3L48A

Crystal structure of the c-terminal domain of the papc usher
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
GKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Outer membrane usher protein PapC
total genus 15
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l48A01
2KT6A 2XETA 3RFZB 4J3OD 3L48A
chains in the Genus database with same CATH superfamily
2C9XA 3LMJH 4Z7AA 4Y4FC 1X5ZA 1AR2A 3LEXA 3ZKNC 4HD5A 3SOBH 3H42H 4NZUH 3AQZA 2OYPA 2FHCA 3TURA 1M7UA 4OLUL 3QFDA 3LVTA 2DQTH 4ODHH 2JFCA 2MJWA 2DY2A 1V3LA 4HUVB 1RXLA 4HIXL 3CZUB 4JY6A 2EDWA 4BFOA 5C0CB 3LV3B 3WYRA 2HRPH 1C5BH 3JT0A 3LXUX 5JPMC 3QORB 3WJJC 3MLZL 4WRLA 3I2CL 1WQVT 2XN1A 3GHEH 2H45A 1EAJA 2OMNA 2LGNA 2Y1AA 3JZ7A 2JB6B 2VH5H 3F8UB 5DUMH 2FATH 3FF7A 3C8KA 3QHTC 4WI7A 3EOTL 4HS6B 1FZOA 3HLAA 2MPAH 4HWBA 4Z7NE 3QRGL 4GQ9H 4RFNC 5JQ6H 2AZUA 2OM5A 1T3FB 4ODBD 5E2UL 4OM0L 5HDWA 2WBJA 2VR8A 1ZLUK 1ACYL 3PREA 3EFFB 4LVNB 1WBYA 3MA7A 1QNZH 3AREA 4UM8A 1BEXA 3C09B 1Q9KA 5IOPB 5DDHB 3FB5A 2I7OA 3HZVB 5D6DC 1MWAL 1ORQA 1IL1B 3T2OA 4PJ7F 1ZHKB 3BI9X 3L3HA 4JAMB 5EU6A 1WAAA 4ZFOB 4CGTA 4XGZA 4TTGA 3DUUA 2ZCKL 3PHAA 4BSJA 2GY7B 2E86A 4PLOB 3QJXA 3FRPA 5E6IB 4MCZA 1S46A 3TO4C 4G8AC 2MHAB 3IDMA 4K55A 3CJJA 2W07B 1BW8A 5BZXA 1SOSA 4YFDB 2PCFA 2TSAA 3FZUC 4OGQC 2CRIA 3IDJB 3DTDA 1GHFL 5AAPA 3ZDZB 4UT7L 3HFMH 4GMTH 2DQCH 2J20A 5T33L 4FF9A 3KWVA 4LDEB 5JPMA 5HYEA 2D7PA 5J7CC 2OMZB 1ITBB 2VLLA 4R84A 1OWRM 5HI5D 1OAYH 3GMRA 4JFDA 1JDDA 2Y07H 1KC5L 2GUYA 4J3OG 1FL5B 1KGIA 3IKKA 1THCA 4DP5X 4KDVA 3QUML 2XXCB 1AKJD 3V5DA 4RAHA 3WFHB 2X53A 4YXLH 4TQEH 2PXYC 2OP4L 1CBJA 2NYKA 3LS4H 4M6AA 2NLJB 2E7CA 1FUNA 3OPZH 2JVUA 4I4WA 4MNQA 4PV1C 3EYUH 4LCWE 1CL7L 2XETA 4P0DA 1G9NC 2YQ2A 1A4BA 4HZLA 4N1HB 3I6GA 3NCWA 4KTDL 5F7FA 4U6TA 4KTGA 3BUPA 5BVPH 3IWVA 3LNFA 1BP3B 3VFOA 1XD1A 3WBDA 4YE4L 5HJDA 3EAKA 2IV8A 3DPBB 4OZGF 4X8JA 4IU3B 3Q9QA 5F9JA 3WIIL 5GGSA 4KO7A 1VF5C 2UZXB 3VXMA 4LESA 4QRRB 5M7QA 3MJ9A 4GEIA 4DK6A 1YCSA 2OCFD 3OKEA 4WFGE 4AITA 2ICEC 4OD1L 5BNXD 3B6SB 3VFGH 1JPST 4M4RA 4O02B 2R0WH 4BH8A 5AKVA 5IF0B 2VLJB 3GKWH 1XH3B 5DC4B 2C9PA 3DGGB 4BUHA 1ZAGA 3B3IB 4XPAL 3M1OA 1AKJB 2Z31A 5CLZA 3D3VB 4RNRB 1NDGB 2CKBB 5IHUL 3FYIB 2X0UA 3MYZA 4HS8L 4Z7WA 3T08A 2J88H 5IJKC 1KXQA 1YJDL 5D7LA 1QPKA 1JTOA 3VXPA 1I9RL 3H9SB 3B43A 3QJQB 1P5UB 5FLUA 1MKFA 2ZOUA 4OZHE 3HZKA 1K3IA 2GEQA 2UX6A 1JGEA 4RQQB 5IWLA 3TIEA 2XWEA 3RNKB 4HK3N 2FL5A 1RIVH 3QVAA 2D7NA 4B5ZA 5DHMC 2LLGA 3NZUA 4XP9H 5A6MA 1R0AL 1VIWA 4OAWB 3OKMB 4O4YH 4TUJB 2Q8AH 4PAZA 5IBUG 3VD5A 4AQ8C 1PNCA 2Y7LA 4MHHI 3C6LD 5C0RH 2E9GA 3RI5F 3CSGA 4WI0A 4XT1C 4OF7A 1BFTA 1PIGA 5HYJD 2OQJA 1ZVYA 3S96B 3H3PL 4MNQD 3G5VA 1FPTL 1J5OL 1F1GA 3H7BB 3BISA 5LHDA 4OZIB 1TTBA 1PF3A 5C08D 1B6UA 3MXVH 1BPVA 1G7HB 1Y18A 2WOYA 3ZDYF 3B2XA 3BKJH 5I6XC 4FHBD 2BIPA 4PJ8C 4BFGA 1CI3M 2BERA 4H2CA 3UTTD 2FTAA 3TZVB 1AANA 3RFZC 2N7BA 2V6HA 3C5ZD 4PMFA 3MRLB 5BV7C 2CA3A 3SKNA 5IROA 3T1FB 4C4BA 1MCQA 1Q9WA 4ZFQA 2CAKA 2EP6A 4OJEH 2NY6B 4DIXA 1W72L 1ZK5A 4AOFA 1FV1A 1IC7H 4ZQTA 5CJQH 4Z23A 1LK3L 1F4HA 4KKBC 4L1BA 1GR7A 4NQVA 2WXFA 5D4JA 3IFOA 1D5ZA 4WCYL 2R56H 3CCHB 4R90L 3N41B 4PWIA 3FTUA 1EO7A 1BAGA 2XYBA 1A5FL 3MGOB 3P2TA 2P8PA 3EG9B 4F33A 5DS2A 3RJDA 1BVNP 1MJJA 4GS7B 3IMRA 1IKOP 1DCEA 4YDNA 3OWEA 3X2QB 5KYWA 2UZIL 1LO4H 3D87B 2PETA 3WL9A 2YAPA 1I1YB 3TJHD 3E3QC 2MQ3A 3RDTB 3W5NA 3ASOB 5CS7A 4HXAH 4X98A 5BRPA 4UINL 3PU7A 1FP5A 2FSEB 2KBGA 2OYMA 3FQWA 3QIBD 4KTDH 4XNBA 4TL4A 3ZYOA 2NCMA 4FYQA 3Q43A 3GIVB 2X4PB 1KWKA 1X5XA 4UAHA 5I5MA 5CBEA 4KHXH 4LL9A 4PJAE 4YR6B 5F93C 3RIFK 3BMVA 4NT6B 2EDDA 5EFIA 3VFPA 4ZG1A 3VXRA 4NUGL 4M6NL 5CSZA 1E5UI 1P1ZA 4F7CA 3M45A 5EIIG 3UFIA 1DSFL 3QDGA 4F2ME 3MLSL 1NC4D 3QHFL 2CLVB 1UENA 4NSKA 1S7SA 2B14A 5FX3A 4AJVA 4Z7QE 3G5XB 1T21B 4M8UA 1CE1H 4L3CA 3EFOA 3IBEA 2NCEA 4YSCA 3MRPA 5GJSL 3MRBB 4KXCA 5T3XD 4NQCA 3EYVB 4N0FB 1V7MH 1QLRA 4PJXF 4ADIA 1XF5A 1M2VB 4PRBB 3HI1B 4LGRB 4GXUM 4ZUVB 3WY1A 2B9AA 2V7HB 3HOGA 3G6DH 3MZTA 1IEAA 2ATKA 2YN5A 3CUPA 4UTCA 3TGXA 5HGHB 4XPBH 2AJ3B 1T5XA 2BIMA 1I3RB 2UXGA 3DSNA 4NKDB 3HKZA 2X9ZA 4J1UB 3GSVB 4WWNA 4PRNA 2D3NA 1RJCA 2IH1A 4LSSL 4XPHL 5H94B 4KUCD 3QAZC 4G8GD 4R97C 3DUHA 2NNFA 1SMOA 4JZJA 1X3DA 4RAUB 3S37L 4XCEA 4YZFF 1NQBA 2XWRA 5C8JB 4YIQB 2MKWA 4D3CH 1DQQB 3QJHA 5CZXD 3VW3H 4LHUA 3WIFA 3ZR5A 4JRXA 2X4OB 3EGSB 3EOTH 1N5AA 4BZ2H 4LHUB 3WIFB 1EJOH 4GS7C 4U4BA 1SUJA 3ARVA 2ARJQ 1E3XA 2G3XA 4M62L 4N3TA 2DIAA 4UDUA 4CUCA 4A6YB 3ZOAA 3BPNC 1E5BA 2EO9A 3FB7A 4GKLA 4PU2A 1L9TA 5DCCA 5GGRA 1TG8A 4UCFA 1E4KA 3A67L 4M5ZL 3U0PB 2WNGA 4U1IA 1FL3B 3B9DA 5FYKD 1DDHA 3CG8A 4GKZB 3VH8B 2NYZA 3A21A 4PJ9A 4Z7IA 3DIFA 2RCSL 5DA0B 4X8CA 3L4CA 1G5AA 2AI0H 3FU8A 5GRVL 2BS71 2EXTA 3GF8A 1EEYB 3WXWH 2L7QA 4HAKA 4DK5A 3MRGA 3QDME 1YRKA 1WV7T 1JN6A 3B5TA 4LIQL 1TZOA 1FSKC 2V7HA 2QQLL 4ZX4A 3OKNB 1VEOA 5FB8B 1LXMA 2CR3A 1CLOL 1G7JB 2BIHA 3RIAF 2CPUA 4NQDE 5CILH 4RCAA 1L6PA 1ZIBA 4JHAH 1A6AA 4QRPD 4WI5A 5H4YA 2EE9A 1ZEAL 4P2RD 2QDWA 4UQ2A 4PGCA 3WD5L 4MQ7A 3QW9A 4KI1A 3BWUF 4O2CA 4OF5A 1M9WA 5T1KD 3NRPA 4G6JH 4U1NA 1LDPH 1XQ4A 3TBTB 3GJFB 2ZT9C 3JV4A 3SQOL 5IV2A 3LTVA 4ZNEA 1BA9A 4M48L 1JK8A 1BEYL 1XGRB 4UIMB 5D96B 2IPKB 4NO5A 4PRHD 1MFBL 1R3IH 5KJ4A 4X42A 4FKKA 4WHYH 3TNNB 4W9HC 1YC7A 1P1VA 2HMID 1E4WH 3UPCA 1ZPUA 3IAPA 3TBBA 1QAWA 3DV6B 4LDCA 5KZCB 1NUGA 2ID5A 2BJML 3M7OA 3UGEA 2GKIA 5GRYA 2JKSA 4QXUL 4ZUUB 5E9DB 1QASA 4I1NB 3I50H 2E6QA 4X98B 4ZFGH 3OMNB 3AXHA 5IVZB 2N1KA 4CVXB 5JIDA 1E5CA 2YKLH 3MV8D 2EC9T 2DPKA 3G6JF 4JFQB 4BSVB 2KZWA 1USZA 5AUMA 2I69A 3US9A 4AKOA 4F5CE 1ZLSH 2FT8A 1NGZB 1G84A 2XPZA 3DV6A 4LLUB 1DJZA 4HJGA 1AO7D 2YMOA 5GS2D 1Z7JA 2FH6A 5TDOB 2WO2B 2VDOB 4CU6A 2CJSA 4ZYKA 3LKQB 1DLHA 2WJ5A 3QWOB 4GG6E 1IGFH 1N6UA 3ULVD 4JFOB 3L7EB 2ZXQA 3BZFB 4IQHA 2CHZA 1TJMA 3ZIMA 4QLRA 2DWDA 2XXGA 1OOWA 2JE8A 3BOVA 1Q0XL 3IXAB 2IAAC 1JGDA 3ZK0A 1NSNH 2E7LC 3H8NA 3QNZB 3BN9C 4U1NB 5L0QC 3IMBA 1H5BC 5GRXG 3U30C 3D4ZA 4PRIE 1PD6A 5DEGA 5F7WC 1IT9H 3BW9B 4XPGH 1L7TL 1ZSDB 5B7FA 5LXGH 3QQNA 4OCSL 5HHVH 3I50L 5C0CE 4ZS6D 4DQOH 5IB2B 4Y7MA 3U7YH 4OCMC 1JNNL 4WFHD 5DK2A 1PG7W 5CBAB 3TS8A 3A5VA 4O9HH 3Q5TA 4H88H 4IKNA 3BUQA 2V2XB 5JW3L 4X8XA 3L7EA 3I9AA 4PPTA 2D7MA 4PBDA 5I9QC 1EEYA 2J21A 1M7IB 5AKTA 4ZYKB 5IUSA 3NJMA 4Z78A 1JS4A 4QXWA 1L5GA 1H8LA 2WXIA 4Q2ZB 3Q3GA 4DGVL 2QQNL 3TVMB 5GZOD 2JJSA 1L4IA 2WKLA 3BIKA 1DFBH 4MJ5A 3QPQD 4GB9A 4YBQD 5D71L 3TEZA 1KNOA 1S7WA 3U25A 2EIMB 3D9AL 3AQDA 1E3ZA 1TOXA 2VWEE 4PJAB 1E27B 2OZ4L 1CLZH 3DVGA 3P0VL 5AKRA 2VQ1B 3S35X 1G7IA 1KGXA 4G9FB 1C7TA 2UY7A 4HUUB 4V1DD 2WXNA 4TSBH 2DQCL 1DANT 5BRZB 1IM9B 3Q8EA 1E67A 1CGTA 5I6OA 3L7FB 4F9LC 3AT9A 3B3IA 1X5YA 1M7DB 2ZXDA 3RWIA 4LPVA 4FGMA 4F9PC 5FGBC 4KXAA 1DUZB 1F4YL 4KRMB 1UTDA 1AGFA 1BX2A 1NLDH 1JNNH 1D7CA 5JPNC 1SEQH 5TQ2H 5JR1L 4K7PL 5I75C 4JO8A 2J8UA 3FU5A 1FFNB 4LEEA 5C2BL 4TOYH 1N70A 5CNHA 1FHNA 1AJ7H 4ZMTA 5T1MB 2DMHA 1PKOA 3K2UH 4C4UA 4EAEA 2P24A 1INQA 3WCYA 4N8VA 3PQYA 2DQUL 2YRBA 4MD0B 4DUWA 2D8KA 4ZI8A 1F58L 2G2RB 1L6ZA 2PR4H 3LKOA 4KXDA 1K9TA 3AT8A 1T1WB 4GQQA 5IMMA 1C16B 2WLIA 3OL2A 4YHZL 5EBWB 5JQ6L 3G6JA 3DIDA 1WHOA 4YHOL 4WWPA 2YUZA 1TVBB 3D09A 4ZW6A 5CKAA 1DTUA 3C5ZB 4FD0A 3TIDA 4HG4K 1M57B 5E2VL 1NGYB 2Y69B 3MJ8B 1CGWA 2R7EB 3JWOL 4I1PA 4HUWA 2ZX5A 4Q0XH 2BVEA 3QFJD 2LTQC 1IMHC 3I74A 3IRPX 3SN6N 5CEZL 2P7TA 3KYOB 2ILLA 4KVCL 1EZUA 2NY5H 3LEYL 3C75A 4ACTA 2VB5A 1U8JA 3BUYB 1S9KC 2CBQA 1HI6B 4WU7B 2VO8A 2AAVA 5EU7E 2X5PA 1DBJL 1E42A 2FLBT 4ZFGL 5EEUA 1RAMA 2K4WA 1UA6H 3C6LB 4LSRL 2ICWA 2DQMA 2ENYA 2Y5TA 4U3CA 2CUAA 2X09A 2OTWA 4PRPD 1QR1A 3IVKB 1QFWL 1XCQA 4H8WC 1NWPA 1Z0MA 5BRQA 2XIDA 2YEZA 4D9QD 4HDIA 3SO3C 4XNAA 3TBYA 5ALBH 3ZDYB 2X28A 1N0XH 4MJ6B 2R1XB 4BM7A 5GGVY 2ICWB 5I1KH 1NMCC 3RJQB 3RWFB 1T0PB 2Y72A 1CR9H 3WLBA 2VXQH 2QBWA 3ULVE 5IKCB 2G4EA 4RAUA 1OTTD 3BVTA 5JHBA 4G1MA 1F4WL 3AREB 1U8JB 1NGXB 1Z3GH 4OZHF 3KHOA 3NA9H 4M6NH 3RWDB 4NN7C 2WC7A 4K7PX 2XKNA 3O11A 4IS6A 3BKML 1P4LA 3KWWA 5D72H 4HIJB 3UP1A 5IROD 2A77H 5L8KB 1M9SA 3CFEA 3QIUB 1FFOB 3LRSB 4OGAC 5MENA 2OCJA 2TAAA 2Q76A 3IK2A 5LJYH 5I19H 2V8MA 4M7JH 2CUIA 1ZLEA 5HHPA 1ICTA 1PLAA 3T77A 1KCRL 1OZTG 3BAKA 3P9WB 4QHKI 1I8MB 3CQQA 3L4VA 4WUUE 4AJYV 1OSZB 3IBOA 2CHWA 3HNVL 3O8XC 1KBVA 3MV9B 4NUJB 3U4EB 7CGTA 4NZJA 1AGCA 2O5XH 2HFEA 4CL7A 3VD1A 1TPXC 5B4MD 4JFZH 4OZIA 3FKUS 4ZFZA 2AJSL 1FFTB 5IGXH 4ERSH 3BH8A 1MSPA 1I8LA 2ZSVA 4JUTA 2C9RA 4B9ZA 3BIBX 2VJ0A 3RWGA 3KR3L 3KLHD 3RX8A 4FLRA 4XNQB 1WD9A 1G4RA 1FFNA 1WPCA 5EU4A 1AKPA 2ZYSA 4NFDA 2DB8A 3GXPA 4IRZL 5FECA 3FQXA 4WWKB 3F12A 4QKXB 5HXMA 4L3ED 5TE6L 3HG4A 4LO9A 5E8EA 4FFTA 1I85C 2DYPB 4D3CL 1U8LA 4XC3L 1AGEA 4HKZB 3B2UD 4N2BA 5IG7B 4ANVA 4U0QB 5EZJA 1OAQH 1RUQH 1YEGH 4G80B 3W0WB 2FNBA 3OKOA 3TBVB 4H8HA 4AIEA 2VDNH 3NN8A 4S10A 4BQCA 5HVFB 3D3VA 1P69B 5E00B 4RGOH 2VERN 3H3PH 4DKTA 3JQOB 1DZBA 3N42F 4MAUL 4B97A 2VLJA 4XODA 1M7IA 3GSWB 4Q14A 2F53A 3NZHH 4XXCA 1OW0C 3TA3C 2IANA 1FF5A 1YEJH 2MIZA 1LTXA 2DI7A 2YMXH 4LOEA 4M03A 5GSRB 1LEIA 3GIZL 2QZ5A 2G60H 1DANU 1TNMA 3KPPA 4PS7A 5PCYA 3X13B 2DLFH 2QV2A 3PY9A 1U2CA 1HIML 1MCNA 3NT0A 3OBAA 4W4NA 1UUSA 3D5OF 1HC1A 3L9RA 1AIFB 5DYFA 1RZIA 3Q2CA 3ZKMC 4WI8A 3PL6A 2Q3XA 4G80A 4UOQA 5E8DL 2XKUA 4XC1H 5HHMB 5JORB 1X5AA 2IXQA 3B9EA 4OZGB 1S78D 4XRCB 3VGEA 1ASQA 1D9KB 3SPGA 1AGEB 2VJ8A 5FYLH 5BO1L 2EDYA 5JW4N 4ONFH 3L8QA 3DX1A 4P5TB 8FABB 3HB3C 4ADGA 4NN5C 3SB3A 3E9UA 1SHWA 1W2KT 2DQFA 4HGMA 3OM3B 2FK9A 3SGJC 5AVVB 4EVNA 2WBJC 5D2LF 2R51A 1YMHB 4WKXA 2NTFA 3WKNA 5DU7A 4TVPH 2WWOA 3UO1L 2YMTA 1IV8A 4XXWC 2YGPA 1UKTA 4LHJB 4LSTL 2XA8L 2YPVL 5AOJA 2AJSH 3L4XA 1V7NH 2EECA 1AQDA 4NC1E 4UINH 3FRPG 2VLLB 3VFUB 3DV4B 2CHNA 1YUKB 2F5AL 4IBSA 5AW5B 3ZX1A 3IDXH 3L1FA 3LSOB 5FGRA 5KANG 4A6YL 5J89A 1CFQB 3A6CL 3CX5J 1Q9LB 1NCJA 2VXVL 5FM4A 1FYTE 4PW3A 1U8MB 4ZTPL 3RBGA 4BFNA 1CBVL 3T77B 2EH8H 3IFNL 4X4YA 1TYEB 1I4FB 3WHE0 2WBJD 3P4NA 1MF2H 2P5WA 3T3MF 4ONOA 4LU5H 2F61A 2P80A 5DHXB 3NFPA 4OI7A 1SLXA 5CAYB 1GAFH 4HWEL 3MROA 4A2FA 1CZ8H 2DEXX 1I85A 1NGPL 2CKNA 2JNZA 2LABA 2FAUA 3WFZA 1O5DT 4AGNA 4JFPB 4O02A 3L9YA 1O0VA 1SHXA 4S2SA 3B6SA 4Y89A 1NGXA 2J8HA 5DA4A 5KTEL 3IMSA 4JM2C 2EYRB 2VSMB 2HUHA 4ZDHB 3TC9A 5IOPA 1E4JA 3FBQA 4LLQB 5DJCA 2FWSA 3VFUA 2G75A 2W8CA 4I77H 1XGRA 1JGLL 2ZJSL 1C9SA 4P2OC 4X7EC 4XB8A 5DMIL 4Z76A 4UZUA 4N8VG 3OKLB 2YAEA 1A64A 1CDJA 1WA2X 4F7EB 2N3JA 5C7XH 5DSCB 5TK4A 4GMTL 1SPDA 4PLKD 4EBQH 1GGBL 4G6ML 1N3NB 3GSUB 4FXKB 3K72A 4HG4J 1Q1PA 4NYLB 1KIQB 2WY3B 4W9CC 5A16A 1ZHNB 4GG8B 2W65B 4HLZH 3IPFA 1JCVA 2B0SL 1TTAA 1N2RB 1UA6L 2AXHA 1K5NA 2NLJA 5FYJU 4FAAB 1F2XK 3FW6A 5H37A 4A63A 4TNVF 4Y88A 2WWKO 5MHSD 4PJHF 1JG9A 2HKFH 4PQXA 1JN6B 4A38A 2YAFA 4KROC 3INUL 5JOPE 3P3TA 2J2ZA 4C54A 4PS3A 3MGAA 3B2VL 3V0VB 4LARL 2MWCA 3SKMB 4PWEA 3VGAB 4O2FA 5TE7L 2YPLB 1AC6A 2GABA 3E6FA 2VXSH 3B7RL 4HPYH 2HX8A 1NBYB 1SDYA 3L08A 5I8EA 1U58A 1GOGA 1K85A 1B4TA 2G3MA 4R4BB 4KVPA 5E1AA 1VFBA 1HSAB 1DQDH 1ZHBB 3FT2B 3LH2H 3O9WB 3U6XA 1A02N 5IVXF 3ZE2E 1DQQA 3O0LA 1DQTA 4CKQA 4JRLA 1CGSH 2NNAA 5ILTL 1UWXH 4GAYA 2BXZA 1QRNB 2G3NA 3T3PB 4ZUTB 1GGUA 3IJSA 3ISWA 2X3BA 4OLZL 3KPMA 3HI5H 3SPVB 2YC1A 4B9JA 4O51B 2E6PA 3ZSSA 3VXSE 5CEYB 2CJUL 2B2XH 4KH9A 5AYUH 4XOBA 4WW1B 2AEQH 4JFYB 2WUCL 2ICWI 5T5FH 4X7DC 4HOXA 5E56A 1E8YA 2DMCA 3WNKA 1A7OL 2EO7A 1KCUL 3NDZE 4ZPVA 4B9GA 1E8ZA 3RPIA 4JFEE 2XBZA 3C5JB 1MCLA 3FHQA 1TETH 2JB5H 2RH0A 4OCYH 1QA9B 4HUXB 4K9EC 3JV6A 1S5HA 3MCKB 4B0MM 1G9MH 4TNWF 1KWGA 3S5LG 2Q1EA 5HD8C 4HIPA 4KQ3L 4NP9A 4Y4HB 3APCA 3GRWL 4WY7L 2X1WL 2D4DA 2CDFA 1HHKB 3FHAA 1MCEA 4K3HA 4JR9H 1FGNH 3H6JA 5T33H 4PTTB 1BWMA 3WU1A 2E5EA 4Q6IB 4WTZG 1YEWA 3SDDD 3ARDB 4QYOA 2ZPKL 3VXUE 2XZQL 4M61A 5F7NC 5EU5A 1QSFB 5E70A 5D7SH 4M8QA 1ODAA 5D9SB 4OI9A 4A67A 4XHQA 1KEGH 4K3DL 1GTNA 4L4VD 4D9RD 1YMMB 4LCWA 4JG1L 5LWYL 4LSRH 4G82A 2EAEA 4GEJA 4X6BA 3KPMB 3ZMRA 4Y5VC 4OLZH 4DK3A 2O30A 3BZDA 3Q6FA 2JLPA 5J13C 2B1HH 1ES0B 4JE0A 4LCCB 5CLXA 4JRYB 1ET8A 3CIQA 2WP3T 3DMMD 1QI4A 5FKPA 4R7LA 1HYRC 4QOKE 5DRZA 5I5IA 2HVJB 2DQIH 3NFNA 1MCBA 2ZE0A 3IJHB 2F5BH 4ES9A 4Z5RA 2Y7SA 1X9QA 3K91A 5H2BB 4N2DA 2JJSC 5F0LB 4E9YA 1CF1A 2NY0D 4AI7A 2DDQH 2A6IA 1DLHB 3MQIA 2F7QA 4XVSL 3T0EB 4GRWE 3VXNB 4HXBL 4UB0L 3E2HC 4XTRC 1UJ3A 1NCDL 1T7YA 2QGBA 4ZMNA 4KVNH 2B4CH 4GRMB 1XZ0A 4LARH 4QYOB 4PW9A 1KXVC 2R2EA 3MLZH 4PY8J 1ZVSB 2P43B 1J0YA 2B77A 4YPGA 5EF1A 2WQRA 4APQB 3P9MB 3LZFL 1SLWA 5E4AA 5MEPB 3K2KA 1EDYA 1LEGB 2BVOA 2GJ6A 3CBRA 4X7CC 3QC5X 4Z18A 4ONGL 3HI6L 5EDSA 4K7PH 1UHVA 1GZQA 1W72A 5MEOA 1QUPA 5G4MA 4RFOH 1K5NB 4YSOA 4A7QA 2OJEB 3OJDA 5TPWH 3VE0B 2LU3A 2NY1D 1OTSD 4UV7H 4WNQB 1HN1A 1HH6B 1JSYA 4P9HC 5B3NA 1C16A 2J8OA 3RY6A 4BK5A 3BQUD 5FUOH 3VMPA 1T80A 4PVBA 4QHPA 5I30L 3KS0H 3PHOB 1G7PB 4AYEC 1MFEH 2F7PA 3Q01A 4ZMAT 3PHQB 3MBED 3BP4A 4FNRA 4N8VB 2Z35A 3UTQB 1CLZL 3P0VH 3U79A 2VNCA 4IKJA 3GJFA 3NSJA 2OMTB 1P7QA 5GHWL 5HVHC 3II2A 2NNRA 3QEQE 1TPXB 4HF5H 2YLHA 4BUGA 2XWDA 4XR8C 4IGBD 1D6EB 1MCRA 1XVSA 1QX1A 2PPDA 4UILL 3AMKA 5A1AA 3W2DH 2K70A 1HH6A 2SEBA 3OAYK 1IFGA 1MFEL 1KCVL 4PJIB 4BFFA 4EI6B 1MRCH 2X4QA 2VDPB 2CIKB 4PCTA 5AW9B 3I9IA 3SPJA 3U4AA 3NABH 5F7DB 4MAYD 4MXQD 4FXLA 1H15B 3DRQB 4H88L 2E47A 4TTDC 1G7MB 1TSHA 1PAMA 3TFBA 4G9FA 4F8OA 2GK0B 2BP3A 4UNTA 3VXMD 2HG5A 2R0ZL 4EE2A 3VVWA 4WUUD 3BXNA 3QXDB 2WKOF 1SOQA 2VTFA 1ZPLA 5DUJA 4MJ5B 1U36A 3SKMA 1FCGA 4CW1A 3WN5B 4YSPA 3V0VA 3G6AA 4JO4H 4K3EL 2X4NB 4XOAA 1EWHA 1JMXA 3JUZA 3MLTB 4XN8A 5D5MF 2C3HA 1EIBA 1I8KA 1NDMB 1YN6A 1M6UA 4AQ1B 4IOIA 2HG5B 1ZVNA 1XB8A 2OMXB 2YO3A 5I1AB 3ZSTA 4CMMB 4MCYB 1CLYH 1JE6A 4KI5E 5GGTA 4AE1A 1SXSA 3QEUA 2ESVB 3T0WA 3WFBL 4AZ8A 4F15C 1HHJA 5I5JA 4NRZB 2HKAA 2X4QB 4KH2A 1KYFA 4FG2A 3ULVL 3OF6A 4D7PA 3RBSA 1JHTB 4ZD3L 4ZOAA 1UD8A 3PAVA 4LSVL 4RMVA 1W0WB 3QUKB 2WVSA 2F1AA 2YBGA 3HAEB 5D1XE 5K1JA 4G6AC 5LBGA 3DX2A 1NFDB 3NIDB 3OXRA 2EC9U 3K6SA 4AGLA 4LMQE 1IQDB 3DVIA 1DFXA 1OTTC 2IDUA 3UBGA 2MEJB 2YUVA 4PJ6A 1GPOL 4E41E 1UD6A 4PS4L 4J28A 4HIHA 1T03H 4NOBA 4TUKH 4QTFA 3ZKQD 2A6JA 4JO2L 3HNTH 3GM8A 2OMYB 3VE0A 4OGAD 4FQJH 4Q9RH 4RDQG 3HS0A 1Z9SB 2RTTA 3TF7C 4KRPC 1NFAA 1OCRB 3N40P 5IFAL 1WWAX 5MEOB 2HG0A 5DVOA 5ADOH 5DFWH 2NNCA 1GC1H 3IS0X 1YNTA 2F74A 5K9OA 2P26A 5I2IB 3BHBA 3CSFA 4LPWA 3SDDC 3UEZA 1X6NA 3CGTA 4HCRA 4OLXL 5CLWA 3PIQB 5D7JD 4HKZA 3F64A 4S1SH 2KZBA 5KG9A 4NQEA 4NUGH 1MFUA 3WD5H 1OQXA 5CGMA 1U3JA 2YZ8A 4JFED 4UU9A 5LNGA 1GH7A 5FGBA 1EGJL 4KAQH 3DO3A 5CILL 4GNKB 2V8LA 2QPDB 2AV1B 3BAEH 1IAIH 3D06A 1GS8A 4KRPD 4F9LA 3D34A 3S3PA 3M8OH 5C09D 4GSQA 4P5KA 4KTEH 1KN2H 3RAJL 3VXTA 2ZSWB 2FSEA 3CSTA 3C60D 3FQWB 3VG9C 1MFCH 5DXWA 1UJ3C 1CT8A 2ODIA 4FQQA 2V5RA 1UWYA 3HG2A 2VZ3A 1JFHA 1S7RA 1ZHBA 1FYHB 1T0NB 2O1AA 3FT2A 2EO1A 3FQRB 1JGIA 5I28A 3AADB 4LVHC 2PTVA 4JY6B 1HQRA 3BVDB 5LGJB 1I9JL 5D8JH 1CK0H 3ETBF 1T83A 1FYTD 4AVIA 5CR1A 4E9LA 3PL6B 3NBNA 2G9HB 4UQIM 4Z3EA 3L9RB 1MHPH 2FT7A 1SYSB 4WI6A 5MENB 1L7IL 3TNMA 5CJQL 4NLHA 4M1CD 4AE0A 1KGUA 1MG3C 2DWYA 3ERXA 1CL7I 3QO0B 5EOCH 3VI4E 1ZTXE 2IWEA 4E41A 2GI7A 5DVMA 5F7HA 2O5ZL 5F7EL 3GB7B 5FXCH 1BM7A 4GKOA 5KAQG 1J8KA 3KJ6H 4HEMA 3TZVA 3WLWD 3CVHL 4PJ7A 5ANMA 1LLAA 1E5ZA 4NDMA 2SODB 2H0JA 2VO5A 4GBXA 1JFQL 3FQRA 3T8XB 3DRTA 4FLOA 4YE0A 1EUUA 3OB0H 5ALBL 3B5HA 3RTLA 4PV8B 4YHML 5GS3A 2A9NH 3U2JA 3VMOA 4NO3A 4Q9RL 5AVYB 3RGBA 2OYLA 3QXTA 1JF5A 4J3SA 3HB3D 4HH9B 3HNTL 3VXTB 2Q0ZX 3CVIL 4JK0D 3UP6A 2OTWB 1INDH 1AZUA 4GMSH 1QLFA 1YDPB 4IMKC 4EPSA 5IREA 3DO7A 1JD9A 1IAIM 2Y2YA 3AS2A 4B9FA 4WV1A 5GJSH 4TUJA 2IBGA 2IV9A 5CZXC 3WLWC 2DQEL 2DM3A 2YAQA 3A4EA 1QO3A 6FABH 4R0LC 3QDMD 5C86A 1YPZB 2DJ4A 5EZIL 2FUTA 2X2JA 4EI5A 1IC1A 5DRXA 3K6NA 4KK8D 3FU9A 2C4FU 5E4IA 2FVNA 5FM8A 4L8SC 1W16A 2H9GB 5EIIA 1KV3A 1BF2A 4BWTA 5ISZB 3PWNA 4GOSA 4S1RH 1P4IL 4UT9H 4F37K 1S9WB 4D2NA 2K7QA 2VN6A 1WRFA 5JZ7C 4ABQA 5KYUA 1RHHB 4RVBA 1OE2A 5IW6B 1N26A 4A68A 4N2EA 2YJQA 5E2VH 4JMXA 4HCGA 4YZFE 5KS9B 2EDEA 5IESH 1Y0LA 2AQ2A 3QI9B 3BAJA 2C3WA 1GGYA 2D03H 1L9RA 2EDNA 4AK2A 4G43A 2P5ED 4ODWB 1L9SA 2OL3A 1CDBA 3A4FA 4LSQL 3GDBA 4POZD 1EERB 4XXCC 4P2QE 3TA3A 2PR4L 5C07E 5JOEA 3L95A 4QRRA 2ZOLB 5I6KA 2AP2A 1E3FA 2R2BA 4JM2D 4WENB 5B39G 1SM3H 4AGPA 1TQCC 4BKSC 5JZ7D 5FYKH 2VZSA 4L2LA 3SE9L 1J05B 3TTYA 3OAUL 4X4XA 1EZVY 3K4DA 3BN3B 2CBMA 2QZQA 4I8DA 4JN1H 1F45A 4XBMA 4OFDA 2K8QA 1C08B 2WN2A 1G43A 1KBWA 1BIIA 1TZIB 4KKBD 1MCOH 3FFCE 1M1SA 4MLSA 3QDAA 3NTCH 5KVGE 5B22A 4NAQA 3F84A 5F7BA 1A6VL 1DJGA 2VYRE 4F9PA 1LK3H 3OB0K 1KPUA 4NO2B 1KG0A 2ARJB 1XCQB 1IAKB 4Z7UB 2WWMC 5L7XH 1RZIB 4UI2A 2VQ1A 3RU8H 3ARFB 4WO0A 1EGJA 4AIOA 5LN8A 3CFKB 5E8DH 5ISZE 3PF2A 3S35L 3C8DA 4P4KB 4ZJ9A 1T83C 1RFDL 3PNRB 2QR0B 4HC1A 2KMWA 3JWDH 3DO4A 2HT3D 3C8HA 1G4MA 1G1YA 1EVTC 3F2LA 4PS8A 4HKJB 4TXVB 1V3MA 4OCRH 4QRUB 3FSZA 2EXYD 3EBAA 2AXGB 5BOZG 4X6DE 5E9DE 4J5VA 5DWUL 1D6VH 4ZUWB 1NCCH 5L2JB 2KPWA 1BVOA 2W81C 4MX7B 4ONHB 2Q87A 5KYNA 1T22A 1G87A 5ITBH 2A0LD 1B0GA 5DJYB 5F1OB 3ZO0A 2Q8AL 1W15A 5DJ2B 5FO7B 3TN0C 3T4YA 4EXPX 2YD6A 3BZ4B 2JCCF 4OFKA 4NQDA 2H5UA 1NMAH 5BV7L 5IMMB 1KGYE 4LT7A 2F58H 1QWNA 5EH1A 2VABA 1X7SA 5J1AB 3ZDXB 1KT2A 3CFBB 1E2WA 1YEGL 3U36A 1OM3L 5JTWA 4WF7A 4F7MA 4MD5B 3DHJA 5BUGA 4MDJB 4OJCA 3AWFA 1WLHA 3G5VB 3F00A 2GJJA 4HEPA 4OSUH 5CSBA 2CXKA 5EDXA 1JZ6A 3O2VH 5IHUH 1L7IH 3RWGB 1RUPH 2IDFA 1JPFA 2JB6A 5HHQA 1OF2A 2OI9B 2R0WL 1WBXB 3EDKA 4NB7A 3OJDB 2PKDA 2EYSB 4P59H 5EBGA 4P5TA 2AJVH 3GLZA 3GKZA 8FABA 2DQIL 3T3MB 3KE0A 4ELMB 4Q4EA 1GTFA 1Y6NR 4LKXA 5T8IA 4Z8FH 4J4PC 4MNHB 1OARL 3GTNA 3DX0A 1B3JA 2R0KH 2C1PB 3MBWB 1P5UA 3BYTA 3SIKA 3QCUH 3WGUB 1AAJA 1LEGA 2BVOB 4ZOEA 2EEAA 4UTAH 3HVDA 4D0CB 2Y06H 3HFFA 4AEFA 4KZDL 4TN9A 4XO3A 1SRDA 2Z93B 2MQCA 2ARWA 3UAAA 2F53B 3CVIH 4I0PB 2VWEC 1JVKA 3CZNA 5D7IE 3VWKA 2YXFA 2KC0A 3EDEA 3D4CA 4RGNE 1SMDA 1A25A 5FA3A 4FTDA 3SJVD 4ATWA 1QI5A 2BHZA 2HTKC 3W5MA 4ZNCD 4Q6KA 3VXQA 4WV1C 1HSBB 1JFQH 1MCHA 1T1XB 3BAIA 4YWGL 4BIKA 3U82B 1HCYA 2XQBH 3H3KA 4ODSL 5FKPB 2Y07L 3VU1A 2JIXA 1RLWA 1R24B 4JMNA 5CR8A 3S3SA 3QUGA 2IG2L 4ZFOL 5I23A 1RJZB 3T0XA 1ZSDA 3OZLA 1A1OB 4NNXA 3DXAB 2HSIA 2EIZB 4XBEH 4AM0Q 5ABZA 3L3JA 4X4ME 3VGBA 4GQRA 4DP2X 3IAGC 1F1AA 5ALCH 2J25A 1AFVH 1QSFA 4QXGH 3MOBH 3PJNA 3V6ZA 4PS4H 4LPCA 4W81A 4AYDC 3EJPA 4HBCL 2UYLA 1S7QA 1PCXA 1QSEE 4BZ1A 3O4OC 4JO5A 1TQUA 5CU9A 2DN7A 3BH8B 3CFCH 4FEMA 1M2OA 1QACA 3HC4H 4IU2A 4ZFZB 2H6PA 2JJTA 4Z3JA 3LEYH 1X5IA 4HOWA 5FUCC 1Q9OA 2B1OA 4NP4L 3RJOA 2Z92B 1CICD 1UZ8A 2XZAH 2GSIB 1NCHA 1KB5H 1KXHA 2NX5B 4PJ5E 1H3VA 3C5ZA 5ACMA 3P73A 2VSCA 1S5HB 4AQ1C 4PJ5D 4U1IB 4F2MB 3W37A 2BVTA 2AC0A 4G43B 4ODWA 1TQWA 1R3KA 4PJDA 5IVZA 3ZRCC 4CVXA 2Y0SA 3QI9A 1B4RA 2Q2LA 5EHFA 3LRHA 1S7TB 1H3PH 2QEJA 2GT9B 4QXTA 4FRWA 2Q5BA 2ADJA 4LLMB 5C3IA 2DWTA 4AGOA 3IN0A 3TO4D 3O11B 1CFNA 1A6WL 1L6XA 1S4IA 1TCMA 5JIIA 1JPGB 3BFOA 1EHNA 1TJHL 3K0YA 1XGQB 1YAZA 2VCOA 5D7LD 4NO5B 4BGLA 5KOMC 4EDXA 2PWDA 1ANUA 1JNLH 4PJEB 1HL5A 3S37X 3VACA 1HNFA 3X3GL 4FMVA 5FHBH 4MJ6A 2X6MA 2EE0A 5JIPA 3RTQB 4UQ3B 1G0YR 5IEKB 3ULVC 2VE6A 5CEZE 3F6JA 3PWVA 2ADFL 1WWBX 3MMEB 2JCWA 2Y1YA 3FONA 2YD0A 2DOCA 3RA7L 5BVJA 3IKCB 4HGKC 4KK9C 4MA1B 4KXZH 5SV4A 2LAGB 1X5GA 2FBJH 4BZ1H 1MRCL 2F18A 2UWEF 2Q7NA 4HMDA 5DC0A 1ZLWK 4EF3A 1DJIA 4DERA 1FVEA 1PY4A 4ANUA 3D39D 1KZYA 4ZMWA 1OM9A 3UZVB 1JP5A 1QSFE 2JJUA 3IETB 4Z1PA 5T3ZE 5ITFA 5FB8A 3NP4A 4FTVE 3X11B 1AI1H 1EH9A 1U3HA 2HVBA 4JE4B 4J8QA 2LFGA 2GB2A 3DGCR 1OLZA 5FCUL 4FA7B 5LO7A 3HNSL 4OZFH 4P46B 4XXDA 2K9UA 1G9NH 3AU0A 4XVUD 4V2BA 3Q1SH 4A7SA 1RUMH 1NC2B 4OIFA 3TIDB 4FXKC 4HWEH 1GAFL 5JW3H 3VFTA 4HMCA 4P05A 1CDUA 2P42B 2I07A 2P5WD 5SX4H 3AG2B 3V10A 3S4SA 1N6QL 3G5WA 1MF2L 4W9FC 3BGFB 2D7OA 4XNUL 1N3NA 3GSUA 1BMWA 3P4MA 4FLHA 1S7RB 4M1GL 2GC7C 5FGCB 5DJAB 3MJ6A 4UTBH 5CFHA 4JZOB 1DBAH 1U95A 3LN4B 4RZCB 5KYWB 1EMTH 5L4IA 1J5IA 4GW1B 4KZCA 2GAZB 5T1JA 4NUPA 4XCEB 4QHMA 3T9WA 3ZE2F 5J9PA 2F54A 1THAA 4KVNL 3SDXE 1VJSA 3SE8L 3WELA 2AKRB 3FQUA 1KBPA 1N6QH 1ONQB 1F02I 3ZGHA 3UBHA 5C2UB 4NZDA 4OIIL 4LP5A 4GUPB 3QEQD 1GJIA 1IGML 4N8UA 4UF7C 5LCVA 4EI5C 3EDFA 2ZKMX 1BQLH 3QIWD 5AUMB 2IAMD 3NFPB 4LLDA 3PUCA 3QDGE 4EN2A 4LLYB 2VXUL 3PIQA 5DYOA 5HYFA 1HE8A 1J1OH 1A4KB 4RFEA 2IGFH 3BHBB 4XP1L 2NW3B 1ZS8A 4DFIA 1E27A 4PLNC 1U3HD 4RGNC 3HE6D 2AJXL 1UQSA 2IC2A 4L5FL 4OKVA 1N68A 4LCWD 2QFRA 5DJ6A 4QTIL 3G5XA 5FK9A 4GAAA 4HLJA 4JG5A 4U1KB 5AW6B 4DCQB 1CU4L 2R69L 4WZ9A 4XPTL 5K9QG 2VZUA 4Q2ZA 2G60L 1PLGL 5E99H 4ZZFA 4BZ1L 4PLJD 3ARPA 1EHXA 4C56B 3RZCB 3UMNA 4M1DL 1IBGL 5FEBA 2X7LB 3MFGB 2D73A 1BPLB 4P5TC 3ZHLA 3TZVC 4QO1B 5KVEE 2X7LA 3K1KC 4OD2B 1R3IL 3X12B 5I6XB 4QT5B 1MWOA 1T2JA 4FTVD 3K6SB 1J8HB 2R8SH 3SBPA 1ZE3C 3P3UA 4M5SA 3WHE1 5J1SC 4LFHG 1KTRL 1MH5B 2DLTA 3VVVA 1YLBB 3ZE1F 1HK6A 3SY0B 2P4AB 2DQHH 1GZPA 5I1HH 2X89D 1OAQL 1RUQL 4OKVB 2WV3A 1TJXA 3RLSA 1TETL 2JB5L 1A6WH 4ZOCA 3CLEH 1DN0B 3VXPB 4NRZA 2NW3A 1CDHA 5T3XH 1CS6A 3SJVE 1SN5A 1NMBL 1ZD6A 2D31B 2P49B 4HS8H 4F27A 1NPNA 1N7ML 4EIBA 4QRPA 1M7XA 3IMTA 4ZZKA 4GRLB 2ITCA 3Q44A 2X1XR 2J1XA 3WENA 3Q2NA 2O6CA 3RHWK 4AEHL 4LEOA 3P4OA 3LKQA 4J6IA 1JRHL 1FAIL 2RR3A 2BNQA 2Q2EB 5K1NA 2H0PA 2MOQA 3MRCB 1PX4A 4HJGB 4PP1D 5T5NG 3UTZB 4XO4A 4IBWA 5CD5D 3EJYC 4PJ9B 1AOZA 3N41F 4IMLA 5FW6A 3L1OL 2WPGA 2XZAL 4IBTA 2LLLA 3MFFB 3WIHH 2GITB 3AB0C 4ZQKA 2RD0A 3S5ZA 1FQ9C 3ZDYE 4HSCX 5D93C 2ZP0T 1ZTXH 5I74C 5ICZA 4PMEA 4TUUA 5GGSB 1KULA 4H1LG 2GK0A 1KJ2A 4WTWA 5IBLD 5ELIA 3FTYA 1XF1A 4TUOB 1H15A 2O6DA 3T2PA 2K1MA 1D5MA 4MA3B 1JYXA 5DD5L 1G7HA 1EJOL 4Y16B 4E0RA 4JKWA 4WO4A 4XN7A 1NH6A 4G72B 5AZUA 5E2WH 3F7QA 5C97A 4KAQL 4XNZC 2APXA 3Q2WA 1E6OL 2XVGA 2AERT 2GJ6D 5CWSB 1P9MC 2RQ8A 2X3CA 4JZJB 1UCTA 1FJ1A 3ZQ9A 4ZTOL 1BXXA 3EBIA 5EU4B 1OAJA 4JZNA 4ZX6A 2IPKA 1KBGH 3FHEA 1AO7E 4NKMA 1ZTMA 3GTVA 4N0YL 3WNIA 4L1HA 4WEUD 5IV2B 2FECL 2IDSA 4L1SA 4PRNB 1T5WB 3CX2A 1B4JH 3STBA 2QELA 2H2SC 4EXKA 1RZKC 2GJRA 3FUFA 4FQ1H 3EH3B 2EDRA 2OSLA 4AMKL 4NRYA 3REWB 1KCUH 4P2OB 3B9KD 4JKKA 3HG3A 4I0CC 4I88A 4XCCL 3IDJA 3HN3A 3D50A 4GXUN 1I8MA 2EDBA 2W38A 3H9SA 3FT0A 3DYMA 2AJZA 5J6SA 2JKIS 3VXUA 2CJUH 2VLME 4NJAH 4AQOA 3IJ8A 4PWGA 5KUKA 4MCZB 5D7KE 3VFSB 4B9PA 1AKJA 3RTQA 2NUTB 1RMFH 7PAZA 4F7TA 2XWBB 5C0ND 2HLAA 3BP5B 1BOYA 3SOTA 1D3CA 1MREH 1XIWC 2ZCKH 3C9NA 1II4E 4QHLB 4FABL 1SJMA 4XNZB 4KVCH 3OHMB 4LASL 4ZXBD 4P9ML 4XZUA 2Y7OA 3HAEG 1ZHLA 2X4TB 4Y5YC 2NSMA 4NT6A 4N86A 1LGVA 1WE5A 4JRXD 3U1QA 1DQIA 3UMTA 5FLVA 3W1ZA 3L4YA 2WHVA 4P23A 1WWCA 3VI3B 1ZGLP 4NWUL 4LB8A 3W39A 3BSHA 4YDKL 1M42A 4AEHH 3MJ7A 3P0GB 4TMPA 3D51A 4RMSA 4Q56A 5IQLA 5DFAA 5SWSD 2DW5A 5FO2A 4Y1AD 2P47B 1HHGA 3LQZA 4X6FB 4XOEA 4GW4A 5D93B 5IB4B 4ZFFA 4BFEA 5E6RB 3QO1B 3RY5A 1XH1A 3UIZA 1I3GL 3MLUL 1RY7B 3GI9L 3TBSA 1MI5A 4Y1TA 4LOFA 1I53A 3UGUA 1SY6L 4QKTA 3PNWB 1MPAH 2WQWA 3V52H 3SDAB 1JDCA 4WI2A 3I6KB 5JHAA 4BFIB 5JYLA 3RL1B 5GRJL 4XAKE 1D5ZB 5EBMA 3UTPD 3TOPA 4X7SL 4J1UA 3V0AC 5LBSL 4JNXA 2FJGA 1ZDQA 3FRUB 5HGDB 2VIRA 5T1LA 1A3LH 1OGTA 4N20A 3UAJA 5I0VA 4H0GA 5AW7B 3ARUA 4ZW7A 5C71A 5IR1A 3NABL 5JPMB 3KLDA 2HT4C 1A9BB 3FTXA 1KIRA 2XXFA 5DUPH 3VD4A 1O7DC 4R96A 3O2DH 2C1OA 2R15A 2YEQA 2P28B 3S4SG 4P04A 5EZOL 2CO3A 2CK2A 1OT1A 3DXAA 2Z31C 5FW7A 1SVZA 2W07A 3S35H 3ZL1A 2CLRA 4M7ZC 1WS7A 1Q0EA 2VDQB 1SBSH 1EA9C 1Z9LA 2ZUXA 3QWRA 3IJEA 3FO0H 3GHPA 4L0ZA 3K4AA 1NBZB 5IMOB 3V9EA 3LQAH 1N10A 4OM1L 5HHME 4JPSA 3ECUA 5EO9B 4DGVH 3MXVL 2CBTA 3L81A 5IB4A 1NCOA 2Z7UA 4NZTH 2NY7H 4WWOA 5C08A 1SMAA 2BCMA 2NR6D 4ENEC 4ZO6A 2FO1A 5EFIB 2WCPA 3VXSB 1CO1A 3NA4A 5DUPL 2MSPA 3OKDA 2EEFA 1ZT1B 4M7LH 4UM8B 3AY2A 5CU5A 3PG2A 4LK4A 3RWJB 1QEWB 2B20A 1U9KA 1T3FA 3GIVA 2X12A 2WBXA 1M7DA 2DWXA 3DETC 3RPBA 6PCYA 1COBA 2H3NA 2F53E 3NVQA 1ZLVH 5FPIA 5J3HD 2WZPD 2FBOJ 2HLAB 4ABUA 2P52A 3CHSA 4D8PB 4FQLH 3UG4A 4DP9X 3WO4B 2GTZB 4Y5YB 2FLMA 3MODH 4B6ZA 4XPFL 3BN9D 3LQAC 4RNRA 1HQ4A 2XVLA 5I9QB 3BO8B 2WANA 3EYSL 2O61B 3TVMA 2DMBA 2AABH 1BJMA 5F9AC 2W60B 1R3JB 3MGTB 5K69A 1L5GB 2YFNA 3MGOA 3EJYD 4TLTA 3APDA 3KBFA 5EUOB 4K3JL 2D4FA 3CCHA 3WIHA 1IGFL 3NCMA 2ERJC 3MTXA 4K7FA 2NY1C 1XHHA 4IRSC 4FNTA 2LOEA 1HHHB 5ICXA 3Q1SL 1PS3A 4PJ5A 3HS0C 3P9LA 4GKNA 5D2NC 1CUOA 2X38A 1QTSA 4BE5A 4X8JB 4DP8X 4P2AA 3VXUD 4Y2DB 4XC1L 5L0QB 4KPHL 3M6DA 4KJQD 1OT2A 4A1RA 4NN7B 4NQDB 1RMFL 3NJIA 3SCMA 2WGXA 5F7UA 3GMQA 4HJIA 1R19A 2QSTA 5DZPA 3C12A 1L9NA 3M7FB 2L7EA 4NQTA 2VDLB 5FOBB 4Z3FA 2PUQT 4G2AA 2IOOA 3RA7H 4CKVX 1PSKH 4TUOA 2Y2WA 1F4XH 4XCCH 4XBEL 3ZHFA 1WJ3A 1Z32X 2PXYD 4CAGA 1KLFB 5EPMB 5ESVB 4ENZA 4L37A 2E76C 3F7VB 3VWKC 4E9VA 2XVKA 5CGYC 2H2PD 1EX0A 2DJSA 1DO5A 2FO8A 2EYRA 4ZDHA 3DIVA 4P4KA 1OSPL 3RNKA 5DGQA 4PP2A 2FX8H 3KYMA 1OAYL 1J10A 3AAZB 2CCLA 4BXSV 3D25A 1HEHC 1EFXD 12E8L 1KPVA 3NFSL 4JREB 2UXTA 3WS6A 2EDMA 3NJVA 4YH6A 1QBML 1EJ8A 1PZ2A 4PD4K 3OB8A 3KXFD 2CZNA 5T5FL 5DRWA 2WUCH 2JLLA 4JFFD 5E2TH 2BINA 3VX0A 1MHPL 3BPCA 3E0GA 2WTRB 4ZPTB 1T66C 2FQDA 1FNGA 1E7VA 1TEGA 3L2MA 4F8TA 2XOTA 5KSVA 3HC0A 1Q9LA 3B34A 2XZZA 4K9EL 5DK0B 5FA4A 1QR4A 5FF6A 4L4JA 3S8FB 1NAMH 4WO4C 1BG9A 3N42B 1KTKE 2O5XL 2V5SA 3U2SB 4MDRA 2GCYB 1GIGL 3QXWA 1J88A 1CIDA 3GNMH 1QNZL 4YMPA 4AM0A 4P59L 2W9EH 3BJLA 2KDGA 3B4NA 3D7PA 3L95B 4U1LB 5TF1H 2ICEA 1AXTH 1U8QA 3RZCA 1IKFH 4GQ9L 5KSVB 4KV5E 1RURL 1A21A 1PMYA 1QEXA 4YHIB 2FZ3B 2VXSL 3K4ZA 4HPYL 4ALAH 3ECBA 2FATL 1J0KA 4YHLH 4DKFH 3HN8A 1HQ4B 1I1RA 2P1YA 1QYGH 3O4OB 5B21A 2J6EH 1HE7A 3H2QA 1JRHI 1MVYA 1UQSB 3N85H 4HT1H 2O93L 1OGAB 2NY3D 2GPZA 3VI3F 1AD0B 3EGXB 5AVXB 4PYGA 2BOBA 3K6IA 3QFDB 4HEME 1ZY9A 1EPFA 2VR3A 3NCJL 1LO0L 2RB8A 4JFHE 3GMRB 3QUMB 2JIXD 2OS7A 3K5SA 3VMNA 4GKZA 4IKIA 1KEML 3VH8A 4A2MA 1BD2A 2VKWA 5I8KL 5JO5B 1VFAA 1H3GA 3MAWA 2WXGA 2YBRA 3D2TA 4K8RH 1QLFB 2BFGA 3FNKA 1CJYA 4CDHA 3GSNH 4KKRA 4B9CA 1FE8L 5EA0L 3VA6A 4M5YL 4FFWC 4EBQL 4HPHA 2P8LB 5CHNA 4JS7A 2BS8A 1WZ1H 2D3VA 5IMOA 4D9LL 5C8JA 1UURA 2F54E 3LJ3A 2A9BA 3AWGA 3QHFH 4OCWL 5BQDA 2YSSB 2DBLL 25C8L 3FOMA 5F9WC 3ZHKA 5GISH 1TR7A 3ATEA 2DQDH 1OB0A 1WBYB 3MA7B 4G6FD 4YFLI 2ZXAA 3DETD 5DHVA 4AVJA 3X3FH 1IIKA 5AOZA 5MERA 4LVOC 5DURB 1Z5YD 5AVRB 1T5XB 1KTCA 3U30B 2CGRH 4DPCX 2GIYA 3LIUA 3DMMA 2L7JA 2W92A 5D6DA 2AMGA 1AR1B 1SDAB 1GL4B 2JKLA 4MD4B 4K71B 3EYVA 4N0FA 3KLAA 5DEFB 2HYMA 3KBHE 1DBKL 4KO9A 5KW9L 1EMTL 3CHRA 2WP3O 5CZVL 1HJCA 4RSYA 2DBJA 4WGKA 3EO9H 1G6VK 4XVJL 5I1GH 2UZIH 2YAOA 3JV5A 4MS8D 3LNDA 2XWCA 2A83B 1F41A 5IFJA 2YPVH 1NPUA 3KH4A 4BEIA 4ZODA 4FXTA 3MLXL 5IROC 1ML0A 2HFFB 3ARGD 1P1ZB 3S8WA 3SCMC 1BD2E 1I9IL 4QEGA 3KLQA 4OT1L 3US1A 2R56L 1HZLA 1RUML 4QAMB 4HULB 5IESL 2XC8A 1HNGA 4MA1C 3U2SA 5C9KA 3E3QE 2ZUYA 4NI3A 4QF1A 1G9NL 1CQYA 1I8IB 2WLHA 3H53A 5GISL 2FQGA 4IMKA 1ILSA 1R5IA 2K3HA 3FB8A 1YNKL 2F7IA 1NDTA 3FULA 5EBLA 1TITA 2P5PA 4W9DC 4UOJA 4JY5L 4AQ8A 2ZOKA 1SJVA 4G3YL 1NBZA 4ZXBC 3F01A 4DEPB 3QJUB 3U7AA 3DX8A 2A99A 3NIGB 3V4PB 1N12A 1U3YA 2GW5A 5AEAA 4KKAD 1R3HB 1FE8H 4H20H 4KKPA 4XNMA 3FMGH 3O6LL 2J7LA 4J6RH 4LGSB 2D9CA 4ABWA 1KF9B 4HIQA 1JXDA 4PTUB 4W9GC 3SODB 1PYWB 4BFRA 1RULH 3NTCL 3ROLB 4NPJA 1IE5A 3RVWC 1MCIA 1OAZH 4LHUG 3CZGA 4X7SH 4YHMH 1MZYA 3OR6B 4BK8A 1F90H 3ILPB 2B16A 1CF8H 3KLKA 5L88H 1WF5A 3ZE0E 4YVUA 4PJFA 3EGXA 3UABA 2HWZH 3P3RA 3LPFA 1HWHB 3BFWA 5EUKA 1FBIH 4JFSA 2AK4B 1O9VA 1QYGL 1FJ1B 4MCNA 2Y22A 5I1JL 3GWJA 2FWOA 5E9NA 1RK1B 2YAHA 3D2UD 1EEQA 5E5RB 3TA3D 1MFVA 2JI3A 3QO1A 1A4JA 1L9OA 2C3VA 3MX0A 4JHBA 5GRUL 7PCYA 2VQTA 1DEDA 4BUQA 1IC5L 3OTTA 3FZUD 4H26B 4Q58C 4UV4H 4WI0B 4JO3L 1ZA3B 3NPSB 5EOTA 3W11C 3L6FB 3VFNB 3DDFA 4CVWA 1CG9B 3V6FB 2CGZA 3IU4L 4EZMA 4OV5B 2FHFA 2WSPA 1Q4NX 3MCLL 3NIFB 5F89B 3ZDZE 2BIOA 4B96A 3QI9C 1J48A 4QPEA 3RWCA 1NLBH 1YEDA 2E74C 4H8PA 3GSRA 3FTWA 5CFAA 3LS5H 4LEOB 4K3DH 3K81A 3T8MA 3ES6A 1TQVA 2BJMH 5BXFA 1WG3A 3B8YA 4BZ2L 4EUPG 2XZQH 2F8IA 4LPUA 1UXMA 2BVYA 4RBPK 5DFTA 5JA8B 4O2EA 1USQA 4RX4A 2VQ4A 5C0GA 1XSJA 1ZWIA 3I9PA 3SE4C 3KCPA 1NIDA 3BVNA 2VDNB 4Z0XA 3L5IA 1B4JL 2OPCA 4PCKA 2Y7NA 1K4CB 3HR6A 3D69A 4IEFB 2I27N 3CN4A 2X2HA 4QJ4B 1X5HA 1LDSA 1FIGL 5ADOL 1WBXA 4Z78B 1T5WA 3D85D 4LSSH 5ENWA 3RG1C 3SGJA 1JERA 2P8MB 3BP4B 3RRQA 1UM6H 3SQBA 1OVZA 4D94A 3T04D 1IGJB 3NZSA 3KPRD 1BZ7B 3EOAA 1LQSR 3L1EA 1FLRH 1ZIAA 2VERA 3DMMC 5F1IA 2BHUA 3SDYL 4G7VH 4BH7A 2XI9A 4S0HA 4MJJA 1AGBB 3UCQA 1UASA 4LNRB 5G5DB 3US0A 2EVFA 5IB2A 1EHLL 2BMKA 1UM4L 2EUVA 2BW4A 1BBJB 4N4YB 4IRSB 4Y16A 2MOGA 4AH2A 5KSUB 4DCQA 3W9DB 2NXZB 4AIZA 4BQ6A 4Y8DC 5L2KB 1OARH 3N1QC 3QJTB 1E6JL 4XN1A 5EUKB 3QDJA 3TEUA 3NCEB 1HZHH 2Q7YA 3S34L 2WLNA 5C0BD 1FO0A 2HKHL 1TQBC 1EAOA 3BPLC 3ULVH 3ESNA 3KL5A 4AGQA 3WO4C 1Y6KR 2VIRB 3PL6C 4R2GC 1JZ7A 4PREB 1C5DB 4JLRB 4OFIA 4GUPA 3O6MH 3IN2A 2MRYA 2CJTA 2UY6A 5CIPH 5LG6A 2A6IB 4A2DA 1KB5A 4X6EB 3RL1A 4IDJH 1RUKH 1I1AD 2CE6A 4FNSA 1NMBH 2ITCB 5H2BA 1HHIB 2F54B 4PY7B 2KLRA 3TA4D 2EVGA 3PPSA 3MNVB 3UEQA 3P3SA 4FQ2H 1GGCL 2DD8L 3BT0A 1U95B 3DC0A 4UAOB 5KVFL 1MI5B 2D3JA 5KYXA 3S34H 4IBYA 3I6SA 5I24A 2V17L 5DC9B 4YFLF 2X9WA 4WDIB 2BC4B 2B9BA 3N1PC 1MHCA 5ABDE 1KY7A 1TZ8A 5JHLH 1MCPH 1T7WA 1F90L 2IDCA 4IBVA 3B2PA 4MRBA 2L8AA 3CNKA 3LZOA 3FB5B 5E8PB 1BBJA 6TAAA 3S88L 3LY6A 3QEGL 3NZ8B 1R75A 1A5FH 4WU5B 1LVEA 2B0SH 2BSSB 3DK2A 4PJ8B 4QAWA 1E8WA 1IBGH 2WTPA 1D6VL 1X9UA 4P23B 4D8OA 3M17A 1BQSA 4NHUB 1KB9K 1U3HC 2PO6D 4RGND 4Q4IA 5CLYA 1BFOA 1IC7L 4YHNA 2KDYA 3TN0A 3ARDA 4G42A 1PD0A 4NX0A 4WTQA 3JUYA 2I60L 4P06A 2R69H 4QHLA 5LB1A 3O8XA 4NQSA 2P9RA 3FQTB 4JY5H 3VI4A 1JVOA 1UXWB 1XF4B 2ZOLA 2YGQA 3D1MC 4MVBC 5E4OA 4GIOA 4WFEE 5IM7B 5I0ZA 3RVTC 5IP4A 1W9XA 1GYVA 2PW1A 3CDGA 1JGVL 5B38G 2LAAA 2YRZA 5C0CA 4UOZA 2Z4TA 1I8LC 1LNUB 3A24A 3HMXH 1T2QL 5FK9B 4HUVA 5MEQB 4NZ8A 1S9YB 3HUJF 1MDAA 2K6ZA 3TT3L 1ZS8B 2EABA 3KYNB 3PUUA 3FH5A 3GZQA 3CBKB 4PJGF 3N50A 3UTSE 5FUCE 3VJ6A 2NSQA 3PJLA 5TGBA 4FERA 2ZWLT 5C70A 2WO4A 1ADWA 2YA0A 2BZDA 3FRUA 3WV0A 4EKJA 4ECNA 1I3VA 4FJYA 3NK4A 1TJGL 3GUTA 3LS5L 2CO2A 5AVWB 1E4XI 3QIWA 4MMXA 5AOKA 1J1XL 4LLAA 3DIFB 1FFPB 3I6KA 1TLMA 3MO1A 3L4TA 4H40A 3SZ6A 3SBWA 3U9WA 5ACZB 2RACA 1XGUB 1MJ7L 2WLMA 4W4OC 4ZOBA 3V95A 1G1OA 3ZYZA 1YDPA 4PLKC 1I3GH 3N04A 3T3PE 3CZKA 4P9HL 2EXYC 4E42A 4KY2A 2C3GA 2FEDC 3LQZB 4X6FA 3S5LA 3IF1B 1IC5H 1HOCA 4H13C 3FJTA 4R90H 3T4AC 5E6YA 4RLDA 1HVXA 3O45B 4BKLA 2PPFA 1E9OA 4Z7WF 3UJTL 4L4TE 4NWUH 3B9KA 2ZOWA 4KJPD 3VI3A 1NCWH 1XGUA 5E7BA 5FDWA 2ED6A 1NBQA 2VLJE 2OR8A 4J3UA 2XSKA 2MCAA 3PGDB 3MXWL 4YSRA 2P80D 1NGQL 1IAMA 2JTYA 2OTUA 4GP8B 1MCDA 2GQHA 4P2QA 1ADQA 2EEDA 3HG1A 3DK0A 4HOZA 4GYBA 4QRRE 4IRJC 2AXJA 4XCFL 1MRDH 2BSRA 5FO8A 4LCYA 2YKKA 4ZSOE 4MLIA 5I30H 1I8UA 1IEBA 2YRLA 5J4MA 4IW4C 3W57A 4GMSL 3MRMA 2WK2A 4X5QA 2AJZB 4XAWH 3BD5A 5C07B 4FQXD 2R1WA 1C5CH 2ZONA 3GFUA 4H0HB 5TPWL 1AMYA 1PZ5B 3LRMA 1JVLA 2QVMA 4FFZH 4DGWC 5C0BE 1ZLUH 2DI8A 3MV7A 4JN2A 32C2A 3NCYP 4NKQB 2YOCA 3SY0A 4YXLL 1HXMA 4U1HA 3FCTA 1DSWA 3JXAA 5DQ9A 3DHPA 1U92B 4B60A 3DYPA 5F88A 2XT1B 4G3YH 4PJBE 4MS6A 4EO5A 1BLIA 1U30A 3TYFB 1I9EA 1N59B 2XTJE 1MLCA 5ETUB 1L9MA 1W0VA 3ALXA 5IQ9A 4AKQA 2P3YA 4NNYA 4YHNB 1A1NA 3GO1H 1A3ZA 2PCPB 5KBDA 1WZKA 3AMLA 4YBHA 1XGQA 4F1ZA 4QHNB 3J8F7 2X4RB 3M86A 3AACA 5TE6H 1GHFH 1YY9C 3I02A 4YOKA 1BFVL 3WEOA 3ILEA 1QABA 2AEQL 2IBZY 2EKSB 3DOSA 4PJ9C 4UU9B 4RMRA 5EIVA 4X5XB 5F3HB 5IZ7A 1AXTL 1PZAA 1MJ8H 3FSWA 3M07A 3QRBA 5GGSY 3RILA 1KBBA 3N9GH 2CSPA 3AW5A 2FSDA 2A6KA 4D0CA 5JNYA 2LU4A 2A9DA 3VRLF 1I1YA 5AYQA 5AW8B 1L0YA 3GRWA 4HWBH 4EI5D 4PD4J 4M7ZB 3SDXB 2Z8RA 4HJ0C 1ED3A 3EO9L 2V9RA 3GMPB 2RA1A 1MJJB 3AU1A 4KO6A 1GC1C 1DBMH 3QUYB 5DD6B 1V3JA 4AEIH 5E51A 2QHRH 4YDLB 4NBZB 4FFYA 1DVTA 1OGAE 4ZUSA 3BKYH 3LPOA 5I15H 5KSBF 1J8RA 1JL8A 3BAEL 1RK0B 4G1EB 2A6DB 1O6SB 2HN7B 2NZ1A 5A7BA 4NNPH 1N7MH 3HBQA 5E23A 1Q0YH 4UM9A 3VFWB 1NL0H 1FCCA 3DI2B 4X80L 3V9CA 5J13B 2ALWA 5D4QA 4Y4FD 5DHVB 1WFTA 5EV7A 4B50A 1RU9L 1IFRA 2EVHA 1U21A 4M3HA 4RMTA 1E4XH 1R17A 4F2EA 1XMWA 1LMIA 3LZQA 4HZ1A 3LIZH 1ACCA 4OZIE 1AO7A 3GXFA 1MIEL 5EC2B 5AWNL 5D7HA 5TE4L 4LMQI 1B2YA 2OMUB 3SGEH 4OCYL 3CDCA 1P2CB 1WO2A 4UT7H 2J12B 2N4IA 3DX6A 3WSQL 2R69A 3X1FA 3RNQA 3RVXD 5HI3D 5EU6D 1LEIB 1EXUA 3CFMA 2QV4A 3CHOA 1W8OA 1V7ML 3Q5YA 1Y1DA 1XCWA 4RISH 1I8KB 5IVNA 3W56A 1GPOH 1QBLL 5FIEA 2FR4A 1LMKA 3AU1B 3UO8B 5JW5A 2Z93A 3U0TA 4Y5VA 4WGWB 4HFUL 4Y2OA 3MNWB 3H0TA 1FL6B 2G4GA 1SLVA 1XIWB 1SXBA 2BOBB 2VW7A 3T2LA 4BYHA 3ZPDA 1XIWA 3D3VE 1NCWL 3ELQA 1ETB1 1XGYH 3LRKA 5DJZB 2J6EL 1UFGA 2QFPA 4LLDB 1SYVA 3FDWA 4I89A 1DE4B 4OV6F 5BXFB 1CZ8L 3QWQB 3HG1D 5L8JB 4AVKA 3QRGH 4OIIH 2JF1A 2ZOOA 4P4RB 1OF2B 1X5MA 3SCMD 4JQIA 2QL1A 1XGPA 2XN9B 5I16B 5I73C 2MCPL 4FZ8H 1KDIA 5EULV 3OKEB 4KOBA 3DX7A 5DD1L 2HX7A 1SN2A 1U8CB 3SE3C 4X4XB 4QRQB 5CP7B 3N43B 3FQYA 5HTSA 2DF3A 4D0DA 4HCFA 4P3CH 4UQCA 4M29A 2AVFA 4UUJB 3MNZA 2Z65C 4YBQC 3VGDA 5F1SA 4PBXA 4U1JA 2FJFB 3DURB 4AW4A 4YNYB 5DJ0B 3QR1A 2WTOA 4OTXL 3S0PA 5C0FA 4R4FL 5I18L 5D5ME 3NIDE 2HJKA 3SY6A 5K9JL 3QUXC 3MCG1 3UO1H 1BD2D 1RSYA 5F44A 1EBPA 3UTSA 4QYAA 1TU2B 5TD4A 3DX9A 3FC8A 5DWUH 4XWOC 1NCGA 3L5XL 3SGEI 2NX5A 4BRJA 2Q6WB 1PAZA 2ED8A 2WNWA 4V1DA 4J4PA 5BS0D 2XN9D 2FJUB 1RHHA 2XLLA 3F7LA 2OULB 2ZUQC 3O3BB 4JGUA 4KJQC 3W2DL 5BO1H 3ULUE 2ZWYA 5C7XL 5MEPA 1WA1X 4BZYA 3MRIA 4LEXH 1BJ8A 3HG1B 3N40F 1EO8L 2FX9L 1SY6A 2I9LA 3CN0A 4OGYL 2OX5A 3MVSA 2X70A 2QR0A 3O4LB 4M5TA 1JNHB 1HEJC 1YPZA 3ZTNH 4GY4A 5L7XL 2G9KA 3CFKA 3MJ9H 5J8OA 5HDOA 3IB4A 4I9WE 1VGKA 4MJIB 3KLSA 5GQBA 1NGPH 3FCUB 3M1BA 3F62A 3OG4B 1C12A 4FFZL 4AVHA 4ICWA 3WJLA 3UERA 3CXHK 3IFPB 2IQAA 1HHGB 3F58H 3N5AA 1A3LL 1HL8A 2DRUA 3PWVB 4BA0A 4MAUH 1MCOL 4L4TA 4WVRA 3PP3H 3BP7A 3TT1L 4K73A 4NM8H 4AYMC 1G9EA 1KGWA 5DZVA 4HUNB 4GFTB 3W39B 4JAMA 4XO9A 5EU6B 1KYOK 2YGVA 2RGSA 3BEVA 2EDQA 2ZX7A 3RY6C 4AQAB 3MO1B 1YY9D 4L8CB 1NFIA 1Q90A 1HINH 3ETSA 4G6AD 5TFSL 2F08A 2CM6A 1YMMA 2VM3A 3RB5A 2E46A 4J39A 3WMSA 1S7XA 1SVCP 2HJLB 4JKLA 4LLMA 3UIYA 3MRDA 4NQED 1IM3D 3RZCC 2Q6WA 1AACA 1P5VA 3FF8A 1JZ3A 4YZWA 1XH2A 3QG6B 1NGWB 4EOWH 4OIBA 4YHKH 3PAUA 4NXKA 4OZGE 5J6GA 5HPOA 1MHEA 2CM5A 1FWXA 1KB5L 2YD3A 4YDIL 5AVSB 2BLFA 3ZT5A 1UZ8B 2Q3ZA 2XICA 4W1TA 4RWHA 4XOCA 1UVQA 5FFGA 1QFHA 1NAKL 1CFVH 1Q1JH 2H6PB 4RETB 3HS8A 1J18A 3FOLB 1CIUA 3IJ9A 3QUYD 4Y4HC 1CT8B 1JXJA 3H2PA 1NINA 4JUSA 4DGIL 5EEWA 4MJ4A 3UXFA 4XVTL 3H9YA 2ZSWA 3T0VA 3GIZH 4P5KB 3ALWA 1AFVL 3ZRFC 4AL8H 1PZDA 4EI5B 4K94C 3M17B 4NHUA 5I19L 4MRCA 4BHUA 1IC4L 4M7KH 2H1PL 4LSUH 2PLTA 4PG9B 3RWJA 2W95A 3H9HB 3ABGA 4WV1B 1XCTA 4P2CG 3QR0A 1CTOA 4E0RB 1K4DB 3OLIA 5BZWB 1DQJA 3BKMH 3FO2A 3HLKA 4WKZA 5CIPA 3V8OA 2CK0H 1RJZA 4OB5H 4I0PC 1TZGH 4QMEA 4B95C 4K15A 4LHQB 2HZHA 2WGNB 5F3FA 3JZYA 4XWGH 5JDJA 3O8XD 3IMUA 3EH5B 3MLPA 3CVHH 5ICZB 5EO1A 3VB9A 4DJMA 1S7WB 1VFBB 3B3BA 4FG6D 3LEVH 3BVVA 4YLBA 4RH4A 3ROOA 5LGYA 1UOKA 2YGNA 1FI8C 3IT8D 2V0AA 1Q72L 3ULUD 2I60H 3GRGA 5TQ0L 2FYYA 4NERA 4BCZA 3KPSE 2UVFA 1UD4A 3P4OB 4OJDH 2R0LL 3MREB 1QFWH 5BZZA 1FZMA 1YMME 5IQ7H 5HYSA 3BZEA 5DJXA 1OP5H 4FA6A 4HU2A 2QMKA 2QVTA 4Z95L 2XUWA 2ZXBA 5C07D 4ERSL 5JHDD 3UZQA 1RZJH 2E59A 4AQEA 1FZKA 4BZ2A 2AANA 1GGIH 1A8ZA 2YXVA 4MNHA 4CC0A 4M6OH 2QVKA 5D2NA 5EORH 3H4FA 1KPUB 4DTGL 3O41B 4P3CL 4HSAC 4D0BA 2I24N 4Q0XL 4IRSA 5I0YA 2Y9RT 4YSQA 3RFZA 1X44A 3Q8BA 2WZ5A 2GK2A 1OP3H 3O6FD 1J5DA 4EN3D 1EEZB 2YWZA 3X12A 3HR5A 2XA3A 1MW1A 1U8QB 4IDJL 3V5KB 2VQUA 5F1IB 3T1WA 5D1ZB 3D39A 1NKOA 3QCVH 1AIZA 3TN0B 2VZTA 1F3DH 2A6DA 2HN7A 3LAFA 3X1EA 3SQBB 1UYWL 2A1WH 4V11A 2Y5QA 5HDBE 5B4MC 4NWTH 3GHEL 4N6RA 5FYKE 3UCRA 2VL4A 3CSBA 2EDKA 3CQPA 5DJCB 4PRID 3DTXA 1VGEL 3KG5A 1PW3A 3EYOB 4YL4A 4AV4A 1OANA 4PJCE 4ALAC 5AG8A 5FR3A 1EZSA 3BWAB 2HKFL 3T0BA 4ZPTA 1JF6A 2DMGA 3C2AL 4ODHL 4GW5B 6PAZA 1S78C 5D1QB 1U2HA 2YWYA 1NLDL 2V5MA 1B0GB 5DJYA 4ODTL 3UZEA 4Q9QL 1LWRA 1YEKL 4B9KC 3GXTA 5K33A 4X50A 1YNLL 1F97A 4XCYB 5F3HA 4OR1A 2BIIA 2WVVA 2V5YA 4PJEE 1TUPA 1RUAL 4GBXD 3T4AB 4IHOB 3D25B 3SBQA 3I02B 1YEDB 2QADB 4ES8A 4ZO9A 5L4FA 2ED9A 4FYTA 3ZYIA 2OAAA 1RPQA 3S8GB 1ASPA 5CZRA 1QQDB 1FGVH 5EOQH 4ELME 4I77L 4RRPG 1YYML 2FX7L 4P5MA 1E28A 4YGVA 1OWWA 1DL7L 4A39A 4HJ0D 2K6YA 2VAAA 2FYVA 2ZNWA 3ARBD 4JZNB 2UZYB 1YYLL 2OCCB 3TPUA 3VI4F 4L9LC 1FFRA 4YGAB 1D5XA 3VXRE 3NSDA 2CDEB 2EDOA 1GJUA 3HHRB 4JPWL 3CK0L 4PN6A 5I17B 1FNLA 3UJIH 3R19A 3KD4A 1F3RB 1R6VA 4DP7X 3BAWA 1PEZA 4GBXB 1NC2A 1GZQB 3QEQA 4PG2A 4AL8L 3BUTA 2I26N 3CWGA 4AYBA 2GBVA 5IVXE 1BZ7A 1J1PH 2Z0BA 2YQGA 3OWRA 4PJ8D 5D7EA 1VKXB 1DJSA 1XGTA 3NK3A 3N0AA 4EZLA 2P8MA 3BE1L 5IQOA 1YN6B 3GD1C 5D1QD 4ZS7L 3GSOB 4X0KB 5HY9A 3EH4B 2VR4A 3OC8A 4TQHA 1V5JA 4PV9B 4TNEA 3L1OH 4XXWA 2JWYA 4OBRA 2CKBL 5D70L 4NZRL 2A7BA 4HU8A 4UTBA 4ZK8A 3RPKA 3AGWA 5IIEB 4EOWL 2G9HA 1LJMA 1JV5A 2GBAA 5FAAA 2R4SL 2F54D 4PRAB 1SFHA 2DL2A 5L8LB 4CNIB 1HZKA 4P23C 2H8PA 3N06B 2X4OA 4J3OC 2GTZA 4Y5YA 5D1ZD 3QJHB 3CZSA 3W0WA 4NM4L 2B5IC 4EN3B 3ULAB 3DTUB 2HWZL 5DVLA 1BGXL 3IGFA 5B8CC 4MSWB 4R0LA 1EJFA 1DFBL 3BKJL 4WHYG 4X6BB 3CZJA 1FFPA 3V4VA 1K2DB 1KPRB 3L3IB 4LDLB 5JLZB 4QGTA 4Y19E 3F6IA 4C4KT 3GUTB 3L5HA 3FFCB 1BVKB 3LDBB 1WGVA 1JZ8A 2E7MA 4Y9CA 2R59A 2HLEB 2FQFA 4NO3B 3S3BB 1WH0A 2EIDA 5L9DL 4AYFB 2F6AA 5FHBL 2FD6L 4E9XA 1KYOJ 4H1LA 3TVMC 3NOIA 2F74B 1ASOA 1LO3H 1U8NB 5CCJA 4ONGH 2IFGA 2NR6A 3KPRB 4G6KH 4O02L 2XN0A 1LNUA 2GSIA 4MQXD 3ZIYA 4KFZC 2CLVA 3GSQB 5CINL 3T0DA 5IHHA 1YNKH 2AQQA 5KN5A 4DN4H 5DLML 5F7YC 4M3KB 1EJ6A 1ZEAH 3O8XB 4JW3A 4NQSB 4APQA 1H9VA 3DJZA 4G7QB 1YQ2A 4XB7A 5CN1A 3G5YB 5L6YH 3HE7A 5GGUA 3RL2B 4HIJA 1UJ3B 4XMPH 4HHAB 1VA9A 4FYRA 5KBKA 3F04A 3L3JB 3PWPB 1UM5L 3SD2A 4YAQB 4FQIL 4R6UA 3UJJH 5BZDB 1UJTA 5J9PB 1HDMA 1U8PB 4IYKA 4WJ5B 1JOIA 4XNMB 3D33A 3PNWA 1XX9C 3DHUA 2VGLM 5H35A 1MWAB 3P11H 4JFZL 2VLRD 4MCMA 4PJGA 2ZP8A 4XO8A 4BD4A 1EHKB 3QJRB 3FQ2A 2QPUA 2AJUL 2BWQA 1ZE3H 4PB9L 1PZUB 3W0WE 5B38A 1N9PA 2ZCLH 4R4ND 5BVPL 1QNIA 4WJ5A 3RAJH 4Q6YA 1U58B 1AZNA 2Q20A 3AGVA 1QR1B 5DI8A 3MJ7B 4J3VA 4Z9KB 3HZMA 4IOIB 4OD3L 2VDLH 2ZX9A 5AENA 3C6LA 4XP5L 5E8NB 3KDPB 2V2WA 3MV01 4BHUI 2XJKA 3H2WA 2LV4A 4Y1AA 4JR9L 4DZ8A 4TQEL 4G83A 4JGNA 5DGRA 4YLCA 1A2YA 1GYAA 4NQEB 3D2UB 1F6AA 2H7WA 3FFDA 4Y4KC 4ODXA 4KKNA 2OTPA 5EWIH 3HCVB 3SQOH 3VTMA 1N6VA 2A4ZA 2DBLH 3MBWA 1CR9L 2NY5C 2OMVA 4JL2A 4MASA 3ZTJG 2AK4D 5CSGA 4FG4A 1A7RH 1AI1L 2PXYA 2N7AA 4WIQA 4RDQF 3ECBB 2WWKT 5DO2D 2YN3A 4I5BB 3QR2A 3REWA 1NCAL 4JPKH 3ASNB 3MMEA 4TUKL 3CN2A 2ADFH 3GS7A 2JJTC 4LSPL 4NI6A 3EOAB 2O5YH 35C8L 5E7FA 3VXOA 5I8KH 2BRQA 3E6HB 4KOCA 4CSZA 1E9QB 1G9HA 2R9HD 1MAMH 4MJID 1KPRA 1K2DA 4ABVA 1XR9A 4ETYA 1LO0H 3U36B 1UEYA 4C4KO 4EUPH 3CMGA 1UCBL 1MWAH 4R5VA 4AV0A 4PCYA 4R0LB 1JPGA 1PLCA 3HG0A 5D7IF 2JXMA 3JBG7 2VN7A 1DUYB 4JDTH 4GG6B 3EDJA 1KELH 5LGKA 5EC1B 5FHAH 1FVDA 1MW3A 1HHJB 2XU9A 4GINA 2ADJB 3QEUB 4AZ8B 2ZUUA 2YUXA 4YSSA 1HSAA 1L3NA 3AT0A 4ONHA 1SQMA 2QTVA 3HBGA 1UXLA 3P69A 4U7SA 3REVB 4HUUA 4KO5A 1KPVB 3RGVB 3T0EE 1U0QA 3WXVL 5GXBB 2EJ1A 3GBNH 4JFFA 5A3ID 3QYCA 4L29A 3I2CH 4U6HB 2CXGA 3GMOA 5IB1A 1HCFX 5T1DL 1BD2B 5F3BB 3OGCA 1J9TA 4JBSA 2PCYA 3L5WA 3VXNA 1NICA 1T04A 1NAML 4L8DB 2XFXB 3WTWA 4ZRGA 2R23A 2Z31D 5B39A 2HFTA 2YD8A 1MCJA 1DVFA 2FT6A 4N25A 2VC2L 4L5FE 5LUMA 3II1A 3S3JA 15C8H 4YL9A 5CF3A 1IAKA 2WIIB 5F1NB 4WFFD 3G5ZB 1A7NH 4ZAKB 5KUMA 3KNBA 3LMJL 3I6GB 1KG0B 1PVHA 4NQQA 4U6YA 3FQNA 3QXAA 5E2TL 2H6OA 5IVXB 3ZXAC 2GIXA 2R83A 4KX8A 1AY1L 1RK1A 4OH2A 4R97B 3SCMB 1J11A 5IK3B 4PJHA 2GJZA 4IRJD 5DD0H 4FI6A 4EUPA 5DURD 2FE0A 4OZ4A 4Y9BA 3LEVL 4N2AA 2F8XC 5JORA 1PJ9A 4Y4FA 4QLWA 2N01B 5AOLA 3WY3A 1UZ6F 2A0LC 2ZIDA 4ISVB 3U9UB 2MFNA 3K6DA 2X9XA 3WAKA 1T1XA 2AEIT 3Q2LA 4HAFA 4NQXB 4UQDA 1PCSA 3ECWA 1UH2A 4G59C 1XIWD 4TF4A 5KVGH 2ZWNA 3F7RA 5GPRA 3QFJE 4G5AA 5LG1A 3HC0B 2KS0A 5E08L 3GMOB 5IB1B 1YPZF 4R2GD 5D1XD 1S9VB 4I2XE 4IK7A 1X4ZA 4WNQA 3VGGA 3V4VH 2DV6A 3TWCH 2OFQA 1RD6A 3BPOC 4UT6A 5AL8A 1Y0LB 3E2HB 4ZW5A 2DQ6A 3MV11 4Y5XA 4JN1L 5DJ6B 1AXSA 4GRWH 1TMQA 1CXIA 1RZQA 4D8PA 3SPCA 1E65A 5BRZE 3V7MA 5CXPA 3SDDA 1KXVA 4WHDA 5EEZA 5JHMA 3HE6C 3BDXA 3LPGA 5E1IA 3ME0B 4FX5A 4KU1A 4FQCL 2M2DA 1QRNE 1ZV2A 3EYOA 2VDOH 1K4DA 3ESUF 4MQTB 4QRSA 1HESA 2CO7B 2ATAA 4JO3H 4LCCC 3WEMA 4AX3A 3ZE2B 2DDQL 3APFA 5JXED 1E8XA 4ATTA 3FUIA 3RDTC 5LGHL 3RVWD 1NEZA 1G0DA 2P5EE 4KDWA 3ULUF 1HOEA 3L13A 1BJ1J 1OCZB 1YMHA 2AABL 4OD1H 5HHOB 1JZGA 1ETZB 4MGXA 5SWZB 2BOCB 4CA4A 1DBBL 3IXTA 4ZXBA 1BECA 4H8UA 5I6PA 3V4UH 3DRTB 2HT2C 4PGCB 5E1AB 4XRCA 1ZV5A 1UATA 4GSXA 4HIEB 3PYCA 1PGRB 2DLFL 1A6AB 5J6GB 4KGJA 4JG1H 5LWYH 2WSDA 3QG6A 2NY6C 3IU3A 4MD4A 1URIA 4OGXH 4ZSOA 2YHGA 3QJFA 4MMYA 5E1QA 3ATBA 3MRDB 2VDML 4ZBJA 3OMIB 2PTUA 2QLYA 5ES4B 2MCG1 3CZFB 4H20L 4OF6A 5E94A 4X7TA 4O4YL 3VM7A 1R0AH 4J23A 1R3JA 4J3TA 2VDNL 4M48H 1NFIB 1E43A 4H4NA 1OGPA 5EG6C 4X5PA 4G8EB 2JJVA 3V6OC 5DR5H 1U8HB 3F5WA 3K1DA 4UDTB 1YYMH 2FX7H 3H9SE 3PP3K 1T7ZA 4TRPH 4Z3TA 3FB6A 2G5BB 3FBKA 2H26A 2V3FA 4PHXA 4YK4B 4JPVL 2BOCA 4LEXL 2Z7WA 1KUMA 2WXMA 2PP9A 3TEWA 1LK2A 3ZY7A 3EGSA 2EIEA 2VE6B