3L3VA

Structure of hiv-1 integrase core domain in complex with sucrose
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
144
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Crystal structure of the HIV-1 integrase core domain in complex with sucrose reveals details of an allosteric inhibitory binding site
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 53
structure length 144
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l3vA00
4JRQA 5J2QA 2IDOA 3ZT1A 4KTWA 3LWLA 1Q8IA 1S6PA 3TAQA 3VA3A 4EP4A 4DSJA 1WAFA 4C8NA 4FYDA 1SL1A 1SKWA 2ZE2A 3VQ9A 4IDKA 3BDPA 1NKCA 4CHZA 4M3WA 4IFYA 1UOCA 2FBTA 3ZSYA 4LSNA 3CG7A 3ITHA 4CE9A 4OKJA 1RT3A 3V1RA 4N56A 4CEFA 4CESA 1T7PA 2HHQA 2YNIA 4KB0A 1C0TA 4DSKA 1JXEA 1VRUA 3V9WA 2G8FA 3VQ4A 4DSIA 3DLGA 1T05A 4DQPA 3WNGA 4CEQA 3SV4A 1NJWA 3V9UA 4F3OA 5KTQA 3LP0A 5HBMA 4CGDA 4E1NA 2PY5A 4NCGA 2BDPA 3C6TA 1HYVA 4OGEA 5J1EA 4XIUA 1WNSA 4CJQA 3HPHA 2A1RA 3KKRA 4FJ7A 2QKKA 3DMJA 3LAKA 4H4MA 3DLHA 4DS4A 2ZD1A 3NBPA 1C0MA 2ITGA 3MXMA 1Q9XA 1ZBHA 1CZBA 2Y1JA 4F3TA 3VQQA 3OY9A 4DLEA 1VSMA 1NK8A 2YHAA 3VQDA 5E41A 3OYMA 3KLFA 4CF2A 2VWJA 1UWBA 3HO1A 1GOAA 3VQ5A 2XY7A 4KRFA 4KTQA 4CFAA 3EY1A 4FLVA 4FJKA 1G15A 1D5AA 3PV8A 3NF8A 1C1CA 3VQAA 3K2PA 4K8ZA 4AHUA 3CQ8A 2HHUA 2XRIA 3MAQA 4E7IA 3T1AA 1JLGA 2VWKA 3ZSOA 4FLXA 3THVA 1L3TA 1TGOA 3FFIA 4FJXA 1BI4B 3F73A 4JLHA 1TL3A 1N5YA 4EZ6A 1JKHA 4E3SA 4RW7A 1T8EA 4GVMA 1WSFA 3SUQA 4KHNA 3L3UA 4CEBA 4PA1A 1BIUA 1QQCA 3DI6A 2QKBA 2DFFA 4HUFA 5I3UA 2F8SA 3PX0A 3C6UA 1EETA 1S9EA 3AA3A 3OYKA 1JLQA 3LPTA 2FC0A 4F2RA 4H8KA 2GUIA 3OYIA 4FXDA 5SWMA 1ASVA 4DFJA 1YTAA 4FJ8A 1NJZA 4KHUA 3QIOA 2PZSA 1S6QA 4Y1CA 3QEWA 1IO2A 1UA1A 1RTIA 1BHLA 3MEDA 4W5RA 1ZBUA 4CHPA 2OA8A 4J2EA 1ASUA 2YNGA 3DLEA 3MXJA 4NYNA 4L8RB 3AVIA 4GMJB 4TSXA 3AVLA 3U3GA 1RT4A 3LZIA 1FKPA 1NK0A 4FJGA 1RT5A 1JL2A 2HHXA 3NF9A 2Z1GA 1D9DA 3AVCA 2BANA 1NK9A 4N41A 4YNQA 2WONA 3M8QA 4FJIA 1GOBA 2IAJA 4CERA 3D0PA 3KLHA 3SUPA 4NCBA 2Z1JA 4C8MA 2JLEA 3NH0A 3DOLA 3O3FA 1JXBA 3AA5X 4O4GA 4BDYA 1WAJA 3OS2A 3DRRA 4K8XA 1RT2A 2OPPA 5JS2A 2PYJA 2OYQA 1WSHA 3TANA 5C24A 1A5VA 4LH4A 4OPKA 4B9VA 4OGCA 4M3ZA 1IG9A 4CK1A 3MXIA 1HRHA 3RR8A 4DS5A 4CEZA 3OYCA 3DLKA 3SYZA 4DQQA 4M42A 4CJVA 4J2BA 1BQNA 2Q3SA 4CF8A 1RT6A 3NE6A 4JS4A 1S1TA 1RILA 2WOMA 3KLGA 2FBYA 3OYGA 4H4OA 4FM0A 1RBRA 3NGYA 4AHRA 4W5OA 2OPRA 4DSFA 3RRHA 3SQ0A 4FLTA 3S3OA 2HW3A 3V9SA 2PYLA 1DTQA 1N6QA 4KI4A 2G8KA 4NCAA 3I8DA 3VN5A 4AILC 4DSLA 4KHQA 4C8OA 4M3UA 1XI1A 5JS1A 1NKEA 4BWMA 2DY4A 4I2PA 1B9FA 2GBZA 1W9HA 4LD0A 4IKFA 2NUBA 2Y1IA 1IKWA 1S1UA 2X6NA 5K14A 3HVRA 3SCXA 1S1XA 1QSLA 3VQEA 3OS0A 2DFEA 2HNDA 4Z4GA 4Z4HA 1FXXA 3AVFA 3LAMA 4CHQA 2B6AA 4DTJA 2G8UA 4EP5A 1QE1A 2E6LA 3G10A 3AVNA 2G8WA 4DG1A 4AHCA 1T03A 1B92A 5KI6A 3L2VA 1C6VA 2E4LA 3C95A 2HVIA 1L3SA 1VSFA 3RR7A 3KK1A 3JSMA 2KFZA 2P5GA 2A1SA 2X78A 3QIPA 5FRMA 4FJ5A 3K58A 1J53A 1SUQA 2G8VA 1TKZA 3NDKA 1TK8A 4CJKA 1X9WA 3RMCA 2ETJA 2D5RA 4FJHA 4FM2A 4ID5A 4CJWA 3AO4A 4FW1A 2KFNA 3WNHA 2O4GA 1TK5A 3ZSRA 3T3FA 4ZTFA 4ELTA 1WSGA 3ZSZA 1HYZA 4HHTA 3HVTA 3V9XA 3CM6A 4OVLA 3MECA 3QINA 3NH1A 4CJFA 3OJSA 4E7KA 1TKXA 4FJ9A 3OYHA 3RTVA 3LP3A 3G0ZA 4CJUA 1EXQA 3OYAA 3ALYA 1U4BA 3VQ7A 1F21A 4M41A 3ZCMA 1S9GA 4CJPA 2YV0X 3SQ4A 3AA2A 4DQIA 3KD5E 1BL3A 4I9QA 1HJRA 2X74A 3QERA 4E0DA 1BGXT 5HRRA 4KB1A 2VG7A 1QSYA 3QESA 2HNYA 5HLFA 1KFSA 5C42A 3U3YA 4CFDA 1RCHA 4KREA 1EP4A 4QCLA 1YT3A 3LPUA 4W5TA 2AJQA 3LALA 3O4NA 3PUFA 4N5SA 4JRPA 4CEEA 5T7BA 3K5LA 4FM1A 2D0CA 4FLYA 4DF8A 4KHYA 4AHTA 4B9NA 4HTUA 3TAEA 3OYLA 4ELUA 3PO4A 3IAYA 3SPZA 3SUNA 4WE1A 3NGIA 4KO0A 1U45A 4KHWA 2F8TA 3L2RA 1EKEA 4B3OA 1SKSA 1RBSA 1KVAA 3WNFA 3QNNA 3OYNA 3L8BA 1TAUA 1TAQA 1FKOA 2FBVA 3RMAA 1ZBLA 2RPIA 1Z25A 4DTSA 1KLNA 4J2AA 4OLAA 3DLBA 4LSLA 3SV3A 4DWIA 2HNZA 2YNHA 5CY4A 1YTUA 2XY6A 1NOYA 4RW6A 4RG8A 3OYFA 4G1QA 4KV8A 4HVJA 1LWCA 3IS9A 5FRNA 3PY8A 4FK0A 1VSKA 3CYMA 1A5XA 3I0SA 1L3VA 1NOZA 2OZSA 3SZ2A 4DFMA 3VQPA 3NFAA 4O55A 1RBVA 3K57A 1QHTA 3VQCA 3ISNC 4CJ4A 5C25A 4CJEA 3DRPA 3U6FA 2OPSA 4I7FA 1KVCA 4FJMA 2F96A 1JLAA 2IOCA 4KKOA 5CZ1A 3ZSXA 1QTMA 3TAGA 3P1GA 4Z4IA 4CECA 4M3TA 3MEEA 3OVNA 4Z4CA 3OYEA 4DLGA 5CYMA 4E89A 1REVA 1KTQA 3O3HA 2XHBA 3AA4A 1LW0A 3CFRA 4IFVA 3HJFA 1DTTA 3AO3A 4DMNA 3OS1A 1WN7A 3VQBA 4I9LA 4B8CA 3TWHA 1RNHA 2YKNA 1IKXA 1BIZA 5HRNA 3RRGA 1B9DA 1TK0A 1RT7A 3S3MA 3V1QA 1NK4A 2X6SA 3CFOA 2IC3A 4DTRA 4CGIA 1LWEA 1C1BA 4GW6A 2E6MA 4CHYA 3I0RA 3K5MA 3RMDA 4ICLA 4CJRA 3CFPA 4O0IA 1TKDA 4DTNA 3O3GA 1LAVA 4PWDA 1SL0A 1VSDA 4CIFA 3SNNA 3LWMA 3LP1A 1VSIA 3IG1A 3P83D 3M8RA 3QEVA 1U48A 1TL1A 3H08A 3S9HA 2P1JA 4IG3A 4HUGA 2IGIA 4DTUA 4IBNA 4FJNA 3A2FA 3QETA 2HHSA 4DF4A 1BCMA 3S3NA 4W5NA 2RN2A 3B6OA 4Y1DA 4W5QA 4CJ5A 5HROA 4HUEA 3LZJA 1YVUA 4DTMA 1J5OA 4Z4EA 5CYQA 3NAEA 3K5OA 4BACA 1UAXA 5DK5A 4CF1A 3K5NA 4PY5A 1ITGA 4DQRA 2D0BA 1HNIA 2YKMA 1BQMA 4CGJA 5KGXA 3DYAA 3V6DA 1KLMA 5HP1A 4B9UA 4N76A 1WSJA 1X9MA 4CEDA 2HVHA 1SL2A 3ZSVA 1D8YA 1IH7A 4C8LA 2HHWA 1L5UA 4CJSA 5SZTA 3VQ8A 4FLWA 4CJLA 1GOCA 3MEGA 5KRTA 1KSPA 3CM5A 1VRTA 3SI6A 1TKTA 2KZMA 3HSTB 4RW8A 1TV6A 1WSEA 4CK3A 1RBTA 3HT3A 1NJXA 4BDZA 1LAWA 2OPQA 4AH9A 2KQ2A 3VQ6A 3L2WA 1ZBIA 1KCFA 2YHBA 3HYFA 1NKBA 2Z1HA 4I2QA 5D3GA 1ASWA 1RDCA 4B9LA 3BGRA 4KPYA 5I42A 4CJ3A 4JS5A 1VSJA 4O5BA 3RMBA 1D9FA 2ATQA 3SJJA 1U49A 3V1OA 2QK9A 3P5JA 4O44A 2XY8A 4RW4A 4CF9A 1LWFA 3ZT3A 4HCCA 3KK3A 4B08A 1TVRA 5J2PA 2B5JA 3OJUA 3VA0A 4FW2A 4ZHRA 3UIQA 2EHGA 1RTHA 3QO9A 5FROA 4YFUA 1IKYA 1J54A 3KIOA 3K59A 4OLBA 4AHVA 3HK2A 1JLEA 2JGUA 4AHSA 3AO5A 3TI0A 4DU4A 3B6PA 3EZ5A 2EX3A 5J2MA 3HP6A 5HRPA 3HM9A 2KW4A 4CEOA 4DFKA 1XC9A 2KTQA 3HPGA 3ZSWA 1ZYQA 2I5JA 4F8RA 3OYJA 4Z0UA 1X1PA 2BGGA 3HPOA 4ID1A 1HYSA 1BI4A 3L2QA 4CCHA 3ASMA 4PQUA 3KK2A 3TAFA 3HXMA 3TABA 3AO1A 3PX4A 3AVHA 4LY7A 5CZ2A 4N47A 3KKSA 1RTJA 3NF6A 3NH2A 2LSNA 4BE1A 1O1WA 1DLOA 4KI6A 2HHTA 4M3RA 2IS3A 1C0UA 2OZMA 1LW2A 1U47A 4OKKA 3ZSQA 4LH5A 3QEXA 4E1MA 2DTUA 1JL1A 1KVBA 1XHXA 3TAMA 2D0AA 3SUOA 1NJYA 1SKRA 4KTZA 1RT1A 3M8SA 5KGWA 4CK2A 4DU1A 1XHZA 1C1AA 1EX4A 1RBUA 3QLHA 3WNEA 3ZT2A 4EZ9A 4FVMA 1JLCA 3KJVA 1BCOA 4NYFA 1J9AA 1JLBA 4FJJA 1CLQA 4E19A 1RDDA 4DTOA 1K6YA 2HB5A 4CEAA 4HCBA 4E7HA 1ZBFA 5HRSA 3OYBA 3RWUA 4OJRA 1HQUA 3DRSA 3T19A 4ELVA 2ZQBA 1QS4A 2XO7A 4MFBA 4CFCA 4E7JA 2DFHA 5FDLA 3TR8A 5KRSA 4KAZA 4DU3A 4PUOA 4FLUA 1CXUA 4MQ3A 4R5PA 1HNVA 1I39A 4E7LA 1HMVA 3NGZA 4Z4FA 3ZT0A 3NF7A 3ULDA 2HMIA 4B8AB 1S5JA 2QXFA 3C94A 2VG5A 4CFBA 3OYDA 4DTXA 2FBXA 3AVBA 1HQEA 4IG0A 4DQSA 1VK0A 1W0HA 4OPJA 4FJLA 4UQGA 3AV9A 3SQ2A 4FZXC 4J2DA 4CHNA 5EU7A 1WLJA 4BDPA 4QAGA 3LDSA 3KLEA 2G8IA 3KLIA 3AVAA 3DM2A 3AVJA 3SQ1A 1UA0A 2HHVA 4O0JA 3SPYA 4KFBA 1RDAA 4DFPA 3V4IA 2Z1IA 3M8PA 4C8KA 3LP2A 1WSIA 1MU2A 3AVKA 1NK6A 3NHGA 2B4JA 3AVMA 4CIGA 3AVGA 4B9MA 1RDBA 1S1WA 2YNFA 4FCYA 4FK4A 1Y97A 1CXQA 1VSEA 1Q9YA 4CGGA 1I3AA 2GV9A 4KHSA 3L2UA 3QEPA 1X9SA 3TARA 3LANA 4CIEA 3E01A 2BE2A 1S1VA 4DTPA 3NCIA 1JLFA 1SV5A 3QEIA 2XY5A 1A5WA 4FZZA 4RW9A 4B9TA 4FZYA 4FK2A 1RTDA 4M3XA 3O4QA 3PX6A 1VSLA 1U04A 4B9SA 3HP9A 3EYZA 4M45A 3F9KA 3TAPA 4F2SA 4ZTJA 4BE0A 3AO2A 4BWJA 5DMRA 3JYTA 1NK7A 3KD1E 4QOZB 4CGFA 4CJTA 3D45A 1IKVA 3HL8A 3L3VA 2R7YA 3QNOA 1QSSA 1NK5A 3IRXA 2W42A 3V81A 2P5OA 1Z26A 1CZ9A 2RF2A 4Q5VA 4M3YA 3V9ZA 2P51A 3DOKA 1VSHA 4FLZA 1R0AA 3KTQA 3ZT4A 1LV5A 1FK9A 2VG6A 4CGHA 1BISA 1L3UA 4BE2A 1XWLA 4OKEA 3PO5A 2KZZA 1KRPA 2RKIA 4F4KA 2O4IA 1KFDA 3DLRA 5J2NA 2G8HA 4CHOA 4DSEA 1HPZA 4Q0BA 4CF0A
chains in the Genus database with same CATH superfamily
3PIOL 5J2QA 1E4FT 1YJWN 1Q8IA 1S6PA 1BUPA 3VA3A 4EP4A 1WAFA 4XH4A 4BRNA 2ZE2A 3BUZB 4IDKA 1JJ2M 1NKCA 4BR4A 3BDPA 4FOEA 4LSNA 3ITHA 4N56A 1T7PA 1W97L 1VRUA 4EFHA 3V9WA 4JI3K 2QWQA 2Q97A 3DLGA 3CC7N 1T05A 1NJWA 3TSPA 3V9UA 4F3OA 3D2FB 3QB0A 3ZEUB 2BDPA 4M7XA 3C6TA 1HYVA 3WXLA 4FJ7A 1VQ9N 3LAKA 1BOTO 1NK8A 3THWA 2HBKA 4JKHA 5F0XA 3OYMA 3HO1A 4KRFA 4KTQA 4CFAA 3EY1A 4FJKA 3CCJN 3NF8A 1C1CA 4FWSA 5BR9A 5AFUA 1BA1A 1K73O 3ZSOA 4GNIA 3THVA 1TGOA 5GAEP 1BI4B 4X62K 3F73A 1TL3A 2O8BB 4RW7A 1NJIO 3SUQA 3R1XA 4CEBA 3MDQA 1BIUA 3K9KA 3DI6A 2QKBA 4I6MA 2QXLA 3DXKA 1S9EA 3OYKA 4PL8A 2A6AA 2FC0A 4MO5A 3KWIA 4MLHA 5TKYA 2H3GX 4DUYK 1NJZA 3QIOA 4KHUA 1KXPA 4Y1CA 2W41A 3CC4N 4W5RA 4CHPA 3VF4A 1WB9A 2PBDA 4L8RB 4DR1K 3CETA 4TSXA 3AVLA 3EZWA 2HHXA 3NF9A 2Z1GA 1D9DA 4N41A 4YNQA 3M8QA 4FJIA 1GOBA 4CERA 3D0PA 3PIPL 4NCBA 2Z1JA 3NH0A 4BDYA 1WAJA 2GTDA 5M1NA 4YOVA 3LL3A 2PYJA 2OYQA 1A5VA 2HMPA 4OGCA 3AY9A 4CK1A 1E4GT 5CHIA 3DLKA 5FPMA 3SYZA 3FZLA 4DQQA 5AQTA 4M42A 4JS4A 2BUPA 2YHYA 1XNQK 1RILA 1RBRA 4AHRA 4BDPA 2OPRA 2NRRA 3SQ0A 4FLTA 1VAZA 1DTQA 4KI4A 2G8KA 2P9UA 1W7AA 4JKBA 4KHQA 2CGJA 2NRXA 3CJCA 4M3UA 1XI1A 4GY2B 4I2PA 2GBZA 4IKFA 3C6HA 1IKWA 1S1UA 2X6NA 5AQWA 2OCEA 3HVRA 1QSLA 1IBKK 1QVFM 2DFEA 2QM1A 4Z4HA 4CHQA 4CZEA 3LDOA 1QE1A 2E6LA 3G10A 5M1QA 1T03A 3L2VA 3C95A 2P9SB 4JEPA 2A1SA 4DV4K 3H3NO 3K58A 4BREA 1N8RO 3QMLA 2KFNA 1Q82O 1OH5A 1XUPO 5KPRA 5AZIB 3ZSRA 5AQJA 3T3FA 1WSGA 3ZSZA 1HYZA 3VEYA 3HVTA 3V9XA 3CM6A 2NRTA 3BZKA 4RCHA 1SS6A 3J7YP 1DKGD 3ATUA 3P31A 1Z6RA 1S9GA 4CJPA 2YV0X 4PHTX 3AA2A 1BL3A 4I9QA 3ENBA 1ATRA 5EY4A 4IO8A 5HRRA 3O80A 1GLJO 3ID8A 1MWKA 5FLXO 1RCHA 4KREA 1VQ8N 4JI0K 3O4NA 5T7BA 3K5LA 1C0FA 2E8AA 4FLYA 1YI2N 3MK6A 3ZX0A 4B3SK 4ELUA 4KO0A 4KHWA 4DQ8A 2O8FA 3SLCA 1WUAA 2NNWA 3OYNA 1FKOA 3DXMA 3RMAA 2V7YA 3DLBA 4BRAA 3FR0A 3VGMA 1NOZA 3SZ2A 4WQ4C 1O13A 3WEEB 3ISNC 4CJ4A 4CJEA 3DRPA 2OPSA 3T1YK 1OVYA 2IOCA 3ZSXA 1QTMA 4FWKA 5AZJA 3A0IX 4Z4CA 2YI1A 1RGIA 5CYMA 3NMUA 3O3HA 3AA4A 1LW0A 3U8XA 4IFVA 1DTTA 3AO3A 3BP8A 4DMNA 3OS1A 2UUBK 3SK3A 4AQYK 3M6GA 3T7ZA 4CZIA 1TK0A 3RVCA 1NK4A 4IOXA 5BPNA 4JKCA 4DTRA 1LWEA 1C1BA 2E6MA 3IUCA 5AQNA 4NXMK 4DV5K 1QQOA 1N33K 3SMPA 3VENA 3LWMA 3IG1A 3QEVA 1TL1A 5AQQA 3RSEA 2IGIA 1HX1A 3CHWA 4FJNA 4PKHA 3S3NA 3EL2A 2RN2A 4Y1DA 4W5QA 4HUEA 1J5OA 5CYQA 1UAXA 2PAVA 1ITGA 3QBXA 1HNIA 1BQMA 3DYAA 5GADP 5HP1A 4B9UA 4LF5K 5ELZA 5LMUK 1SL2A 4C8LA 2QWLA 1H1VA 5KRTA 4JAXA 1TKTA 3HSTB 3G6EN 5C12A 1RBTA 4BDZA 3M5RA 1HLUA 4AH9A 1KCFA 2A42A 2YHBA 3HYFA 5D3GA 3BGRA 5I42A 4KHPK 4IFEA 1VSJA 4O5BA 1D9FA 2V7ZA 3VETA 2XY8A 4RW4A 1LWFA 2B5JA 3UIQA 2E1YA 1Q81O 5BN8A 4BRHA 3UKRB 4C23A 3HK2A 2JGUA 3AO5A 5A2QO 4DU4A 3THYB 5LMNK 5AQFA 3VMFB 2I5JA 3OYJA 4Z0UA 3C7NA 1HYSA 3L2QA 5EOYA 3GBTA 4RWTA 2CGLA 3TABA 1BG3A 3E1YA 3KKSA 4DV3K 4BE1A 2HHHK 4DR7K 2OZMA 3L4IA 3G4SN 4JV5K 3D2EA 5AQUA 4OKKA 3ZSQA 4DV2K 1KVBA 3FGUA 2D0AA 3JS6A 2GWKA 2ZJRL 1C1AA 3ZT2A 1GLEG 3KJVA 2P9IB 2O8DB 4FJJA 2Q31A 2HB5A 4CEAA 4HCBA 3OYBA 4OJRA 2ZQBA 3THXB 4FVUA 1G99A 4CD3A 5AQYA 4EIAA 1HNVA 5M1OA 4WQ5A 2ZM6K 2QXFA 1HQEA 4DQSA 4OPJA 3KZBA 2VGMA 4H5TA 2JWKA 2V51B 3CQXA 3LDSA 3AVAA 3DM2A 1UA0A 4O0JA 3SPYA 4MO4A 4DFPA 3V4IA 4H5WA 5AQPA 3NHGA 3LDPA 5EXWA 3L6QA 3FZMA 4WQ4A 2YNFA 4FCYA 4OO1J 3VERA 1VSEA 1X3MA 1I3AA 2GV9A 3L2UA 2W6LA 3O08A 1DEJA 1S1VA 4GKJK 3NCIA 1JLFA 2ASPA 3H1VX 1A5WA 4K43A 4RW9A 1P8ZA 3U9DA 4M45A 3ID6A 2QWOA 5JLFA 2QEXN 4BE0A 3AO2A 1NK7A 5F1XA 3R3LA 4CGFA 3WUHA 3HZ6A 3DAWA 3W3DA 3I56N 3D45A 1IKVA 3HL8A 3L3VA 2R7YA 1QSSA 3IRXA 1Z26A 4Q5VA 1NGIA 3DWLA 3V9ZA 3HOTA 1VSHA 2FF3B 2RE2A 1R0AA 3ZT4A 1FK9A 2Q1NA 1S3XA 4AM7A 1XC3A 3OA9A 4LFBK 4B1ZA 2G8HA 4Q0BA 2IDOA 1K9MO 5DM7L 3OW2M 3WXIA 4M3WA 2YX6A 4JKGB 3VQ9A 1FJGK 1NGEA 4CHZA 2I7PA 1N36K 3V1RA 4CESA 2HHQA 2YNIA 1C0TA 3CI5A 1JXEA 3CMEN 5M1FA 3VQ4A 3O8MA 4BR9A 4CEQA 1KAZA 4DQPA 1GLBG 4NCGA 4CBWA 3ZX3A 3ENHA 4M7YA 3HPHA 2A1RA 3CCQN 3DLHA 4H4MA 4DS4A 2NRHA 2ZD1A 3NBPA 4QS9A 1HUXA 2ITGA 3VF6A 4X65K 1CZBA 4WFNL 3VQQA 2YHAA 4JKAA 4CF2A 1UWBA 4NO7A 1G15A 1D5AA 3EO3A 1ZBSA 3CQ8A 2HHUA 4BVPA 3E9PA 3MAQA 3DLLL 1D4XA 1ATSA 1JLGA 3EKSA 4E7IA 4FLXA 1L3TA 3PSIA 1JKHA 4GVMA 4XH1A 4DKWA 5I3UA 3C6UA 3ATVA 1CZAN 2HBJA 3AA3A 4F2RA 4FL9A 3OYIA 4A62A 3UB5A 4BC4A 1YTAA 5BREA 4FJ8A 3T1HK 2PZSA 1NGHA 3QEWA 1IO2A 3R6MA 1J5EK 3TTCA 1ASUA 3VGLA 3DLEA 5JMVA 4NYNA 4CZKA 3U3GA 4BRDA 1RT4A 2YJFA 1RT5A 1JL2A 2WONA 4DV7K 2P9NB 3UKUB 3SAFA 1OVQA 1QZ5A 4C8MA 3AA5X 1N34K 4K8XA 5JS2A 3VEOA 4BRGA 3SJHA 4BR5A 3MCAB 2GWJA 4CZFA 3MN5A 3HOSA 1OH6A 4JI5K 3QDKA 4R79A 1HKBA 1RT6A 1SAZA 2WOMA 1DGKN 2O8CB 3RRHA 4W5OA 4A61A 4DSFA 3V9SA 5M1PA 3VN5A 4C8OA 5JS1A 1K8KB 3GDQA 4BWMA 1GLLO 4LD0A 2P9KA 1J6ZA 3A5OC 2FSJA 4NLCA 4DTJA 2G8UA 1Q86O 3AVNA 2G8WA 1TYQA 2RHKA 3GE1A 4AHCA 1C6VA 2VQFK 4DR4K 4JI1K 3BF3A 5I9EB 3VOVA 2P5GA 2X78A 3QIPA 1MA9B 3GG4A 1X9WA 3RMCA 2A5XA 2FXUA 3ZEUA 4FM2A 4FJHA 3WQTA 3H1QA 4ELTA 1GLAG 3ENOA 2V52B 4OVLA 4E7KA 1YUWA 3QINA 4CBXA 1T6DA 5GINA 3C0BA 5C0YA 1NWKA 3FLCO 1EXQA 3ALYA 1YJ9N 4ILJA 2FF6A 3SQ4A 5BR8K 2BH1A 3QERA 4E0DA 1BGXT 2VG7A 3CIPA 4FPBA 4JNEA 1QSYA 2HNYA 3E9LA 5C42A 3FE1A 3C65A 1YT3A 1Z05A 2AJQA 4B3RK 4JRPA 4FM1A 4HTUA 3OYLA 3TPQA 3CJAA 3IAYA 3A8YA 1V4TA 3SUNA 2UYTA 1EKEA 3PSFA 3LM9A 3QNNA 3L8BA 1TAUA 4J2AA 3SV3A 4DWIA 4BRMA 2HNZA 5CY4A 4BRKA 5BPMA 4RW6A 4CVNE 4IJNA 1Y64A 1LWCA 4BC3A 5FRNA 4A2AA 4BG8A 3CYMA 3QBWA 5KPZA 4DFMA 1NG9A 1QHTA 4JI8K 5C25A 3U6FA 3DXKB 4ISEA 4EAHD 2F96A 1JLAA 4KKOA 2VWBA 4Z4IA 4CECA 3MCPA 3MEEA 3OVNA 4WYBA 4WFBL 1R59O 1GLDG 2GEMA 4LF9K 2XHBA 3CFRA 2E88A 5AFUH 3TWHA 4JN4A 4I9LA 5AQRA 1HNXK 5BN9A 4IO9L 1C0GA 4CGIA 4K41A 2QA4N 4ICLA 1TKDA 3EEQA 1Q7YO 3HTVA 4PWDA 3OBWA 4CIFA 1QZ6A 1VSIA 2VGNA 1EWQA 3M8RA 3H08A 4IG3A 3DJCA 3C6AA 5AQZA 4DTUA 4IBNA 3QETA 4DF4A 1BCMA 4W5NA 5HROA 5ADXH 4Z4EA 1YVUA 3J81O 4BACA 4A5AA 2D0BA 4B3MK 1IJJA 2P9SA 4N76A 3D7EO 1X9MA 5GAHP 1D8YA 1IH7A 4FWOA 1VQ7N 4CJLA 1GOCA 1KSPA 3CM5A 3SI6A 4RW8A 3HT3A 2P9UB 1NJXA 3NVMA 2OPQA 4DR3K 1NKBA 1NGFA 4IXCA 4FWRA 4JS5A 3RMBA 4FWLA 3WT0A 3WQUA 1U49A 1NGJA 4RTFD 4GV6A 3ZT3A 4HCCA 2JWLA 4ZHRA 2EHGA 4DCHA 3EE8A 4YFUA 1IKYA 4AHVA 4HWIA 5LJVA 1JLEA 4AHSA 4E1JA 3J8AA 5AQHA 3KD1E 4QOZB 2KTQA 2KW4A 4CEOA 4DFKA 3HPGA 3O1BA 1ZYQA 2ITMA 4F8RA 1TUUA 3P39A 4YORA 4ID1A 1HKGA 5IT9O 4CCHA 5AJ3K 5JLHA 1BU6O 4PQUA 2AP1A 4JD2B 3AARA 3AO1A 3PX4A 3AVHA 3NH2A 2ZJQL 2LSNA 4H0TB 4KI6A 3I33A 2VYPA 5FPDA 4WQ5C 1LW2A 5EVZA 4DR5K 5C2DA 3QEXA 3FFKB 4E1MA 1XHXA 2QI2A 4KTZA 3M8SA 2W40A 1XHZA 3QLHA 4FSVA 4ISFA 3JXUA 3BEXA 3CCMN 3RWUA 1HQUA 2FSKA 5MLCQ 2P9LA 1QS4A 2XO7A 4MFBA 3AGKA 4E7JA 3T69A 5M1KA 5KRSA 4AF1A 4FLUA 4R5PA 2O8FB 3MX2A 3NGZA 4UY8O 1XMOK 1HNZK 1KRPA 1S5JA 2O4IA 4CFBA 4DTXA 2FBXA 3DXMB 3O6WA 1DT9A 5HOOA 3VPZA 4FJLA 3TTDA 3EE9A 4CZLA 4FZXC 4ISGA 1WLJA 4A2BA 2G8IA 2HHVA 3SQ1A 4KFBA 4GV9A 2O8EA 2Z1IA 1KFSA 1MU2A 2F4VK 3CJ1A 5JVGL 3AVGA 4B9MA 1RDBA 4IOCL 1GLFO 4C1NI 3U4LA 4KHSA 3VEZA 5AZJB 3TARA 3H3OB 3LDQA 4DTPA 3QICA 4JI4K 1SV5A 3QEIA 5KQ8A 4M3XA 3PX6A 2OTJN 3HP9A 1K8AO 4F2SA 4BWJA 3AAPA 3H46O 3QNOA 4BGBA 1HPMA 2P5OA 2RF2A 4M3YA 2P51A 4L3QA 3RSEB 4BG9A 2VG6A 1BISA 2Q2RA 1YIJN 1S72N 4OKEA 3PO5A 3J7AP 2RKIA 3NVKA 1HPZA 4CF0A 1WBDA 4JRQA 3LWLA 4IWVA 1EO1A 4PKIA 3VEVA 4DSJA 3IKMA 4FYDA 1SL1A 1SKWA 3UKRA 1UOCA 3CG7A 4CE9A 4OKJA 5H1SQ 1RT3A 3THYA 4CEFA 4DSKA 2G8FA 3VEWA 4DSIA 4IEEA 3WNGA 3SV4A 4FWNA 5KTQA 1BWFO 1RFQA 4CGDA 2PY5A 1LCUA 4J8FA 5J1EA 4GKKK 1SZ2A 4XIUA 1WNSA 3G71N 3KWGA 3KKRA 3MWTA 3DMJA 1ZXOA 1C0MA 3MXMA 2Y1JA 4BQZA 1VSMA 2F9TA 3VQDA 2VWJA 1GOAA 2XY7A 2IIRA 4FLVA 4U67L 3VQAA 3K2PA 4AHUA 2O8DA 3P38A 1JCEA 2VWKA 3C7NB 4FK2A 3FFIA 1N5YA 4EZ6A 4QS8A 4E3SA 1T8EA 4KHNA 4DHYA 1WSFA 3CF5L 2E2QA 1QQCA 5GAGP 4HUFA 2F8SA 3PX0A 1EETA 3BF1A 1ZC6A 2CH5A 2QWMA 4H8KA 2GUIA 3OHRA 2GELA 5SWMA 1FW6A 1ASVA 3D2EB 1S6QA 1UA1A 4V19S 2KLAA 1ZBUA 4J2EA 4BR7A 1VHXA 2YNGA 2ZF5O 3MXJA 3LZIA 3VTHA 1FKPA 4H0PA 4H0XB 3AVCA 2BANA 1NK9A 4LFAK 2WFBA 2IAJA 2HBLA 3SUPA 2P9PA 3DOLA 4NLBA 1JXBA 4O4GA 4KBOA 4BRIA 3W0LA 3OS2A 1GLCG 3DRRA 1RT2A 3FZKA 1E3MA 4EHUA 5TKWA 4YOYA 4LH4A 4OPKA 4B9VA 1HRHA 4BVOA 4CEZA 3OYCA 1SQKA 3A5MC 3UE5A 4J2BA 1BQNA 3NE6A 3I8BA 1S1TA 4YOTA 3FZHA 2ZGZA 4H5VA 2FBYA 3OYGA 4A57A 3B8AX 4OX9K 2PYLA 5E26A 3MX5A 4G9ZA 3H6EA 4NCAA 3PLAA 4LF7K 4DSLA 3J80O 1NKEA 2QWPA 2WBNA 1W9HA 2NUBA 2Y1IA 3SCXA 3VQEA 1MWMA 3S41A 2UXCK 2HNDA 4DR6K 4Z4GA 1FXXA 5BPLA 3LAMA 4KH5A 2B6AA 3SBTA 2ASMA 4FOIA 3AAQA 3SBGA 3ULEA 3KK7A 1B92A 4ILHA 4YOWA 1L3SA 3KK1A 2KFZA 2FSNA 1J53A 3VF2A 1TKZA 4CZGA 4IOAL 3A5NC 3ZETA 1XMQK 5BRDA 4ID5A 3AO4A 4FW1A 3WNHA 4B1UB 2O4GA 3N4QA 1TK5A 4ZTFA 1XQSC 1QQMA 3NH1A 2ZJPL 4ILGB 3RTVA 3G0ZA 4CJUA 4H0OA 1KD1O 4MLEA 3HSCA 2HSTA 3BY5A 3ZCMA 3SMSA 4WFAL 3VTIA 2X74A 5LJWA 4JK7A 3QESA 2NZTA 4K25A 3J7ZO 2J4RA 4CFDA 1EP4A 4W5TA 1Q18A 1U2VB 3LALA 2F9WA 3PUFA 4DF8A 4KHYA 4AHTA 4B9NA 3PO4A 5AR0A 3ZX2A 2F8TA 3MN7A 4B3OA 2W6KA 1RBSA 1KVAA 2FBVA 1KLNA 1Z25A 4DTSA 3BZCA 4LSLA 2YNHA 3L0QA 1YTUA 3A5LC 1IBMK 5KPTA 2QWNA 4HVJA 3IS9A 1VSKA 3JAMO 3I0SA 1A5XA 2OZSA 3VQPA 1RBVA 2A40A 3VQCA 4FJMA 3ZLJA 4BC2A 5CZ1A 3TAGA 4DLGA 5HL7L 1KTQA 3HJFA 5AQLA 4WCEL 1QVGM 1WN7A 4B1XB 1RNHA 1IKXA 5HRNA 1B9DA 3S3MA 3V1QA 3MN6A 3CFOA 4PL7A 4JHDA 4GW6A 4CHYA 4HTLA 5AQOA 3I0RA 5E84A 2WUSA 4DV6K 4DTNA 4Y0WA 3O3GA 3K0SA 1SL0A 1VSDA 4NB4A 3P83D 3S9HA 3MN9A 2P1JA 2Q36A 4HUGA 4C1NK 3A2FA 5FPNA 3B6OA 4CJ5A 3LZJA 4DTMA 3M3ZA 4K42A 3K5OA 5DK5A 3H45C 4DQRA 5KGXA 4CGJA 1U6ZA 3V6DA 1KLMA 4M63C 1V4SA 2GX9A 4CEDA 2HVHA 5KQDA 1T6CA 1VQ4N 4CJSA 5SZTA 1P90A 4FLWA 3MEGA 1VRTA 2KZMA 5C2FA 4JKEA 4YOXA 1TV6A 4CK3A 3QFUA 1ZBIA 3L2WA 3VQ6A 4JK9A 4IJAA 3D2FA 2P9KB 3KHYA 1ASWA 1RDCA 4KPYA 4CJ3A 1NMNA 2ATQA 1X3NA 1W2BM 3SJJA 2QK9A 3V1OA 3P5JA 4CJ7A 2BTFA 4O44A 4CF9A 2E2PA 4JKDA 1TVRA 5J2PA 2NRWA 1LOTB 1TYQB 4FW2A 3VA0A 4GV3A 4LF6K 5FROA 4H5NA 1J54A 3K59A 1HR0K 5J2MA 5HRPA 1XC9A 3ZSWA 1X1PA 2E2OA 4CW7B 1BI4A 2O8BA 3P4IA 5CE3A 4U7BA 3CCEN 3KK2A 4CBUA 4B1VA 3IFRA 3L4QA 4OPAA 4BRPA 2YCHA 1YITN 1NBWA 3WXJA 3E9OA 1C0UA 4BR0A 1U47A 5DM6L 4PKGA 4FPAA 3THWB 2HF4A 4K0KK 2DTUA 1M90O 3TAMA 3SUOA 1NJYA 4QS7A 1I94K 4DU1A 1RBUA 4FVMA 1JLCA 1BDGA 1J9AA 1CLQA 4E19A 1RDDA 4YDUA 4DTOA 4E7HA 1VQ6N 3DRSA 4I6MB 4ELVA 4CFCA 3CC2N 4OPHA 4KAZA 5AQSA 4PUOA 2IVPA 1I39A 1VQLN 3CCUN 1HMVA 2OANA 1XNRK 3ULDA 2HMIA 5ADXA 4B8AB 3OYDA 3AVBA 1W0HA 3O9QA 3O9UA 1YF5L 3CJ7A 3AV9A 3O4WA 3IMXA 4CHNA 5EU7A 4BGAA 3KLIA 2ZWHA 3WXKA 2UXDK 3M8PA 4C8KA 3LP2A 1KC8O 1NK6A 3AVMA 1QHAA 2GUPA 3E66A 2QWRA 2QW9A 4CGGA 3GOIA 3QEPA 1X9SA 4A59A 2IVOA 1OH8A 4CIEA 2BE2A 3VEXA 3CJBA 3O9SA 4FZZA 1RTDA 3O4QA 1U04A 3EYZA 3TAPA 4ZTJA 2YJEA 2AA4A 5GIPA 4YHHK 3O9RA 1NK5A 2W42A 3DOKA 4FLZA 3KTQA 3D6RA 4CGHA 4BE2A 4F4KA 1YJNN 4JI7K 5AZIA 2E1ZA 4DSEA 2VCPA 2F7TA 2PFUA 4CZJA 1NGCA 3ZT1A 4KTWA 3MWPA 5C10A 3TAQA 2KHOA 1M1KO 3AGRA 1JCFA 5IWAK 4C8NA 4IFYA 2FBTA 3ZSYA 3ZYYX 4XEIA 4KB0A 3O9TA 3O5BA 3EN9A 3R8EA 3LP0A 5HBMA 4E1NA 4JD2A 4OGEA 3VESA 4CJQA 3VGKA 2QKKA 4BY9C 2E5LK 3CCLN 1Q9XA 1ZBHA 1NGBA 4F3TA 4DLEA 3OY9A 3CCVN 5E41A 3KLFA 3VQ5A 3PV8A 2NLXA 4JI6K 4LFCK 4K8ZA 4YY3K 1YAGA 2XRIA 1WOQA 4KH4A 3T1AA 4FJXA 1ATNA 4JLHA 4O8KA 1VQ5N 3L3UA 4PA1A 4BRLA 5FPEA 2DFFA 3WEEA 2UU9K 1EWRA 4FWQA 1JLQA 3LPTA 5AQIA 1EQYA 2EWSA 3LM2A 4CI6A 4FXDA 4DFJA 4DB3A 2I7NA 5CR4A 4JKFA 1RTIA 1BHLA 3MEDA 1IG8A 2OA8A 1QQNA 3U9ZA 3AVIA 4GMJB 4FJGA 1NK0A 3SAGA 3I55N 4FO0A 2WC9A 4A5BA 3KLHA 5BRFA 2JLEA 3O3FA 2P9LB 3K9JA 4JYAK 1T44A 5F2RA 2OPPA 1WSHA 4FWMA 2VQEK 3TANA 5C24A 5B8HA 3Q7CA 4M3ZA 1IG9A 5EX5A 3MXIA 3RR8A 4DS5A 1ESVA 3TU5A 4CJVA 5BRHA 2Q3SA 4CF8A 2CH6A 3KLGA 4H4OA 4FM0A 3NGYA 2O8EB 2HW3A 4DV1K 3S3OA 1N6QA 3I8DA 4AILC 4O5FA 3CPWM 2DY4A 1B9FA 3F5TA 2D0PA 5K14A 1BA0A 1RDWX 1S1XA 1MDUB 3OS0A 4JK8A 2D1KA 3AVFA 4EP5A 2DPNA 4Z94A 4BC5A 4DG1A 5KI6A 4CZMA 2E4LA 1HJOA 2HVIA 1VSFA 4YOUA 3RR7A 3JSMA 3CMAN 5FRMA 3M1FA 4FJ5A 4B1WB 1SUQA 3WXMB 2G8VA 5C15A 3NDKA 1TK8A 4CJKA 2D4WA 2ETJA 4B1YB 2D5RA 4CJWA 4IEIA 1NGGA 4HHTA 3MECA 3SAHA 4CJFA 3OJSA 4FJ9A 1TKXA 3OYHA 3LP3A 1NNEA 2HBMA 3CCRN 1KAXA 3CXCM 3OYAA 4BR2A 1U4BA 4FWPA 1F21A 4M41A 3VQ7A 4DQIA 3KD5E 3O1WA 1HJRA 4KB1A 2P9IA 5HLFA 4IDHA 3U3YA 2KKZA 2HF3A 4QCLA 3LPUA 3F9MA 2IVNA 4N5SA 4CEEA 2D0CA 3Q7BA 3TAEA 3THXA 4BRFA 3SPZA 5LL6Z 4WE1A 3NGIA 1U45A 3L2RA 1T3VA 1SKSA 3WNFA 1ILYA 1TAQA 1TUYA 1YVNA 2RPIA 1ZBLA 4OLAA 2XY6A 1NOYA 1YXQA 4RG8A 3OYFA 4G1QA 4KV8A 3PY8A 4FK0A 1VQKN 1L3VA 3NFAA 4O55A 4EHTA 2WTUA 3K57A 4I7FA 1KVCA 3P1GA 4M3TA 3OYEA 4E89A 1REVA 3HM8A 3VQBA 4B8CA 2YKNA 1VQMN 3RRGA 1BIZA 1RT7A 2X6SA 2CGKA 2IC3A 5AQXA 1RDUA 3RMDA 3K5MA 2QTDA 4JI2K 4CJRA 3R9PA 1NU0A 4IZ9A 3CFPA 4O0IA 1LAVA 4H03B 3SNNA 2P9PB 3LP1A 1U48A 1BO5O 2NRZA 4H0VB 1NGAA 2HHSA 4AM6A 3CJ9A 2UUAK 3NAEA 4H0YB 4CF1A 1VQNN 3K5NA 3N4PA 4PY5A 3QFPA 4KH6A 4DUZK 2YKMA 4MDBA 5JICA 3CCSN 4NXNK 1WSJA 5AQMA 2E20A 2Q0RA 4JKGA 3ZSVA 2HHWA 1L5UA 3VQ8A 4DV0K 2OTLN 1WSEA 3LDNA 1LAWA 3MMVA 2KQ2A 3LDLA 2UXBK 4BQLA 2Z1HA 4I2QA 4B9LA 3OTOK 2YHWA 2D0OA 5AQKA 3KK3A 4B08A 3ULEB 3OJUA 4LF8K 1NGDA 1RTHA 3QO9A 3KIOA 4OLBA 4MDAA 3G25A 2HOEA 1KAYA 4WF9L 3TI0A 3B6PA 3EZ5A 2EX3A 3HP6A 3HM9A 4LC9B 3F2KA 3GL1A 3ZETB 2BGGA 3HPOA 4YDUC 1U2VA 3ASMA 1OKJA 2YHXA 3TAFA 3HXMA 4LY7A 5CZ2A 4N47A 1RTJA 2A3ZA 2Q0UA 3HBTA 3NF6A 1O1WA 1DLOA 2ZGYA 2HHTA 3HI0A 5LY3A 4M3RA 2IS3A 3CPEA 4X66K 2FLOA 1IBLK 4LH5A 1JL1A 4B9QA 1VQPN 1SKRA 1RT1A 5KGWA 2NRVA 4CK2A 4LF4K 3WNEA 1EX4A 4EZ9A 4O8UA 1BCOA 4NYFA 1JLBA 1K6YA 1ZBFA 5HRSA 2A41A 2P9NA 3UKUA 3T19A 2DFHA 5FDLA 4BRCA 3TR8A 4DU3A 4CZHA 1CXUA 3EKUA 4MQ3A 4E7LA 4Z4FA 3CERA 3ZT0A 3NF7A 3IDHA 1X9JA 3C94A 2VG5A 4IG0A 1VK0A 1YHQN 4UQGA 3SQ2A 3KVGA 4J2DA 1IV0A 1WBBA 4QAGA 3KLEA 3AVJA 2O8CA 2E2NA 1RDAA 4BROA 3HRGA 2ASOA 5JVHL 1WSIA 3AVKA 3OBYA 2B4JA 4CIGA 4FK4A 1S1WA 1Y97A 1CXQA 1Q9YA 1KQSM 4H5RA 1K8KA 3TTFA 1HNWK 3LANA 4GVEA 3E01A 2XY5A 4B9TA 4FZYA 5GIOA 1VSLA 4B9SA 3F9KA 3FZFA 5DMRA 4X64K 4JHDB 4DR2K 3JYTA 2UUCK 4CJTA 1NLVA 1JCGA 4CD1A 3CQYA 3V81A 1NMDA 1CZ9A 3CD6N 5AQVA 3TSQA 1LV5A 1N32K 1VQON 3TSUA 1L3UA 1NM1A 1S22A 1XWLA 4F9OA 4BRQA 2KZZA 1OH7A 1KFDA 1HKCA 3DLRA 5J2NA 4CHOA 4XH5A 4B3TK 5AQGA
chains in the Genus database with same CATH topology
4JRQA 5J2QA 2IDOA 3ZT1A 4KTWA 3LWLA 1Q8IA 1S6PA 3TAQA 3VA3A 4EP4A 4DSJA 1WAFA 4C8NA 4FYDA 1SL1A 1SKWA 2ZE2A 3VQ9A 4IDKA 3BDPA 1NKCA 4CHZA 4M3WA 4IFYA 1UOCA 2FBTA 3ZSYA 4LSNA 3CG7A 3ITHA 4CE9A 4OKJA 1RT3A 3V1RA 4N56A 4CEFA 4CESA 1T7PA 2HHQA 2YNIA 4KB0A 1C0TA 4DSKA 1JXEA 1VRUA 3V9WA 2G8FA 3VQ4A 4DSIA 3DLGA 1T05A 4DQPA 3WNGA 4CEQA 3SV4A 1NJWA 3V9UA 4F3OA 5KTQA 3LP0A 5HBMA 4CGDA 4E1NA 2PY5A 4NCGA 2BDPA 3C6TA 1HYVA 4OGEA 5J1EA 4XIUA 1WNSA 4CJQA 3HPHA 2A1RA 3KKRA 4FJ7A 2QKKA 3DMJA 3LAKA 4H4MA 3DLHA 4DS4A 2ZD1A 3NBPA 1C0MA 2ITGA 3MXMA 1Q9XA 1ZBHA 1CZBA 2Y1JA 4F3TA 3VQQA 3OY9A 4DLEA 1VSMA 1NK8A 2YHAA 3VQDA 5E41A 3OYMA 3KLFA 4CF2A 2VWJA 1UWBA 3HO1A 1GOAA 3VQ5A 2XY7A 4KRFA 4KTQA 4CFAA 3EY1A 4FLVA 4FJKA 1G15A 1D5AA 3PV8A 3NF8A 1C1CA 3VQAA 3K2PA 4K8ZA 4AHUA 3CQ8A 2HHUA 2XRIA 3MAQA 4E7IA 3T1AA 1JLGA 2VWKA 3ZSOA 4FLXA 3THVA 1L3TA 1TGOA 3FFIA 4FJXA 1BI4B 3F73A 4JLHA 1TL3A 1N5YA 4EZ6A 1JKHA 4E3SA 4RW7A 1T8EA 4GVMA 1WSFA 3SUQA 4KHNA 3L3UA 4CEBA 4PA1A 1BIUA 1QQCA 3DI6A 2QKBA 2DFFA 4HUFA 5I3UA 2F8SA 3PX0A 3C6UA 1EETA 1S9EA 3AA3A 3OYKA 1JLQA 3LPTA 2FC0A 4F2RA 4H8KA 2GUIA 3OYIA 4FXDA 5SWMA 1ASVA 4DFJA 1YTAA 4FJ8A 1NJZA 4KHUA 3QIOA 2PZSA 1S6QA 4Y1CA 3QEWA 1IO2A 1UA1A 1RTIA 1BHLA 3MEDA 4W5RA 1ZBUA 4CHPA 2OA8A 4J2EA 1ASUA 2YNGA 3DLEA 3MXJA 4NYNA 4L8RB 3AVIA 4GMJB 4TSXA 3AVLA 3U3GA 1RT4A 3LZIA 1FKPA 1NK0A 4FJGA 1RT5A 1JL2A 2HHXA 3NF9A 2Z1GA 1D9DA 3AVCA 2BANA 1NK9A 4N41A 4YNQA 2WONA 3M8QA 4FJIA 1GOBA 2IAJA 4CERA 3D0PA 3KLHA 3SUPA 4NCBA 2Z1JA 4C8MA 2JLEA 3NH0A 3DOLA 3O3FA 1JXBA 3AA5X 4O4GA 4BDYA 1WAJA 3OS2A 3DRRA 4K8XA 1RT2A 2OPPA 5JS2A 2PYJA 2OYQA 1WSHA 3TANA 5C24A 1A5VA 4LH4A 4OPKA 4B9VA 4OGCA 4M3ZA 1IG9A 4CK1A 3MXIA 1HRHA 3RR8A 4DS5A 4CEZA 3OYCA 3DLKA 3SYZA 4DQQA 4M42A 4CJVA 4J2BA 1BQNA 2Q3SA 4CF8A 1RT6A 3NE6A 4JS4A 1S1TA 1RILA 2WOMA 3KLGA 2FBYA 3OYGA 4H4OA 4FM0A 1RBRA 3NGYA 4AHRA 4W5OA 2OPRA 4DSFA 3RRHA 3SQ0A 4FLTA 3S3OA 2HW3A 3V9SA 2PYLA 1DTQA 1N6QA 4KI4A 2G8KA 4NCAA 3I8DA 3VN5A 4AILC 4DSLA 4KHQA 4C8OA 4M3UA 1XI1A 5JS1A 1NKEA 4BWMA 2DY4A 4I2PA 1B9FA 2GBZA 1W9HA 4LD0A 4IKFA 2NUBA 2Y1IA 1IKWA 1S1UA 2X6NA 5K14A 3HVRA 3SCXA 1S1XA 1QSLA 3VQEA 3OS0A 2DFEA 2HNDA 4Z4GA 4Z4HA 1FXXA 3AVFA 3LAMA 4CHQA 2B6AA 4DTJA 2G8UA 4EP5A 1QE1A 2E6LA 3G10A 3AVNA 2G8WA 4DG1A 4AHCA 1T03A 1B92A 5KI6A 3L2VA 1C6VA 2E4LA 3C95A 2HVIA 1L3SA 1VSFA 3RR7A 3KK1A 3JSMA 2KFZA 2P5GA 2A1SA 2X78A 3QIPA 5FRMA 4FJ5A 3K58A 1J53A 1SUQA 2G8VA 1TKZA 3NDKA 1TK8A 4CJKA 1X9WA 3RMCA 2ETJA 2D5RA 4FJHA 4FM2A 4ID5A 4CJWA 3AO4A 4FW1A 2KFNA 3WNHA 2O4GA 1TK5A 3ZSRA 3T3FA 4ZTFA 4ELTA 1WSGA 3ZSZA 1HYZA 4HHTA 3HVTA 3V9XA 3CM6A 4OVLA 3MECA 3QINA 3NH1A 4CJFA 3OJSA 4E7KA 1TKXA 4FJ9A 3OYHA 3RTVA 3LP3A 3G0ZA 4CJUA 1EXQA 3OYAA 3ALYA 1U4BA 3VQ7A 1F21A 4M41A 3ZCMA 1S9GA 4CJPA 2YV0X 3SQ4A 3AA2A 4DQIA 3KD5E 1BL3A 4I9QA 1HJRA 2X74A 3QERA 4E0DA 1BGXT 5HRRA 4KB1A 2VG7A 1QSYA 3QESA 2HNYA 5HLFA 1KFSA 5C42A 3U3YA 4CFDA 1RCHA 4KREA 1EP4A 4QCLA 1YT3A 3LPUA 4W5TA 2AJQA 3LALA 3O4NA 3PUFA 4N5SA 4JRPA 4CEEA 5T7BA 3K5LA 4FM1A 2D0CA 4FLYA 4DF8A 4KHYA 4AHTA 4B9NA 4HTUA 3TAEA 3OYLA 4ELUA 3PO4A 3IAYA 3SPZA 3SUNA 4WE1A 3NGIA 4KO0A 1U45A 4KHWA 2F8TA 3L2RA 1EKEA 4B3OA 1SKSA 1RBSA 1KVAA 3WNFA 3QNNA 3OYNA 3L8BA 1TAUA 1TAQA 1FKOA 2FBVA 3RMAA 1ZBLA 2RPIA 1Z25A 4DTSA 1KLNA 4J2AA 4OLAA 3DLBA 4LSLA 3SV3A 4DWIA 2HNZA 2YNHA 5CY4A 1YTUA 2XY6A 1NOYA 4RW6A 4RG8A 3OYFA 4G1QA 4KV8A 4HVJA 1LWCA 3IS9A 5FRNA 3PY8A 4FK0A 1VSKA 3CYMA 1A5XA 3I0SA 1L3VA 1NOZA 2OZSA 3SZ2A 4DFMA 3VQPA 3NFAA 4O55A 1RBVA 3K57A 1QHTA 3VQCA 3ISNC 4CJ4A 5C25A 4CJEA 3DRPA 3U6FA 2OPSA 4I7FA 1KVCA 4FJMA 2F96A 1JLAA 2IOCA 4KKOA 5CZ1A 3ZSXA 1QTMA 3TAGA 3P1GA 4Z4IA 4CECA 4M3TA 3MEEA 3OVNA 4Z4CA 3OYEA 4DLGA 5CYMA 4E89A 1REVA 1KTQA 3O3HA 2XHBA 3AA4A 1LW0A 3CFRA 4IFVA 3HJFA 1DTTA 3AO3A 4DMNA 3OS1A 1WN7A 3VQBA 4I9LA 4B8CA 3TWHA 1RNHA 2YKNA 1IKXA 1BIZA 5HRNA 3RRGA 1B9DA 1TK0A 1RT7A 3S3MA 3V1QA 1NK4A 2X6SA 3CFOA 2IC3A 4DTRA 4CGIA 1LWEA 1C1BA 4GW6A 2E6MA 4CHYA 3I0RA 3K5MA 3RMDA 4ICLA 4CJRA 3CFPA 4O0IA 1TKDA 4DTNA 3O3GA 1LAVA 4PWDA 1SL0A 1VSDA 4CIFA 3SNNA 3LWMA 3LP1A 1VSIA 3IG1A 3P83D 3M8RA 3QEVA 1U48A 1TL1A 3H08A 3S9HA 2P1JA 4IG3A 4HUGA 2IGIA 4DTUA 4IBNA 4FJNA 3A2FA 3QETA 2HHSA 4DF4A 1BCMA 3S3NA 4W5NA 2RN2A 3B6OA 4Y1DA 4W5QA 4CJ5A 5HROA 4HUEA 3LZJA 1YVUA 4DTMA 1J5OA 4Z4EA 5CYQA 3NAEA 3K5OA 4BACA 1UAXA 5DK5A 4CF1A 3K5NA 4PY5A 1ITGA 4DQRA 2D0BA 1HNIA 2YKMA 1BQMA 4CGJA 5KGXA 3DYAA 3V6DA 1KLMA 5HP1A 4B9UA 4N76A 1WSJA 1X9MA 4CEDA 2HVHA 1SL2A 3ZSVA 1D8YA 1IH7A 4C8LA 2HHWA 1L5UA 4CJSA 5SZTA 3VQ8A 4FLWA 4CJLA 1GOCA 3MEGA 5KRTA 1KSPA 3CM5A 1VRTA 3SI6A 1TKTA 2KZMA 3HSTB 4RW8A 1TV6A 1WSEA 4CK3A 1RBTA 3HT3A 1NJXA 4BDZA 1LAWA 2OPQA 4AH9A 2KQ2A 3VQ6A 3L2WA 1ZBIA 1KCFA 2YHBA 3HYFA 1NKBA 2Z1HA 4I2QA 5D3GA 1ASWA 1RDCA 4B9LA 3BGRA 4KPYA 5I42A 4CJ3A 4JS5A 1VSJA 4O5BA 3RMBA 1D9FA 2ATQA 3SJJA 1U49A 3V1OA 2QK9A 3P5JA 4O44A 2XY8A 4RW4A 4CF9A 1LWFA 3ZT3A 4HCCA 3KK3A 4B08A 1TVRA 5J2PA 2B5JA 3OJUA 3VA0A 4FW2A 4ZHRA 3UIQA 2EHGA 1RTHA 3QO9A 5FROA 4YFUA 1IKYA 1J54A 3KIOA 3K59A 4OLBA 4AHVA 3HK2A 1JLEA 2JGUA 4AHSA 3AO5A 3TI0A 4DU4A 3B6PA 3EZ5A 2EX3A 5J2MA 3HP6A 5HRPA 3HM9A 2KW4A 4CEOA 4DFKA 1XC9A 2KTQA 3HPGA 3ZSWA 1ZYQA 2I5JA 4F8RA 3OYJA 4Z0UA 1X1PA 2BGGA 3HPOA 4ID1A 1HYSA 1BI4A 3L2QA 4CCHA 3ASMA 4PQUA 3KK2A 3TAFA 3HXMA 3TABA 3AO1A 3PX4A 3AVHA 4LY7A 5CZ2A 4N47A 3KKSA 1RTJA 3NF6A 3NH2A 2LSNA 4BE1A 1O1WA 1DLOA 4KI6A 2HHTA 4M3RA 2IS3A 1C0UA 2OZMA 1LW2A 1U47A 4OKKA 3ZSQA 4LH5A 3QEXA 4E1MA 2DTUA 1JL1A 1KVBA 1XHXA 3TAMA 2D0AA 3SUOA 1NJYA 1SKRA 4KTZA 1RT1A 3M8SA 5KGWA 4CK2A 4DU1A 1XHZA 1C1AA 1EX4A 1RBUA 3QLHA 3WNEA 3ZT2A 4EZ9A 4FVMA 1JLCA 3KJVA 1BCOA 4NYFA 1J9AA 1JLBA 4FJJA 1CLQA 4E19A 1RDDA 4DTOA 1K6YA 2HB5A 4CEAA 4HCBA 4E7HA 1ZBFA 5HRSA 3OYBA 3RWUA 4OJRA 1HQUA 3DRSA 3T19A 4ELVA 2ZQBA 1QS4A 2XO7A 4MFBA 4CFCA 4E7JA 2DFHA 5FDLA 3TR8A 5KRSA 4KAZA 4DU3A 4PUOA 4FLUA 1CXUA 4MQ3A 4R5PA 1HNVA 1I39A 4E7LA 1HMVA 3NGZA 4Z4FA 3ZT0A 3NF7A 3ULDA 2HMIA 4B8AB 1S5JA 2QXFA 3C94A 2VG5A 4CFBA 3OYDA 4DTXA 2FBXA 3AVBA 1HQEA 4IG0A 4DQSA 1VK0A 1W0HA 4OPJA 4FJLA 4UQGA 3AV9A 3SQ2A 4FZXC 4J2DA 4CHNA 5EU7A 1WLJA 4BDPA 4QAGA 3LDSA 3KLEA 2G8IA 3KLIA 3AVAA 3DM2A 3AVJA 3SQ1A 1UA0A 2HHVA 4O0JA 3SPYA 4KFBA 1RDAA 4DFPA 3V4IA 2Z1IA 3M8PA 4C8KA 3LP2A 1WSIA 1MU2A 3AVKA 1NK6A 3NHGA 2B4JA 3AVMA 4CIGA 3AVGA 4B9MA 1RDBA 1S1WA 2YNFA 4FCYA 4FK4A 1Y97A 1CXQA 1VSEA 1Q9YA 4CGGA 1I3AA 2GV9A 4KHSA 3L2UA 3QEPA 1X9SA 3TARA 3LANA 4CIEA 3E01A 2BE2A 1S1VA 4DTPA 3NCIA 1JLFA 1SV5A 3QEIA 2XY5A 1A5WA 4FZZA 4RW9A 4B9TA 4FZYA 4FK2A 1RTDA 4M3XA 3O4QA 3PX6A 1VSLA 1U04A 4B9SA 3HP9A 3EYZA 4M45A 3F9KA 3TAPA 4F2SA 4ZTJA 4BE0A 3AO2A 4BWJA 5DMRA 3JYTA 1NK7A 3KD1E 4QOZB 4CGFA 4CJTA 3D45A 1IKVA 3HL8A 3L3VA 2R7YA 3QNOA 1QSSA 1NK5A 3IRXA 2W42A 3V81A 2P5OA 1Z26A 1CZ9A 2RF2A 4Q5VA 4M3YA 3V9ZA 2P51A 3DOKA 1VSHA 4FLZA 1R0AA 3KTQA 3ZT4A 1LV5A 1FK9A 2VG6A 4CGHA 1BISA 1L3UA 4BE2A 1XWLA 4OKEA 3PO5A 2KZZA 1KRPA 2RKIA 4F4KA 2O4IA 1KFDA 3DLRA 5J2NA 2G8HA 4CHOA 4DSEA 1HPZA 4Q0BA 4CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRQ A;  5J2Q A;  2IDO A;  3ZT1 A;  4KTW A;  3LWL A;  1Q8I A;  1S6P A;  3TAQ A;  3VA3 A;  4EP4 A;  4DSJ A;  1WAF A;  4C8N A;  4FYD A;  1SL1 A;  1SKW A;  2ZE2 A;  3VQ9 A;  4IDK A;  3BDP A;  1NKC A;  4CHZ A;  4M3W A;  4IFY A;  1UOC A;  2FBT A;  3ZSY A;  4LSN A;  3CG7 A;  3ITH A;  4CE9 A;  4OKJ A;  1RT3 A;  3V1R A;  4N56 A;  4CEF A;  4CES A;  1T7P A;  2HHQ A;  2YNI A;  4KB0 A;  1C0T A;  4DSK A;  1JXE A;  1VRU A;  3V9W A;  2G8F A;  3VQ4 A;  4DSI A;  3DLG A;  1T05 A;  4DQP A;  3WNG A;  4CEQ A;  3SV4 A;  1NJW A;  3V9U A;  4F3O A;  5KTQ A;  3LP0 A;  5HBM A;  4CGD A;  4E1N A;  2PY5 A;  4NCG A;  2BDP A;  3C6T A;  1HYV A;  4OGE A;  5J1E A;  4XIU A;  1WNS A;  4CJQ A;  3HPH A;  2A1R A;  3KKR A;  4FJ7 A;  2QKK A;  3DMJ A;  3LAK A;  4H4M A;  3DLH A;  4DS4 A;  2ZD1 A;  3NBP A;  1C0M A;  2ITG A;  3MXM A;  1Q9X A;  1ZBH A;  1CZB A;  2Y1J A;  4F3T A;  3VQQ A;  3OY9 A;  4DLE A;  1VSM A;  1NK8 A;  2YHA A;  3VQD A;  5E41 A;  3OYM A;  3KLF A;  4CF2 A;  2VWJ A;  1UWB A;  3HO1 A;  1GOA A;  3VQ5 A;  2XY7 A;  4KRF A;  4KTQ A;  4CFA A;  3EY1 A;  4FLV A;  4FJK A;  1G15 A;  1D5A A;  3PV8 A;  3NF8 A;  1C1C A;  3VQA A;  3K2P A;  4K8Z A;  4AHU A;  3CQ8 A;  2HHU A;  2XRI A;  3MAQ A;  4E7I A;  3T1A A;  1JLG A;  2VWK A;  3ZSO A;  4FLX A;  3THV A;  1L3T A;  1TGO A;  3FFI A;  4FJX A;  1BI4 B;  3F73 A;  4JLH A;  1TL3 A;  1N5Y A;  4EZ6 A;  1JKH A;  4E3S A;  4RW7 A;  1T8E A;  4GVM A;  1WSF A;  3SUQ A;  4KHN A;  3L3U A;  4CEB A;  4PA1 A;  1BIU A;  1QQC A;  3DI6 A;  2QKB A;  2DFF A;  4HUF A;  5I3U A;  2F8S A;  3PX0 A;  3C6U A;  1EET A;  1S9E A;  3AA3 A;  3OYK A;  1JLQ A;  3LPT A;  2FC0 A;  4F2R A;  4H8K A;  2GUI A;  3OYI A;  4FXD A;  5SWM A;  1ASV A;  4DFJ A;  1YTA A;  4FJ8 A;  1NJZ A;  4KHU A;  3QIO A;  2PZS A;  1S6Q A;  4Y1C A;  3QEW A;  1IO2 A;  1UA1 A;  1RTI A;  1BHL A;  3MED A;  4W5R A;  1ZBU A;  4CHP A;  2OA8 A;  4J2E A;  1ASU A;  2YNG A;  3DLE A;  3MXJ A;  4NYN A;  4L8R B;  3AVI A;  4GMJ B;  4TSX A;  3AVL A;  3U3G A;  1RT4 A;  3LZI A;  1FKP A;  1NK0 A;  4FJG A;  1RT5 A;  1JL2 A;  2HHX A;  3NF9 A;  2Z1G A;  1D9D A;  3AVC A;  2BAN A;  1NK9 A;  4N41 A;  4YNQ A;  2WON A;  3M8Q A;  4FJI A;  1GOB A;  2IAJ A;  4CER A;  3D0P A;  3KLH A;  3SUP A;  4NCB A;  2Z1J A;  4C8M A;  2JLE A;  3NH0 A;  3DOL A;  3O3F A;  1JXB A;  3AA5 X;  4O4G A;  4BDY A;  1WAJ A;  3OS2 A;  3DRR A;  4K8X A;  1RT2 A;  2OPP A;  5JS2 A;  2PYJ A;  2OYQ A;  1WSH A;  3TAN A;  5C24 A;  1A5V A;  4LH4 A;  4OPK A;  4B9V A;  4OGC A;  4M3Z A;  1IG9 A;  4CK1 A;  3MXI A;  1HRH A;  3RR8 A;  4DS5 A;  4CEZ A;  3OYC A;  3DLK A;  3SYZ A;  4DQQ A;  4M42 A;  4CJV A;  4J2B A;  1BQN A;  2Q3S A;  4CF8 A;  1RT6 A;  3NE6 A;  4JS4 A;  1S1T A;  1RIL A;  2WOM A;  3KLG A;  2FBY A;  3OYG A;  4H4O A;  4FM0 A;  1RBR A;  3NGY A;  4AHR A;  4W5O A;  2OPR A;  4DSF A;  3RRH A;  3SQ0 A;  4FLT A;  3S3O A;  2HW3 A;  3V9S A;  2PYL A;  1DTQ A;  1N6Q A;  4KI4 A;  2G8K A;  4NCA A;  3I8D A;  3VN5 A;  4AIL C;  4DSL A;  4KHQ A;  4C8O A;  4M3U A;  1XI1 A;  5JS1 A;  1NKE A;  4BWM A;  2DY4 A;  4I2P A;  1B9F A;  2GBZ A;  1W9H A;  4LD0 A;  4IKF A;  2NUB A;  2Y1I A;  1IKW A;  1S1U A;  2X6N A;  5K14 A;  3HVR A;  3SCX A;  1S1X A;  1QSL A;  3VQE A;  3OS0 A;  2DFE A;  2HND A;  4Z4G A;  4Z4H A;  1FXX A;  3AVF A;  3LAM A;  4CHQ A;  2B6A A;  4DTJ A;  2G8U A;  4EP5 A;  1QE1 A;  2E6L A;  3G10 A;  3AVN A;  2G8W A;  4DG1 A;  4AHC A;  1T03 A;  1B92 A;  5KI6 A;  3L2V A;  1C6V A;  2E4L A;  3C95 A;  2HVI A;  1L3S A;  1VSF A;  3RR7 A;  3KK1 A;  3JSM A;  2KFZ A;  2P5G A;  2A1S A;  2X78 A;  3QIP A;  5FRM A;  4FJ5 A;  3K58 A;  1J53 A;  1SUQ A;  2G8V A;  1TKZ A;  3NDK A;  1TK8 A;  4CJK A;  1X9W A;  3RMC A;  2ETJ A;  2D5R A;  4FJH A;  4FM2 A;  4ID5 A;  4CJW A;  3AO4 A;  4FW1 A;  2KFN A;  3WNH A;  2O4G A;  1TK5 A;  3ZSR A;  3T3F A;  4ZTF A;  4ELT A;  1WSG A;  3ZSZ A;  1HYZ A;  4HHT A;  3HVT A;  3V9X A;  3CM6 A;  4OVL A;  3MEC A;  3QIN A;  3NH1 A;  4CJF A;  3OJS A;  4E7K A;  1TKX A;  4FJ9 A;  3OYH A;  3RTV A;  3LP3 A;  3G0Z A;  4CJU A;  1EXQ A;  3OYA A;  3ALY A;  1U4B A;  3VQ7 A;  1F21 A;  4M41 A;  3ZCM A;  1S9G A;  4CJP A;  2YV0 X;  3SQ4 A;  3AA2 A;  4DQI A;  3KD5 E;  1BL3 A;  4I9Q A;  1HJR A;  2X74 A;  3QER A;  4E0D A;  1BGX T;  5HRR A;  4KB1 A;  2VG7 A;  1QSY A;  3QES A;  2HNY A;  5HLF A;  1KFS A;  5C42 A;  3U3Y A;  4CFD A;  1RCH A;  4KRE A;  1EP4 A;  4QCL A;  1YT3 A;  3LPU A;  4W5T A;  2AJQ A;  3LAL A;  3O4N A;  3PUF A;  4N5S A;  4JRP A;  4CEE A;  5T7B A;  3K5L A;  4FM1 A;  2D0C A;  4FLY A;  4DF8 A;  4KHY A;  4AHT A;  4B9N A;  4HTU A;  3TAE A;  3OYL A;  4ELU A;  3PO4 A;  3IAY A;  3SPZ A;  3SUN A;  4WE1 A;  3NGI A;  4KO0 A;  1U45 A;  4KHW A;  2F8T A;  3L2R A;  1EKE A;  4B3O A;  1SKS A;  1RBS A;  1KVA A;  3WNF A;  3QNN A;  3OYN A;  3L8B A;  1TAU A;  1TAQ A;  1FKO A;  2FBV A;  3RMA A;  1ZBL A;  2RPI A;  1Z25 A;  4DTS A;  1KLN A;  4J2A A;  4OLA A;  3DLB A;  4LSL A;  3SV3 A;  4DWI A;  2HNZ A;  2YNH A;  5CY4 A;  1YTU A;  2XY6 A;  1NOY A;  4RW6 A;  4RG8 A;  3OYF A;  4G1Q A;  4KV8 A;  4HVJ A;  1LWC A;  3IS9 A;  5FRN A;  3PY8 A;  4FK0 A;  1VSK A;  3CYM A;  1A5X A;  3I0S A;  1L3V A;  1NOZ A;  2OZS A;  3SZ2 A;  4DFM A;  3VQP A;  3NFA A;  4O55 A;  1RBV A;  3K57 A;  1QHT A;  3VQC A;  3ISN C;  4CJ4 A;  5C25 A;  4CJE A;  3DRP A;  3U6F A;  2OPS A;  4I7F A;  1KVC A;  4FJM A;  2F96 A;  1JLA A;  2IOC A;  4KKO A;  5CZ1 A;  3ZSX A;  1QTM A;  3TAG A;  3P1G A;  4Z4I A;  4CEC A;  4M3T A;  3MEE A;  3OVN A;  4Z4C A;  3OYE A;  4DLG A;  5CYM A;  4E89 A;  1REV A;  1KTQ A;  3O3H A;  2XHB A;  3AA4 A;  1LW0 A;  3CFR A;  4IFV A;  3HJF A;  1DTT A;  3AO3 A;  4DMN A;  3OS1 A;  1WN7 A;  3VQB A;  4I9L A;  4B8C A;  3TWH A;  1RNH A;  2YKN A;  1IKX A;  1BIZ A;  5HRN A;  3RRG A;  1B9D A;  1TK0 A;  1RT7 A;  3S3M A;  3V1Q A;  1NK4 A;  2X6S A;  3CFO A;  2IC3 A;  4DTR A;  4CGI A;  1LWE A;  1C1B A;  4GW6 A;  2E6M A;  4CHY A;  3I0R A;  3K5M A;  3RMD A;  4ICL A;  4CJR A;  3CFP A;  4O0I A;  1TKD A;  4DTN A;  3O3G A;  1LAV A;  4PWD A;  1SL0 A;  1VSD A;  4CIF A;  3SNN A;  3LWM A;  3LP1 A;  1VSI A;  3IG1 A;  3P83 D;  3M8R A;  3QEV A;  1U48 A;  1TL1 A;  3H08 A;  3S9H A;  2P1J A;  4IG3 A;  4HUG A;  2IGI A;  4DTU A;  4IBN A;  4FJN A;  3A2F A;  3QET A;  2HHS A;  4DF4 A;  1BCM A;  3S3N A;  4W5N A;  2RN2 A;  3B6O A;  4Y1D A;  4W5Q A;  4CJ5 A;  5HRO A;  4HUE A;  3LZJ A;  1YVU A;  4DTM A;  1J5O A;  4Z4E A;  5CYQ A;  3NAE A;  3K5O A;  4BAC A;  1UAX A;  5DK5 A;  4CF1 A;  3K5N A;  4PY5 A;  1ITG A;  4DQR A;  2D0B A;  1HNI A;  2YKM A;  1BQM A;  4CGJ A;  5KGX A;  3DYA A;  3V6D A;  1KLM A;  5HP1 A;  4B9U A;  4N76 A;  1WSJ A;  1X9M A;  4CED A;  2HVH A;  1SL2 A;  3ZSV A;  1D8Y A;  1IH7 A;  4C8L A;  2HHW A;  1L5U A;  4CJS A;  5SZT A;  3VQ8 A;  4FLW A;  4CJL A;  1GOC A;  3MEG A;  5KRT A;  1KSP A;  3CM5 A;  1VRT A;  3SI6 A;  1TKT A;  2KZM A;  3HST B;  4RW8 A;  1TV6 A;  1WSE A;  4CK3 A;  1RBT A;  3HT3 A;  1NJX A;  4BDZ A;  1LAW A;  2OPQ A;  4AH9 A;  2KQ2 A;  3VQ6 A;  3L2W A;  1ZBI A;  1KCF A;  2YHB A;  3HYF A;  1NKB A;  2Z1H A;  4I2Q A;  5D3G A;  1ASW A;  1RDC A;  4B9L A;  3BGR A;  4KPY A;  5I42 A;  4CJ3 A;  4JS5 A;  1VSJ A;  4O5B A;  3RMB A;  1D9F A;  2ATQ A;  3SJJ A;  1U49 A;  3V1O A;  2QK9 A;  3P5J A;  4O44 A;  2XY8 A;  4RW4 A;  4CF9 A;  1LWF A;  3ZT3 A;  4HCC A;  3KK3 A;  4B08 A;  1TVR A;  5J2P A;  2B5J A;  3OJU A;  3VA0 A;  4FW2 A;  4ZHR A;  3UIQ A;  2EHG A;  1RTH A;  3QO9 A;  5FRO A;  4YFU A;  1IKY A;  1J54 A;  3KIO A;  3K59 A;  4OLB A;  4AHV A;  3HK2 A;  1JLE A;  2JGU A;  4AHS A;  3AO5 A;  3TI0 A;  4DU4 A;  3B6P A;  3EZ5 A;  2EX3 A;  5J2M A;  3HP6 A;  5HRP A;  3HM9 A;  2KW4 A;  4CEO A;  4DFK A;  1XC9 A;  2KTQ A;  3HPG A;  3ZSW A;  1ZYQ A;  2I5J A;  4F8R A;  3OYJ A;  4Z0U A;  1X1P A;  2BGG A;  3HPO A;  4ID1 A;  1HYS A;  1BI4 A;  3L2Q A;  4CCH A;  3ASM A;  4PQU A;  3KK2 A;  3TAF A;  3HXM A;  3TAB A;  3AO1 A;  3PX4 A;  3AVH A;  4LY7 A;  5CZ2 A;  4N47 A;  3KKS A;  1RTJ A;  3NF6 A;  3NH2 A;  2LSN A;  4BE1 A;  1O1W A;  1DLO A;  4KI6 A;  2HHT A;  4M3R A;  2IS3 A;  1C0U A;  2OZM A;  1LW2 A;  1U47 A;  4OKK A;  3ZSQ A;  4LH5 A;  3QEX A;  4E1M A;  2DTU A;  1JL1 A;  1KVB A;  1XHX A;  3TAM A;  2D0A A;  3SUO A;  1NJY A;  1SKR A;  4KTZ A;  1RT1 A;  3M8S A;  5KGW A;  4CK2 A;  4DU1 A;  1XHZ A;  1C1A A;  1EX4 A;  1RBU A;  3QLH A;  3WNE A;  3ZT2 A;  4EZ9 A;  4FVM A;  1JLC A;  3KJV A;  1BCO A;  4NYF A;  1J9A A;  1JLB A;  4FJJ A;  1CLQ A;  4E19 A;  1RDD A;  4DTO A;  1K6Y A;  2HB5 A;  4CEA A;  4HCB A;  4E7H A;  1ZBF A;  5HRS A;  3OYB A;  3RWU A;  4OJR A;  1HQU A;  3DRS A;  3T19 A;  4ELV A;  2ZQB A;  1QS4 A;  2XO7 A;  4MFB A;  4CFC A;  4E7J A;  2DFH A;  5FDL A;  3TR8 A;  5KRS A;  4KAZ A;  4DU3 A;  4PUO A;  4FLU A;  1CXU A;  4MQ3 A;  4R5P A;  1HNV A;  1I39 A;  4E7L A;  1HMV A;  3NGZ A;  4Z4F A;  3ZT0 A;  3NF7 A;  3ULD A;  2HMI A;  4B8A B;  1S5J A;  2QXF A;  3C94 A;  2VG5 A;  4CFB A;  3OYD A;  4DTX A;  2FBX A;  3AVB A;  1HQE A;  4IG0 A;  4DQS A;  1VK0 A;  1W0H A;  4OPJ A;  4FJL A;  4UQG A;  3AV9 A;  3SQ2 A;  4FZX C;  4J2D A;  4CHN A;  5EU7 A;  1WLJ A;  4BDP A;  4QAG A;  3LDS A;  3KLE A;  2G8I A;  3KLI A;  3AVA A;  3DM2 A;  3AVJ A;  3SQ1 A;  1UA0 A;  2HHV A;  4O0J A;  3SPY A;  4KFB A;  1RDA A;  4DFP A;  3V4I A;  2Z1I A;  3M8P A;  4C8K A;  3LP2 A;  1WSI A;  1MU2 A;  3AVK A;  1NK6 A;  3NHG A;  2B4J A;  3AVM A;  4CIG A;  3AVG A;  4B9M A;  1RDB A;  1S1W A;  2YNF A;  4FCY A;  4FK4 A;  1Y97 A;  1CXQ A;  1VSE A;  1Q9Y A;  4CGG A;  1I3A A;  2GV9 A;  4KHS A;  3L2U A;  3QEP A;  1X9S A;  3TAR A;  3LAN A;  4CIE A;  3E01 A;  2BE2 A;  1S1V A;  4DTP A;  3NCI A;  1JLF A;  1SV5 A;  3QEI A;  2XY5 A;  1A5W A;  4FZZ A;  4RW9 A;  4B9T A;  4FZY A;  4FK2 A;  1RTD A;  4M3X A;  3O4Q A;  3PX6 A;  1VSL A;  1U04 A;  4B9S A;  3HP9 A;  3EYZ A;  4M45 A;  3F9K A;  3TAP A;  4F2S A;  4ZTJ A;  4BE0 A;  3AO2 A;  4BWJ A;  5DMR A;  3JYT A;  1NK7 A;  3KD1 E;  4QOZ B;  4CGF A;  4CJT A;  3D45 A;  1IKV A;  3HL8 A;  3L3V A;  2R7Y A;  3QNO A;  1QSS A;  1NK5 A;  3IRX A;  2W42 A;  3V81 A;  2P5O A;  1Z26 A;  1CZ9 A;  2RF2 A;  4Q5V A;  4M3Y A;  3V9Z A;  2P51 A;  3DOK A;  1VSH A;  4FLZ A;  1R0A A;  3KTQ A;  3ZT4 A;  1LV5 A;  1FK9 A;  2VG6 A;  4CGH A;  1BIS A;  1L3U A;  4BE2 A;  1XWL A;  4OKE A;  3PO5 A;  2KZZ A;  1KRP A;  2RKI A;  4F4K A;  2O4I A;  1KFD A;  3DLR A;  5J2N A;  2G8H A;  4CHO A;  4DSE A;  1HPZ A;  4Q0B A;  4CF0 A; 
#chains in the Genus database with same CATH topology
 3PIO L;  5J2Q A;  1E4F T;  1YJW N;  1Q8I A;  1S6P A;  1BUP A;  3VA3 A;  4EP4 A;  1WAF A;  4XH4 A;  4BRN A;  2ZE2 A;  3BUZ B;  4IDK A;  1JJ2 M;  1NKC A;  4BR4 A;  3BDP A;  4FOE A;  4LSN A;  3ITH A;  4N56 A;  1T7P A;  1W97 L;  1VRU A;  4EFH A;  3V9W A;  4JI3 K;  2QWQ A;  2Q97 A;  3DLG A;  3CC7 N;  1T05 A;  1NJW A;  3TSP A;  3V9U A;  4F3O A;  3D2F B;  3QB0 A;  3ZEU B;  2BDP A;  4M7X A;  3C6T A;  1HYV A;  3WXL A;  4FJ7 A;  1VQ9 N;  3LAK A;  1BOT O;  1NK8 A;  3THW A;  2HBK A;  4JKH A;  5F0X A;  3OYM A;  3HO1 A;  4KRF A;  4KTQ A;  4CFA A;  3EY1 A;  4FJK A;  3CCJ N;  3NF8 A;  1C1C A;  4FWS A;  5BR9 A;  5AFU A;  1BA1 A;  1K73 O;  3ZSO A;  4GNI A;  3THV A;  1TGO A;  5GAE P;  1BI4 B;  4X62 K;  3F73 A;  1TL3 A;  2O8B B;  4RW7 A;  1NJI O;  3SUQ A;  3R1X A;  4CEB A;  3MDQ A;  1BIU A;  3K9K A;  3DI6 A;  2QKB A;  4I6M A;  2QXL A;  3DXK A;  1S9E A;  3OYK A;  4PL8 A;  2A6A A;  2FC0 A;  4MO5 A;  3KWI A;  4MLH A;  5TKY A;  2H3G X;  4DUY K;  1NJZ A;  3QIO A;  4KHU A;  1KXP A;  4Y1C A;  2W41 A;  3CC4 N;  4W5R A;  4CHP A;  3VF4 A;  1WB9 A;  2PBD A;  4L8R B;  4DR1 K;  3CET A;  4TSX A;  3AVL A;  3EZW A;  2HHX A;  3NF9 A;  2Z1G A;  1D9D A;  4N41 A;  4YNQ A;  3M8Q A;  4FJI A;  1GOB A;  4CER A;  3D0P A;  3PIP L;  4NCB A;  2Z1J A;  3NH0 A;  4BDY A;  1WAJ A;  2GTD A;  5M1N A;  4YOV A;  3LL3 A;  2PYJ A;  2OYQ A;  1A5V A;  2HMP A;  4OGC A;  3AY9 A;  4CK1 A;  1E4G T;  5CHI A;  3DLK A;  5FPM A;  3SYZ A;  3FZL A;  4DQQ A;  5AQT A;  4M42 A;  4JS4 A;  2BUP A;  2YHY A;  1XNQ K;  1RIL A;  1RBR A;  4AHR A;  4BDP A;  2OPR A;  2NRR A;  3SQ0 A;  4FLT A;  1VAZ A;  1DTQ A;  4KI4 A;  2G8K A;  2P9U A;  1W7A A;  4JKB A;  4KHQ A;  2CGJ A;  2NRX A;  3CJC A;  4M3U A;  1XI1 A;  4GY2 B;  4I2P A;  2GBZ A;  4IKF A;  3C6H A;  1IKW A;  1S1U A;  2X6N A;  5AQW A;  2OCE A;  3HVR A;  1QSL A;  1IBK K;  1QVF M;  2DFE A;  2QM1 A;  4Z4H A;  4CHQ A;  4CZE A;  3LDO A;  1QE1 A;  2E6L A;  3G10 A;  5M1Q A;  1T03 A;  3L2V A;  3C95 A;  2P9S B;  4JEP A;  2A1S A;  4DV4 K;  3H3N O;  3K58 A;  4BRE A;  1N8R O;  3QML A;  2KFN A;  1Q82 O;  1OH5 A;  1XUP O;  5KPR A;  5AZI B;  3ZSR A;  5AQJ A;  3T3F A;  1WSG A;  3ZSZ A;  1HYZ A;  3VEY A;  3HVT A;  3V9X A;  3CM6 A;  2NRT A;  3BZK A;  4RCH A;  1SS6 A;  3J7Y P;  1DKG D;  3ATU A;  3P31 A;  1Z6R A;  1S9G A;  4CJP A;  2YV0 X;  4PHT X;  3AA2 A;  1BL3 A;  4I9Q A;  3ENB A;  1ATR A;  5EY4 A;  4IO8 A;  5HRR A;  3O80 A;  1GLJ O;  3ID8 A;  1MWK A;  5FLX O;  1RCH A;  4KRE A;  1VQ8 N;  4JI0 K;  3O4N A;  5T7B A;  3K5L A;  1C0F A;  2E8A A;  4FLY A;  1YI2 N;  3MK6 A;  3ZX0 A;  4B3S K;  4ELU A;  4KO0 A;  4KHW A;  4DQ8 A;  2O8F A;  3SLC A;  1WUA A;  2NNW A;  3OYN A;  1FKO A;  3DXM A;  3RMA A;  2V7Y A;  3DLB A;  4BRA A;  3FR0 A;  3VGM A;  1NOZ A;  3SZ2 A;  4WQ4 C;  1O13 A;  3WEE B;  3ISN C;  4CJ4 A;  4CJE A;  3DRP A;  2OPS A;  3T1Y K;  1OVY A;  2IOC A;  3ZSX A;  1QTM A;  4FWK A;  5AZJ A;  3A0I X;  4Z4C A;  2YI1 A;  1RGI A;  5CYM A;  3NMU A;  3O3H A;  3AA4 A;  1LW0 A;  3U8X A;  4IFV A;  1DTT A;  3AO3 A;  3BP8 A;  4DMN A;  3OS1 A;  2UUB K;  3SK3 A;  4AQY K;  3M6G A;  3T7Z A;  4CZI A;  1TK0 A;  3RVC A;  1NK4 A;  4IOX A;  5BPN A;  4JKC A;  4DTR A;  1LWE A;  1C1B A;  2E6M A;  3IUC A;  5AQN A;  4NXM K;  4DV5 K;  1QQO A;  1N33 K;  3SMP A;  3VEN A;  3LWM A;  3IG1 A;  3QEV A;  1TL1 A;  5AQQ A;  3RSE A;  2IGI A;  1HX1 A;  3CHW A;  4FJN A;  4PKH A;  3S3N A;  3EL2 A;  2RN2 A;  4Y1D A;  4W5Q A;  4HUE A;  1J5O A;  5CYQ A;  1UAX A;  2PAV A;  1ITG A;  3QBX A;  1HNI A;  1BQM A;  3DYA A;  5GAD P;  5HP1 A;  4B9U A;  4LF5 K;  5ELZ A;  5LMU K;  1SL2 A;  4C8L A;  2QWL A;  1H1V A;  5KRT A;  4JAX A;  1TKT A;  3HST B;  3G6E N;  5C12 A;  1RBT A;  4BDZ A;  3M5R A;  1HLU A;  4AH9 A;  1KCF A;  2A42 A;  2YHB A;  3HYF A;  5D3G A;  3BGR A;  5I42 A;  4KHP K;  4IFE A;  1VSJ A;  4O5B A;  1D9F A;  2V7Z A;  3VET A;  2XY8 A;  4RW4 A;  1LWF A;  2B5J A;  3UIQ A;  2E1Y A;  1Q81 O;  5BN8 A;  4BRH A;  3UKR B;  4C23 A;  3HK2 A;  2JGU A;  3AO5 A;  5A2Q O;  4DU4 A;  3THY B;  5LMN K;  5AQF A;  3VMF B;  2I5J A;  3OYJ A;  4Z0U A;  3C7N A;  1HYS A;  3L2Q A;  5EOY A;  3GBT A;  4RWT A;  2CGL A;  3TAB A;  1BG3 A;  3E1Y A;  3KKS A;  4DV3 K;  4BE1 A;  2HHH K;  4DR7 K;  2OZM A;  3L4I A;  3G4S N;  4JV5 K;  3D2E A;  5AQU A;  4OKK A;  3ZSQ A;  4DV2 K;  1KVB A;  3FGU A;  2D0A A;  3JS6 A;  2GWK A;  2ZJR L;  1C1A A;  3ZT2 A;  1GLE G;  3KJV A;  2P9I B;  2O8D B;  4FJJ A;  2Q31 A;  2HB5 A;  4CEA A;  4HCB A;  3OYB A;  4OJR A;  2ZQB A;  3THX B;  4FVU A;  1G99 A;  4CD3 A;  5AQY A;  4EIA A;  1HNV A;  5M1O A;  4WQ5 A;  2ZM6 K;  2QXF A;  1HQE A;  4DQS A;  4OPJ A;  3KZB A;  2VGM A;  4H5T A;  2JWK A;  2V51 B;  3CQX A;  3LDS A;  3AVA A;  3DM2 A;  1UA0 A;  4O0J A;  3SPY A;  4MO4 A;  4DFP A;  3V4I A;  4H5W A;  5AQP A;  3NHG A;  3LDP A;  5EXW A;  3L6Q A;  3FZM A;  4WQ4 A;  2YNF A;  4FCY A;  4OO1 J;  3VER A;  1VSE A;  1X3M A;  1I3A A;  2GV9 A;  3L2U A;  2W6L A;  3O08 A;  1DEJ A;  1S1V A;  4GKJ K;  3NCI A;  1JLF A;  2ASP A;  3H1V X;  1A5W A;  4K43 A;  4RW9 A;  1P8Z A;  3U9D A;  4M45 A;  3ID6 A;  2QWO A;  5JLF A;  2QEX N;  4BE0 A;  3AO2 A;  1NK7 A;  5F1X A;  3R3L A;  4CGF A;  3WUH A;  3HZ6 A;  3DAW A;  3W3D A;  3I56 N;  3D45 A;  1IKV A;  3HL8 A;  3L3V A;  2R7Y A;  1QSS A;  3IRX A;  1Z26 A;  4Q5V A;  1NGI A;  3DWL A;  3V9Z A;  3HOT A;  1VSH A;  2FF3 B;  2RE2 A;  1R0A A;  3ZT4 A;  1FK9 A;  2Q1N A;  1S3X A;  4AM7 A;  1XC3 A;  3OA9 A;  4LFB K;  4B1Z A;  2G8H A;  4Q0B A;  2IDO A;  1K9M O;  5DM7 L;  3OW2 M;  3WXI A;  4M3W A;  2YX6 A;  4JKG B;  3VQ9 A;  1FJG K;  1NGE A;  4CHZ A;  2I7P A;  1N36 K;  3V1R A;  4CES A;  2HHQ A;  2YNI A;  1C0T A;  3CI5 A;  1JXE A;  3CME N;  5M1F A;  3VQ4 A;  3O8M A;  4BR9 A;  4CEQ A;  1KAZ A;  4DQP A;  1GLB G;  4NCG A;  4CBW A;  3ZX3 A;  3ENH A;  4M7Y A;  3HPH A;  2A1R A;  3CCQ N;  3DLH A;  4H4M A;  4DS4 A;  2NRH A;  2ZD1 A;  3NBP A;  4QS9 A;  1HUX A;  2ITG A;  3VF6 A;  4X65 K;  1CZB A;  4WFN L;  3VQQ A;  2YHA A;  4JKA A;  4CF2 A;  1UWB A;  4NO7 A;  1G15 A;  1D5A A;  3EO3 A;  1ZBS A;  3CQ8 A;  2HHU A;  4BVP A;  3E9P A;  3MAQ A;  3DLL L;  1D4X A;  1ATS A;  1JLG A;  3EKS A;  4E7I A;  4FLX A;  1L3T A;  3PSI A;  1JKH A;  4GVM A;  4XH1 A;  4DKW A;  5I3U A;  3C6U A;  3ATV A;  1CZA N;  2HBJ A;  3AA3 A;  4F2R A;  4FL9 A;  3OYI A;  4A62 A;  3UB5 A;  4BC4 A;  1YTA A;  5BRE A;  4FJ8 A;  3T1H K;  2PZS A;  1NGH A;  3QEW A;  1IO2 A;  3R6M A;  1J5E K;  3TTC A;  1ASU A;  3VGL A;  3DLE A;  5JMV A;  4NYN A;  4CZK A;  3U3G A;  4BRD A;  1RT4 A;  2YJF A;  1RT5 A;  1JL2 A;  2WON A;  4DV7 K;  2P9N B;  3UKU B;  3SAF A;  1OVQ A;  1QZ5 A;  4C8M A;  3AA5 X;  1N34 K;  4K8X A;  5JS2 A;  3VEO A;  4BRG A;  3SJH A;  4BR5 A;  3MCA B;  2GWJ A;  4CZF A;  3MN5 A;  3HOS A;  1OH6 A;  4JI5 K;  3QDK A;  4R79 A;  1HKB A;  1RT6 A;  1SAZ A;  2WOM A;  1DGK N;  2O8C B;  3RRH A;  4W5O A;  4A61 A;  4DSF A;  3V9S A;  5M1P A;  3VN5 A;  4C8O A;  5JS1 A;  1K8K B;  3GDQ A;  4BWM A;  1GLL O;  4LD0 A;  2P9K A;  1J6Z A;  3A5O C;  2FSJ A;  4NLC A;  4DTJ A;  2G8U A;  1Q86 O;  3AVN A;  2G8W A;  1TYQ A;  2RHK A;  3GE1 A;  4AHC A;  1C6V A;  2VQF K;  4DR4 K;  4JI1 K;  3BF3 A;  5I9E B;  3VOV A;  2P5G A;  2X78 A;  3QIP A;  1MA9 B;  3GG4 A;  1X9W A;  3RMC A;  2A5X A;  2FXU A;  3ZEU A;  4FM2 A;  4FJH A;  3WQT A;  3H1Q A;  4ELT A;  1GLA G;  3ENO A;  2V52 B;  4OVL A;  4E7K A;  1YUW A;  3QIN A;  4CBX A;  1T6D A;  5GIN A;  3C0B A;  5C0Y A;  1NWK A;  3FLC O;  1EXQ A;  3ALY A;  1YJ9 N;  4ILJ A;  2FF6 A;  3SQ4 A;  5BR8 K;  2BH1 A;  3QER A;  4E0D A;  1BGX T;  2VG7 A;  3CIP A;  4FPB A;  4JNE A;  1QSY A;  2HNY A;  3E9L A;  5C42 A;  3FE1 A;  3C65 A;  1YT3 A;  1Z05 A;  2AJQ A;  4B3R K;  4JRP A;  4FM1 A;  4HTU A;  3OYL A;  3TPQ A;  3CJA A;  3IAY A;  3A8Y A;  1V4T A;  3SUN A;  2UYT A;  1EKE A;  3PSF A;  3LM9 A;  3QNN A;  3L8B A;  1TAU A;  4J2A A;  3SV3 A;  4DWI A;  4BRM A;  2HNZ A;  5CY4 A;  4BRK A;  5BPM A;  4RW6 A;  4CVN E;  4IJN A;  1Y64 A;  1LWC A;  4BC3 A;  5FRN A;  4A2A A;  4BG8 A;  3CYM A;  3QBW A;  5KPZ A;  4DFM A;  1NG9 A;  1QHT A;  4JI8 K;  5C25 A;  3U6F A;  3DXK B;  4ISE A;  4EAH D;  2F96 A;  1JLA A;  4KKO A;  2VWB A;  4Z4I A;  4CEC A;  3MCP A;  3MEE A;  3OVN A;  4WYB A;  4WFB L;  1R59 O;  1GLD G;  2GEM A;  4LF9 K;  2XHB A;  3CFR A;  2E88 A;  5AFU H;  3TWH A;  4JN4 A;  4I9L A;  5AQR A;  1HNX K;  5BN9 A;  4IO9 L;  1C0G A;  4CGI A;  4K41 A;  2QA4 N;  4ICL A;  1TKD A;  3EEQ A;  1Q7Y O;  3HTV A;  4PWD A;  3OBW A;  4CIF A;  1QZ6 A;  1VSI A;  2VGN A;  1EWQ A;  3M8R A;  3H08 A;  4IG3 A;  3DJC A;  3C6A A;  5AQZ A;  4DTU A;  4IBN A;  3QET A;  4DF4 A;  1BCM A;  4W5N A;  5HRO A;  5ADX H;  4Z4E A;  1YVU A;  3J81 O;  4BAC A;  4A5A A;  2D0B A;  4B3M K;  1IJJ A;  2P9S A;  4N76 A;  3D7E O;  1X9M A;  5GAH P;  1D8Y A;  1IH7 A;  4FWO A;  1VQ7 N;  4CJL A;  1GOC A;  1KSP A;  3CM5 A;  3SI6 A;  4RW8 A;  3HT3 A;  2P9U B;  1NJX A;  3NVM A;  2OPQ A;  4DR3 K;  1NKB A;  1NGF A;  4IXC A;  4FWR A;  4JS5 A;  3RMB A;  4FWL A;  3WT0 A;  3WQU A;  1U49 A;  1NGJ A;  4RTF D;  4GV6 A;  3ZT3 A;  4HCC A;  2JWL A;  4ZHR A;  2EHG A;  4DCH A;  3EE8 A;  4YFU A;  1IKY A;  4AHV A;  4HWI A;  5LJV A;  1JLE A;  4AHS A;  4E1J A;  3J8A A;  5AQH A;  3KD1 E;  4QOZ B;  2KTQ A;  2KW4 A;  4CEO A;  4DFK A;  3HPG A;  3O1B A;  1ZYQ A;  2ITM A;  4F8R A;  1TUU A;  3P39 A;  4YOR A;  4ID1 A;  1HKG A;  5IT9 O;  4CCH A;  5AJ3 K;  5JLH A;  1BU6 O;  4PQU A;  2AP1 A;  4JD2 B;  3AAR A;  3AO1 A;  3PX4 A;  3AVH A;  3NH2 A;  2ZJQ L;  2LSN A;  4H0T B;  4KI6 A;  3I33 A;  2VYP A;  5FPD A;  4WQ5 C;  1LW2 A;  5EVZ A;  4DR5 K;  5C2D A;  3QEX A;  3FFK B;  4E1M A;  1XHX A;  2QI2 A;  4KTZ A;  3M8S A;  2W40 A;  1XHZ A;  3QLH A;  4FSV A;  4ISF A;  3JXU A;  3BEX A;  3CCM N;  3RWU A;  1HQU A;  2FSK A;  5MLC Q;  2P9L A;  1QS4 A;  2XO7 A;  4MFB A;  3AGK A;  4E7J A;  3T69 A;  5M1K A;  5KRS A;  4AF1 A;  4FLU A;  4R5P A;  2O8F B;  3MX2 A;  3NGZ A;  4UY8 O;  1XMO K;  1HNZ K;  1KRP A;  1S5J A;  2O4I A;  4CFB A;  4DTX A;  2FBX A;  3DXM B;  3O6W A;  1DT9 A;  5HOO A;  3VPZ A;  4FJL A;  3TTD A;  3EE9 A;  4CZL A;  4FZX C;  4ISG A;  1WLJ A;  4A2B A;  2G8I A;  2HHV A;  3SQ1 A;  4KFB A;  4GV9 A;  2O8E A;  2Z1I A;  1KFS A;  1MU2 A;  2F4V K;  3CJ1 A;  5JVG L;  3AVG A;  4B9M A;  1RDB A;  4IOC L;  1GLF O;  4C1N I;  3U4L A;  4KHS A;  3VEZ A;  5AZJ B;  3TAR A;  3H3O B;  3LDQ A;  4DTP A;  3QIC A;  4JI4 K;  1SV5 A;  3QEI A;  5KQ8 A;  4M3X A;  3PX6 A;  2OTJ N;  3HP9 A;  1K8A O;  4F2S A;  4BWJ A;  3AAP A;  3H46 O;  3QNO A;  4BGB A;  1HPM A;  2P5O A;  2RF2 A;  4M3Y A;  2P51 A;  4L3Q A;  3RSE B;  4BG9 A;  2VG6 A;  1BIS A;  2Q2R A;  1YIJ N;  1S72 N;  4OKE A;  3PO5 A;  3J7A P;  2RKI A;  3NVK A;  1HPZ A;  4CF0 A;  1WBD A;  4JRQ A;  3LWL A;  4IWV A;  1EO1 A;  4PKI A;  3VEV A;  4DSJ A;  3IKM A;  4FYD A;  1SL1 A;  1SKW A;  3UKR A;  1UOC A;  3CG7 A;  4CE9 A;  4OKJ A;  5H1S Q;  1RT3 A;  3THY A;  4CEF A;  4DSK A;  2G8F A;  3VEW A;  4DSI A;  4IEE A;  3WNG A;  3SV4 A;  4FWN A;  5KTQ A;  1BWF O;  1RFQ A;  4CGD A;  2PY5 A;  1LCU A;  4J8F A;  5J1E A;  4GKK K;  1SZ2 A;  4XIU A;  1WNS A;  3G71 N;  3KWG A;  3KKR A;  3MWT A;  3DMJ A;  1ZXO A;  1C0M A;  3MXM A;  2Y1J A;  4BQZ A;  1VSM A;  2F9T A;  3VQD A;  2VWJ A;  1GOA A;  2XY7 A;  2IIR A;  4FLV A;  4U67 L;  3VQA A;  3K2P A;  4AHU A;  2O8D A;  3P38 A;  1JCE A;  2VWK A;  3C7N B;  4FK2 A;  3FFI A;  1N5Y A;  4EZ6 A;  4QS8 A;  4E3S A;  1T8E A;  4KHN A;  4DHY A;  1WSF A;  3CF5 L;  2E2Q A;  1QQC A;  5GAG P;  4HUF A;  2F8S A;  3PX0 A;  1EET A;  3BF1 A;  1ZC6 A;  2CH5 A;  2QWM A;  4H8K A;  2GUI A;  3OHR A;  2GEL A;  5SWM A;  1FW6 A;  1ASV A;  3D2E B;  1S6Q A;  1UA1 A;  4V19 S;  2KLA A;  1ZBU A;  4J2E A;  4BR7 A;  1VHX A;  2YNG A;  2ZF5 O;  3MXJ A;  3LZI A;  3VTH A;  1FKP A;  4H0P A;  4H0X B;  3AVC A;  2BAN A;  1NK9 A;  4LFA K;  2WFB A;  2IAJ A;  2HBL A;  3SUP A;  2P9P A;  3DOL A;  4NLB A;  1JXB A;  4O4G A;  4KBO A;  4BRI A;  3W0L A;  3OS2 A;  1GLC G;  3DRR A;  1RT2 A;  3FZK A;  1E3M A;  4EHU A;  5TKW A;  4YOY A;  4LH4 A;  4OPK A;  4B9V A;  1HRH A;  4BVO A;  4CEZ A;  3OYC A;  1SQK A;  3A5M C;  3UE5 A;  4J2B A;  1BQN A;  3NE6 A;  3I8B A;  1S1T A;  4YOT A;  3FZH A;  2ZGZ A;  4H5V A;  2FBY A;  3OYG A;  4A57 A;  3B8A X;  4OX9 K;  2PYL A;  5E26 A;  3MX5 A;  4G9Z A;  3H6E A;  4NCA A;  3PLA A;  4LF7 K;  4DSL A;  3J80 O;  1NKE A;  2QWP A;  2WBN A;  1W9H A;  2NUB A;  2Y1I A;  3SCX A;  3VQE A;  1MWM A;  3S41 A;  2UXC K;  2HND A;  4DR6 K;  4Z4G A;  1FXX A;  5BPL A;  3LAM A;  4KH5 A;  2B6A A;  3SBT A;  2ASM A;  4FOI A;  3AAQ A;  3SBG A;  3ULE A;  3KK7 A;  1B92 A;  4ILH A;  4YOW A;  1L3S A;  3KK1 A;  2KFZ A;  2FSN A;  1J53 A;  3VF2 A;  1TKZ A;  4CZG A;  4IOA L;  3A5N C;  3ZET A;  1XMQ K;  5BRD A;  4ID5 A;  3AO4 A;  4FW1 A;  3WNH A;  4B1U B;  2O4G A;  3N4Q A;  1TK5 A;  4ZTF A;  1XQS C;  1QQM A;  3NH1 A;  2ZJP L;  4ILG B;  3RTV A;  3G0Z A;  4CJU A;  4H0O A;  1KD1 O;  4MLE A;  3HSC A;  2HST A;  3BY5 A;  3ZCM A;  3SMS A;  4WFA L;  3VTI A;  2X74 A;  5LJW A;  4JK7 A;  3QES A;  2NZT A;  4K25 A;  3J7Z O;  2J4R A;  4CFD A;  1EP4 A;  4W5T A;  1Q18 A;  1U2V B;  3LAL A;  2F9W A;  3PUF A;  4DF8 A;  4KHY A;  4AHT A;  4B9N A;  3PO4 A;  5AR0 A;  3ZX2 A;  2F8T A;  3MN7 A;  4B3O A;  2W6K A;  1RBS A;  1KVA A;  2FBV A;  1KLN A;  1Z25 A;  4DTS A;  3BZC A;  4LSL A;  2YNH A;  3L0Q A;  1YTU A;  3A5L C;  1IBM K;  5KPT A;  2QWN A;  4HVJ A;  3IS9 A;  1VSK A;  3JAM O;  3I0S A;  1A5X A;  2OZS A;  3VQP A;  1RBV A;  2A40 A;  3VQC A;  4FJM A;  3ZLJ A;  4BC2 A;  5CZ1 A;  3TAG A;  4DLG A;  5HL7 L;  1KTQ A;  3HJF A;  5AQL A;  4WCE L;  1QVG M;  1WN7 A;  4B1X B;  1RNH A;  1IKX A;  5HRN A;  1B9D A;  3S3M A;  3V1Q A;  3MN6 A;  3CFO A;  4PL7 A;  4JHD A;  4GW6 A;  4CHY A;  4HTL A;  5AQO A;  3I0R A;  5E84 A;  2WUS A;  4DV6 K;  4DTN A;  4Y0W A;  3O3G A;  3K0S A;  1SL0 A;  1VSD A;  4NB4 A;  3P83 D;  3S9H A;  3MN9 A;  2P1J A;  2Q36 A;  4HUG A;  4C1N K;  3A2F A;  5FPN A;  3B6O A;  4CJ5 A;  3LZJ A;  4DTM A;  3M3Z A;  4K42 A;  3K5O A;  5DK5 A;  3H45 C;  4DQR A;  5KGX A;  4CGJ A;  1U6Z A;  3V6D A;  1KLM A;  4M63 C;  1V4S A;  2GX9 A;  4CED A;  2HVH A;  5KQD A;  1T6C A;  1VQ4 N;  4CJS A;  5SZT A;  1P90 A;  4FLW A;  3MEG A;  1VRT A;  2KZM A;  5C2F A;  4JKE A;  4YOX A;  1TV6 A;  4CK3 A;  3QFU A;  1ZBI A;  3L2W A;  3VQ6 A;  4JK9 A;  4IJA A;  3D2F A;  2P9K B;  3KHY A;  1ASW A;  1RDC A;  4KPY A;  4CJ3 A;  1NMN A;  2ATQ A;  1X3N A;  1W2B M;  3SJJ A;  2QK9 A;  3V1O A;  3P5J A;  4CJ7 A;  2BTF A;  4O44 A;  4CF9 A;  2E2P A;  4JKD A;  1TVR A;  5J2P A;  2NRW A;  1LOT B;  1TYQ B;  4FW2 A;  3VA0 A;  4GV3 A;  4LF6 K;  5FRO A;  4H5N A;  1J54 A;  3K59 A;  1HR0 K;  5J2M A;  5HRP A;  1XC9 A;  3ZSW A;  1X1P A;  2E2O A;  4CW7 B;  1BI4 A;  2O8B A;  3P4I A;  5CE3 A;  4U7B A;  3CCE N;  3KK2 A;  4CBU A;  4B1V A;  3IFR A;  3L4Q A;  4OPA A;  4BRP A;  2YCH A;  1YIT N;  1NBW A;  3WXJ A;  3E9O A;  1C0U A;  4BR0 A;  1U47 A;  5DM6 L;  4PKG A;  4FPA A;  3THW B;  2HF4 A;  4K0K K;  2DTU A;  1M90 O;  3TAM A;  3SUO A;  1NJY A;  4QS7 A;  1I94 K;  4DU1 A;  1RBU A;  4FVM A;  1JLC A;  1BDG A;  1J9A A;  1CLQ A;  4E19 A;  1RDD A;  4YDU A;  4DTO A;  4E7H A;  1VQ6 N;  3DRS A;  4I6M B;  4ELV A;  4CFC A;  3CC2 N;  4OPH A;  4KAZ A;  5AQS A;  4PUO A;  2IVP A;  1I39 A;  1VQL N;  3CCU N;  1HMV A;  2OAN A;  1XNR K;  3ULD A;  2HMI A;  5ADX A;  4B8A B;  3OYD A;  3AVB A;  1W0H A;  3O9Q A;  3O9U A;  1YF5 L;  3CJ7 A;  3AV9 A;  3O4W A;  3IMX A;  4CHN A;  5EU7 A;  4BGA A;  3KLI A;  2ZWH A;  3WXK A;  2UXD K;  3M8P A;  4C8K A;  3LP2 A;  1KC8 O;  1NK6 A;  3AVM A;  1QHA A;  2GUP A;  3E66 A;  2QWR A;  2QW9 A;  4CGG A;  3GOI A;  3QEP A;  1X9S A;  4A59 A;  2IVO A;  1OH8 A;  4CIE A;  2BE2 A;  3VEX A;  3CJB A;  3O9S A;  4FZZ A;  1RTD A;  3O4Q A;  1U04 A;  3EYZ A;  3TAP A;  4ZTJ A;  2YJE A;  2AA4 A;  5GIP A;  4YHH K;  3O9R A;  1NK5 A;  2W42 A;  3DOK A;  4FLZ A;  3KTQ A;  3D6R A;  4CGH A;  4BE2 A;  4F4K A;  1YJN N;  4JI7 K;  5AZI A;  2E1Z A;  4DSE A;  2VCP A;  2F7T A;  2PFU A;  4CZJ A;  1NGC A;  3ZT1 A;  4KTW A;  3MWP A;  5C10 A;  3TAQ A;  2KHO A;  1M1K O;  3AGR A;  1JCF A;  5IWA K;  4C8N A;  4IFY A;  2FBT A;  3ZSY A;  3ZYY X;  4XEI A;  4KB0 A;  3O9T A;  3O5B A;  3EN9 A;  3R8E A;  3LP0 A;  5HBM A;  4E1N A;  4JD2 A;  4OGE A;  3VES A;  4CJQ A;  3VGK A;  2QKK A;  4BY9 C;  2E5L K;  3CCL N;  1Q9X A;  1ZBH A;  1NGB A;  4F3T A;  4DLE A;  3OY9 A;  3CCV N;  5E41 A;  3KLF A;  3VQ5 A;  3PV8 A;  2NLX A;  4JI6 K;  4LFC K;  4K8Z A;  4YY3 K;  1YAG A;  2XRI A;  1WOQ A;  4KH4 A;  3T1A A;  4FJX A;  1ATN A;  4JLH A;  4O8K A;  1VQ5 N;  3L3U A;  4PA1 A;  4BRL A;  5FPE A;  2DFF A;  3WEE A;  2UU9 K;  1EWR A;  4FWQ A;  1JLQ A;  3LPT A;  5AQI A;  1EQY A;  2EWS A;  3LM2 A;  4CI6 A;  4FXD A;  4DFJ A;  4DB3 A;  2I7N A;  5CR4 A;  4JKF A;  1RTI A;  1BHL A;  3MED A;  1IG8 A;  2OA8 A;  1QQN A;  3U9Z A;  3AVI A;  4GMJ B;  4FJG A;  1NK0 A;  3SAG A;  3I55 N;  4FO0 A;  2WC9 A;  4A5B A;  3KLH A;  5BRF A;  2JLE A;  3O3F A;  2P9L B;  3K9J A;  4JYA K;  1T44 A;  5F2R A;  2OPP A;  1WSH A;  4FWM A;  2VQE K;  3TAN A;  5C24 A;  5B8H A;  3Q7C A;  4M3Z A;  1IG9 A;  5EX5 A;  3MXI A;  3RR8 A;  4DS5 A;  1ESV A;  3TU5 A;  4CJV A;  5BRH A;  2Q3S A;  4CF8 A;  2CH6 A;  3KLG A;  4H4O A;  4FM0 A;  3NGY A;  2O8E B;  2HW3 A;  4DV1 K;  3S3O A;  1N6Q A;  3I8D A;  4AIL C;  4O5F A;  3CPW M;  2DY4 A;  1B9F A;  3F5T A;  2D0P A;  5K14 A;  1BA0 A;  1RDW X;  1S1X A;  1MDU B;  3OS0 A;  4JK8 A;  2D1K A;  3AVF A;  4EP5 A;  2DPN A;  4Z94 A;  4BC5 A;  4DG1 A;  5KI6 A;  4CZM A;  2E4L A;  1HJO A;  2HVI A;  1VSF A;  4YOU A;  3RR7 A;  3JSM A;  3CMA N;  5FRM A;  3M1F A;  4FJ5 A;  4B1W B;  1SUQ A;  3WXM B;  2G8V A;  5C15 A;  3NDK A;  1TK8 A;  4CJK A;  2D4W A;  2ETJ A;  4B1Y B;  2D5R A;  4CJW A;  4IEI A;  1NGG A;  4HHT A;  3MEC A;  3SAH A;  4CJF A;  3OJS A;  4FJ9 A;  1TKX A;  3OYH A;  3LP3 A;  1NNE A;  2HBM A;  3CCR N;  1KAX A;  3CXC M;  3OYA A;  4BR2 A;  1U4B A;  4FWP A;  1F21 A;  4M41 A;  3VQ7 A;  4DQI A;  3KD5 E;  3O1W A;  1HJR A;  4KB1 A;  2P9I A;  5HLF A;  4IDH A;  3U3Y A;  2KKZ A;  2HF3 A;  4QCL A;  3LPU A;  3F9M A;  2IVN A;  4N5S A;  4CEE A;  2D0C A;  3Q7B A;  3TAE A;  3THX A;  4BRF A;  3SPZ A;  5LL6 Z;  4WE1 A;  3NGI A;  1U45 A;  3L2R A;  1T3V A;  1SKS A;  3WNF A;  1ILY A;  1TAQ A;  1TUY A;  1YVN A;  2RPI A;  1ZBL A;  4OLA A;  2XY6 A;  1NOY A;  1YXQ A;  4RG8 A;  3OYF A;  4G1Q A;  4KV8 A;  3PY8 A;  4FK0 A;  1VQK N;  1L3V A;  3NFA A;  4O55 A;  4EHT A;  2WTU A;  3K57 A;  4I7F A;  1KVC A;  3P1G A;  4M3T A;  3OYE A;  4E89 A;  1REV A;  3HM8 A;  3VQB A;  4B8C A;  2YKN A;  1VQM N;  3RRG A;  1BIZ A;  1RT7 A;  2X6S A;  2CGK A;  2IC3 A;  5AQX A;  1RDU A;  3RMD A;  3K5M A;  2QTD A;  4JI2 K;  4CJR A;  3R9P A;  1NU0 A;  4IZ9 A;  3CFP A;  4O0I A;  1LAV A;  4H03 B;  3SNN A;  2P9P B;  3LP1 A;  1U48 A;  1BO5 O;  2NRZ A;  4H0V B;  1NGA A;  2HHS A;  4AM6 A;  3CJ9 A;  2UUA K;  3NAE A;  4H0Y B;  4CF1 A;  1VQN N;  3K5N A;  3N4P A;  4PY5 A;  3QFP A;  4KH6 A;  4DUZ K;  2YKM A;  4MDB A;  5JIC A;  3CCS N;  4NXN K;  1WSJ A;  5AQM A;  2E20 A;  2Q0R A;  4JKG A;  3ZSV A;  2HHW A;  1L5U A;  3VQ8 A;  4DV0 K;  2OTL N;  1WSE A;  3LDN A;  1LAW A;  3MMV A;  2KQ2 A;  3LDL A;  2UXB K;  4BQL A;  2Z1H A;  4I2Q A;  4B9L A;  3OTO K;  2YHW A;  2D0O A;  5AQK A;  3KK3 A;  4B08 A;  3ULE B;  3OJU A;  4LF8 K;  1NGD A;  1RTH A;  3QO9 A;  3KIO A;  4OLB A;  4MDA A;  3G25 A;  2HOE A;  1KAY A;  4WF9 L;  3TI0 A;  3B6P A;  3EZ5 A;  2EX3 A;  3HP6 A;  3HM9 A;  4LC9 B;  3F2K A;  3GL1 A;  3ZET B;  2BGG A;  3HPO A;  4YDU C;  1U2V A;  3ASM A;  1OKJ A;  2YHX A;  3TAF A;  3HXM A;  4LY7 A;  5CZ2 A;  4N47 A;  1RTJ A;  2A3Z A;  2Q0U A;  3HBT A;  3NF6 A;  1O1W A;  1DLO A;  2ZGY A;  2HHT A;  3HI0 A;  5LY3 A;  4M3R A;  2IS3 A;  3CPE A;  4X66 K;  2FLO A;  1IBL K;  4LH5 A;  1JL1 A;  4B9Q A;  1VQP N;  1SKR A;  1RT1 A;  5KGW A;  2NRV A;  4CK2 A;  4LF4 K;  3WNE A;  1EX4 A;  4EZ9 A;  4O8U A;  1BCO A;  4NYF A;  1JLB A;  1K6Y A;  1ZBF A;  5HRS A;  2A41 A;  2P9N A;  3UKU A;  3T19 A;  2DFH A;  5FDL A;  4BRC A;  3TR8 A;  4DU3 A;  4CZH A;  1CXU A;  3EKU A;  4MQ3 A;  4E7L A;  4Z4F A;  3CER A;  3ZT0 A;  3NF7 A;  3IDH A;  1X9J A;  3C94 A;  2VG5 A;  4IG0 A;  1VK0 A;  1YHQ N;  4UQG A;  3SQ2 A;  3KVG A;  4J2D A;  1IV0 A;  1WBB A;  4QAG A;  3KLE A;  3AVJ A;  2O8C A;  2E2N A;  1RDA A;  4BRO A;  3HRG A;  2ASO A;  5JVH L;  1WSI A;  3AVK A;  3OBY A;  2B4J A;  4CIG A;  4FK4 A;  1S1W A;  1Y97 A;  1CXQ A;  1Q9Y A;  1KQS M;  4H5R A;  1K8K A;  3TTF A;  1HNW K;  3LAN A;  4GVE A;  3E01 A;  2XY5 A;  4B9T A;  4FZY A;  5GIO A;  1VSL A;  4B9S A;  3F9K A;  3FZF A;  5DMR A;  4X64 K;  4JHD B;  4DR2 K;  3JYT A;  2UUC K;  4CJT A;  1NLV A;  1JCG A;  4CD1 A;  3CQY A;  3V81 A;  1NMD A;  1CZ9 A;  3CD6 N;  5AQV A;  3TSQ A;  1LV5 A;  1N32 K;  1VQO N;  3TSU A;  1L3U A;  1NM1 A;  1S22 A;  1XWL A;  4F9O A;  4BRQ A;  2KZZ A;  1OH7 A;  1KFD A;  1HKC A;  3DLR A;  5J2N A;  4CHO A;  4XH5 A;  4B3T K;  5AQG A; 
#chains in the Genus database with same CATH homology
 4JRQ A;  5J2Q A;  2IDO A;  3ZT1 A;  4KTW A;  3LWL A;  1Q8I A;  1S6P A;  3TAQ A;  3VA3 A;  4EP4 A;  4DSJ A;  1WAF A;  4C8N A;  4FYD A;  1SL1 A;  1SKW A;  2ZE2 A;  3VQ9 A;  4IDK A;  3BDP A;  1NKC A;  4CHZ A;  4M3W A;  4IFY A;  1UOC A;  2FBT A;  3ZSY A;  4LSN A;  3CG7 A;  3ITH A;  4CE9 A;  4OKJ A;  1RT3 A;  3V1R A;  4N56 A;  4CEF A;  4CES A;  1T7P A;  2HHQ A;  2YNI A;  4KB0 A;  1C0T A;  4DSK A;  1JXE A;  1VRU A;  3V9W A;  2G8F A;  3VQ4 A;  4DSI A;  3DLG A;  1T05 A;  4DQP A;  3WNG A;  4CEQ A;  3SV4 A;  1NJW A;  3V9U A;  4F3O A;  5KTQ A;  3LP0 A;  5HBM A;  4CGD A;  4E1N A;  2PY5 A;  4NCG A;  2BDP A;  3C6T A;  1HYV A;  4OGE A;  5J1E A;  4XIU A;  1WNS A;  4CJQ A;  3HPH A;  2A1R A;  3KKR A;  4FJ7 A;  2QKK A;  3DMJ A;  3LAK A;  4H4M A;  3DLH A;  4DS4 A;  2ZD1 A;  3NBP A;  1C0M A;  2ITG A;  3MXM A;  1Q9X A;  1ZBH A;  1CZB A;  2Y1J A;  4F3T A;  3VQQ A;  3OY9 A;  4DLE A;  1VSM A;  1NK8 A;  2YHA A;  3VQD A;  5E41 A;  3OYM A;  3KLF A;  4CF2 A;  2VWJ A;  1UWB A;  3HO1 A;  1GOA A;  3VQ5 A;  2XY7 A;  4KRF A;  4KTQ A;  4CFA A;  3EY1 A;  4FLV A;  4FJK A;  1G15 A;  1D5A A;  3PV8 A;  3NF8 A;  1C1C A;  3VQA A;  3K2P A;  4K8Z A;  4AHU A;  3CQ8 A;  2HHU A;  2XRI A;  3MAQ A;  4E7I A;  3T1A A;  1JLG A;  2VWK A;  3ZSO A;  4FLX A;  3THV A;  1L3T A;  1TGO A;  3FFI A;  4FJX A;  1BI4 B;  3F73 A;  4JLH A;  1TL3 A;  1N5Y A;  4EZ6 A;  1JKH A;  4E3S A;  4RW7 A;  1T8E A;  4GVM A;  1WSF A;  3SUQ A;  4KHN A;  3L3U A;  4CEB A;  4PA1 A;  1BIU A;  1QQC A;  3DI6 A;  2QKB A;  2DFF A;  4HUF A;  5I3U A;  2F8S A;  3PX0 A;  3C6U A;  1EET A;  1S9E A;  3AA3 A;  3OYK A;  1JLQ A;  3LPT A;  2FC0 A;  4F2R A;  4H8K A;  2GUI A;  3OYI A;  4FXD A;  5SWM A;  1ASV A;  4DFJ A;  1YTA A;  4FJ8 A;  1NJZ A;  4KHU A;  3QIO A;  2PZS A;  1S6Q A;  4Y1C A;  3QEW A;  1IO2 A;  1UA1 A;  1RTI A;  1BHL A;  3MED A;  4W5R A;  1ZBU A;  4CHP A;  2OA8 A;  4J2E A;  1ASU A;  2YNG A;  3DLE A;  3MXJ A;  4NYN A;  4L8R B;  3AVI A;  4GMJ B;  4TSX A;  3AVL A;  3U3G A;  1RT4 A;  3LZI A;  1FKP A;  1NK0 A;  4FJG A;  1RT5 A;  1JL2 A;  2HHX A;  3NF9 A;  2Z1G A;  1D9D A;  3AVC A;  2BAN A;  1NK9 A;  4N41 A;  4YNQ A;  2WON A;  3M8Q A;  4FJI A;  1GOB A;  2IAJ A;  4CER A;  3D0P A;  3KLH A;  3SUP A;  4NCB A;  2Z1J A;  4C8M A;  2JLE A;  3NH0 A;  3DOL A;  3O3F A;  1JXB A;  3AA5 X;  4O4G A;  4BDY A;  1WAJ A;  3OS2 A;  3DRR A;  4K8X A;  1RT2 A;  2OPP A;  5JS2 A;  2PYJ A;  2OYQ A;  1WSH A;  3TAN A;  5C24 A;  1A5V A;  4LH4 A;  4OPK A;  4B9V A;  4OGC A;  4M3Z A;  1IG9 A;  4CK1 A;  3MXI A;  1HRH A;  3RR8 A;  4DS5 A;  4CEZ A;  3OYC A;  3DLK A;  3SYZ A;  4DQQ A;  4M42 A;  4CJV A;  4J2B A;  1BQN A;  2Q3S A;  4CF8 A;  1RT6 A;  3NE6 A;  4JS4 A;  1S1T A;  1RIL A;  2WOM A;  3KLG A;  2FBY A;  3OYG A;  4H4O A;  4FM0 A;  1RBR A;  3NGY A;  4AHR A;  4W5O A;  2OPR A;  4DSF A;  3RRH A;  3SQ0 A;  4FLT A;  3S3O A;  2HW3 A;  3V9S A;  2PYL A;  1DTQ A;  1N6Q A;  4KI4 A;  2G8K A;  4NCA A;  3I8D A;  3VN5 A;  4AIL C;  4DSL A;  4KHQ A;  4C8O A;  4M3U A;  1XI1 A;  5JS1 A;  1NKE A;  4BWM A;  2DY4 A;  4I2P A;  1B9F A;  2GBZ A;  1W9H A;  4LD0 A;  4IKF A;  2NUB A;  2Y1I A;  1IKW A;  1S1U A;  2X6N A;  5K14 A;  3HVR A;  3SCX A;  1S1X A;  1QSL A;  3VQE A;  3OS0 A;  2DFE A;  2HND A;  4Z4G A;  4Z4H A;  1FXX A;  3AVF A;  3LAM A;  4CHQ A;  2B6A A;  4DTJ A;  2G8U A;  4EP5 A;  1QE1 A;  2E6L A;  3G10 A;  3AVN A;  2G8W A;  4DG1 A;  4AHC A;  1T03 A;  1B92 A;  5KI6 A;  3L2V A;  1C6V A;  2E4L A;  3C95 A;  2HVI A;  1L3S A;  1VSF A;  3RR7 A;  3KK1 A;  3JSM A;  2KFZ A;  2P5G A;  2A1S A;  2X78 A;  3QIP A;  5FRM A;  4FJ5 A;  3K58 A;  1J53 A;  1SUQ A;  2G8V A;  1TKZ A;  3NDK A;  1TK8 A;  4CJK A;  1X9W A;  3RMC A;  2ETJ A;  2D5R A;  4FJH A;  4FM2 A;  4ID5 A;  4CJW A;  3AO4 A;  4FW1 A;  2KFN A;  3WNH A;  2O4G A;  1TK5 A;  3ZSR A;  3T3F A;  4ZTF A;  4ELT A;  1WSG A;  3ZSZ A;  1HYZ A;  4HHT A;  3HVT A;  3V9X A;  3CM6 A;  4OVL A;  3MEC A;  3QIN A;  3NH1 A;  4CJF A;  3OJS A;  4E7K A;  1TKX A;  4FJ9 A;  3OYH A;  3RTV A;  3LP3 A;  3G0Z A;  4CJU A;  1EXQ A;  3OYA A;  3ALY A;  1U4B A;  3VQ7 A;  1F21 A;  4M41 A;  3ZCM A;  1S9G A;  4CJP A;  2YV0 X;  3SQ4 A;  3AA2 A;  4DQI A;  3KD5 E;  1BL3 A;  4I9Q A;  1HJR A;  2X74 A;  3QER A;  4E0D A;  1BGX T;  5HRR A;  4KB1 A;  2VG7 A;  1QSY A;  3QES A;  2HNY A;  5HLF A;  1KFS A;  5C42 A;  3U3Y A;  4CFD A;  1RCH A;  4KRE A;  1EP4 A;  4QCL A;  1YT3 A;  3LPU A;  4W5T A;  2AJQ A;  3LAL A;  3O4N A;  3PUF A;  4N5S A;  4JRP A;  4CEE A;  5T7B A;  3K5L A;  4FM1 A;  2D0C A;  4FLY A;  4DF8 A;  4KHY A;  4AHT A;  4B9N A;  4HTU A;  3TAE A;  3OYL A;  4ELU A;  3PO4 A;  3IAY A;  3SPZ A;  3SUN A;  4WE1 A;  3NGI A;  4KO0 A;  1U45 A;  4KHW A;  2F8T A;  3L2R A;  1EKE A;  4B3O A;  1SKS A;  1RBS A;  1KVA A;  3WNF A;  3QNN A;  3OYN A;  3L8B A;  1TAU A;  1TAQ A;  1FKO A;  2FBV A;  3RMA A;  1ZBL A;  2RPI A;  1Z25 A;  4DTS A;  1KLN A;  4J2A A;  4OLA A;  3DLB A;  4LSL A;  3SV3 A;  4DWI A;  2HNZ A;  2YNH A;  5CY4 A;  1YTU A;  2XY6 A;  1NOY A;  4RW6 A;  4RG8 A;  3OYF A;  4G1Q A;  4KV8 A;  4HVJ A;  1LWC A;  3IS9 A;  5FRN A;  3PY8 A;  4FK0 A;  1VSK A;  3CYM A;  1A5X A;  3I0S A;  1L3V A;  1NOZ A;  2OZS A;  3SZ2 A;  4DFM A;  3VQP A;  3NFA A;  4O55 A;  1RBV A;  3K57 A;  1QHT A;  3VQC A;  3ISN C;  4CJ4 A;  5C25 A;  4CJE A;  3DRP A;  3U6F A;  2OPS A;  4I7F A;  1KVC A;  4FJM A;  2F96 A;  1JLA A;  2IOC A;  4KKO A;  5CZ1 A;  3ZSX A;  1QTM A;  3TAG A;  3P1G A;  4Z4I A;  4CEC A;  4M3T A;  3MEE A;  3OVN A;  4Z4C A;  3OYE A;  4DLG A;  5CYM A;  4E89 A;  1REV A;  1KTQ A;  3O3H A;  2XHB A;  3AA4 A;  1LW0 A;  3CFR A;  4IFV A;  3HJF A;  1DTT A;  3AO3 A;  4DMN A;  3OS1 A;  1WN7 A;  3VQB A;  4I9L A;  4B8C A;  3TWH A;  1RNH A;  2YKN A;  1IKX A;  1BIZ A;  5HRN A;  3RRG A;  1B9D A;  1TK0 A;  1RT7 A;  3S3M A;  3V1Q A;  1NK4 A;  2X6S A;  3CFO A;  2IC3 A;  4DTR A;  4CGI A;  1LWE A;  1C1B A;  4GW6 A;  2E6M A;  4CHY A;  3I0R A;  3K5M A;  3RMD A;  4ICL A;  4CJR A;  3CFP A;  4O0I A;  1TKD A;  4DTN A;  3O3G A;  1LAV A;  4PWD A;  1SL0 A;  1VSD A;  4CIF A;  3SNN A;  3LWM A;  3LP1 A;  1VSI A;  3IG1 A;  3P83 D;  3M8R A;  3QEV A;  1U48 A;  1TL1 A;  3H08 A;  3S9H A;  2P1J A;  4IG3 A;  4HUG A;  2IGI A;  4DTU A;  4IBN A;  4FJN A;  3A2F A;  3QET A;  2HHS A;  4DF4 A;  1BCM A;  3S3N A;  4W5N A;  2RN2 A;  3B6O A;  4Y1D A;  4W5Q A;  4CJ5 A;  5HRO A;  4HUE A;  3LZJ A;  1YVU A;  4DTM A;  1J5O A;  4Z4E A;  5CYQ A;  3NAE A;  3K5O A;  4BAC A;  1UAX A;  5DK5 A;  4CF1 A;  3K5N A;  4PY5 A;  1ITG A;  4DQR A;  2D0B A;  1HNI A;  2YKM A;  1BQM A;  4CGJ A;  5KGX A;  3DYA A;  3V6D A;  1KLM A;  5HP1 A;  4B9U A;  4N76 A;  1WSJ A;  1X9M A;  4CED A;  2HVH A;  1SL2 A;  3ZSV A;  1D8Y A;  1IH7 A;  4C8L A;  2HHW A;  1L5U A;  4CJS A;  5SZT A;  3VQ8 A;  4FLW A;  4CJL A;  1GOC A;  3MEG A;  5KRT A;  1KSP A;  3CM5 A;  1VRT A;  3SI6 A;  1TKT A;  2KZM A;  3HST B;  4RW8 A;  1TV6 A;  1WSE A;  4CK3 A;  1RBT A;  3HT3 A;  1NJX A;  4BDZ A;  1LAW A;  2OPQ A;  4AH9 A;  2KQ2 A;  3VQ6 A;  3L2W A;  1ZBI A;  1KCF A;  2YHB A;  3HYF A;  1NKB A;  2Z1H A;  4I2Q A;  5D3G A;  1ASW A;  1RDC A;  4B9L A;  3BGR A;  4KPY A;  5I42 A;  4CJ3 A;  4JS5 A;  1VSJ A;  4O5B A;  3RMB A;  1D9F A;  2ATQ A;  3SJJ A;  1U49 A;  3V1O A;  2QK9 A;  3P5J A;  4O44 A;  2XY8 A;  4RW4 A;  4CF9 A;  1LWF A;  3ZT3 A;  4HCC A;  3KK3 A;  4B08 A;  1TVR A;  5J2P A;  2B5J A;  3OJU A;  3VA0 A;  4FW2 A;  4ZHR A;  3UIQ A;  2EHG A;  1RTH A;  3QO9 A;  5FRO A;  4YFU A;  1IKY A;  1J54 A;  3KIO A;  3K59 A;  4OLB A;  4AHV A;  3HK2 A;  1JLE A;  2JGU A;  4AHS A;  3AO5 A;  3TI0 A;  4DU4 A;  3B6P A;  3EZ5 A;  2EX3 A;  5J2M A;  3HP6 A;  5HRP A;  3HM9 A;  2KW4 A;  4CEO A;  4DFK A;  1XC9 A;  2KTQ A;  3HPG A;  3ZSW A;  1ZYQ A;  2I5J A;  4F8R A;  3OYJ A;  4Z0U A;  1X1P A;  2BGG A;  3HPO A;  4ID1 A;  1HYS A;  1BI4 A;  3L2Q A;  4CCH A;  3ASM A;  4PQU A;  3KK2 A;  3TAF A;  3HXM A;  3TAB A;  3AO1 A;  3PX4 A;  3AVH A;  4LY7 A;  5CZ2 A;  4N47 A;  3KKS A;  1RTJ A;  3NF6 A;  3NH2 A;  2LSN A;  4BE1 A;  1O1W A;  1DLO A;  4KI6 A;  2HHT A;  4M3R A;  2IS3 A;  1C0U A;  2OZM A;  1LW2 A;  1U47 A;  4OKK A;  3ZSQ A;  4LH5 A;  3QEX A;  4E1M A;  2DTU A;  1JL1 A;  1KVB A;  1XHX A;  3TAM A;  2D0A A;  3SUO A;  1NJY A;  1SKR A;  4KTZ A;  1RT1 A;  3M8S A;  5KGW A;  4CK2 A;  4DU1 A;  1XHZ A;  1C1A A;  1EX4 A;  1RBU A;  3QLH A;  3WNE A;  3ZT2 A;  4EZ9 A;  4FVM A;  1JLC A;  3KJV A;  1BCO A;  4NYF A;  1J9A A;  1JLB A;  4FJJ A;  1CLQ A;  4E19 A;  1RDD A;  4DTO A;  1K6Y A;  2HB5 A;  4CEA A;  4HCB A;  4E7H A;  1ZBF A;  5HRS A;  3OYB A;  3RWU A;  4OJR A;  1HQU A;  3DRS A;  3T19 A;  4ELV A;  2ZQB A;  1QS4 A;  2XO7 A;  4MFB A;  4CFC A;  4E7J A;  2DFH A;  5FDL A;  3TR8 A;  5KRS A;  4KAZ A;  4DU3 A;  4PUO A;  4FLU A;  1CXU A;  4MQ3 A;  4R5P A;  1HNV A;  1I39 A;  4E7L A;  1HMV A;  3NGZ A;  4Z4F A;  3ZT0 A;  3NF7 A;  3ULD A;  2HMI A;  4B8A B;  1S5J A;  2QXF A;  3C94 A;  2VG5 A;  4CFB A;  3OYD A;  4DTX A;  2FBX A;  3AVB A;  1HQE A;  4IG0 A;  4DQS A;  1VK0 A;  1W0H A;  4OPJ A;  4FJL A;  4UQG A;  3AV9 A;  3SQ2 A;  4FZX C;  4J2D A;  4CHN A;  5EU7 A;  1WLJ A;  4BDP A;  4QAG A;  3LDS A;  3KLE A;  2G8I A;  3KLI A;  3AVA A;  3DM2 A;  3AVJ A;  3SQ1 A;  1UA0 A;  2HHV A;  4O0J A;  3SPY A;  4KFB A;  1RDA A;  4DFP A;  3V4I A;  2Z1I A;  3M8P A;  4C8K A;  3LP2 A;  1WSI A;  1MU2 A;  3AVK A;  1NK6 A;  3NHG A;  2B4J A;  3AVM A;  4CIG A;  3AVG A;  4B9M A;  1RDB A;  1S1W A;  2YNF A;  4FCY A;  4FK4 A;  1Y97 A;  1CXQ A;  1VSE A;  1Q9Y A;  4CGG A;  1I3A A;  2GV9 A;  4KHS A;  3L2U A;  3QEP A;  1X9S A;  3TAR A;  3LAN A;  4CIE A;  3E01 A;  2BE2 A;  1S1V A;  4DTP A;  3NCI A;  1JLF A;  1SV5 A;  3QEI A;  2XY5 A;  1A5W A;  4FZZ A;  4RW9 A;  4B9T A;  4FZY A;  4FK2 A;  1RTD A;  4M3X A;  3O4Q A;  3PX6 A;  1VSL A;  1U04 A;  4B9S A;  3HP9 A;  3EYZ A;  4M45 A;  3F9K A;  3TAP A;  4F2S A;  4ZTJ A;  4BE0 A;  3AO2 A;  4BWJ A;  5DMR A;  3JYT A;  1NK7 A;  3KD1 E;  4QOZ B;  4CGF A;  4CJT A;  3D45 A;  1IKV A;  3HL8 A;  3L3V A;  2R7Y A;  3QNO A;  1QSS A;  1NK5 A;  3IRX A;  2W42 A;  3V81 A;  2P5O A;  1Z26 A;  1CZ9 A;  2RF2 A;  4Q5V A;  4M3Y A;  3V9Z A;  2P51 A;  3DOK A;  1VSH A;  4FLZ A;  1R0A A;  3KTQ A;  3ZT4 A;  1LV5 A;  1FK9 A;  2VG6 A;  4CGH A;  1BIS A;  1L3U A;  4BE2 A;  1XWL A;  4OKE A;  3PO5 A;  2KZZ A;  1KRP A;  2RKI A;  4F4K A;  2O4I A;  1KFD A;  3DLR A;  5J2N A;  2G8H A;  4CHO A;  4DSE A;  1HPZ A;  4Q0B A;  4CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...