;  2HHU A;  1C1A A;  1BI4 B;  4OVL A;  4DS5 A;  4PUO A;  4C8O A;  3PX0 A;  4G1Q A;  4AH9 A;  5JS1 A;  1LAV A;  1TL3 A;  3V6D A;  4O5B A;  3IAY A;  2A1R A;  4LY7 A;  4MQ3 A;  3SQ2 A;  3NFA A;  2D5R A;  4FK0 A;  2PYL A;  3ISN C;  3LZI A;  4ELT A;  2HVH A;  4B3O A;  1BIS A;  2PZS A;  3C6T A;  1T7P A;  3QNO A;  4KHY A;  1TAQ A;  3AVK A;  4IBN A;  4CIE A;  1HYV A;  1D8Y A;  1XI1 A;  2HMI A;  1C1B A;  4E7J A;  3NGI A;  3LP3 A;  1L3T A;  2QKK A;  4NCG A;  5KGW A;  4CF8 A;  1LW0 A;  1KVC A;  3OJS A;  1TK5 A;  2IGI A;  5FRN A;  1VSL A;  3O3G A;  1HRH A;  2D0C A;  4FW2 A;  2IC3 A;  4E1M A;  4E89 A;  3QEV A;  1J5O A;  3QEP A;  3SPZ A;  1RTI A;  3QO9 A;  3S9H A;  4N56 A;  5KGX A;  3OYC A;  3L2V A;  1X9S A;  4B9L A;  2O4G A;  3MXJ A;  3AVH A;  4FYD A;  3ZCM A;  4FM0 A;  1NK4 A;  3PX4 A;  4CHO A;  3EYZ A;  4CER A;  3VQ7 A;  3ZT2 A;  4M3T A;  4AHS A;  2G8I A;  3VQ9 A;  1JLC A;  1VK0 A;  4KKO A;  3ZT0 A;  1LW2 A;  1QS4 A;  3M8S A;  4CJE A;  4E7H A;  3VQ5 A;  3VQD A;  5C42 A;  3HO1 A;  4UQG A;  3OYJ A;  1BCO A;  1X9M A;  4F2S A;  1S9E A;  3LAM A;  4CJ5 A;  3DM2 A;  4RW6 A;  1QQC A;  3K59 A;  4B9N A;  4C8K A;  4CJF A;  4CK2 A;  1Y97 A;  3KIO A;  1RTH A;  1LWC A;  2B4J A;  3O4N A;  5SWM A;  4HCB A;  3LAN A;  2RF2 A;  3DOK A;  3O4Q A;  2FC0 A;  4CJS A;  1NJY A;  4C8L A;  4FJ5 A;  1KRP A;  3ALY A;  4RW4 A;  4Z0U A;  4LD0 A;  3V81 A;  4JS5 A;  4J2B A;  3B6P A;  5CY4 A;  1NK6 A;  1RT4 A;  4FJH A;  1W0H A;  4DU4 A;  2Y1J A;  2VG6 A;  3DRR A;  3CFP A;  3DLB A;  3RR8 A;  2P5O A;  1U49 A;  1WSF A;  3UIQ A;  4M45 A;  4HUF A;  4BE1 A;  4OLB A;  3ZT3 A;  3HP6 A;  1EXQ A;  3SNN A;  2BAN A;  3SQ1 A;  4MFB A;  4AHU A;  3ZSO A;  4FM1 A;  4H4O A;  4CF9 A;  3HT3 A;  4CHZ A;  1VSM A;  5K14 A;  2BE2 A;  3NF7 A;  1CZ9 A;  1VRT A;  3AVN A;  3VQE A;  2O4I A;  3KKR A;  3L2W A;  3K2P A;  2HHQ A;  5DMR A;  4Z4F A;  4O0I A;  1VSJ A;  1YT3 A;  4YNQ A;  3S3O A;  4F2R A;  4CGD A;  5KRS A;  1XC9 A;  4FLW A;  3BDP A;  5I42 A;  3DRS A;  1KFS A;  2WOM A;  4FCY A;  1CZB A;  1JL2 A;  1JXE A;  1QE1 A;  1SL0 A;  3MAQ A;  3AVG A;  4NCA A;  4JLH A;  2VWK A;  1JLB A;  3SQ0 A;  4NCB A;  3S3N A;  3VQC A;  3HST B;  3RMA A;  4DF4 A;  1B9F A;  5J2M A;  3KK1 A;  1NK0 A;  4CHQ A;  3V9Z A;  1HNV A;  1UA1 A;  2XY6 A;  2W42 A;  4K8Z A;  4CJV A;  2VG5 A;  3LAK A;  1RDC A;  3MEG A;  2KZZ A;  3CFR A;  3LP2 A;  2RKI A;  5CZ2 A;  2FBX A;  3JYT A;  2QKB A;  2IAJ A;  2HW3 A;  3L3V A;  3SJJ A;  2P5G A;  4KTQ A;  3NH2 A;  3SZ2 A;  2VWJ A;  3RMC A;  1S6P A;  1YVU A;  4ICL A;  4FLY A;  1A5V A;  4KRE A;  3V4I A;  1MU2 A;  2P1J A;  5FDL A;  4DSJ A;  3ZT4 A;  1UA0 A;  3LWM A;  4IKF A;  4H4M A;  4DTP A;  4FJ8 A;  1ZBH A;  1WSE A;  1TKX A;  2DTU A;  5C25 A;  3TAE A;  2ZD1 A;  3ASM A;  2ZE2 A;  2JLE A;  3TAM A;  3OYI A;  1REV A;  2D0A A;  4I2Q A;  4K8X A;  1X1P A;  4J2A A;  3H08 A;  4PWD A;  3WNE A;  2E6M A;  1DTT A;  1J53 A;  1C0T A;  3AA4 A;  1GOC A;  1IG9 A;  3PO4 A;  4B08 A;  1WAF A;  2IOC A;  3V1R A;  4CGI A;  4CHY A;  3VA3 A;  3TAG A;  1HQE A;  3PO5 A;  4DS4 A;  3ZSV A;  3F73 A;  1VSE A;  4KRF A;  3L8B A;  3AVL A;  4KHN A;  1JLQ A;  1RNH A;  4DU3 A;  3C94 A;  4LSL A;  3VQQ A;  4PY5 A;  1DLO A;  1WSH A;  3PX6 A;  2QXF A;  3HL8 A;  4OGE A;  3MED A;  4HUG A;  5E41 A;  4C8N A;  4CES A;  4DTS A;  4DFP A;  1EX4 A;  1A5X A;  3AVI A;  1K6Y A;  3HXM A;  4CGG A;  2NUB A;  4KB0 A;  3VQ8 A;  3HPO A;  1SKR A;  1LV5 A;  4KTW A;  4CF1 A;  4CFB A;  1C6V A;  3KK2 A;  3OY9 A;  3LPU A;  3M8Q A;  4Z4E A;  4CJU A;  4FM2 A;  4BDY A;  1RT6 A;  4E1N A;  1RBT A;  3NH1 A;  4KI4 A;  1S1V A;  1SL2 A;  3C95 A;  2KFN A;  1WSG A;  4KB1 A;  4M3X A;  1CLQ A;  3QIN A;  2Z1I A;  4CFD A;  1JLA A;  3KLE A;  4ELV A;  3DLK A;  4CK1 A;  1NKB A;  1UWB A;  5HRO A;  3OYH A;  4CGF A;  1NOY A;  1EKE A;  2VG7 A;  3K57 A;  2OZS A;  4I2P A;  4Z4C A;  3OS1 A;  2YKN A;  1KSP A;  5EU7 A;  4DWI A;  2EX3 A;  4M42 A;  4QOZ B;  3SCX A;  3CG7 A;  4DU1 A;  1BCM A;  4L8R B;  1LWE A;  1WNS A;  4N76 A;  4DTU A;  5J2Q A;  1YTA A;  1C0M A;  3ZSR A;  3V1O A;  2HHX A;  1UAX A;  3QLH A;  3LP0 A;  2R7Y A;  1IKX A;  2P51 A;  4C8M A;  2HHW A;  4M41 A;  3T19 A;  3AO3 A;  1VSD A;  3HVR A;  2A1S A;  3L3U A;  4CFC A;  1NK7 A;  4BE2 A;  3KK3 A;  5C24 A;  1SKS A;  1S1U A;  4FJ7 A;  3HVT A;  1KTQ A;  1FKP A;  3I8D A;  5I3U A;  1BHL A;  4HHT A;  3OYM A;  2ETJ A;  2YKM A;  3HM9 A;  1XHX A;  1RT5 A;  1RT1 A;  3DRP A;  1CXQ A;  2IDO A;  1J54 A;  3ZT1 A;  1RT3 A;  4CED A;  4W5T A;  3NAE A;  4JS4 A;  2ZQB A;  4FLV A;  3U6F A;  2Z1H A;  3LAL A;  4E7K A;  3HYF A;  3SUN A;  2ATQ A;  1TKD A;  2HNY A;  4CF2 A;  1NK8 A;  3OJU A;  2OPS A;  3OYA A;  3KLF A;  4N47 A;  4H8K A;  3U3Y A;  1S1T A;  4N5S A;  2RPI A;  4O55 A;  4ZTF A;  3TAB A;  4CJT A;  4Z4G A;  2DFE A;  1UOC A;  1D9D A;  1ZBL A;  4DSK A;  3U3G A;  4OJR A;  2X74 A;  3WNH A;  3NF8 A;  2YNI A;  1C0U A;  4AHC A;  4CJK A;  3NGZ A;  3ZSQ A;  3AO5 A;  2Z1G A;  3KD5 E;  4DSL A;  1BQM A;  1JLG A;  4DMN A;  3OYD A;  3T1A A;  4J2E A;  4E19 A;  1HQU A;  3IG1 A;  2XY7 A;  4Q0B A;  3P1G A;  4DQS A;  3CYM A;  3NGY A;  5CYQ A;  3OYF A;  2XY8 A;  2KW4 A;  3JSM A;  3LZJ A;  1Q9Y A;  4J2D A;  1Z25 A;  3DMJ A;  3MXI A;  3LDS A;  4FLZ A;  3A2F A;  3V9W A;  1NK5 A;  3RR7 A;  3P83 D;  1ASU A;  1QSL A;  4ID5 A;  4KAZ A;  2F8T A;  1BL3 A;  1RT2 A;  4I7F A;  3EZ5 A;  3TAF A;  4CF0 A;  3D0P A;  1IO2 A;  4QAG A;  4FLU A;  1B92 A;  1JL1 A;  3F9K A;  4B9S A;  3S3M A;  1RTJ A;  1S6Q A;  2GUI A;  3SUQ A;  1TKT A;  3VN5 A;  2HVI A;  3TR8 A;  3KD1 E;  4B8A B;  5HLF A;  1RBU A;  4DQQ A;  2KZM A;  3SV3 A;  1EET A;  3AA3 A;  3FFI A;  1FKO A;  4B8C A;  4KTZ A;  3MXM A;  2WON A;  3AVC A;  4LH5 A;  5J1E A;  1D9F A;  1VRU A;  1RCH A;  4M3R A;  4BWM A;  1HNI A;  1U04 A;  3ITH A;  1S1X A;  3L2R A;  5HBM A;  4Y1D A;  4CEE A;  3QEI A;  4BAC A;  1U4B A;  3DYA A;  4RW7 A;  2Q3S A;  4FVM A;  3G10 A;  4RW9 A;  3DLH A;  2GV9 A;  3DI6 A;  1CXU A;  2YV0 X;  3MEE A;  2ITG A;  4CEQ A;  3AA2 A;  4Q5V A;  3OYB A;  1SKW A;  2OA8 A;  3PY8 A;  2KFZ A;  1L3S A;  4B9V A;  2F8S A;  1KFD A;  2F96 A;  2XY5 A;  3K5O A;  4YFU A;  1T8E A;  4W5N A;  1LWF A;  4CHP A;  2RN2 A;  3SUP A;  4KHW A;  3M8R A;  3V1Q A;  3HP9 A;  1ITG A;  1WN7 A;  2YNF A;  3QNN A;  3KTQ A;  1W9H A;  4DQI A;  2HHS A;  1RDA A;  2LSN A;  2B6A A;  2HHT A;  3NF9 A;  5T7B A;  1JKH A;  1RIL A;  1SUQ A;  3SI6 A;  2B5J A;  4DTX A;  4FJI A;  3OS0 A;  2OPQ A;  3B6O A;  4TSX A;  4CIG A;  4CJP A;  4E7I A;  4PQU A;  3RTV A;  3O3F A;  5FRM A;  4DSI A;  4IFV A;  4CEF A;  4DSE A;  3CM5 A;  4CJ3 A;  1ZBU A;  3VQA A;  3QIP A;  3TAP A;  2JGU A;  3K5N A;  3TAR A;  4DLG A;  3V9X A;  1NKC A;  4DQP A;  3OS2 A;  4DFJ A;  4AHV A;  4LH4 A;  1BIZ A;  1HYZ A;  1IKV A;  5J2P A;  4FK4 A;  1S9G A;  3AVM A;  1KVA A;  3WNG A;  3TAQ A;  4I9L A;  4CEB A;  1ZBF A;  3LP1 A;  4BDZ A;  1N6Q A;  2DFH A;  4DFK A;  2BGG A;  1KCF A;  3NCI A;  2G8F A;  2X6S A;  2Z1J A;  1TV6 A;  5FRO A;  3QER A;  1YTU A;  2X6N A;  1TKZ A;  1KVB A;  2GBZ A;  4CJQ A;  3LWL A;  3SQ4 A;  3M8P A;  1KLN A;  2HND A;  4DTM A;  4F3O A;  2YNG A;  4FW1 A;  4KHQ A;  4CGH A;  2G8K A;  1HPZ A;  3AV9 A;  4FJG A;  5KRT A;  2YNH A;  3SPY A;  3IS9 A;  4OLA A;  2XHB A;  3P5J A;  1WLJ A;  3OYK A;  1WSJ A;  4HUE A;  1ZBI A;  4DG1 A;  4FLT A;  4O44 A;  3VQ6 A;  4F4K A;  1U45 A;  4CCH A;  4EZ6 A;  4KHS A;  2HHV A;  4OPJ A;  4OGC A;  3DLR A;  1TK8 A;  2PY5 A;  2OZM A;  3PV8 A;  4FJK A;  2DFF A;  2KTQ A;  4DTJ A;  1L3V A;  1B9D A;  4Z4H A;  3WNF A;  3DOL A;  3DLG A;  3AVA A;  4AHR A;  4FZY A;  2I5J A;  4F8R A;  5CYM A;  2QK9 A;  3EY1 A;  4FJL A; 
#chains in the Genus database with same CATH topology
 2QA4 N;  3VA0 A;  4KHU A;  3CJB A;  3C0B A;  1EWQ A;  2VGN A;  3OYN A;  1T05 A;  2PYJ A;  1FK9 A;  5AQW A;  4JRQ A;  3VQP A;  1EP4 A;  4JK7 A;  1TVR A;  2UXB K;  4C1N K;  5ADX H;  1RGI A;  2G8U A;  1BDG A;  3A5L C;  4OPA A;  2GX9 A;  3HOS A;  2G8V A;  4E0D A;  3DXK B;  3KLH A;  2E1Z A;  2E2N A;  3AO1 A;  2FBV A;  1X9W A;  2H3G X;  1XC3 A;  3H1Q A;  3NHG A;  4Z4I A;  3T69 A;  1I39 A;  1VSK A;  1T03 A;  3TWH A;  4FWQ A;  2Q36 A;  2HNZ A;  5AQL A;  3GOI A;  3ZSX A;  4DV1 K;  4M3W A;  4EZ9 A;  3BZK A;  1ESV A;  1J6Z A;  2P9I B;  4UY8 O;  2BDP A;  1BIU A;  2NRV A;  2OPR A;  2CGK A;  5AZJ B;  1IBM K;  3K5M A;  2HOE A;  2X78 A;  3AVF A;  1X3M A;  3OYG A;  3W3D A;  2NZT A;  5JIC A;  4GW6 A;  3NMU A;  4B9M A;  1NGG A;  3THW A;  2DY4 A;  1S5J A;  4CK3 A;  4WE1 A;  4JI4 K;  2ZM6 K;  1NJW A;  5BPM A;  2G8H A;  4BRN A;  3LDP A;  1OVQ A;  2YHA A;  3HZ6 A;  4NO7 A;  4DV2 K;  3HBT A;  3CM6 A;  1Z6R A;  2O8C B;  4DFM A;  1TYQ A;  1M1K O;  1J9A A;  1DTQ A;  5AQJ A;  1GLD G;  1MA9 B;  3D6R A;  1YJ9 N;  3L2Q A;  3E01 A;  4LF8 K;  1A5W A;  3UKU A;  3CIP A;  1RT7 A;  3G0Z A;  1VQ7 N;  1BUP A;  5HRP A;  3VGK A;  1S3X A;  3VQB A;  4DTO A;  3CCQ N;  5JS2 A;  1TL1 A;  2QI2 A;  1NU0 A;  4B1V A;  5M1N A;  1XQS C;  3QIC A;  4ZHR A;  2KKZ A;  4FJX A;  3QIO A;  4BRE A;  3TSU A;  4CFA A;  4CIF A;  3I0R A;  4A61 A;  3KKS A;  3NE6 A;  3P4I A;  1RBR A;  1Q81 O;  3O9Q A;  3VF2 A;  1XHZ A;  2HHU A;  3IMX A;  1BI4 B;  3L6Q A;  4AH9 A;  1LAV A;  1DT9 A;  2HHH K;  4K41 A;  4MQ3 A;  1RDW X;  1NGJ A;  2E5L K;  2PYL A;  3LZI A;  1NGA A;  2PZS A;  2HBM A;  5LL6 Z;  1TAQ A;  3AVK A;  3AY9 A;  4IBN A;  4CIE A;  1HYV A;  4NCG A;  5FRN A;  1HJO A;  3O3G A;  2D0C A;  2IC3 A;  1J5O A;  1RTI A;  4N56 A;  3D2F B;  3OTO K;  3L2V A;  4FYD A;  4FM0 A;  3EYZ A;  4M3T A;  3VQ7 A;  5AQN A;  3CF5 L;  1VK0 A;  4IWV A;  3ZT0 A;  4A2A A;  4CJE A;  2E8A A;  3VQ5 A;  3VQD A;  4BRK A;  4UQG A;  5M1K A;  3WQT A;  1S9E A;  5BN9 A;  3K59 A;  4O8U A;  4RW6 A;  1QQC A;  1Y64 A;  4CJF A;  3H45 C;  4CJ7 A;  3M5R A;  1LWC A;  3ZLJ A;  5SWM A;  1JJ2 M;  2QWN A;  3DOK A;  5CE3 A;  2FC0 A;  1NJY A;  4RW4 A;  4LD0 A;  4CZG A;  4J2B A;  4FJH A;  4JHD A;  3BY5 A;  3DLB A;  3RR8 A;  3UIQ A;  1WSF A;  3DAW A;  4BE1 A;  2UUC K;  4DR7 K;  4MLH A;  3VEY A;  2P9S B;  4AHU A;  2YCH A;  4FM1 A;  4H4O A;  3VF6 A;  3HT3 A;  3G71 N;  3NF7 A;  3KKR A;  3L2W A;  2HHQ A;  5DMR A;  4O0I A;  1VSJ A;  2A40 A;  4FOI A;  1YI2 N;  4FLW A;  1XC9 A;  5I42 A;  1KFS A;  2WOM A;  2QWO A;  2WTU A;  3MAQ A;  2OCE A;  3CCS N;  1JLB A;  3VQC A;  3HST B;  3RMA A;  4DF4 A;  3KK1 A;  1NK0 A;  4K8Z A;  1HNV A;  1UA1 A;  3C7N A;  2W42 A;  4BRO A;  1VHX A;  5CZ2 A;  4DUY K;  3L3V A;  4BG9 A;  2VGM A;  3GG4 A;  3SZ2 A;  2QWM A;  4BR4 A;  4CBX A;  3TSQ A;  4ICL A;  3MDQ A;  3VEZ A;  1XNR K;  4FJ8 A;  4IKF A;  4DR1 K;  3WEE A;  4DTP A;  1WSE A;  5C25 A;  3ASM A;  3O9U A;  3TAM A;  3CCE N;  3ZX2 A;  3OYI A;  1REV A;  2D0A A;  1X1P A;  4BC2 A;  1KAY A;  1VQ8 N;  2E6M A;  4FVU A;  1GOC A;  3PO4 A;  1WAF A;  3QFP A;  2A42 A;  3V1R A;  3VGM A;  3ZSV A;  3FZL A;  4KHN A;  1RNH A;  4LSL A;  1N8R O;  1DLO A;  4DFP A;  3MED A;  1C0G A;  2NLX A;  4CES A;  4HUG A;  1N36 K;  1A5X A;  4JKB A;  4CGG A;  1NGF A;  2O8D A;  2FSK A;  3HPO A;  3C7N B;  1SKR A;  3EO3 A;  4FL9 A;  3LPU A;  4PKG A;  4E1N A;  2KFN A;  4KB1 A;  4B3R K;  1CLQ A;  1M90 O;  1JLA A;  4YOU A;  4ELV A;  1EKE A;  3THY B;  2OZS A;  5FPN A;  3SMS A;  1FW6 A;  4Z4C A;  4CI6 A;  4DWI A;  3WXK A;  2EX3 A;  3HRG A;  4M42 A;  3CG7 A;  4DU1 A;  1YJW N;  1WNS A;  3ZEU B;  3MWT A;  4YOW A;  3ZX3 A;  1ATS A;  4BR7 A;  3LP0 A;  2R7Y A;  1NGB A;  4CZI A;  4MDA A;  4JV5 K;  3L3U A;  1XUP O;  1O13 A;  3KK3 A;  5MLC Q;  2ZJP L;  5BRH A;  4CED A;  3K58 A;  3DRP A;  3U6F A;  1RT3 A;  2UUB K;  4B9N A;  3CHW A;  2Z1H A;  4M7X A;  5C0Y A;  2P9P A;  4A59 A;  4YOR A;  4WCE L;  3U3Y A;  3ZX0 A;  5GIO A;  3EE8 A;  3TAB A;  1U6Z A;  4WYB A;  4CJT A;  2DFE A;  1UOC A;  1D9D A;  1ZBL A;  4B1Z A;  2X74 A;  1BOT O;  4ISG A;  3NGZ A;  3VET A;  5B8H A;  3OYD A;  1QHA A;  2XY7 A;  1YJN N;  3A5M C;  4HWI A;  4JKG B;  5AQU A;  1Z25 A;  3MXI A;  3LDS A;  1BU6 O;  1ASU A;  1QSL A;  4ID5 A;  2F8T A;  1RT2 A;  1BA1 A;  4CF0 A;  3TAF A;  1IO2 A;  2GUP A;  2PFU A;  5AQQ A;  4A57 A;  3ULE B;  3SAF A;  4IXC A;  2WBN A;  3SUQ A;  4BR2 A;  3VN5 A;  3LDO A;  2RHK A;  3FZH A;  5AZJ A;  3GE1 A;  1RBU A;  4DQQ A;  3F2K A;  5F2R A;  3MXM A;  4G9Z A;  4JK9 A;  4I6M A;  1LCU A;  1VRU A;  1VQL N;  1HNI A;  1S1X A;  5HBM A;  3QEI A;  4LF4 K;  1X9J A;  1E3M A;  3G10 A;  3DLH A;  4NXM K;  4BGB A;  4IOC L;  3MEE A;  2OA8 A;  3PY8 A;  2F8S A;  3JAM O;  5BR9 A;  4YFU A;  1T8E A;  3O9T A;  3SUP A;  3ID8 A;  4H0Y B;  1ITG A;  4B3M K;  2UU9 K;  1RDA A;  3C6A A;  3NF9 A;  3FLC O;  3R1X A;  1SUQ A;  4DTX A;  5BRD A;  1EQY A;  4TSX A;  4CJP A;  4PQU A;  5FRM A;  5LMU K;  3VTH A;  4IFV A;  4YOT A;  3VEV A;  1ZBU A;  1BA0 A;  3MN7 A;  4DQP A;  3OS2 A;  1BIZ A;  1OH7 A;  3I8B A;  1KVA A;  3HTV A;  4ISE A;  1ZBF A;  4A5A A;  4GV3 A;  2DFH A;  3OW2 M;  3LL3 A;  5FRO A;  4BRQ A;  2X6S A;  1TV6 A;  4J8F A;  4JN4 A;  4KBO A;  1KLN A;  3R8E A;  4WFA L;  1TUY A;  2JWK A;  4CGH A;  4ILG B;  1WLJ A;  2QM1 A;  1U45 A;  4CCH A;  2HHV A;  4OPJ A;  4H03 B;  5HL7 L;  2PY5 A;  3PV8 A;  1HKC A;  5JLH A;  1ZBS A;  2NRT A;  3WNF A;  4FWN A;  4FJL A;  1JCE A;  4H5N A;  4ELU A;  4DTR A;  4B9U A;  3P39 A;  4FJ9 A;  1W97 L;  4GV9 A;  4PL8 A;  4DHY A;  1GLC G;  2EHG A;  3TAN A;  1GOB A;  4DCH A;  2IS3 A;  4QCL A;  1VSI A;  3M6G A;  4PA1 A;  4OPK A;  3K5L A;  4DLE A;  3RRH A;  2FLO A;  4BRM A;  2XO7 A;  3QET A;  5HP1 A;  4CJ4 A;  4BRH A;  2F4V K;  3VEW A;  3A8Y A;  3O3H A;  3O5B A;  2KLA A;  4CHN A;  5LY3 A;  3OBY A;  5TKY A;  3HI0 A;  5BPN A;  2OPP A;  1ASW A;  3OVN A;  4DV5 K;  2I7N A;  3THX B;  4JHD B;  4R5P A;  4FO0 A;  2E6L A;  4KO0 A;  4E7L A;  4M3Y A;  4DR6 K;  2YJE A;  4KPY A;  4RWT A;  2YHY A;  5E84 A;  3CJ9 A;  1S1W A;  1T6D A;  3JXU A;  1VQ4 N;  3SV4 A;  2AA4 A;  1NOZ A;  4CGJ A;  1JLF A;  4DV7 K;  2KQ2 A;  3VEO A;  4XH1 A;  2QWQ A;  4CJW A;  3HJF A;  5SZT A;  4IEI A;  3CQ8 A;  1BO5 O;  4NYF A;  1F21 A;  3J8A A;  1KQS M;  1NJX A;  1WAJ A;  1NGH A;  3MCP A;  1NWK A;  5IWA K;  4AIL C;  4MDB A;  1G15 A;  5GAD P;  4WQ4 A;  4A5B A;  1Q9X A;  3AA5 X;  2IVP A;  4PL7 A;  1QQO A;  4LSN A;  3GL1 A;  2FSN A;  3HPH A;  3B8A X;  1XMQ K;  4WQ5 A;  3O9S A;  1VSF A;  4DQR A;  1HMV A;  4IZ9 A;  3KWI A;  3G4S N;  3NVM A;  2NRR A;  4IG0 A;  4DF8 A;  3HM8 A;  3THV A;  4FK2 A;  3QES A;  2F7T A;  4EP5 A;  1C1C A;  4OKJ A;  4AHT A;  4OVL A;  4G1Q A;  1TL3 A;  3ZEU A;  3J80 O;  2A1R A;  3SQ2 A;  3NFA A;  2D5R A;  4FK0 A;  4B3O A;  1NMD A;  2W41 A;  1GLB G;  2CH6 A;  1NG9 A;  3C6T A;  5EVZ A;  3QNO A;  4KHY A;  3CME N;  4KH5 A;  2JWL A;  2HMI A;  5GAE P;  4IOX A;  1XI1 A;  3NGI A;  3QB0 A;  5EY4 A;  1LW0 A;  1TK5 A;  5M1F A;  4BVO A;  5AQS A;  3QEV A;  2YHX A;  3QO9 A;  5KGX A;  3OYC A;  3MXJ A;  4BRA A;  4X64 K;  1KAX A;  4CER A;  3WXI A;  3VQ9 A;  3CJ1 A;  4V19 S;  1LW2 A;  3O4W A;  3HO1 A;  3LAM A;  3P31 A;  3KIO A;  1RTH A;  3Q7C A;  4BG8 A;  2V51 B;  3JS6 A;  3O4Q A;  2W6K A;  5AZI B;  4C8L A;  4FJ5 A;  1KRP A;  4IO9 L;  3B6P A;  1NK6 A;  4DU4 A;  2VG6 A;  3CFP A;  1U49 A;  1BWF O;  4HUF A;  4LC9 B;  2O8F B;  3ZT3 A;  4CZE A;  2HBK A;  1EXQ A;  3SNN A;  3ZSO A;  1VSM A;  1CZ9 A;  1VRT A;  2O4I A;  5DM6 L;  3DXK A;  4Z4F A;  2HF4 A;  1YT3 A;  3S3O A;  1WOQ A;  1CZB A;  1JXE A;  1QE1 A;  3A5N C;  4IEE A;  3AVG A;  4NCA A;  4BRI A;  2O8F A;  4NCB A;  1SZ2 A;  3S3N A;  1VQK N;  3L4I A;  4BR5 A;  2O8D B;  5J2M A;  2ITM A;  2XY6 A;  4CJV A;  3O80 A;  2NRW A;  2KZZ A;  3CFR A;  3LP2 A;  4H0P A;  3JYT A;  1RDU A;  3QBX A;  3SJJ A;  2P5G A;  2VWJ A;  3CJC A;  4CZL A;  3RMC A;  1YVU A;  4CZK A;  2CH5 A;  4FLY A;  1A5V A;  2P1J A;  5E26 A;  5FDL A;  4H4M A;  1U2V A;  1TKX A;  4LFA K;  3TAE A;  2ZD1 A;  1VQM N;  2ZE2 A;  3P38 A;  4LF5 K;  3IUC A;  1DTT A;  1C0T A;  3AA4 A;  2IOC A;  1CZA N;  4CHY A;  3VA3 A;  3TAG A;  4JK8 A;  3U8X A;  3L8B A;  5BR8 K;  1P8Z A;  3PX6 A;  2P9L B;  3HL8 A;  3E66 A;  3J81 O;  3TAR A;  5E41 A;  3VQ8 A;  3EEQ A;  3MWP A;  3G6E N;  4CF1 A;  4CFB A;  2AP1 A;  3RVC A;  3UB5 A;  3M8Q A;  1RT6 A;  1RBT A;  3C95 A;  4HTL A;  2Z1I A;  4CFD A;  4JI0 K;  4CK1 A;  1NKB A;  1UWB A;  3OYH A;  3FZM A;  3GBT A;  3F5T A;  3K57 A;  4I2P A;  5ADX A;  2GEL A;  4BRP A;  1T3V A;  4QOZ B;  4L8R B;  4JNE A;  4N76 A;  5J2Q A;  1K8A O;  3ZSR A;  4JI3 K;  2HHX A;  3WXM B;  1IKX A;  2P51 A;  5TKW A;  5CHI A;  1ILY A;  4M41 A;  3T19 A;  3ZET A;  4DB3 A;  3HVR A;  2WC9 A;  1NK7 A;  4BE2 A;  1GLA G;  5C24 A;  1SKS A;  1U2V B;  2E20 A;  1KTQ A;  1FKP A;  3GDQ A;  5I3U A;  3CCR N;  3RSE A;  3OYM A;  2ETJ A;  4FOE A;  3UKR A;  1CXQ A;  1J54 A;  2HBJ A;  3NAE A;  1HPM A;  3CCU N;  4FLV A;  1TKD A;  3AGR A;  3MN9 A;  3HYF A;  4CF2 A;  1VQ5 N;  1NK8 A;  3W0L A;  4R79 A;  4Y0W A;  4CZM A;  4N5S A;  4ZTF A;  4Z4G A;  1R59 O;  4OJR A;  3D2E B;  2YNI A;  5KPR A;  4CJK A;  3ZSQ A;  3AO5 A;  3KD5 E;  4DSL A;  1BQM A;  1JLG A;  3QML A;  3IDH A;  1HQU A;  1Q18 A;  4Q0B A;  4JKH A;  5KQD A;  5CYQ A;  3JSM A;  3SMP A;  2F9W A;  2KW4 A;  3CPW M;  3DMJ A;  1YF5 L;  3M3Z A;  1W7A A;  4KAZ A;  3EZ5 A;  4QAG A;  4CBU A;  1T44 A;  3S3M A;  2ZGZ A;  3BF3 A;  3J7Y P;  1C0F A;  1S6Q A;  1W2B M;  3CI5 A;  3FZK A;  1QZ6 A;  4JYA K;  2HVI A;  3KD1 E;  1VQ9 N;  3VER A;  4NXN K;  3UE5 A;  3PSF A;  4B1Y B;  3AVC A;  4LH5 A;  4X66 K;  1RCH A;  4M3R A;  1U04 A;  3L2R A;  1I94 K;  5KPZ A;  3DYA A;  2Q3S A;  4FVM A;  4RW9 A;  3DI6 A;  2HMP A;  2ITG A;  3OYB A;  1K8K B;  3TTD A;  1L3S A;  4B9V A;  2KFZ A;  2XY5 A;  3K5O A;  4M63 C;  3EE9 A;  4CHP A;  2RN2 A;  3M8R A;  3HP9 A;  1W9H A;  2HHS A;  2LSN A;  2HHT A;  4JEP A;  4XH5 A;  5T7B A;  1JKH A;  5M1Q A;  1JCF A;  3B6O A;  1QQM A;  4CIG A;  4AM6 A;  3UKU B;  3O3F A;  3FGU A;  4DSI A;  3LDQ A;  2FSJ A;  3CM5 A;  4CJ3 A;  3TAP A;  2JGU A;  3K5N A;  5AFU A;  1NKC A;  4JAX A;  1K73 O;  4AHV A;  4JD2 A;  1IKV A;  1S9G A;  3PIO L;  5FPM A;  5H1S Q;  3TAQ A;  4CEB A;  3N4Q A;  2BGG A;  4AQY K;  3QER A;  1YTU A;  2GBZ A;  1KVB A;  4CJQ A;  3M8P A;  4KHQ A;  4OPH A;  1HPZ A;  2YNH A;  5JVH L;  3SPY A;  2QWP A;  1Q7Y O;  4OLA A;  2ASP A;  4IFE A;  5LMN K;  4HUE A;  4DG1 A;  2ZJR L;  3VQ6 A;  4FLT A;  4FPA A;  4F4K A;  4FWO A;  3DLR A;  3MX2 A;  5AQM A;  2OZM A;  2DFF A;  2KTQ A;  4DTJ A;  3SAH A;  1L3V A;  3DLG A;  2ZGY A;  1N32 K;  4F8R A;  5CYM A;  2QK9 A;  3EY1 A;  1L3U A;  1DGK N;  1L5U A;  3MN5 A;  4BR0 A;  5I9E B;  2PAV A;  3M1F A;  4A2B A;  3J7Z O;  3BP8 A;  2E1Y A;  4JI6 K;  2YHB A;  3HPG A;  1RFQ A;  1QSY A;  2YHW A;  5GAG P;  4KI6 A;  3ZSY A;  3DLL L;  4FWM A;  5BRE A;  2DPN A;  3I56 N;  3CET A;  3QEX A;  4AF1 A;  3AO4 A;  4GVM A;  5KQ8 A;  1OKJ A;  4JD2 B;  4EP4 A;  4CEZ A;  3SBT A;  1BI4 A;  1TAU A;  4KFB A;  3D45 A;  2Q0U A;  3O9R A;  1RDB A;  1YAG A;  3AVB A;  1U48 A;  3IRX A;  1QTM A;  4FXD A;  3TPQ A;  3VQ4 A;  1MWM A;  4IFY A;  2O8B A;  1N5Y A;  4GKJ K;  2CGJ A;  4M3Z A;  3OYE A;  4HCC A;  1RDD A;  1Z26 A;  1N33 K;  4N41 A;  3BGR A;  2ZF5 O;  4PHT X;  3SK3 A;  1HLU A;  3V9S A;  1RBS A;  1IKW A;  2QEX N;  3PUF A;  3D2F A;  4EHU A;  1S22 A;  4FWL A;  4ID1 A;  1HKB A;  1DKG D;  4YY3 K;  1S72 N;  2Q1N A;  1D5A A;  3C6U A;  2P9N A;  4CEA A;  4W5R A;  3KLI A;  4IG3 A;  4BWJ A;  5AQY A;  4Y1C A;  2E2Q A;  4FWK A;  4LFC K;  4B3T K;  4W5Q A;  5ELZ A;  3MMV A;  3WXL A;  4JKF A;  4FZZ A;  1I3A A;  3RRG A;  3CC7 N;  3CCL N;  3DLE A;  5D3G A;  1WSI A;  3CC4 N;  3I0S A;  1TK0 A;  3LPT A;  4M3U A;  1Q82 O;  1VSH A;  5J2N A;  3RMB A;  3SLC A;  3HK2 A;  4BVP A;  2GEM A;  3THY A;  4CD3 A;  4CJL A;  5DK5 A;  3OYL A;  4JRP A;  1YUW A;  2O8E A;  4EIA A;  3DXM A;  3ZSW A;  3CFO A;  1WBD A;  3VF4 A;  2D0O A;  3SUO A;  4E3S A;  5AQG A;  3TTF A;  4RW8 A;  3RWU A;  5HRS A;  4RG8 A;  1HNX K;  2J4R A;  4O5F A;  3KWG A;  4IJA A;  4DSF A;  1IH7 A;  1C1A A;  4PUO A;  5JMV A;  1NGI A;  3PX0 A;  2E2O A;  4WFB L;  4WQ5 C;  3IAY A;  1WUA A;  4LY7 A;  3ISN C;  4ELT A;  2HVH A;  1BIS A;  1KXP A;  3NVK A;  4H5T A;  3I33 A;  4O8K A;  1L3T A;  2QKK A;  4CF8 A;  3PSI A;  3MK6 A;  4YDU A;  1VSL A;  1HRH A;  4E89 A;  3MCA B;  3SPZ A;  4Z94 A;  4H0O A;  3S9H A;  2O4G A;  3ZCM A;  3PX4 A;  4CHO A;  3WQU A;  4AHS A;  2G8I A;  3M8S A;  1WBB A;  5C42 A;  1X9M A;  3QDK A;  4F2S A;  4CJ5 A;  4CK2 A;  1Y97 A;  3O4N A;  5M1P A;  3LAN A;  4BRD A;  3E1Y A;  1VQO N;  1E4G T;  3ALY A;  5EX5 A;  5CY4 A;  1OH5 A;  1RT4 A;  2P9P B;  4B1U B;  2Y1J A;  3DRR A;  4M45 A;  2HBL A;  4OLB A;  2Q97 A;  3K9J A;  2UYT A;  3HP6 A;  3OBW A;  1NGE A;  2BAN A;  3BUZ B;  1ATR A;  3LDN A;  4RTF D;  3SQ1 A;  4CF9 A;  5K14 A;  4MO5 A;  2RE2 A;  4RCH A;  4DR4 K;  3E9P A;  4YNQ A;  1T6C A;  3MN6 A;  3DRS A;  2OTL N;  3VEX A;  2P9L A;  4JLH A;  5BPL A;  5EOY A;  3ENO A;  3THW B;  4CHQ A;  4DV6 K;  2VG5 A;  1RDC A;  2RKI A;  2FBX A;  4MO4 A;  4KTQ A;  2D4W A;  1S6P A;  3PLA A;  4IOA L;  5GIP A;  4L3Q A;  3V4I A;  4DSJ A;  1ZBH A;  3ZT4 A;  1UA0 A;  1BG3 A;  2DTU A;  2V7Y A;  4BY9 C;  4K8X A;  3ENB A;  2YI1 A;  1J53 A;  4B08 A;  2A3Z A;  4XEI A;  5LJW A;  4B1W B;  4A62 A;  1HQE A;  4DS4 A;  3H3O B;  4X62 K;  1VSE A;  2FF3 B;  1JLQ A;  4DU3 A;  5AQZ A;  1WSH A;  2QXF A;  4OGE A;  5AQO A;  1EX4 A;  1GLL O;  2IVO A;  4KHP K;  1LV5 A;  4KTW A;  1C6V A;  2GWK A;  4Z4E A;  5JVG L;  3VEN A;  3NH1 A;  1S1V A;  1WSG A;  1KD1 O;  3CJA A;  3QIN A;  3O8M A;  3DLK A;  1NOY A;  3TSP A;  3D2E A;  1KSP A;  1JCG A;  4C23 A;  3AAP A;  5HOO A;  2QW9 A;  3SCX A;  4JKC A;  1LWE A;  2V52 B;  1IBK K;  3C65 A;  5DM7 L;  2ASM A;  1YTA A;  1C0M A;  3V1O A;  3QLH A;  2VQF K;  1VSD A;  4YOX A;  5FLX O;  4K25 A;  1VQ6 N;  1NM1 A;  1S1U A;  3HVT A;  4GNI A;  4K42 A;  3I8D A;  1BHL A;  3K0S A;  2BH1 A;  1EO1 A;  2YJF A;  2YKM A;  5F0X A;  1RT5 A;  2QTD A;  3ZT1 A;  2IDO A;  4B1X B;  1QVG M;  4JS4 A;  3LAL A;  2HNY A;  2YX6 A;  2KHO A;  3OJU A;  5AR0 A;  2OPS A;  3OYA A;  2PBD A;  1S1T A;  2RPI A;  4O55 A;  2O8C A;  4DSK A;  4ILJ A;  3NF8 A;  3R3L A;  1C0U A;  4AHC A;  2Z1G A;  2VWB A;  2NRZ A;  4GY2 B;  4DMN A;  3BZC A;  4J2E A;  3RSE B;  4H5R A;  3P1G A;  3CCV N;  1D4X A;  4DQS A;  3LM9 A;  4GVE A;  3OYF A;  1K8K A;  2XY8 A;  1Q9Y A;  1NGD A;  4NB4 A;  4FLZ A;  3A2F A;  3RR7 A;  1NK5 A;  3P83 D;  1HUX A;  3D0P A;  2GWJ A;  1XMO K;  3J7A P;  2GUI A;  2I7P A;  3OA9 A;  4KH4 A;  3TR8 A;  4JI1 K;  4YDU C;  2UXD K;  4QS8 A;  1EET A;  2V7Z A;  5F1X A;  3T1H K;  2WON A;  5FPE A;  5J1E A;  3AGK A;  3ITH A;  4Y1D A;  4RW7 A;  2E88 A;  4DKW A;  3A0I X;  1Z05 A;  3O1B A;  2GV9 A;  1CXU A;  1NGC A;  1SKW A;  4FSV A;  3OHR A;  1KFD A;  2GTD A;  3IKM A;  3L0Q A;  1SS6 A;  3CCM N;  4C1N I;  4DQI A;  3C6H A;  4F3T A;  1WN7 A;  2IVN A;  2HST A;  2YNF A;  2ASO A;  3IFR A;  3U9Z A;  2B6A A;  4YOY A;  4BRG A;  5C2F A;  1RIL A;  4FJI A;  1QQN A;  3THX A;  3E9O A;  4E7I A;  4BR9 A;  3T7Z A;  3RTV A;  4JI7 K;  4DSE A;  4CEF A;  4DLG A;  2IIR A;  3WT0 A;  5A2Q O;  1HYZ A;  1VAZ A;  3WNG A;  4I9L A;  3LP1 A;  4BDZ A;  1N6Q A;  4QS7 A;  1K9M O;  3BEX A;  4BRC A;  4BQL A;  2FXU A;  4JKG A;  3NCI A;  2X6N A;  1TKZ A;  3SQ4 A;  3H6E A;  3QBW A;  4DTM A;  2VCP A;  3AV9 A;  5KRT A;  5AQP A;  3IS9 A;  4GKK K;  3OYK A;  4BRF A;  1WSJ A;  4O44 A;  1QZ5 A;  3CQY A;  2QWL A;  2P9U B;  4FJK A;  2BUP A;  3AVA A;  4AHR A;  4K0K K;  4CW7 B;  2I5J A;  3FE1 A;  3PIP L;  2G8W A;  4CJR A;  1BGX T;  3EZW A;  1IBL K;  3CER A;  3EN9 A;  4IDK A;  3FZF A;  4I6M B;  4BDP A;  1JXB A;  3AO2 A;  1MWK A;  1SV5 A;  1QHT A;  3U9D A;  4IJN A;  1QVF M;  1YIJ N;  4FWR A;  2O8E B;  3RMD A;  3DXM B;  4BC4 A;  4B9T A;  3H46 O;  4JI2 K;  2AJQ A;  1LAW A;  2FBY A;  3A5O C;  1U47 A;  2P9I A;  1HX1 A;  5KTQ A;  1O1W A;  5AQX A;  1RBV A;  3AVJ A;  4O4G A;  1ZC6 A;  4PKH A;  4FZX C;  2UXC K;  5C2D A;  4QS9 A;  4JKA A;  4CEC A;  4CEO A;  3T3F A;  3QEW A;  3NDK A;  3NF6 A;  1IKY A;  3LDL A;  3ZSZ A;  3WEE B;  5KPT A;  4FJN A;  3NBP A;  3R6M A;  4OKK A;  2EWS A;  1NJI O;  4NYN A;  4BC5 A;  3CC2 N;  3ULE A;  1GOA A;  3FFK B;  1ASV A;  3KJV A;  3CCJ N;  1R0A A;  1V4S A;  4DR2 K;  5HRR A;  4I9Q A;  4CE9 A;  4KV8 A;  4FPB A;  4O0J A;  5KI6 A;  1TYQ B;  2VYP A;  1WB9 A;  4ZTJ A;  2XRI A;  3U4L A;  4MLE A;  4DR5 K;  2HF3 A;  1SL1 A;  2Y1I A;  4FJJ A;  1NJZ A;  3TI0 A;  5AQF A;  4DUZ K;  4GMJ B;  3CXC M;  4HVJ A;  4U7B A;  2FBT A;  4IDH A;  4H5W A;  2E4L A;  1X3N A;  1NMN A;  4LF9 K;  4LF6 K;  2D1K A;  1TGO A;  4XIU A;  4HTU A;  5AFU H;  1NK9 A;  4OKE A;  3VPZ A;  1Q8I A;  3NH0 A;  4FLX A;  2WFB A;  4DTN A;  1IJJ A;  1FXX A;  3ID6 A;  3V9U A;  3VMF B;  3KLG A;  1HJR A;  4JI8 K;  4B3S K;  5C10 A;  5HRN A;  4DV3 K;  2D0B A;  1NBW A;  3L2U A;  4CD1 A;  4EAH D;  4OO1 J;  4CBW A;  4BE0 A;  4FJM A;  3MEC A;  5CZ1 A;  3SYZ A;  2OYQ A;  3ENH A;  1ZYQ A;  1BQN A;  3HSC A;  1KAZ A;  3VOV A;  1QSS A;  1KLM A;  2HB5 A;  2Q31 A;  3O1W A;  1HYS A;  1RTD A;  4W5O A;  1JLE A;  3ZET B;  1NKE A;  5AQR A;  4YHH K;  3ULD A;  1XWL A;  4DS5 A;  4C8O A;  5JS1 A;  1YVN A;  1OH6 A;  3V6D A;  4O5B A;  3CJ7 A;  4B9Q A;  4ILH A;  2A5X A;  3EKS A;  3DWL A;  4YOV A;  3L4Q A;  1T7P A;  1D8Y A;  1C1B A;  2NNW A;  4E7J A;  3LP3 A;  5KGW A;  3OJS A;  1KVC A;  3O08 A;  2IGI A;  4FW2 A;  4E1M A;  3QEP A;  2A6A A;  3UKR B;  2UUA K;  3CQX A;  1X9S A;  4B9L A;  3AVH A;  1NK4 A;  1HR0 K;  4LFB K;  3ZT2 A;  1JLC A;  4KKO A;  5C12 A;  1QS4 A;  5AQI A;  4E7H A;  3OYJ A;  1BCO A;  5CR4 A;  4C8K A;  3DM2 A;  3ATV A;  2P9S A;  2B4J A;  4HCB A;  4NLB A;  2RF2 A;  4FWS A;  3AAR A;  4CJS A;  3V81 A;  4Z0U A;  4JS5 A;  1W0H A;  3KHY A;  2P5O A;  1E4F T;  3VTI A;  4X65 K;  5AQH A;  5BN8 A;  4MFB A;  1DEJ A;  1SAZ A;  1N34 K;  1J5E K;  4CHZ A;  2BE2 A;  3KVG A;  1OVY A;  3AVN A;  3VQE A;  4WF9 L;  3K2P A;  3CD6 N;  3TU5 A;  4F2R A;  4CGD A;  5KRS A;  3BDP A;  3T1Y K;  4FCY A;  3Q7B A;  1JL2 A;  5LJV A;  1SL0 A;  1YIT N;  1ATN A;  2VWK A;  3SQ0 A;  3ATU A;  1YXQ A;  1B9F A;  1HNZ K;  3V9Z A;  1GLJ O;  3LAK A;  3MEG A;  1HNW K;  4DV4 K;  2QKB A;  2IAJ A;  2HW3 A;  2VQE K;  3NH2 A;  3WXJ A;  1ZXO A;  4KRE A;  1MU2 A;  2ZWH A;  3LWM A;  2JLE A;  1YHQ N;  4I2Q A;  4J2A A;  4PWD A;  3H08 A;  3WNE A;  1NNE A;  3N4P A;  3VGL A;  5AQT A;  4CZH A;  5FPD A;  1IG9 A;  4CGI A;  1EWR A;  3PO5 A;  3CMA N;  3F73 A;  4KRF A;  2CGL A;  3D7E O;  3AVL A;  5AQV A;  3SBG A;  3C94 A;  3VQQ A;  4PY5 A;  4BGA A;  3FR0 A;  4DTS A;  4C8N A;  4H0T B;  5AJ3 K;  3AVI A;  1K6Y A;  3HXM A;  4F9O A;  2NUB A;  4KB0 A;  1H1V A;  3F9M A;  3KK2 A;  3OY9 A;  4CJU A;  4FM2 A;  2Q2R A;  4BDY A;  5M1O A;  4KI4 A;  1SL2 A;  4CZF A;  4M3X A;  4EHT A;  3KLE A;  4H0X B;  5HRO A;  4CGF A;  2VG7 A;  3OS1 A;  4DV0 K;  2YKN A;  5EU7 A;  2P9U A;  3LM2 A;  1BCM A;  2WUS A;  2A41 A;  4DTU A;  4OX9 K;  3ZYY X;  1UAX A;  3SAG A;  1TUU A;  4C8M A;  2HHW A;  1IV0 A;  1SQK A;  3AO3 A;  2A1S A;  4CFC A;  1IG8 A;  2Q0R A;  4FJ7 A;  1LOT B;  5GIN A;  3O6W A;  4CZJ A;  1KC8 O;  4HHT A;  3HM9 A;  1GLE G;  1XHX A;  1GLF O;  1RT1 A;  2QWR A;  4W5T A;  4XH4 A;  2ZQB A;  3SUN A;  4E7K A;  2ATQ A;  2W6L A;  2D0P A;  3KLF A;  2OTJ N;  4N47 A;  2FF6 A;  4JKD A;  4BRL A;  4H8K A;  1Q86 O;  4PKI A;  3EKU A;  2OAN A;  3U3G A;  3WNH A;  4GV6 A;  1FJG K;  3T1A A;  2E2P A;  1HKG A;  4E19 A;  3IG1 A;  4CVN E;  1VQN N;  5IT9 O;  3CYM A;  3NGY A;  3LZJ A;  4J2D A;  2P9N B;  3V9W A;  1BL3 A;  4I7F A;  4K43 A;  3DJC A;  3I55 N;  3CPE A;  4FLU A;  1B92 A;  1JL1 A;  3F9K A;  4B9S A;  4AM7 A;  2O8B B;  5EXW A;  1RTJ A;  1TKT A;  3BF1 A;  5BRF A;  4B8A B;  5AQK A;  5HLF A;  3MX5 A;  2KZM A;  3QFU A;  3SV3 A;  5GAH P;  4DQ8 A;  3AA3 A;  4WFN L;  3FFI A;  1FKO A;  4B8C A;  4KTZ A;  2W40 A;  2P9K B;  1D9F A;  4JI5 K;  4BWM A;  1V4T A;  4CEE A;  4BQZ A;  5AZI A;  4BAC A;  1U4B A;  3HOT A;  4ISF A;  4FWP A;  4E1J A;  2NRX A;  3TTC A;  4LF7 K;  1G99 A;  4CEQ A;  2YV0 X;  4Q5V A;  3AA2 A;  2F96 A;  3H1V X;  2NRH A;  4EFH A;  4W5N A;  1LWF A;  3H3N O;  3K9K A;  3VES A;  4KH6 A;  2P9K A;  4KHW A;  3V1Q A;  4M7Y A;  3QNN A;  3KTQ A;  3SI6 A;  2B5J A;  3OS0 A;  2OPQ A;  3KZB A;  3R9P A;  2ZJQ L;  3AAQ A;  4IO8 A;  3VQA A;  3QIP A;  3V9X A;  4DFJ A;  4LH4 A;  5J2P A;  1MDU B;  4FK4 A;  3EL2 A;  4U67 L;  3AVM A;  1VQP N;  4NLC A;  4BC3 A;  4WQ4 C;  4DFK A;  4DR3 K;  1KCF A;  1NLV A;  2G8F A;  3SJH A;  2Z1J A;  3LWL A;  2HND A;  4F3O A;  2YNG A;  4FW1 A;  4H0V B;  2G8K A;  2BTF A;  4FJG A;  4JKE A;  1XNQ K;  3G25 A;  5JLF A;  2XHB A;  3P5J A;  1ZBI A;  4H5V A;  3WUH A;  4KHS A;  4EZ6 A;  3S41 A;  4OGC A;  2F9T A;  3E9L A;  3KK7 A;  1TK8 A;  1OH8 A;  1B9D A;  4Z4H A;  2QXL A;  5C15 A;  3DOL A;  4FZY A;  1P90 A; 
#chains in the Genus database with same CATH homology
 2G8W A;  4CJR A;  3VA0 A;  1BGX T;  4KHU A;  1L5U A;  4ELU A;  4DTR A;  4B9U A;  4FJ9 A;  4IDK A;  4BDP A;  3OYN A;  1JXB A;  3AO2 A;  1T05 A;  2YHB A;  1FK9 A;  3HPG A;  2PYJ A;  4JRQ A;  1SV5 A;  1QHT A;  3VQP A;  1EP4 A;  2EHG A;  3TAN A;  1QSY A;  1GOB A;  3RMD A;  1TVR A;  2IS3 A;  4QCL A;  1VSI A;  4B9T A;  2AJQ A;  1LAW A;  2FBY A;  2G8U A;  4PA1 A;  4OPK A;  3K5L A;  4DLE A;  3RRH A;  1U47 A;  2G8V A;  4KI6 A;  5KTQ A;  1O1W A;  4E0D A;  2XO7 A;  3KLH A;  3ZSY A;  1RBV A;  4CJ4 A;  3QET A;  5HP1 A;  1L3U A;  3AVJ A;  3AO1 A;  2FBV A;  4O4G A;  4FZX C;  1X9W A;  3O3H A;  4CEC A;  3NHG A;  4Z4I A;  4CEO A;  3T3F A;  3QEW A;  3NDK A;  1I39 A;  1VSK A;  3NF6 A;  4CHN A;  3QEX A;  1T03 A;  3AO4 A;  4GVM A;  1IKY A;  4EP4 A;  3TWH A;  4CEZ A;  3ZSZ A;  1BI4 A;  1TAU A;  4KFB A;  2HNZ A;  4FJN A;  3D45 A;  3NBP A;  3ZSX A;  4OKK A;  1RDB A;  4M3W A;  3AVB A;  4NYN A;  2OPP A;  1ASW A;  3IRX A;  1U48 A;  1QTM A;  4EZ9 A;  3OVN A;  4FXD A;  3VQ4 A;  4IFY A;  1GOA A;  1N5Y A;  1ASV A;  4R5P A;  3KJV A;  3K58 A;  2BDP A;  1BIU A;  1R0A A;  2E6L A;  4M3Z A;  2OPR A;  3OYE A;  5HRR A;  4HCC A;  4I9Q A;  4KO0 A;  4E7L A;  3K5M A;  1RDD A;  4CE9 A;  4M3Y A;  4KV8 A;  2X78 A;  1Z26 A;  3AVF A;  4O0J A;  5KI6 A;  3OYG A;  4KPY A;  4N41 A;  4GW6 A;  4B9M A;  1S1W A;  3BGR A;  4ZTJ A;  2DY4 A;  1S5J A;  2XRI A;  4CK3 A;  4WE1 A;  2Y1I A;  1SL1 A;  3V9S A;  1RBS A;  3SV4 A;  4FJJ A;  1IKW A;  1NOZ A;  3PUF A;  1JLF A;  4CGJ A;  1NJZ A;  1NJW A;  3TI0 A;  2KQ2 A;  2G8H A;  4ID1 A;  2YHA A;  1D5A A;  4CJW A;  4GMJ B;  3C6U A;  3CM6 A;  4CEA A;  4HVJ A;  3KLI A;  4W5R A;  2FBT A;  4IG3 A;  4BWJ A;  3HJF A;  4Y1C A;  5SZT A;  2E4L A;  3CQ8 A;  4DFM A;  4NYF A;  1TGO A;  1J9A A;  1F21 A;  4XIU A;  4W5Q A;  4HTU A;  1DTQ A;  1NK9 A;  1WAJ A;  4OKE A;  1Q8I A;  3NH0 A;  4FLX A;  1NJX A;  4FZZ A;  4DTN A;  1I3A A;  3RRG A;  1FXX A;  3V9U A;  4AIL C;  1G15 A;  3DLE A;  5D3G A;  1Q9X A;  1WSI A;  1HJR A;  3AA5 X;  3I0S A;  3KLG A;  1TK0 A;  5HRN A;  3L2Q A;  3LPT A;  4M3U A;  2D0B A;  3E01 A;  1A5W A;  3L2U A;  1VSH A;  4F3T A;  1RT7 A;  3G0Z A;  5J2N A;  3RMB A;  4LSN A;  5HRP A;  3HPH A;  4BE0 A;  3HK2 A;  4FJM A;  3MEC A;  5CZ1 A;  3VQB A;  4CJL A;  4DTO A;  1VSF A;  5DK5 A;  3OYL A;  4JRP A;  3SYZ A;  5JS2 A;  4DQR A;  1HMV A;  1ZYQ A;  2OYQ A;  1TL1 A;  1BQN A;  1QSS A;  4ZHR A;  3ZSW A;  3CFO A;  1KLM A;  4FJX A;  3QIO A;  4IG0 A;  4DF8 A;  3SUO A;  2HB5 A;  4CFA A;  4E3S A;  4CIF A;  3I0R A;  3THV A;  4RW8 A;  3RWU A;  1RTD A;  4FK2 A;  1HYS A;  3KKS A;  4W5O A;  3NE6 A;  3QES A;  1JLE A;  5HRS A;  4RG8 A;  1RBR A;  1NKE A;  3ULD A;  1XWL A;  4DSF A;  4EP5 A;  1XHZ A;  1C1C A;  1IH7 A;  4OKJ A;  4AHT A;  2HHU A;  1C1A A;  1BI4 B;  4OVL A;  4DS5 A;  4PUO A;  4C8O A;  3PX0 A;  4G1Q A;  4AH9 A;  5JS1 A;  1LAV A;  1TL3 A;  3V6D A;  4O5B A;  3IAY A;  2A1R A;  4LY7 A;  4MQ3 A;  3SQ2 A;  3NFA A;  2D5R A;  4FK0 A;  2PYL A;  3ISN C;  3LZI A;  4ELT A;  2HVH A;  4B3O A;  1BIS A;  2PZS A;  3C6T A;  1T7P A;  3QNO A;  4KHY A;  1TAQ A;  3AVK A;  4IBN A;  4CIE A;  1HYV A;  1D8Y A;  1XI1 A;  2HMI A;  1C1B A;  4E7J A;  3NGI A;  3LP3 A;  1L3T A;  2QKK A;  4NCG A;  5KGW A;  4CF8 A;  1LW0 A;  1KVC A;  3OJS A;  1TK5 A;  2IGI A;  5FRN A;  1VSL A;  3O3G A;  1HRH A;  2D0C A;  4FW2 A;  2IC3 A;  4E1M A;  4E89 A;  3QEV A;  1J5O A;  3QEP A;  3SPZ A;  1RTI A;  3QO9 A;  3S9H A;  4N56 A;  5KGX A;  3OYC A;  3L2V A;  1X9S A;  4B9L A;  2O4G A;  3MXJ A;  3AVH A;  4FYD A;  3ZCM A;  4FM0 A;  1NK4 A;  3PX4 A;  4CHO A;  3EYZ A;  4CER A;  3VQ7 A;  3ZT2 A;  4M3T A;  4AHS A;  2G8I A;  3VQ9 A;  1JLC A;  1VK0 A;  4KKO A;  3ZT0 A;  1LW2 A;  1QS4 A;  3M8S A;  4CJE A;  4E7H A;  3VQ5 A;  3VQD A;  5C42 A;  3HO1 A;  4UQG A;  3OYJ A;  1BCO A;  1X9M A;  4F2S A;  1S9E A;  3LAM A;  4CJ5 A;  3DM2 A;  4RW6 A;  1QQC A;  3K59 A;  4B9N A;  4C8K A;  4CJF A;  4CK2 A;  1Y97 A;  3KIO A;  1RTH A;  1LWC A;  2B4J A;  3O4N A;  5SWM A;  4HCB A;  3LAN A;  2RF2 A;  3DOK A;  3O4Q A;  2FC0 A;  4CJS A;  1NJY A;  4C8L A;  4FJ5 A;  1KRP A;  3ALY A;  4RW4 A;  4Z0U A;  4LD0 A;  3V81 A;  4JS5 A;  4J2B A;  3B6P A;  5CY4 A;  1NK6 A;  1RT4 A;  4FJH A;  1W0H A;  4DU4 A;  2Y1J A;  2VG6 A;  3DRR A;  3CFP A;  3DLB A;  3RR8 A;  2P5O A;  1U49 A;  1WSF A;  3UIQ A;  4M45 A;  4HUF A;  4BE1 A;  4OLB A;  3ZT3 A;  3HP6 A;  1EXQ A;  3SNN A;  2BAN A;  3SQ1 A;  4MFB A;  4AHU A;  3ZSO A;  4FM1 A;  4H4O A;  4CF9 A;  3HT3 A;  4CHZ A;  1VSM A;  5K14 A;  2BE2 A;  3NF7 A;  1CZ9 A;  1VRT A;  3AVN A;  3VQE A;  2O4I A;  3KKR A;  3L2W A;  3K2P A;  2HHQ A;  5DMR A;  4Z4F A;  4O0I A;  1VSJ A;  1YT3 A;  4YNQ A;  3S3O A;  4F2R A;  4CGD A;  5KRS A;  1XC9 A;  4FLW A;  3BDP A;  5I42 A;  3DRS A;  1KFS A;  2WOM A;  4FCY A;  1CZB A;  1JL2 A;  1JXE A;  1QE1 A;  1SL0 A;  3MAQ A;  3AVG A;  4NCA A;  4JLH A;  2VWK A;  1JLB A;  3SQ0 A;  4NCB A;  3S3N A;  3VQC A;  3HST B;  3RMA A;  4DF4 A;  1B9F A;  5J2M A;  3KK1 A;  1NK0 A;  4CHQ A;  3V9Z A;  1HNV A;  1UA1 A;  2XY6 A;  2W42 A;  4K8Z A;  4CJV A;  2VG5 A;  3LAK A;  1RDC A;  3MEG A;  2KZZ A;  3CFR A;  3LP2 A;  2RKI A;  5CZ2 A;  2FBX A;  3JYT A;  2QKB A;  2IAJ A;  2HW3 A;  3L3V A;  3SJJ A;  2P5G A;  4KTQ A;  3NH2 A;  3SZ2 A;  2VWJ A;  3RMC A;  1S6P A;  1YVU A;  4ICL A;  4FLY A;  1A5V A;  4KRE A;  3V4I A;  1MU2 A;  2P1J A;  5FDL A;  4DSJ A;  3ZT4 A;  1UA0 A;  3LWM A;  4IKF A;  4H4M A;  4DTP A;  4FJ8 A;  1ZBH A;  1WSE A;  1TKX A;  2DTU A;  5C25 A;  3TAE A;  2ZD1 A;  3ASM A;  2ZE2 A;  2JLE A;  3TAM A;  3OYI A;  1REV A;  2D0A A;  4I2Q A;  4K8X A;  1X1P A;  4J2A A;  3H08 A;  4PWD A;  3WNE A;  2E6M A;  1DTT A;  1J53 A;  1C0T A;  3AA4 A;  1GOC A;  1IG9 A;  3PO4 A;  4B08 A;  1WAF A;  2IOC A;  3V1R A;  4CGI A;  4CHY A;  3VA3 A;  3TAG A;  1HQE A;  3PO5 A;  4DS4 A;  3ZSV A;  3F73 A;  1VSE A;  4KRF A;  3L8B A;  3AVL A;  4KHN A;  1JLQ A;  1RNH A;  4DU3 A;  3C94 A;  4LSL A;  3VQQ A;  4PY5 A;  1DLO A;  1WSH A;  3PX6 A;  2QXF A;  3HL8 A;  4OGE A;  3MED A;  4HUG A;  5E41 A;  4C8N A;  4CES A;  4DTS A;  4DFP A;  1EX4 A;  1A5X A;  3AVI A;  1K6Y A;  3HXM A;  4CGG A;  2NUB A;  4KB0 A;  3VQ8 A;  3HPO A;  1SKR A;  1LV5 A;  4KTW A;  4CF1 A;  4CFB A;  1C6V A;  3KK2 A;  3OY9 A;  3LPU A;  3M8Q A;  4Z4E A;  4CJU A;  4FM2 A;  4BDY A;  1RT6 A;  4E1N A;  1RBT A;  3NH1 A;  4KI4 A;  1S1V A;  1SL2 A;  3C95 A;  2KFN A;  1WSG A;  4KB1 A;  4M3X A;  1CLQ A;  3QIN A;  2Z1I A;  4CFD A;  1JLA A;  3KLE A;  4ELV A;  3DLK A;  4CK1 A;  1NKB A;  1UWB A;  5HRO A;  3OYH A;  4CGF A;  1NOY A;  1EKE A;  2VG7 A;  3K57 A;  2OZS A;  4I2P A;  4Z4C A;  3OS1 A;  2YKN A;  1KSP A;  5EU7 A;  4DWI A;  2EX3 A;  4M42 A;  4QOZ B;  3SCX A;  3CG7 A;  4DU1 A;  1BCM A;  4L8R B;  1LWE A;  1WNS A;  4N76 A;  4DTU A;  5J2Q A;  1YTA A;  1C0M A;  3ZSR A;  3V1O A;  2HHX A;  1UAX A;  3QLH A;  3LP0 A;  2R7Y A;  1IKX A;  2P51 A;  4C8M A;  2HHW A;  4M41 A;  3T19 A;  3AO3 A;  1VSD A;  3HVR A;  2A1S A;  3L3U A;  4CFC A;  1NK7 A;  4BE2 A;  3KK3 A;  5C24 A;  1SKS A;  1S1U A;  4FJ7 A;  3HVT A;  1KTQ A;  1FKP A;  3I8D A;  5I3U A;  1BHL A;  4HHT A;  3OYM A;  2ETJ A;  2YKM A;  3HM9 A;  1XHX A;  1RT5 A;  1RT1 A;  3DRP A;  1CXQ A;  2IDO A;  1J54 A;  3ZT1 A;  1RT3 A;  4CED A;  4W5T A;  3NAE A;  4JS4 A;  2ZQB A;  4FLV A;  3U6F A;  2Z1H A;  3LAL A;  4E7K A;  3HYF A;  3SUN A;  2ATQ A;  1TKD A;  2HNY A;  4CF2 A;  1NK8 A;  3OJU A;  2OPS A;  3OYA A;  3KLF A;  4N47 A;  4H8K A;  3U3Y A;  1S1T A;  4N5S A;  2RPI A;  4O55 A;  4ZTF A;  3TAB A;  4CJT A;  4Z4G A;  2DFE A;  1UOC A;  1D9D A;  1ZBL A;  4DSK A;  3U3G A;  4OJR A;  2X74 A;  3WNH A;  3NF8 A;  2YNI A;  1C0U A;  4AHC A;  4CJK A;  3NGZ A;  3ZSQ A;  3AO5 A;  2Z1G A;  3KD5 E;  4DSL A;  1BQM A;  1JLG A;  4DMN A;  3OYD A;  3T1A A;  4J2E A;  4E19 A;  1HQU A;  3IG1 A;  2XY7 A;  4Q0B A;  3P1G A;  4DQS A;  3CYM A;  3NGY A;  5CYQ A;  3OYF A;  2XY8 A;  2KW4 A;  3JSM A;  3LZJ A;  1Q9Y A;  4J2D A;  1Z25 A;  3DMJ A;  3MXI A;  3LDS A;  4FLZ A;  3A2F A;  3V9W A;  1NK5 A;  3RR7 A;  3P83 D;  1ASU A;  1QSL A;  4ID5 A;  4KAZ A;  2F8T A;  1BL3 A;  1RT2 A;  4I7F A;  3EZ5 A;  3TAF A;  4CF0 A;  3D0P A;  1IO2 A;  4QAG A;  4FLU A;  1B92 A;  1JL1 A;  3F9K A;  4B9S A;  3S3M A;  1RTJ A;  1S6Q A;  2GUI A;  3SUQ A;  1TKT A;  3VN5 A;  2HVI A;  3TR8 A;  3KD1 E;  4B8A B;  5HLF A;  1RBU A;  4DQQ A;  2KZM A;  3SV3 A;  1EET A;  3AA3 A;  3FFI A;  1FKO A;  4B8C A;  4KTZ A;  3MXM A;  2WON A;  3AVC A;  4LH5 A;  5J1E A;  1D9F A;  1VRU A;  1RCH A;  4M3R A;  4BWM A;  1HNI A;  1U04 A;  3ITH A;  1S1X A;  3L2R A;  5HBM A;  4Y1D A;  4CEE A;  3QEI A;  4BAC A;  1U4B A;  3DYA A;  4RW7 A;  2Q3S A;  4FVM A;  3G10 A;  4RW9 A;  3DLH A;  2GV9 A;  3DI6 A;  1CXU A;  2YV0 X;  3MEE A;  2ITG A;  4CEQ A;  3AA2 A;  4Q5V A;  3OYB A;  1SKW A;  2OA8 A;  3PY8 A;  2KFZ A;  1L3S A;  4B9V A;  2F8S A;  1KFD A;  2F96 A;  2XY5 A;  3K5O A;  4YFU A;  1T8E A;  4W5N A;  1LWF A;  4CHP A;  2RN2 A;  3SUP A;  4KHW A;  3M8R A;  3V1Q A;  3HP9 A;  1ITG A;  1WN7 A;  2YNF A;  3QNN A;  3KTQ A;  1W9H A;  4DQI A;  2HHS A;  1RDA A;  2LSN A;  2B6A A;  2HHT A;  3NF9 A;  5T7B A;  1JKH A;  1RIL A;  1SUQ A;  3SI6 A;  2B5J A;  4DTX A;  4FJI A;  3OS0 A;  2OPQ A;  3B6O A;  4TSX A;  4CIG A;  4CJP A;  4E7I A;  4PQU A;  3RTV A;  3O3F A;  5FRM A;  4DSI A;  4IFV A;  4CEF A;  4DSE A;  3CM5 A;  4CJ3 A;  1ZBU A;  3VQA A;  3QIP A;  3TAP A;  2JGU A;  3K5N A;  3TAR A;  4DLG A;  3V9X A;  1NKC A;  4DQP A;  3OS2 A;  4DFJ A;  4AHV A;  4LH4 A;  1BIZ A;  1HYZ A;  1IKV A;  5J2P A;  4FK4 A;  1S9G A;  3AVM A;  1KVA A;  3WNG A;  3TAQ A;  4I9L A;  4CEB A;  1ZBF A;  3LP1 A;  4BDZ A;  1N6Q A;  2DFH A;  4DFK A;  2BGG A;  1KCF A;  3NCI A;  2G8F A;  2X6S A;  2Z1J A;  1TV6 A;  5FRO A;  3QER A;  1YTU A;  2X6N A;  1TKZ A;  1KVB A;  2GBZ A;  4CJQ A;  3LWL A;  3SQ4 A;  3M8P A;  1KLN A;  2HND A;  4DTM A;  4F3O A;  2YNG A;  4FW1 A;  4KHQ A;  4CGH A;  2G8K A;  1HPZ A;  3AV9 A;  4FJG A;  5KRT A;  2YNH A;  3SPY A;  3IS9 A;  4OLA A;  2XHB A;  3P5J A;  1WLJ A;  3OYK A;  1WSJ A;  4HUE A;  1ZBI A;  4DG1 A;  4FLT A;  4O44 A;  3VQ6 A;  4F4K A;  1U45 A;  4CCH A;  4EZ6 A;  4KHS A;  2HHV A;  4OPJ A;  4OGC A;  3DLR A;  1TK8 A;  2PY5 A;  2OZM A;  3PV8 A;  4FJK A;  2DFF A;  2KTQ A;  4DTJ A;  1L3V A;  1B9D A;  4Z4H A;  3WNF A;  3DOL A;  3DLG A;  3AVA A;  4AHR A;  4FZY A;  2I5J A;  4F8R A;  5CYM A;  2QK9 A;  3EY1 A;  4FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...