3L48A

Crystal structure of the c-terminal domain of the papc usher
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
GKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane usher protein PapC
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 15
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l48A01
3RFZB 3L48A 4J3OD 2XETA 2KT6A
chains in the Genus database with same CATH superfamily
3RPIB 1CBVH 5CUSH 2EIBA 3EAKA 5HGHB 3HI1B 5EC1B 2CIKA 3RGVD 2W0FB 4ABQA 4Y8AA 3BEVA 5FYKD 3W5NA 1JUFA 1XD1A 1NJ9A 4QRPB 3RIAK 3JV4B 5ITBH 3C2AL 2E9GA 4N2NA 2F54A 3HN8A 5JW4M 2OTWA 1QFWL 5HGDB 4DW2L 2VXQA 1HHHA 2W9EH 1VB9A 3EFOA 1MAJA 1A6UL 3EFDH 5HDOA 3THML 4GBXB 1SEBA 1LP9A 3HCVA 4HXAH 5D93B 5A2FA 2R0LH 3FUDA 4KROC 5ILTL 3MXWL 5T5FL 1CE6B 1QO3B 1WUNT 3MA7B 2GJ6D 2WLIB 2YWYA 4ZOBA 4FZEL 3S36X 3BAEL 4F3FB 5EIIA 2ZXQA 2VSMB 5AWNH 3VFNA 4PJ9B 4LCCC 3FQWB 3ULUL 4MNGE 5A16A 3QHZL 1ZVHA 4N85A 3QO1B 1J8RA 4WWPA 2A9NL 2D3NA 4GW5B 4XO3A 5BZWA 3OWRA 1A7OL 2Z64C 3FCSA 2R29L 1VERA 1KB9J 2VZSA 4QOKB 2B16A 1AI1L 1COBA 1WZ1L 2W0LA 3ARDB 1CC3A 1INDH 4LRIC 1ID5I 1P4BL 4NQDA 4IK6A 4H0IA 5KVGE 4J4PD 4LCWD 5AKVA 3I50L 2NDGA 3N04A 3VRJA 1NOFA 1UA6L 4GI9A 5FO2A 4CVUA 3C5ZC 2CM6A 2DTMH 1F3RB 3DUSA 4C4KO 5CZVH 1LEIA 1RURL 4HBCH 1U8HA 4PJGB 1J8KA 3JTTA 2BLFA 4UV4L 4MMXC 5AALA 1A7NH 4F9LA 1JPSH 5E94B 4PYGA 4F37F 4NZRH 2FT6A 3DI3B 1TMCB 3UJTH 3VFPB 5D2NC 1KBBA 2I07A 1R3KA 2BCKA 5KVEE 1M2VB 3BMWA 4KX7A 4N8UA 4BQ9A 4P57A 3VFTB 2V2TA 2F8OA 1IQWH 1OGTA 4OGYL 4ETYA 3BH9B 3LKRA 3F6JA 4AIOA 4I8DA 1TTFA 3D6GA 5DHVH 3CZGA 4O5LH 3VXMA 3GXIA 1IAIM 4ENZA 4N90E 2DEWX 3RIAF 2VM4A 3D3VA 4AIEA 4AWJC 2XWJA 4PJ8C 2Y07L 5DZOA 2J6EL 1KBPA 3KBFA 2A9ML 1XZ0A 4A2DA 5IT2L 3AG3B 4MQ7A 2QBWA 4DVRL 4NJAL 5DD3L 1SDYA 2VDRB 2PKDA 5FR3A 3DBSA 4Q6KA 2FJUB 4K55A 4J3SA 4P5SA 3L81A 5DS8A 1F6LL 2RCSL 1NCNA 4LKCA 5I28A 3MV01 2NNXA 3NZSA 4F8QA 1I7ZA 2EVJA 1CGVA 2VLLA 4YZFE 4Y4HD 4WDIA 3V9CA 5KBKA 3D39E 3O2DH 5HJGA 4BH8A 4LO9A 1IFHL 2H9GA 4K3DH 2DQGH 3CVCA 4O2CB 4P4KB 4Z76A 1FL6B 1OM9A 1HS6A 1MLCB 3B7RL 4HK3N 4N1EA 1IGMH 4JDZB 4QPEA 2PWDA 1FN4B 3ZLQC 2YLHA 3JUYA 3QDJB 4R2GB 1EXUA 3JTSA 4ODSL 3COOA 1AHWA 3CVHB 3FZUD 5C6TH 5GZNC 1CFNA 1BBJB 1PG7W 1ONQB 2BCMA 2VDRL 2ENSA 2VISA 2MFNA 4EPSA 2HFTA 3BWAB 1WGOA 2YPLE 3BGMA 3BH8A 4U1MB 1KTBA 3KDMB 3UJJH 2IOMA 3BYYA 1XF5B 3HVDA 3QC6X 4PGBA 4AMXA 4PD4J 1C5BL 4XX1E 3OZLA 5CR8A 1T2XA 3D4GA 3SCMA 2VAAB 4ZX3A 4NN6C 1HINH 1MRDH 3CFMA 5CEYA 4WI8A 4ABVA 3POHA 3F7PC 3CVHL 1IEBA 3VI3E 4OFYA 1GR7A 2BM3A 3QHTC 3FFDB 4MCYB 1KGJA 4MXWL 1K4DB 3F7YA 3V5DB 5I17A 5KJ4A 1QRNA 5FFOA 4ZXBA 3W57A 1DFBL 3EDEA 3ILEA 4CADA 4GQRA 2CBOA 4AXWB 4JRWA 5F1SA 3IDXH 3TNMA 2WXHA 4FQCH 4BCXA 3IMBA 3NABH 4X4ME 3ZE0E 5I5IA 1KJ2A 3LQMA 3VRLE 4HUVB 3KPSA 4HJUA 5E99L 1R33A 2UXVA 4PJFF 2Z31B 2DQJL 3L3OC 1U36A 5JNYA 2X4SA 4UQ2B 4E68A 1N2RB 1WAEA 1UD8A 4JHWH 1JRHH 1KIPB 2CA3A 4MNGB 3SE9L 1BZQK 2TSBA 4FADA 3US0A 2JSFA 5M94B 4GMTL 4AMKH 2P8LA 3IJ7A 3UZQB 3X1BA 5C07E 3FU6A 4DKEL 5A3ID 5CCJA 4PJCA 3FC8A 4LP8A 2NY6D 1IQDA 1CWVA 1UWXK 3B37A 3JV0A 3AY4A 2OJZH 1XBDA 3WTYA 1CD1A 4YAQB 5E2JA 1QASA 1RMFH 1TETH 5M95B 4OCWL 2J55A 1JWMA 3ZE2F 5EO9A 5E9DA 1BMWA 4MNQA 4YBLB 2DM2A 3EYOB 4NO3B 4IGBA 1JV5A 3L4UA 3EO9L 1FNEB 3LZQA 4GUPA 1HJBC 1ZT1A 5E2WL 1FV1B 2Y72A 4DCQB 4XXDB 5DQJA 4FLRA 4KI5C 2QPSA 1WD8A 3WN5A 3FT4B 4ELKA 1J8HA 3I75A 5ICYB 5AOKA 5D1XE 4NSKB 2NUTA 1F4AA 2BWQA 1DVFC 4N8VG 5I76A 1U58A 3VWJD 4PRHD 4KX8A 3WEAA 1DJYA 2OM5A 2A3TA 2IDSA 4AL8C 4RZCB 1YY8B 4R0LA 2XXCB 3ARBD 4ZMVA 1UKQA 2X44D 4G9FE 4A6YA 5CXPA 1X4YA 1D5BA 2IH3B 3LZFH 1M42A 4X5LA 1FVEB 4G11A 5E6ID 1FNGB 5F7YC 4FFYH 2DBLL 1I1CA 3EYVB 3QI9A 2GTWA 3QJFB 2WNKA 3B8SA 1GGBH 2PXYC 1CFQA 2FHCA 3V4VA 3GM8A 5DD0L 4PFEA 2DM3A 1HOEA 5IVXF 3BX7C 5IHWA 1YEJH 2NLJA 2DWDA 5IOKA 1PMYA 1UUNA 1NGZA 4XRCA 5I18L 1WZMA 1XCTB 2CU9A 5JIIA 4KXCA 2QT6A 1YYML 1ECYA 3NT0A 5E03A 5KVEL 4ZUSB 3ARYA 4H8QA 4MVBD 5IQNA 3WKML 4BFBD 1FE8L 2FCBA 2NXZB 4ZT1A 5T33H 4UBDD 3NCWA 4LCYB 2B2XH 2DQIH 1ITBB 3O0RL 1CMOA 3D39B 3MJ7A 1AD9B 4JPIA 4NZFA 2KH2B 4EQ3A 3CC5B 1A4KA 4O9HH 4BFJA 5SWZA 4I9WE 3D69B 3MNWB 1R46A 1OQXA 2JB5L 1A14L 2C4FT 1MCBA 3UYPA 1CN4A 1Y7VA 1OIOA 2JCCA 2NY3B 3KWXA 3B5TA 4XNUH 1C16A 1ML0A 2XV6B 1E6OL 3PWLB 1PJWA 3LS5H 5GJSH 4ACTA 2WZ5A 2YPLB 4GO6B 2E9BA 5IHZB 2E8ZA 4JHVA 4R4BB 3BXNB 3EOAB 4JFXB 3S34H 2BNRD 3FU7B 4FG6D 3KL5A 1GL4B 3T77A 3FO2B 1KT2B 4XWGL 4DAGH 1DUYA 4JFOB 5L2KE 1FFNB 1F41A 5CBAA 3S37X 2CO6A 4P2OD 3TWCL 3KJ6L 3RA7H 1KXTA 2VB5A 1S9YB 4ZAKA 3TIEA 1IMHC 4TUOA 3VI3B 3ZHKA 3GMLA 4HS3B 1OTSC 4UMGA 4Y7MA 5DJAB 4ZO6A 1YY9D 4AKPA 2LR4A 2WWKO 1JV2B 4XNMA 3PPEA 2BRQA 4IRZL 2ED7A 2VLRE 3CZJA 3D85A 3UTSA 1DQKA 1FSKB 4FFTA 4BKLB 1WS8A 1BAWA 3A6BL 4HWEH 4B7IA 1FF5A 2QQLH 1XF1A 1DEDA 4X99A 3F62A 4DFHA 2P9RA 5L0QB 4ZSOA 3QEQA 3ZE0B 2Z35B 3ZTJG 4OCSH 2X4QB 5IMOA 1YEIL 4AQAA 3B2UD 4H1LA 3S3JA 3UPCA 4NJ9L 4FQLL 4AJVA 3D18B 3P1VA 4AEEA 3ZL4L 3UACA 1AGFA 3NDZE 1D6EA 1VPOL 3E7JA 4PRIE 2HAZA 1UZ6E 1X5JA 5E4EC 5HYJD 1E6JH 2LLGA 3CVDA 3E38A 3VCLB 1REIA 3DGGB 1XR9B 3DYPA 2Q1EA 3HZYB 5C07B 3DSFL 3RL2B 4XMPH 2FK9A 3BCFA 1OZTG 1N8OE 5HP5A 1TQTA 2AABH 3APMA 1OSZB 3F7VA 5IJVB 3OHMB 4MJ4A 4PJCF 1MHHB 2H1XA 1D9KB 2LE9A 2Z8WC 1M6OB 5D2LF 5ESQA 1TYJA 4G80A 3U2JA 4ZMYA 4AM0B 5D9SB 1BXUA 2WCPA 5E8NB 1N5AA 1AAJA 1HH9A 1NAMH 3AREB 1U3ZA 2FBRA 3Q9PA 4NLAA 1X5ZA 3W56A 3KW8A 3S97C 1ADQA 1NPUA 1ZKAA 3CLEH 3W39A 3NPSC 2X9XA 3NGBC 3REVA 2CUAA 3DMMC 1WAAE 2WVUA 5D1XB 1P7KB 3QORB 5HI3C 4Q6IA 2I26N 3CUPA 2F2HA 3ABKB 2KZWA 1VADB 2D3JA 1L9RA 1B0RB 1V3MA 3PS6A 3EH1A 3QPXH 4GRLB 5F9WC 1CFTA 3VVVA 4YLQT 4YHPA 2FJFB 2TRYA 4G9FB 5K9QG 1KYDA 4APQC 5B3JF 3AQYA 3AMKA 3G5YA 4W9KC 1U2YA 3HBGA 3PNWB 2ARJB 4DK6A 3PWPA 2VL4A 2Y5TA 1ZHLA 3TFBA 1EGJA 2VXQH 2X4UA 1IV8A 3UFIA 3H2WA 3PP3K 5T1LD 5IIEA 2HLAB 2FB4L 2ZPKH 2GYSA 4NN5B 4YSQA 3K0YA 4J1UB 1M7UA 4LCUA 3IFLL 1MRCH 4XH2B 2EUZA 4DQAA 2P24A 4LEEA 4WHYH 4B9PA 4NKDA 1G7HB 4WU5B 3R4RA 4MB3A 1M3IA 4TF4A 2XZCH 3F5WB 1YYCA 4OCMC 4DT2A 3VH8B 3HS0B 2EEBA 4PS4H 5C70A 2O4EA 4E41E 2ODHA 5DEFA 2OSWA 1YNKL 5GRVL 4Z95H 4X7FC 4Y5XA 1DR9A 4BK4A 1RZJL 2JTYA 4YPJA 5DMKB 1J0HA 3QDGE 4K73A 4R3SA 5GZOC 5D7KE 2A9AA 4X4KA 4HUXA 3QWNA 4DGIL 3G5VA 3GSQA 5T8IA 3PUUA 3C8KA 4YPGB 4D7PA 3FYEB 4AQEB 2YXVA 1A6PA 4CJ0A 1MZYA 4BZ1L 5BVPH 5EUKB 3O8XC 3ZHFA 1S9WB 3VM5A 3ULVC 5DD6A 5JHLL 5E08L 1F02I 5D7EA 5IFAL 4HQQH 3WY1A 5KANG 2HG5B 4AZ8A 4HT1L 2AK4D 4MYWB 2QSQA 3NZ8B 2WD0A 3DTXA 2PN5A 2BOCB 3D30A 2BVYA 4MJIA 2AGJL 4RAHA 5HGAB 5L2KB 1NIDA 1T1WA 3PP4H 4B60A 4OR1A 4Z7UA 1M2OA 5AVUB 4ZPTB 1MCIA 2XXMB 4JFDD 3N40F 4U6HB 4QJ5B 2HX8A 4YHMH 3NG5A 2DQUH 2D7PA 3WG7B 4YK4C 1FIGH 3BPOB 3AS2A 3TN0A 1KN4H 4L4TD 1S7QB 3UPAA 1GY1A 2MEJB 4Y9BA 4ELME 2VLRB 2FX9L 1UT2A 1XIWD 5CD5C 2H3KA 2ZZUT 2E75C 5D7SL 2G2PA 4HGWA 4UDUB 4LP4A 1A1NB 2F18A 4X7CC 5I0VA 2D2OA 1UH2A 3DX9B 1QWNA 5HHVH 1GJUA 4WFGE 4OGZA 4X6FA 1I1AA 1PZBA 5HD8C 3O3DA 4CL7A 2HVKB 2QLVB 3VI4A 2BP5M 1YRKA 4NT6A 5I6XB 4HJJL 1XB3A 4HS8L 4N2FA 4PRIB 1TPXB 3WJMB 2B1HH 4WIQA 1ZV2A 1IGJB 1Y1DA 2PWGA 4DERA 4UQAA 4F15B 4QLWA 4N2IA 4N4YB 3BPCB 3OLIA 5HHXH 3MRQA 2BINA 4DF9A 1BV8A 2FGWL 4KH9A 4NPKA 1Q9OB 5EZLB 3N0PB 3OHXA 4XMKH 4YS4A 2B3IA 1KOAA 3MGTB 1E8YA 4PHZA 2IPKB 4N0YL 3T2NL 3GBML 4CVWA 3BSZA 3KJ4C 1PS3A 3MRHB 2QQKH 5J1AA 1UXSA 2YUXA 4L8SC 1YCSA 4HXBL 4KROD 4EUPG 5CLZA 4XNYL 4BYHA 3VXRA 1FAIH 1A4AA 4PI0A 2B0SL 3D9AH 3HLAA 4EIGB 1SEQH 2PTVA 4K5LA 4YHOL 1UM5L 5K93A 1Q8MA 5HHMD 3HPJA 1KBWA 4YE0A 4KNUA 5CZXC 1ET8A 1DQDH 1PY0A 5CSGA 4K71B 3QUZA 1MREL 4AEFA 1T0PB 2VR3A 3WIHA 4S1SL 1L0YA 2BP3A 1D5MA 3PL6A 1J0ZA 3KL3A 3PFQA 3K1DA 3G5WA 1I9RL 2KDYA 1OALA 2CLRA 1YZZA 2APSA 3VRIB 2ZXBA 5DT1L 2NY1B 5IHUL 5JXAH 2JK5B 3LRGA 4KXAA 4BD4A 1AGBA 2GSIB 3EOBB 5CNHA 1JPGB 1FRGL 1CFVH 1XQ4A 2WHVA 4HUKB 1T03H 3QB7C 3QG7L 4JRYA 3F7KA 1XGUB 4L9LB 4W9IC 1KJ2H 1UJTA 4PJXE 3D8MA 1H6UA 1MFMA 3BC9A 4G6KL 4D9LH 5FCUL 2GVYA 5EWIL 1DLHB 1ZV5A 1A4CA 3CC1A 3H3PL 3LZOA 2DQTL 3E2HB 2VR6A 3AAZA 3O6FC 1JZFA 3TPKA 2FTAA 1L9TA 1OGSA 2PPEA 2VM9A 3GBNH 1BLNA 4GW1A 3VSQA 2DKUA 2OAAA 2VYRE 1NAKL 4MHHI 4JFSA 3ZGHA 2ZCLL 4L3CA 5F7EH 3QFJD 4E41B 4AEIL 4JBSA 3FUMA 4NQED 3HTLX 2J4WL 5D72H 3WE6B 3QDGB 5EU5B 4GPVA 3G7TA 5DQ9B 1LO0H 4HJIA 3Q01A 1ZLSL 3OC8A 5GS1A 3H2QA 4ZNCD 3W38A 2BMKA 2YUVA 3HG4A 4PRNB 4ZO7A 1IKNA 4WV1B 2WXJA 2B5IC 2O6FA 3ZOAA 2NNAA 4FXGB 1BMGA 3NFSH 3LKNA 2VO5A 2XN9A 4A2FA 3VG0L 3QIUB 5IB3B 2Q3XA 5C0IA 3T8XA 1BZ9B 4F7EA 5JIPA 1BQKA 4X2UA 3SKJL 2EKJA 1A64A 4PJBF 1KCRH 4WEBL 3Q3GA 4XHQA 3Q1SH 3U9UB 5B38B 1I9JL 1KIUB 2NCMA 3AG2B 3D0VA 2WCGA 3HUJE 5I0ZA 1YPZA 3DURB 3BKJL 3JQOB 4Z7UF 2FLMA 1EFXD 4A6YH 5GZND 3LS4H 1U3NA 1IILE 1XAUA 4U4IA 3F01A 4ELMB 1CGYA 1K2DB 4OB5L 3UGEA 1CLOL 1KC5H 3CLFL 5A43C 3SDAB 5IVZB 2AZAA 4Y2DC 4DUWA 1HIMH 1CE1H 3V4VH 4PJFE 4B9YA 3LSOA 2B1AL 2W94A 1DDHB 1S5IL 5D96B 1IAOA 2IGLA 4TV3A 3FBKA 4QHNB 4PN6A 3KD4A 4HHAA 3MMEA 2WINA 4JY6A 4K94H 1YEGH 3NEEA 2F5AL 1GS8A 3WAJA 5B21A 3VI4F 1G7LA 3W9DB 5FCSH 3X14A 1E7VA 4F2FA 4QTHB 3S3PA 1FJ1A 1UB5B 2UZYB 2VLJD 2HZHA 5E8EA 1RJLB 2DQEL 4NKIL 4TQHA 1T5XB 3LAFA 4TQEH 1Z5YD 1BQUA 3I3DA 4H8PA 5AVVB 4MCMA 4HMEA 1VFUA 1NCUA 5EEXA 5DEGA 4HKJA 5KUMA 1X5IA 2AJXH 5DZ9A 3B1UA 2WXKA 3FN0L 4G8IB 4L1LA 4A7UA 5A2IH 3WTVA 3MZTA 1TNMA 3MUGB 4EAEA 2PPCA 1OQOA 1U3HA 5F96L 4H7VA 4NDMA 4M3JA 1NCGA 3D2UB 2GK2A 3HRZC 1FZKA 2EINB 4HFUH 3X13B 3BQUA 4U1JA 4XBMA 3P40A 4B9GA 4HWNA 4S11A 3CFQA 2X4OB 4OVUA 1K9TA 4AQ1C 2XQBH 5J11C 4ENEC 4A1RA 4GG6F 2VZOA 5GGVY 4FFVD 4U7SA 4RIRA 3V0DA 1UWEL 5AD0A 3IAQA 3OJDA 4JQXC 4XCNB 1YNTB 2R59A 1HCZA 1M7DA 4JPKH 3P4MB 3PWJB 3GMQA 2L04A 2WMPA 2AF2A 3W5MA 5KTEH 1D7BA 3U79A 1NCBL 3A67H 3C5ZA 3U0TB 5D71H 2WBJB 3VD5A 5DUML 1J8SA 4LOVA 3BDXA 4R7DB 3TP4A 1MUJA 4FAAB 1HL4A 2BWIA 2DQHL 2HRLA 4WUKL 3D4ZA 4Q9RL 2GITB 3NA4A 3HMXL 1U33A 1KIRA 5FUZH 4ZX4A 1JNHB 3RU8H 3GSVA 4YHNB 1CDJA 4HK0B 4WKZA 5F88A 2OXHB 2BSTA 3FB6A 4KI5D 4URTB 5HI5D 4DKTA 4PJXB 1P4IL 2BRRH 1X9UA 1INEL 1SVBA 4H1LH 1KENH 4JFZL 4ZOEA 1VCAA 4UM9D 4Q58C 3APDA 1XR8A 1SXNA 2IG2L 2YN3A 4HVBA 1U8PA 3DXAD 2F1EA 1XWVA 2OR7A 4FI6A 2WK2A 2Y6TE 1J11A 2V2XB 2NSXA 3WTSA 1CGSH 3ESVF 3C9NA 3GLDA 4U6YB 1BQHG 2FIKA 4PJ8A 2R8SL 3CFKA 3FO9A 4R9HA 1MWAL 2ZSWA 2PXYD 2VDQL 4IRSB 3CSGA 4GY4A 3S5ZA 3BN9D 2HJKB 4LKXB 4OLWL 3U4KA 4XNDA 2DH2A 1VFMA 4AIZA 4G43B 4ZUVA 3BD5A 3IGUA 4Y5VB 3KAAA 4YHIB 3SJVD 5EG6C 1BFSA 4JFYA 4K9EC 4U0RC 1FFPB 4IBYA 4BFRA 4GFTB 2ZKMX 1DJHA 2ZD0A 1ET7A 1ADQH 1I7TB 2AEPH 2XVBA 2YPVA 3CFDB 4PJDF 3G6JA 4NZUH 1W72B 2QHRL 5GS2H 1TVBA 2N7AA 2EKSA 2R1XA 3UADA 2HN7A 4KO9A 4WTZG 4N87A 3NH7L 4MDJA 1F3DH 3MBEC 4B96A 2Q6WB 1NGQH 1WLHA 3HUJB 2RIKA 1IGCL 3OXSB 4QJ3B 4YDMA 1I85C 2IAMA 5IROC 3MGAA 4PCTA 2ZUQB 1JTPA 3CK0H 5EC2B 3MNDA 5EMYA 1I8KB 5F1IA 4GYBA 5D1ZI 3I6LD 5H94B 2GEEA 1GC1L 2CM5A 3UZEA 1XB8A 3BD4A 5I71C 4JKNA 4PJFB 2VERN 1KGCD 2GJ6E 4OF0A 1E2WA 3ZQ9A 1EGJH 5GGTA 3QQ3A 4WU7B 2X2UA 1Q72L 5EBMA 1T89C 4FXKC 3GXMA 1O9VA 4FN0A 3IDYC 3JT0A 4G83A 1SJXA 4Q6YA 1W0VB 4XP6L 5IESL 4RFOH 5TGBB 2ZG3A 2XBZA 1A3RH 4HPYL 4NQTA 1OTSD 2PW1B 2XWBA 4ISVA 3KEDA 5JA8B 1JGLL 1UOKA 2Y7QB 3OSVA 3EIFA 5GGSY 3AUWB 4EDWH 5D1ZA 2OK0H 2HFFA 4LCWE 2J88H 3CFUA 2A6DB 2LTQB 1G9MC 1USZA 4J2QA 3NQIA 3NIGE 5E1QA 3NFNB 3VD0A 1HOCB 5FO9A 1CR9H 3NCCB 1SM3L 2MKLC 4DP4X 1S7VB 2O6PA 2L7EA 5ALBL 2RFXA 1XDTT 1H8OA 1LMKA 4RMQA 3KNBA 1U8JB 4HZLB 2X9YA 1YECL 2XT1B 4RGMC 3RVVC 2FQEA 2GCYA 3LQAL 1X5GA 5BZZA 5JW3H 2K4WA 2GSGA 4DN4L 2KQNA 4MZRA 1LDPH 4FQXC 5BQ7A 3PAZA 5L4IA 5EZIH 1AQHA 4KRPB 2E4FA 2DTSA 3JV5A 2Y6SC 3L2NA 3RL1A 3DIFA 5I6NA 3N3EA 4IKLA 2ZAGA 3B43A 3QUMA 1IGFH 1IGTB 3MTXA 4QTIL 1U92B 3MVSA 1X44A 3KYKH 5GRJL 4NQSA 4PV9B 2BC4A 1N8ZA 4HKBA 4YQXL 1XO8A 3OX8A 4NIYE 3ZR6A 4UF7C 3TJEH 4O00A 4OCXH 3ARGB 1GZHC 2X70B 4UOW1 3NRFA 2GKIA 3OV6A 4Y4FA 43C9B 5I8EB 1PSKL 5C7XH 4W81A 3R8BB 4YFDB 4LF3A 3L9RB 1WBZB 4KFMA 3U46B 4DKFL 4ZMXA 2WY3B 2H6PA 1T4WA 1RV6X 3QXWA 4JG5A 5HI3D 4ANXA 4NNYA 1QSFA 4D3CH 3SPVA 5MEOA 5G4MA 3T8VA 2GJZA 5AG8A 2Z34A 2ZX9A 3FMGL 5IQMA 3BEWA 2DL2A 5MP6H 3CPLA 5I15H 3BI9X 1QKZH 2G9HB 4APQD 3RDTC 2QVIA 4N0CC 5DC4B 1W6LA 3OAUL 1FZJA 2MCMA 1L7IL 2XOTA 5EH1A 3GI8H 5CU5A 3UG3A 3ZHDA 4LNRA 2FEEL 4NLHA 2MTAA 3PXJA 4RCAA 4TULL 2Z7WA 4F33A 2BXYA 2G3NA 4I1PA 3D7PA 5CP7B 3RTQD 4H8WH 3VXTA 3WNJA 2A6IA 1D6VL 5CFAA 2MWCA 4XP4H 3BSZH 5DJXB 4FYRA 3CDZA 3FRUA 4DFIA 5JHDA 5D7JC 4WVRA 4Z0BL 4O2FB 3MRGB 4J6RL 1K85A 2QELA 1KCVH 3S88L 3B6SA 5C08D 1OXYA 2YMOA 4YE4L 4MB1A 4DQOL 1RHHB 5E24E 3TV3H 3SEPA 3RY6A 4BFIB 5KSUA 4Y9GA 3W9EA 1CDCA 4G8FA 1JIBA 1FYTA 1QPPA 1NMAH 1NUFA 4JJ5A 2ICWI 4AJWA 5CU9A 3QK0A 2BXZA 3HG1E 4P2CG 2B9AA 3E6HA 3MLWH 4NQXB 2WC7A 4YUEH 4F24A 1PIGA 3HPLA 1OCZB 2GAZB 4OGXH 4RQQA 4TM9A 5DK2A 3WIHH 4A2EA 5GZOD 3EH4B 3ZKXC 3Q8CA 5EULV 1HHJA 1NA8A 4L1SA 4PY7B 3RZCA 1JNLH 1Y1UA 1SVZA 1QEWA 3VXPB 4L1BA 5I9QC 3EYUL 3ZMRA 2GJ6B 3G08B 3ESNA 5T5FA 1XTMA 1AJ7H 3T1FA 4M5SA 1ZXQA 4Q8BA 5DVPA 1E8XA 3IXTA 1NL0L 2CHZA 5HYQB 5T3XD 3FRPG 1ZVSA 4JY4A 1H19A 1T20A 4HIQA 4HAFA 1E8WA 2DWEA 3RWJA 3OQ3B 1QUPA 1W8OA 5EFIB 1BVLA 1JCKA 5GXBB 5BW7C 2LLLA 5IF0A 2YSTA 4P4RB 4PJAE 3FW6A 1A7BA 5AZEH 1JHKH 3NIGB 5FS5A 4GS7C 5IEHA 1X5MA 2C3GA 2AV7B 2IQAB 2HB0A 5DVNA 2F19H 1OP5H 5HD8D 5B1KA 2BY2A 3P0GB 4JANB 3RUGA 3SGKA 4CDGC 3RWHB 4X42A 2HYMA 2F54D 2V7NB 4X7DC 2DD8L 5EEWA 3LKQB 1VA9A 4FTVA 4IRJA 4UZUA 3DO7A 2IANE 1GMIA 1U8KA 4Y1SA 2UY6B 4PRHE 1OWWA 3EHBD 4HCRL 2MNJB 4HIJB 1RVFL 4W68A 1GIGL 5EU6D 5FGCE 4L1TA 2ZONA 2AJUL 5IKCA 2FR4B 3QQ4B 2VW6A 1RZ7L 4DZ8A 2O6DA 3KCWA 1BFOA 3KLDA 4L37B 4BSJA 4FI8A 4DP2X 5I1GL 2IOIA 5BUPA 3ALWA 4JO2L 4XTRD 3UIZA 1PD0A 2RQ8A 4K7PL 1VFAB 2YQBA 2VDOL 3FQTB 2PO6C 1QR1B 4YNYB 3QIWC 4KI5F 1JPST 4KXZI 3MRJA 1X5XA 1YSOA 3P73A 4R97C 3AGVA 5CZXD 4P49A 1E9OB 2I69A 3AQZA 1H3PH 3GB7B 3PU7A 1G6RA 5D7HA 1LO2L 4P2QA 3VJ6B 1OAQH 2EO1A 1FH5L 2X4NA 1LO4H 4AT6A 1HEZB 1DUZA 2QKSA 3QUYA 4QKTA 4Z78B 3ZYZA 5CJ5A 3FYIB 5GGSA 3TYFB 3DX6A 2X6UA 3FFCA 4PR5B 4JM2C 2JF1A 3DARA 1EO5A 5I19L 3DHJA 4YIQA 3QRFM 4MA1C 4JO4H 5AW8B 2YJLA 4P5KA 2KLRA 1A1MA 4V1DE 3GRBA 4J8RB 2VLKE 4TNFA 2XXFA 5AW9B 5ESVA 4ODUA 2MJWA 3GBEA 1Q9WB 1Z0MA 5HYSB 3H42H 2BNRE 4OJAA 3VXMD 4YBQC 2EDMA 3SKMB 1JS4A 2OMBA 1A3LH 1T2JA 4PG9B 2YJQA 1HZHH 5JIQA 2NY5L 2WB1A 3VNZA 2L7JA 3S7GA 2AC0A 1AYRA 2G2RA 3B9VA 3KM1A 4B97A 2I7OA 5J1SC 5JOFB 1QBAA 4LHUA 2Y2TA 3HG1B 3KGRA 4JUSA 1P7QA 3ABLB 3BVNA 3HR5B 1H5BB 1F8TL 1MHCB 1PQZB 1BBDL 4LBEB 4XO9A 1IB5A 1QNZL 5SX5H 3RJOA 3IMUA 4MA3B 2P7TA 3ZDZE 1LEGB 3DA0A 3TEUA 1JGVL 2WUBL 3MLZH 4F91B 2NY4C 5DO8A 1ZD6A 3IWVA 3KPOA 1IC5H 4K07A 2ZP8A 2P48B 1CXEA 2ED6A 1TR7A 2A38A 3O6KH 4NWUH 2CUIA 3RAJH 3K6SA 1MHEB 3BPLB 2VZVA 5ALCL 2NYZA 1I3VA 4YSUA 1MAKA 4HWZA 4MA7H 3TBBA 3LH2L 3EH5B 3RIFF 5HYJE 3VQ1C 1HQ4A 4J28A 2F7QA 3VFVB 4U1NB 5LXGL 3RKPA 3MOBH 15C8L 2FX7L 4XB8A 3QDMA 1ZLDA 2GTZA 2VXTL 2C3XA 1R3JA 3KBEA 3LMJL 3OVUB 3VYNA 3ZYJA 1I31A 2NY6B 5DMJB 4XMVA 2GIMA 4NQVA 6FABL 2OA9A 5KSVB 1R75A 3IAPA 4PJAB 2IALA 3LPWA 5JPNB 4XNZB 3VGHA 3FUJA 3KPPA 3PABA 3SDDA 4YSAA 2NW3A 1VKXB 4UB0L 2AANA 4WW2B 4Y2DD 5B8CC 2GJRA 3RTLA 3GK8H 1A66A 3TNNB 3NSFA 5DSCB 1RUMH 2BP8A 3FU9A 3DJRA 4P23A 3IU3A 4E0RB 4LOUD 3QQ9C 4NENB 4ZXBD 4G7VH 3VGEA 4AGMA 3UTQA 4OZFG 2IANB 1IL1B 4GG6E 2X40A 1FDLH 3VWJB 4PRHB 4AV5A 2EE3A 4HKZA 2YPVH 5ITFA 4LCIH 3ABMB 1H9VA 4X5XA 1IBZA 1BD2E 3EOTL 1J5OH 3ARBB 5FGCB 4HEME 2ZQKA 4GSUA 1MJ7H 4M8VA 2IQ9H 1PKQE 3MYJB 4F57H 2HT2C 3A4FA 1HKFA 1DZBA 4M93C 1FFOA 4S2SA 5L7XH 2IADB 2AZUA 1VACB 1OARL 4YC2B 3TTYA 1TKWA 1E9QA 4OJFL 5IK3A 4W9CC 3FKUS 1I1RA 2F7IA 4P3CH 3WENA 1NFDA 3HFML 1VDGA 3WEMA 2IWFA 1G7IA 2WN2A 5JO5A 2J43A 1IKFL 3QPQC 1C08A 1RQ5A 1JZ8A 3UTTA 2X28A 4MNQD 5GGTH 1GYVA 1YAIA 2C34A 4OM1L 2JQMA 5F3HA 3CZKA 4IGBD 2X7LA 3QNXA 3Q2NA 3QIBA 3IGAB 3TBTA 4FABH 1KDIA 4ORGA 1I8LA 1NKOA 2V9RA 3A22A 3HEIB 4G71B 3MLXH 4HJGB 5H37A 1D5IH 1J8HD 5CD3B 1DBBH 4APXB 4L3EE 1IC4L 3VGAC 3HZKB 4TTGA 3WYRA 3APCA 3A6CL 1N6QL 4DGYL 3SDYL 1MVYA 1JPFA 4JHAH 1QSED 1K8DB 2EYTB 2Y25A 4FQ1H 4GNKB 4J6IA 2VDLL 4K3JH 4FLQA 2F7PA 4V1DB 8FABB 4JCWA 1Y6MR 2IF7A 2VLKB 4GAGL 3R4DA 1KJVB 1QLRA 2G60L 3EXLA 2DQDH 3VXOA 2AK4E 2BNRB 4UNIA 4JVWA 3WMPA 4P9MH 1ZT7B 2BNQD 3WMQA 3OC5A 4ZPVA 1MJ8L 1T1XB 4OSUL 1IT9H 4E9RA 1UXMA 4P2OB 4ZS6C 4JFDE 2V37A 3OR6B 5D7LA 2P52A 3P9LB 1OP4A 4XMWA 2EH7H 3FFOA 1YUHA 3K4AA 2LU4A 2EXTA 1OAKH 3QSKB 4NOBA 2DL9A 5EV7A 1S7SB 1Z66A 2W88A 2N59A 1I75A 1A7PH 5F6HJ 4YDKH 1N0XH 4LGSB 2AEOA 3TO2B 3QUMH 1KXVA 4MMZB 1G0DA 5HDRA 5JDSA 4NYLA 3ZDZB 2A77H 1TEGA 1R5IA 3HVNA 1A25A 4GXFA 1KXHA 1KGYE 4QUOA 4FGMA 4N0RA 3L08A 4DUXA 3ULVF 5D1QC 3V4UH 1XFPA 1LO3L 3PGDA 1A9EA 3TO4C 4L8CA 2N1TE 4BUQA 3WKNA 4G6AC 4XVUC 3OGCA 3IFOB 4L8BB 1SLWA 3FONB 5HYJB 3AQDA 4MASA 2HKFH 3FOLA 1P1ZB 2LHAA 3PWUB 4JKKA 4AL8H 4XXWC 5KVDL 4UIMB 2XWTA 3TBSB 4X4YB 4AYDC 3IETA 3MBED 4OLUH 5LGJA 2F68X 5GISL 3WUWG 4ZO9A 3QJHB 4LK4A 3UC0H 5K59E 5IROD 5FWRA 5I1AA 1OAXL 5FX3A 4KTDL 3VD3A 3STLB 2IXQB 3NVQA 4ONHA 3V0EA 4JN2B 2AQTA 1CGWA 4G8GE 3LN5B 3T0DA 4D2NA 2Y24A 4WO4A 2W65B 1HJCA 4QHPA 5GS3A 4Z8FL 2DJ4A 4DNLA 3MJ6A 3I9IA 4N68A 2OYMA 3QZPA 3S5LB 1HKLH 5KSAA 1AY1L 3D85D 3U6RB 1I3RB 4HF5L 4L4VA 1DQTA 3BZ5A 4MQXC 1B9ZA 5D7IE 4WNQA 3U7WL 3DVGB 4GG6B 1QHQA 1EX0A 2VAJA 4X9YA 5FLUA 3SYOA 3P3SA 4OIFA 4LLDA 4X5PA 5AVQB 4M4PA 3EJSA 3PWVB 2UWEE 1I8IB 4WW1B 4GQ9L 1BD2B 4D0DA 4P59H 3P11H 4LXFA 2J2ZB 3AS0A 1CLVA 1MF2L 2DIAA 4FYTA 1PKQB 4Y5YB 2Z92B 3BVTA 3KPQB 3P4NA 4LEOB 1VF5C 4IBTA 3BO8A 5JIKA 1RPQA 1MFEL 1ZHKA 2X1QA 3CSPA 3HRZA 4OZGF 1M3JA 5IVNA 2FZ3A 1T3FA 5HHOE 1FA4A 1GJWA 1HXYA 2F9BT 2GUOB 3GXTA 2HKHH 4HH9A 4FJZA 4L0ZA 4ZD3H 4QHKJ 4WEEA 2IGFH 4JVPA 3THMH 1U0QA 2CRZA 1TZIB 4HUWB 4LPWA 1FZMA 5KVFE 2ZP9A 4TOYH 4YVNA 2N0KA 3VW3L 1YQVH 1X7SA 5KOVC 1RY7B 3CN4A 5CZKA 3LV3B 1NFDF 3S0PA 4BRVA 3FCTA 1H8NA 1CXKA 3GGWA 4PY8I 3ZIYA 5I0XA 3V4PA 5TQ2L 1CFSB 2WWOA 4TMPA 3QFJE 4XGZB 3LIZL 3VGGA 5B7FA 3P3TA 5TTRA 4UQDA 1C12A 4XVSL 3BP4A 4NQEE 1I9IH 1OANA 5GS2D 3SYPA 5CKAA 3WIIH 1EAOA 4L3EB 2FECI 1VGKA 5EUOF 1IAIL 1RJCA 1PEWA 4M1GH 3ZZSA 1KB5B 4MD5B 3D05A 5K9KA 4I87A 1RUPL 4WEUD 1Z5LA 4IBLT 1S2EA 4AH2B 4P9HH 2WTOA 3GJEB 3QWRA 3GTVA 4HPOH 1RJZB 2OJ1A 1BZ8A 5FUCE 4R5TA 1H15B 4NCDA 2CJ3A 1MQKH 3FO0H 3IS0X 2MQCA 3DOHA 4PP2B 1PPIA 3EFFB 3FQXB 3NSXA 1SPDA 1AQMA 1AQDB 4G5AA 2AK4B 3WY2A 3ARTA 1R5VB 3D5OF 4NKOA 1XH3A 4UQIM 5CEZD 3BPNC 1NC2D 3GPEA 3PWPD 3JWNC 4PSRA 3GHEL 3L5XH 4ANVA 1A6AB 2DMGA 3AJ7A 3B3IB 3E1F1 4PYHA 1UCTA 3GMNB 3HAEA 4JFDB 3NJJA 4UT6L 2BJML 1NGXA 3FQRA 1SQ2N 3IJ9A 5T3ZH 3QUXB 1JNNL 3E6FA 4NO2A 5EO0B 3SQOL 4LSRH 3N85L 4MRCA 3UG5A 4DH2A 2KI6A 2XA3A 4PHXA 4XO4A 3W11C 4RGNC 2LFEA 4LSTL 1LE9A 2GI7A 4RISL 4O2EB 3C5XA 3LZLA 3W1ZA 1M05B 2FL5A 1IBGL 3H6JA 2PLTA 2ZWKA 1N3NA 3SPIA 5D7JD 2OZ4A 2PYFB 2JKWA 5GQBA 3RHWF 1CD0A 3F6LA 3JWDL 2OQJA 2A1WL 2NT1A 1DE4A 3WNLA 1S4IA 4L3AA 5JQ6L 4NBXB 1ETA1 3BZFA 4UTAL 3GWJA 2FO4A 3ZZQA 1UKSA 3GSRB 3QW9A 2OR9L 3K1KC 4AC2A 4YDIH 5DUPH 5BVJB 4PS3A 2VT0A 2WIIB 3MLUH 1A7QL 1V7ML 1WZKA 2VLJE 1G6RH 5GS0D 1CICB 3GZPA 3JYCA 2CO7B 4MJID 1YYLL 2YKKA 4LOEA 5EOTA 5JW4R 2IFFH 4EZKA 3ULUC 4G8GB 2DM4A 2WSDA 3EGSB 2PCFB 1YJDC 4GKZB 5B7MA 2XV3A 2VR8A 1DQVA 5TF1H 4LU5H 3O41B 4V11A 3S35L 1E9PA 2J1KA 3TN0D 2AQ2A 2P5WA 1EHLL 2YSSB 2EDBA 3ZRSA 4KJPC 4Z77B 2R39A 5C0GB 4GBXC 4JZOB 2ZNXA 2EYRB 2GY5A 4Z7VF 5D7IB 4GUQA 1AHKA 4MGXA 2UY7A 3TM6A 2XG5B 4Z7NE 3CX5K 3KYNA 2UWEB 4D8PA 3GS0A 2IBZY 4PJ9C 1V8HA 2F0CA 3NIDF 1F1AA 1IAKA 4HX1B 1ZDSA 2RMNA 3M1OA 3K72A 1SQMA 2DWYA 4TRPL 4NQUA 2HJFB 2VR7A 3BZ4A 3U30B 3II3A 5DJDB 5F89A 3SBWA 3RVWC 3BWSA 2NQ3A 5FM5M 5ICZA 3VFSA 2H32A 2OMVB 2QGEA 5TDOB 5HHOB 2OLDA 1NBZA 4YVUA 3ULVH 3ARDC 4ESKA 1NEPA 3TA3A 4ECNA 2HTKC 1HL8A 5CS7A 4FQXA 2PPFA 5CGYC 4QWWD 4TNVK 3BIAX 2EVHA 3D25B 5I82A 3SPGA 4CSPA 3B7UX 1I1YA 4ZUWA 4Q52A 1PKOA 1M71A 2DQJH 3J8F7 3RWFA 3WHE1 3ZL1A 5KYXA 4XO5A 5I8OL 5INDA 1KJMA 3QFJB 5DHYB 2C9UA 2V9QA 2N01B 5FYJH 4NQEB 1L0PA 3HAEG 4K23L 5CJQH 3Q6FA 3R1GL 3M8OH 3MBXH 4S1QH 3IDIA 1MCJA 2PTTA 3F6IA 2VQ4A 4UOJA 3MO1A 2MHAB 5AZUA 3JZ7A 3LXUX 1WWAX 1BFVH 3GLEA 4XCYB 1J1OL 1NSNL 1MIML 2H1LM 3DECA 4ADJA 2WKOF 3CN1A 3B5HA 3PL6D 3N43B 5AYTA 3SJVE 3N42F 1R3HA 4HV8A 4PREB 3LH8A 4EOWH 2EEAA 1NH6A 1KPUB 4MB4A 1QRKA 1AQKL 1HCFX 5EO1B 1LD9B 4EIBA 3EO9H 4IIZA 4ICXA 3SODB 3TZVD 1QLFB 2WYTA 1F4XH 4S0TD 1T6WA 3N44F 5F9JA 3RDTA 2AV1B 5I5JA 3L6FB 3ATDA 1FGNH 2OXGB 4JRYD 4L29A 1H8LA 4JO5A 5CLWA 5CUSL 1CBVL 3HG2A 1IIKA 1NEZB 1HXKA 1YEFH 3SDCC 2WQXA 3TVMB 4G70B 4OLYH 1P2CA 1Z9LA 2Q76A 3MLSH 3NP4A 3QA3A 4JM2D 4LT7A 1EFXB 2JH2A 3OAZH 4KRNA 5JIMA 3I6LE 1KXQA 4IU2B 3MCKA 3RBSA 1U91A 3KXFA 3SY6A 4XI5D 4CNIA 1OGAD 1W9XA 5F0MB 2YAHA 2W9EL 3QNZA 3S2AA 1AD0A 3OPZH 3EFDL 1KY7A 1KGCE 2FQFA 4HXAL 3EYSH 4N2EA 4R2GC 3S96B 2O61A 2R0LL 5TK4A 2EDOA 2LT9A 2IEPA 4X6CA 4YBQD 1TQWA 4S1DC 1UXLA 3DVNA 4I2XA 5IMMB 1T1ZB 3BISA 4MKMA 5DLLA 5AWNL 3CVBA 3KMDA 4I4WA 4NC1E 4OW6A 4TNVF 4JFWA 4J3OH 2GIXA 2Z0UA 4AC4A 1T0MB 4EVNB 4K5OA 5KOMC 3DX3A 5TFSH 2OBGA 2VLJB 4GT0A 4DGUA 3OF6A 1ZIAA 1QI4A 2WO2B 2K7QA 3WKQA 5BCAA 4JKLA 5H37H 3MV8D 3EBAA 4QYOA 1INDL 4M8QB 4DVBB 4JNXA 3OLEA 4P3WA 5E8OB 1C7SA 3ECBA 1T4KB 2NY4D 3V6OC 5HY9B 4KOBA 2Y3NA 1FHNA 2WZ6A 3QH3A 3HOGA 2DTML 3NIFF 5C9JB 5FEBA 2WQUA 2A9DA 1ZK9A 4PLNC 3RWEA 5CZVL 3MJ9A 5BV7H 1AXSA 2V7HA 4HBCL 2WJ7A 1TZHA 1TJHH 2D9QB 1FHGA 4PRPA 3OXRB 4UUJA 5GIRB 2ZXWB 3SQBB 2AJ3A 1A7NL 1JPSL 3SIKA 1CVRA 5KUKA 3UAJC 1OSEA 4XVTH 3GBDA 4NZRL 1PYWB 2Z31C 1AS7A 3UJTL 1H3XA 5IQ9A 2AFNA 2PETA 1RK1B 4BKSC 5C7ZA 1NCDH 4Z7NB 2VITA 4UAOB 1FG2B 4WFHD 3EJZC 1IQWL 2XTJC 1IVLA 1KZYA 4PGEB 2BNUA 3LH9A 4X4ZA 3DX0A 1M1XA 4ZW8A 4O5LL 3PAUA 4XBEH 3AW5A 2ADGA 4WHCA 5C0FA 1X5KA 3UTZA 3V10A 2ILLA 2J3SA 1TTRA 3KWVA 3NYKA 1B6DA 2BSSA 2SEBB 3FT3B 4WWNA 5F70A 5BS0E 1MFBH 1XSJA 4BELD 4RZKA 1OAUH 1FFQA 1NKRA 2ZAIA 3IJYA 12E8H 4MJJA 3ETBJ 4N0FB 1NC4D 3V52H 2O6EA 3G9VA 1RZ8B 5DEZA 1E4WH 2IWKA 1SOSA 4HW6A 1H3UA 1HC1A 1HH6A 2ZOWA 4U1IA 5CINH 4PUBH 4J12A 1KNOA 3O2DL 3WY3A 4ALAH 5CMAA 4K3DL 3BQUD 2DQGL 1GKOA 2ICEA 1HDMB 3VVWA 2ADJB 2GY7B 1YEKH 5IR1A 3RFZA 2KT6A 4I0PB 4N9OB 3VX0A 5HGBB 1NCOA 4GSDH 1IGML 3PGCB 2FQGA 2OCJA 2BZDA 2E6JA 5SV3A 5C6TL 3SD5A 4YDLC 1UA7A 4P3DA 1URZA 3NN8B 4XN2A 2CJUH 3DUUA 3QYCA 3FHAA 5SX4I 3QIWA 2XG4B 2H8PB 2HFEB 5EOCJ 3SE4C 3SJVB 4BK5A 3KCPA 4FXLA 1P9MC 3EGDA 4MZIA 5AAMA 4PVMA 4JE0A 2BSRB 4LFHD 3LQZA 3UJJL 5C08E 5KSBE 2OL3A 3QPQD 5KAQG 4AITA 2NX5A 2Y7OA 4IS6B 1JZIA 2JI1A 2C9PA 4AVIA 1S7UB 5KS9F 1SYVA 4N5UA 4ETQB 5JIDA 2WTRB 4PVNA 2CDFB 2FT8A 1HINL 1MRDL 2QVTA 3WFDH 5DMIH 4HEPA 2R2EB 3RG1C 1MXDA 1ZGLA 1TZ8A 2YD9A 3PIQA 2RA1A 1R5WA 4TUJB 4NI3A 4BHUI 2NXZC 1PX8A 4O02A 2PPAA 5IHBA 3DRQA 5LAXB 4HZAA 3T09A 4F7KA 4YX2H 4JKMA 2OSXA 3BRGC 2EIMB 3T0EA 1AC0A 1SJEB 3SOTA 2R0KH 1ZEAH 3HC3H 3IDXL 3K5RA 4FQCL 3LPGA 4GP5B 2B7DT 3NABL 4ZDHB 4MD0B 1HSBB 1IGIH 2EDJA 1XCQA 2F7RA 4FNLH 1NMCB 4UT9A 3V0GA 2NY3C 5DJCA 3VYPA 1G84A 4I89A 1Y18B 4JHWL 3QDAA 1JRHL 4P2YA 1U8MB 3C6LA 2V9TA 3FCUB 4ZS6D 4KQ4L 3FHEA 4MNHB 5T3XE 2XJLA 3O4LA 3ME0A 4AMKL 4AYID 2ZF8A 1KUMA 2FX8H 2BOLA 3QXVA 5DZNA 3MROA 3V4PH 4PJ7A 4BHUA 4KJYA 1NDTA 2H26A 2ZKWA 3HZVB 4W6WB 1UQSA 1ZSHA 5E56A 2OJZL 2N1KA 3BSGA 1W2KT 4PTTA 1RMFL 1TETL 5DMGC 1OWRM 3UBXI 4JZNB 3CSFA 1QBLH 4QY8B 2XNAB 1NICA 4CVXB 1WWWX 4X6BA 4W9FC 3ILQC 4RAVA 4U1SA 3E1ZA 5CN3A 5ADOH 1A2YA 2A6JA 5D1QD 3P54A 3I9GH 2F54E 1M1SA 1FSKC 4NUGH 4UYPA 4ZMZA 3KGUA 3TO4D 1GVIA 4G6AD 4XVUD 3QJVB 4X8JA 2YZ1A 4ZI8A 5L0QC 3S37H 3ARWA 1LP9E 1EANA 1EVTC 2IBBA 2X87A 2M1KA 1SDDB 1A8JH 1WIPA 4DIXA 1R34A 4TS6A 4U1KA 1BMZA 1TVDA 2Q87A 4KPHH 3F00A 5FOJA 3SDXA 3Q05A 2JIXD 3LHPH 3KLSA 3LY6A 1IM9A 1PZ5A 3HAEH 1P53A 3CNKA 4QJ4B 3S4SB 2EXWC 4GB9A 4N20A 5BZDA 4HSCX 3LZFL 5B8CA 4HUMB 3UBXA 3GEWB 4FFYL 3FQYA 3ECQA 1BZ7A 4HJTA 1GGBL 2CCWA 3CZFB 4HU2A 1DJWA 1RZGB 3ZKQD 4OFPA 1I3UA 4KBPA 3D48R 5BS0B 1YEJL 3KPNB 2FJHB 3E0GA 1P1VA 2GBTA 2C4XA 1D9KC 3L9EA 5D7SH 4NQDE 1UADC 1AZCA 2OZ4H 4CSTA 1OP5K 4IW4C 4RMUA 2A99A 4OZHE 4MQXD 4CW1B 4CC1A 1OAYH 4PCYA 3AREC 1T5KA 3H7BA 4OUOA 4ZOCA 3GHPA 1SXAA 3OGOE 3RNQB 2AHIA 5T33L 4RSYA 2B2XL 2DQIL 4XNBA 3WNNA 2A83B 4PG2A 4NI6A 5D1XC 3DPBB 4O9HL 3C8DA 1G5GA 5ICXA 2NRDA 3QORC 4MDIB 3CSBA 4GKNA 4PJ5A 4HWUA 2OMWA 1RCYA 5I6LA 5J3HD 3QR1A 1U30A 4G1EB 3G6AA 3BHBA 4U1LB 3P2DA 3QRBA 3QZNA 3VE0A 3EBGA 3CG8A 2BOBA 2WKLA 2K8MA 4GRLC 3RTQB 4TPRH 4EI5B 1FO0A 3HBPA 3M1CA 3CHSA 3B3BA 3EJYC 2IMNA 4XNUL 4XN1A 3WL9A 3LS5L 5GJSL 3TCLA 3X2QB 3VXME 1RZJC 4LLWA 4R83A 4I48A 3S34L 1HN1A 5C08B 4I13B 5KSBB 2E6QA 2EABA 3QQDB 4JM0A 5DI8A 1Z3GH 4DAGL 4HC1A 1U4FA 3NSCA 5DRWA 3B7TA 3JYBA 4AM0Q 4BQ8A 5C2BH 4NN5C 1KWKA 4KZ0A 3RA7L 3SB3A 3JWOH 5JR1H 4ZFOA 3A0OA 2CD0A 4XCNA 5F7AA 3NK3A 3IFNH 4P2AA 4P5TA 4JM2F 5MEQB 3HS0C 1QSFD 3KHQA 2ZXAA 4YFEA 1T2QH 3QXUA 4XCFH 2IH8A 3OKKB 3U36A 3V5HB 4HWEL 5AOLA 2QQLL 4HG4K 2DBJA 2EDQA 5DGQA 2VJXA 1XGPB 3KYOA 2ITCB 4GSQA 2H32H 4OCSL 1M4KA 1JI2A 1NGWB 3BP6B 2J8UF 4F7TB 3BW9B 3MRRB 1XGQA 3FSZA 4DKAA 2CG9X 4W6YB 2VABA 4OIIH 1NAMB 3WKYA 2F6AA 3MYZA 3UH8A 3EGXB 2W0KA 4I1NB 3U1QA 1S7XA 4F5CA 4AW7A 4POYA 1E6JL 1QA9A 1RUKH 4JFFD 3UMNA 4OGQC 2JTDA 3IWUA 5D4QA 1P4LB 4BQBA 3KYMA 1OHQA 3WFCH 4QR7A 2E7CA 4NPYB 4DTGH 2O5YH 4XMPL 5FAAA 3KPLB 2GQHA 1F11B 3SY0A 4Y16A 3W11D 4RGND 3ZHNA 4IIQB 1K5WA 5IW3A 2AABL 1FQ9C 1JMZA 4TUKH 2ZOLA 3ARRA 4YL4A 3WV0A 4ORZC 2XZAH 3QARA 4MX7B 2CIKB 4HLJA 1I7UA 3BPOC 5DHEA 4N6RA 1NAML 3L7EA 2VN6A 4XXCC 2QJDA 2EYSA 4NZJA 2WANA 1GYUA 1QRNE 2F54B 3WHXB 3GXDA 2FT7A 3CLEL 2D4FA 4DEUA 3VTTA 3EFOB 1HHHB 4MBRA 3RZCD 1SEBB 1LP9B 3EHBB 3EJCA 3HCVB 4ODVH 5JW5A 3KPSE 4RFEA 3GKZA 3NIDE 4YO0A 5KBPA 3II1A 2YOCA 2DRUA 4L0YA 3AGWA 4F8OA 3QPXL 2X4RA 3QZLA 1TPXC 3HKFA 4ZUUA 5DK0A 5A16B 1BG9A 3C2SA 4N0UA 3VDAA 4CU7A 2EIJB 2F53A 4F15C 3C09C 3EF7A 4M6AA 3ZW3A 1DTUA 4YSOA 3ULUD 5BZWB 2R23B 5FV1L 2LW3A 2YXMA 1EZLA 1SY6A 4N5ED 3CMGA 4NERA 1RKRA 3V0VB 4KKLC 2RJMA 3ZKNC 2VXQL 1AG6A 3GSOA 2A4CA 1VZGA 3BVDB 3MZGB 4NQDB 4LFHG 2ZPKL 4KJPD 5E9DE 2GIYA 1UVQB 3OKDA 4FNQA 1YO4A 2BIMA 4GBXD 1W16A 4MNQE 3MLTA 1TMQA 4OZHB 4U3XA 5DR5H 1KYOK 1MRCL 2Z4QA 4YGAB 1FZOA 2FH6A 3SKNB 4G1MA 3IDMB 1CLZH 3DUSB 2XZCL 3CX5J 4M5YH 1LEIB 2XWRA 3L9BA 1CCZA 1CYXA 3BJLA 4PS4L 1U8HB 4KRLB 3JTTB 4PJ9D 1ZS8A 2DMHA 3EO1A 3KWWA 5L2JA 3WJLC 1J8HE 4I88A 4QCIA 4Z95L 3GKWH 3MAWA 4D0BA 1NGYA 2BHZA 1DVZA 5E51A 4G8EA 5LBSA 5AB2A 3O6LH 4RAUA 4K71C 1QSEE 1U8LA 2NYKA 1R3KB 4JN1H 4PGCA 5F3BB 2BCKB 5GSVB 5BVPL 2AEQH 1AGEA 3H9HB 4P57B 4NUJA 5E9AA 3ARDD 1MI5D 1OGTB 2VJ8A 1CTOA 4U2YA 1VFOA 1E42A 2CR0A 5T1KD 1E65A 2HTKD 2X1PA 3GTNA 1CYWA 3FB7A 3PRZA 4H25A 5DJZA 5E4IA 5CGYD 3SPCA 3VXMB 4HQQL 2NY1C 1CDIA 1AC6A 2BNQE 3MJ9H 5I0YA 2CHNA 1G9EA 2XWJB 1G9NH 3MV7A 4KDTC 2VZ3A 3FNKA 4XNAA 4WWOA 4N1HB 1UHVA 3PP4L 4L9LC 1TSHA 4MQ7B 3TBWB 4KKBD 2I24N 1JG9A 1HEJC 4FCAA 4K7PX 1TVHA 3DVFA 4YHML 5H35B 4ADGA 4LKCB 2DQUL 3E2HC 5FK9B 5IY5B 1FIGL 4WLCA 3TX4A 4X0KB 3HN3A 3KWTA 4FA6A 1UM6H 1JXJA 1KN4L 1IBBA 2VLLB 4J3VA 1HE7A 4PJEA 1RUAL 2DQMA 5AB1A 4P2QD 2QVFB 2APTA 4F7CA 5I16A 3R06B 3L4YA 4FFZA 2ENPA 2DN7A 5HHVL 3IAGC 4LLQB 3UYOD 3S48A 1Q0YH 3US9A 3JTSB 1BQ5A 4JZJA 1QFWI 4WV1C 1KV3A 1OTTC 2JCCE 2PCPA 4FXGC 2VISB 5E0FA 4LL1A 2B1HL 3B2VH 1ZLVH 3BGMB 2DH3A 5K33A 4FNPA 3QIUC 4HKXB 2FWOA 2NR6C 2FNWA 3EJUA 4P99A 1D5ZA 5HHXL 3QUKA 5AZ2H 3S3BB 4CN1A 3SDCD 1TJGH 4PGBB 2WB7A 3MREA 3IKKA 2EDYA 4DN3H 1EQWA 1UC6A 3OD3A 4XMKL 4HFWA 3CD4A 5KZCB 5HJBA 3IPBA 5I1KH 4WZ9A 3NSYA 2AQSA 4DP8X 1VIWA 5EOQL 5CEYB 5C0NC 4UTBA 3H53A 4DO4A 4IMKC 2QQKL 3SSGA 1NKGA 1IEBB 1WT5C 3LEYH 5EU4A 2A0LC 4KKQA 5I17B 1MH5B 4R96B 3F7YB 3V5KA 1FAIL 4RGOH 1MVUB 2BVPA 1U8CA 4M6NH 5I1LB 1QRNB 1ET5A 3BWUC 3D9AL 4ZXBB 3PQYD 1SEQL 4QNPF 2XY1A 4CADB 4AYSA 3SDAC 3TNMB 2OL3H 2KZBA 4ZSOE 4N8CH 1KJ2B 5D96C 2EECA 3AVEA 2BHFA 4F1ZA 3KPSB 1EJFA 4EEEA 5AENA 1M57B 3P2BA 2UV3A 1DQDL 5DFVC 3NIDB 5DFWH 1O7VA 2X4SB 3P0VH 1C5CH 1F1GA 1F3DJ 4JX0A 5HGHA 4AV0A 5EC1A 2W0FA 4XHJC 2ZCZA 3AU1A 4QRPA 3KW7A 3JV4A 1FUNA 1PX3A 3KS0H 4O02H 4OFQA 2ZUYA 4LOFA 2ED9A 1E4XI 3RVUC 5JXAL 5HGDA 3QRGH 3PCYA 4BA0A 3P30H 2XPZA 3G5XA 1CFVL 1IQDB 2AMGA 3IJSA 4NO0D 2VSDA 5SX4H 4F2MA 2YXFA 4MAUH 1T03L 1QZ1A 4AK2A 1CD1B 1JNJA 3HHMA 1KJ2L 1CE6A 3DROA 2OMUB 1QOKA 2WLIA 5DJ6B 5E9DB 5EO9B 4D9LL 2EXSA 3INOA 4MNQB 3UAJD 4AQ1B 3AC0A 2LVEA 4UT9H 3FQWA 2CPUA 4Z3JA 3GZOA 4H8HA 4IGBB 5HJDA 4N2DA 1JV5B 2V2WA 4GUPB 3MJ8A 3GBNL 2CKNA 4X7EC 4PB0H 5GGQH 4KZDH 4P23D 5DJ8B 3IJHA 4GW5A 5F7EL 3EJZD 5L8LB 3RDJA 4ELKB 1J8HB 3WIAA 1WIUA 2XTJD 3I75B 2HLEB 2NUTB 5D72L 5I76B 4M03A 2HMIC 1U58B 4UT7H 2PCXA 3N41B 3QJRB 1LO0L 5LGKA 5BJTA 1QSEB 4R0LB 1KTKE 1SYSB 3D51A 1UZGA 5BMFH 1AP2A 2DLFH 4A6YB 3LKPA 3TT3H 1R9FA 1D5BB 3NFSL 4LESA 3OJMB 2YKLH 4ZYKB 5IV2A 4NXSA 4Y9FA 4IOFD 2GTWB 5CEZE 4O2FA 4NUMA 3PWPE 3V4VB 1CFQB 1MJJA 2BNQB 2NCEA 2YRLA 3DRTB 5BQDA 3JWNG 2WNXA 3SQRA 4NRYA 5E94A 1USQA 2LFGA 2NY0B 1KCRL 2XWXA 5HYIA 2DWDB 3T9WA 3R8QA 5KJ7E 1WITA 2Z7ZA 3Q1SL 4XRCB 1A6ZA 5F2FA 3VFPA 4NXKA 1L6XA 2L8AA 2VOTA 4X7SH 3QZWA 3LPOA 1K5NA 1M2VA 3HI6H 1HYSC 3VFTA 1OHZA 3CFCH 1MDTA 4LVHB 1CLYH 5CF3A 4XZUA 4A6YL 2YBGA 3LS4L 2P45B 3TS8A 3ALXA 3MFFA 3N50A 3QIBD 3MJ7B 4IDJH 4JPIB 3IBEA 3MLRH 1FNSH 1KC5L 3PGFH 4B6ZA 1MNUH 1V05A 4RWYH 1H6FA 4DZBB 3S8GB 1HIML 1CE1L 3T71A 2EE0A 3V4VL 4PLKD 5ELIA 2CXKA 4U0RB 5BO1H 5B4MC 2DPKA 2EDWA 4N90D 4E9TA 3WD5H 4KVNH 4FQQA 4Q7DA 4RMTA 4M6MH 1WDAA 4LSQH 1E4KC 3RX8A 3MV9A 2JCCB 2VDMH 4OZ4B 4K94L 1YEGL 2DI7A 4Y5VC 5IFHH 2B20A 3QJQB 2YBRB 4JLRB 1GC1C 3MBEB 2FLBT 5E6ZA 3IMWA 3D08A 2JKJA 1Z9OA 4L05A 2B4CH 4O2CA 4MJIE 4P4KA 4TQEL 1DUYB 3EDDA 4FL4B 2HT4C 4JDZA 5CBAB 5AVWB 2CO6B 1FN4A 1JP5A 5EF2A 2G75A 4KQ3H 3QDJA 2AJXL 4X4XB 1KXTB 5T5NG 3OAYK 2BFGA 4BQCA 43CAB 4TUOB 1UB6B 2ZUQC 1VLXA 1BJ1H 3GMLB 1IE4A 3O0LA 1FO0H 4P46A 5C0BA 4OD1H 2BVUA 4HFUL 4XNMB 3BRFA 4U1MA 1KLFB 2NY3D 5H2BA 1C8PA 3D85B 2YFOA 3NCYS 4N8PA 2AVFA 3U25A 4X99B 3CDGA 4IBUA 2XQBL 2JELH 4ZSOB 2OFQA 4YXKH 5IMOB 2Q86A 4JCLA 5EBGA 4HC1H 4AQAB 3WFHA 1LDSA 4D94A 4Y4KC 3T4AC 1E5ZA 2Y7LA 1D6EB 1ZPUA 4JPKL 2XRAH 4C59B 3LQAC 4MJ6B 3FFDA 1P5VA 5KTEL 1DBAH 3A67L 3ULUF 3QGVA 5D71L 2WP3O 3AS1A 2YEVB 1JYXA 3NCJH 5ID0A 3ILQD 4FHJA 3LNGA 5EEUA 2C8NA 1QI3A 5FUZL 1RZIA 4F80A 3RU8L 2LTQC 5K1NA 2ATPA 2EUWA 2R2HA 3I74A 2Z31A 5EZJB 4UNVA 1XF2B 2XACC 2BRRL 4G80B 3BUIA 1KENL 25C8H 1N2RA 2FBJH 1A22B 4UILH 1DBMH 1N12A 1N5AB 4MNGA 2HWZH 4QRSB 1ZANH 1GYAA 4XP1H 1CO1A 4OGAC 3REVB 4ILDA 4G8AC 1QTYT 1CGSL 4KRPC 4M61A 4Q6IB 3CUPB 4EI0A 4MMYA 1VSCA 1GGUA 4M6OH 1AR1B 1PZDA 4RNRA 1CFTB 3MJGX 2NZ9C 3IKCA 4FCHA 1Y07A 3CFIC 1QFHA 3G5YB 1J9SA 2FYYA 3LKSA 32C2A 1ORSA 2CH8A 3WEBA 3J2PA 2R1WA 3T08A 4DCQA 4XXDA 1PG7H 3PWPB 4D8OA 3ARED 1ADQL 1C5DA 2Y5TB 3ARGC 1EHAA 1QABA 4NZUL 4NSKA 3IDUA 2HVBA 4JRYE 4PJGF 4G59C 4OD2B 3IDJB 5IIEB 4FA7B 1YY8A 4HD9A 4UAHA 1NGQL 5J56B 5HYEA 3CHQA 1XTLA 1J9TA 2I25N 4NKDB 1DN0B 3WJJC 2G4GA 3CK0L 5I1JH 3DVIA 5A1AA 1YHPA 4ERSH 1BWMA 1OGAE 4LVNB 1UD2A 3S3DB 3WIFA 3EYVA 3EJYD 5DEFB 3TCXA 1BOYA 4RRPA 4Z9KB 3LNFA 1QPXA 2XKSA 1TYEB 5D7JB 1N10A 2VDKB 4X80H 4A66A 4R3SB 1SY6H 2XX1A 2WCSA 3DX4A 1EGJL 1A9BB 4YDJB 3G5VB 3GSQB 1XCTA 1XV8A 3C8KB 4L0PB 2QR0A 4MZ3A 1KPRB 2WGXA 1THAA 1N26A 3WO3B 3MTRA 4ZUSA 2K6YA 2OZNA 2TAAA 4X50A 5DD6B 4J3WA 4RFOL 2ID5A 3PDDA 4LCYA 4UV7H 1A3RL 3GZKA 1P7BA 1Z2KA 4KKAC 4XNXH 2WBKA 2WLMA 4RESB 2XIIA 1LVEA 2X2JA 4WUUA 4MJIB 3MV8E 3DTUB 4YL9A 1WJ3A 3MKKA 3U9PH 4EDWL 3NK4A 3D69A 3ZPDA 2OK0L 3AB0B 3MNWA 1T1WB 2EE6A 4JGJA 1ZGLM 1V54B 3X12A 2J88L 4DK5A 1X7TA 4HG4J 2EVIA 1GZPA 4LQ1A 4Y2NA 5LBSH 3RGHA 2FEDC 2EAEA 2NTSP 1BYNA 1CR9L 1WH0A 1C7TA 4C56D 3GMMA 3MR9B 2QSTA 5LN4A 5LG1A 4O4YH 3IPFA 4P0DA 2YPLA 4XN9A 5F21B 3TN0B 5K9JH 3KVQA 5IHZA 4R4BA 3BXNA 1EO8H 1G4MA 2VXUH 4JFXA 4K8RH 5JW3L 3CXFA 1J1XH 4HGWB 2CLVB 4WI9A 4BV1A 1LDPL 3FO2A 1KT2A 2H3XC 3GBLA 4IM8A 1FFNA 1HXMB 2WOYA 5EZIL 1ZA3B 2FGZA 1NOLA 3QJOA 3O3DB 4KK8D 1LEKB 3F83A 1WSST 1S9YA 2AAVA 4JPVH 2ITDB 4FKHA 1LO5A 2G3MA 5EBLB 2EQDA 1IGFL 3VI3A 2H41A 3CIAA 1KTLA 4PW4A 1YA5A 1KTCA 5DJAA 1X5AA 3F85A 2BY0A 4UM8A 2NUPB 4KJWD 2PYED 3SPJA 2R27A 5GHWH 1JGEA 3FAWA 4I18A 5AVTB 3MRQB 1CS6A 4BKLA 2VQ1A 4IOSD 1VZIA 2UVEA 4LPUA 2ZUSA 2QTVA 3TJEL 1EMTH 4AG4H 1BJ8A 5DYFA 4OCXL 1R47A 4X4MA 2VJ0A 4J4PC 2Z35A 4FFZH 3OMNB 2XYCA 2J21A 5E6SB 5C7XL 3OKEB 3D18A 2OW7A 4Q56A 1IE5A 5J1AB 3FS9A 1YMMD 5AQ0A 1LK2B 4OF5A 4D3CL 2C9SA 5MP6L 3VCLA 3A24A 3HLAB 4PRID 5I15L 1XR9A 2Z8SA 4L48A 2VIRB 5MI0C 4YDNA 1QKZL 3HZYA 5C07A 1L5GA 3HPJB 4GW4B 5DZVA 3D87B 5DD1H 3I9AA 5EZPA 4GQZA 3GI8L 4TXVB 2A2QT 5IJVA 1SHWA 2FH8A 1S9VA 3QUZB 4FYQA 4H8WL 3DBXA 1G7JB 3PL6B 4AM0A 4XP4L 3POCA 4OQ1A 3ZKND 3BSZL 4UTBH 5E8NA 2VDPH 2NNRA 2ZUTA 1XF2A 4GRWH 2CLRB 1PLBA 4NO5A 1KYOJ 1KCVL 4XC3H 4K9JA 2LAAA 4LDOB 5DC2A 3TZVB 4U3SA 1AGBB 3L4TA 3TV3L 4FTDA 3NFPA 1V55B 4Y2OA 5D1XA 2QGCA 1AS6A 1P7KA 4JRYB 2ROXA 3H2PA 4Q9CA 2GABA 2X0UA 2DQ6A 1JZGA 2IPUG 1E43A 1NMAL 3K74B 4JFPA 2HT3C 3RKDC 1F0LA 2R2CA 2N7SA 2FJFA 3MLWL 4YUEL 4G9FA 4M4RB 1DLFH 4NGHH 4OGXL 3AAZB 3WIHL 4HPHA 3P4OA 1CQKA 4PBDA 5IB2B 3IMRA 2NY5C 1OGAB 3PNWA 1YJDH 4L3CB 3BAXA 4DP5X 1JK9A 2J5WA 1GTNA 1JNLL 1PY9A 3BKCH 3FZUC 4N2CA 2DMKA 4OBSA 2JVUA 1KFGA 4X6DF 5C86A 1AJ7L 2GTQA 1FP5A 3CBKB 1U2CA 4GQPH 5GS1B 2FATH 2BMKB 2VR4A 2WLLB 4XH2A 2YWZA 3QQNA 3M17A 2QDVA 3KWUA 4X83A 4WU5A 3QNFA 3C87A 3VH8A 1T6BX 2E7DA 4FQJH 1PLGH 5C09A 4A67A 1XEUA 4XX1G 4EMZA 1KPVB 3G6DH 2A73A 4GINA 1J86A 5IOPA 3MV8B 2I7SA 3L3HA 3QEHA 4YZFF 1ADWA 1G0YR 1CYGA 2CBMA 3Q3GB 3IJ8A 3ZUCA 5AZEL 1JHKL 2NY4B 4E9YA 4YPGA 1E4XH 4QXGH 3N91A 3QDGD 5TH2A 4AQEA 4MXVE 1H5BC 5D5ME 2F19L 4N3UA 2XFXA 5FHAH 4RDBA 5CJOH 1NPJA 1BF8A 5CAYB 5J5EA 4IBSA 1PX4A 3N2JA 5F7KC 2ENJA 3MLPA 1OTTD 5B39A 4GH7B 4WI4A 1Z9PA 1RLBA 3FU3A 2QQNH 2VH5H 4BZ2A 7PCYA 2DKMA 3QIUD 4P2RA 1W8EA 3CH1A 5FYLH 4JRXA 2NR6D 1IAOB 3BPLC 4WI0A 5JPMA 3AT9A 4CSZA 4G5ZH 1T83A 2O5XH 3MRMA 2XBDA 4JY6B 4U6HA 1GCFA 1BVNT 4W70A 5CHNA 5I5RA 5I74B 3QEGH 5A3IC 4KITB 1G7LB 1JZEA 1S7QA 3X14B 1YQ2A 3BAWA 3VI3F 2VLRA 5CJBA 4YXLH 4NP9A 4X7TB 2A0LD 2QQQA 3GSNL 5CCGE 2IH1A 1GZQA 1JN6A 4U2ZA 5JPNC 4K7FA 4XNZC 3FXIC 5INCA 1Y6KR 1NC4B 5DEGB 3SYAA 4WW2C 3EOYG 3P3RA 2X2YA 1I53A 1LWRA 3ZE0F 5ERWA 2E7LA 3VRLF 3HRPA 5IBTH 3WJMA 4IKKA 4YLCA 1H3PL 1FZKB 1WFUA 1OAQL 2HVJB 1XH0A 4KU1A 1LO4L 3CFEA 1RZPA 3BQUB 4OT1H 2ZCKH 3FTGA 3Q0HA 4IMLA 3B2PA 4IYKA 3NZUA 3VWJC 3I6GA 5A6LA 1JDAA 2V5TA 3NJVA 1UTDA 4CC4A 5FWQA 4M93B 3SPHA 4JO4L 5AVZB 3RVUD 2VMFA 3ALPA 3MNVA 4ZO8A 5B3SB 5AD0B 3DDGA 3OJDB 5E2UH 3GFUA 3RWIB 1M7DB 1W0YT 5C2UB 3GMQB 2WMPB 1EEZA 1N5YH 4WWKC 3H42L 5GGRY 1JXDA 3AROA 2UUDK 2YAEA 3VXSA 5LNEA 1WGVA 2YK1H 3D2UD 1A3LL 4YC2C 3UTOA 1EK3A 1HZHL 5IJKC 3OKOB 5DGRA 1MUJB 1GAFH 2EILB 3KL0A 1NM4A 1WAAA 2KPNA 1YN6B 4FQIH 3Q48A 1SXBA 5F88B 3FB6B 2BSTB 3LVTA 4NKMB 4Y88A 3T65A 2AEIT 2J8OA 1H3TA 2AVGA 1FVCA 1JZ7A 4UBDC 3AMLA 5CJXC 1WVZA 1QSFE 1XR8B 3IXAA 4WRLA 1ZY9A 2OP4H 4M9OA 1U8PB 1MCRA 4JFEA 4NFBA 2FBOJ 1T7WA 3NQKA 3MLZL 1G1CA 4BKTC 3M7FB 3CHRA 3R7RA 4X6EA 3C75A 1OZUA 2FEJA 3C9NB 3EOBA 2FIKB 3CZUB 3ISRA 1IC5L 3TA4D 3CQPA 1AKPA 4YFLI 3VFMA 2LU3A 3NEOA 1BZDA 3O6KL 4NWUL 3RAJL 2ESVA 1XGUA 4L9LA 2XKUA 4MSWA 1TTGA 4AIZB 5C6WH 2IDQA 4MA7L 1OP9A 5LAPA 3QJXA 4YZWA 4RX4A 5JHDE 1R24B 2E7HA 1OE1A 3E8UH 3MOBL 3GSWA 2JJSA 4OJCA 1JGDA 2NZIA 5J89A 3U0WH 1HYSD 5BRZD 3KHOA 2YQGA 3IMSA 5FDWA 1XL6A 4RGNE 1YNLH 1OE2A 3L5WA 3NSDA 3T6WA 1KJ3H 4H20H 1L7TH 4HJ0C 3DJ9A 3VXNB 3WE6A 3K6DA 1BXXA 3MOQA 2GB2A 2B9BA 3L7FA 5DQ9A 1FYTE 1MPAH 1MCQA 4MDJB 4MCZA 5GJTH 2D31B 3C60D 5F7NC 1D5XA 2IAMB 3T04D 1R6VA 3GK8L 3IE4A 5D5MB 5B4MD 5KVGH 5H4ZA 1RUML 3LRKA 4KY2A 4EIZC 1EXHA 5F1IB 2CAKA 1P5UA 2NW2A 3GSXA 3U6XS 1TZGH 5DTFB 4G7VL 5IB3A 4P5RA 4PAZA 3HE7C 4OLVH 1OF0A 1FDLL 1CL7I 2YPVL 1PJ9A 2D9CA 1QHPA 4LCIL 4F93B 3HBQA 4FX5A 1E5AA 1J5OL 2WVTA 3VDBA 3QQ3B 4NAQA 5EBMB 1MJ7L 4IMKA 2HT4D 3DURA 3NP3A 2IQ9L 4F57L 2PABA 4JKPH 2WZ0A 3IDGA 3P9MA 4KHXH 3DHMA 3WNPA 5L7XL 1E4HA 1S3RA 4ISVB 1PIFA 3SDAA 5IVZA 1Q4NX 1VRSA 4JQVA 2C3HA 2HP4A 3HHSB 5D1ZB 4CVZA 5K9OA 4P3CL 1DDHA 3FT0A 1NLBH 4GJTB 5FC9A 5IQ7H 4L1HA 1ASQA 1P4UA 1U8IB 4DUVA 2C9XA 4HIIA 4QHNA 4FULA 2WLJA 5GGTL 4K2UH 4GRMA 4PJIF 4E9SA 3RUGE 3CQQA 3CX2A 2RFXB 4GI6A 2GEQA 1ID2A 2QMJA 4FABL 4Y4KD 3KNBB 4PVLA 1CGUA 1RLWA 4FTVE 3FL7A 4M7JH 2GCYB 3KVDD 3MLXL 1UZ6F 1MQ8A 1D5IL 2MRYA 2DOCA 4WCYH 1DBBL 3OQRA 4N22A 1YEEH 5BQ7B 3ZR5A 1XF3A 5FF6B 3IM1A 3RL1B 3LB6C 4JHAL 4FQ1L 1GW0A 5IW6B 5I75C 4Z3TA 3EDFA 1MI5E 4K3JL 4NM4H 3VXUA 3IEAA 2V5YA 3L45A 3QUMB 3K8LA 3CDYA 4Y5YC 1WHOA 3A3YB 5E2VH 2DQDL 3QHFH 1IRAY 3QG6A 4ATWA 3V55A 2G5RA 4UINH 4P9ML 3WFBH 2BC4B 4HKBB 3MUHL 2DKSA 3Q2CA 3X1NA 4FA8A 3OX8B 1AFVH 5E7BA 4XN7A 3RBGA 2WVVA 1IT9L 5DWUH 4XVOA 2OPCA 2XCMC 1UCBH 4Y4FB 3AZUA 3K4ZA 2WNWA 4OGAD 2EH7L 1WAAF 4LF3B 2Y1AA 1OAKL 2H6PB 2YUWA 4HUUA 4KRPD 4RFNB 3ARQA 3P4MA 4YDKL 1A7PL 2YAMA 5E2TH 1N0XL 1QSFB 2LOEA 4QGTA 4P2QE 5MEOB 3QUML 3BEWB 3CPLB 3U0TA 1LLAA 1M9WA 2WBJA 2A77L 4B9KC 3OSKA 2NZ9D 4X5RA 3FT1A 1RIUH 2BSED 4CA4A 2RH0A 3ATEA 4R7DA 1ULVA 2IC2A 5AVXB 4PJ5D 1A4JB 1FZJB 2BFVH 5FW8A 5HDQH 2GITA 3J27A 4NNPH 3V4UL 1YC7A 3K2UH 5KYYB 4HJ1A 4YHNA 4IQHA 2OXHA 3VXTB 2E56A 1JHLH 2A6IB 4PJXA 3DLQR 4LARH 1J1PH 4KMTH 2HKFL 3FRUB 1CUOA 1ZWIA 5AW6B 4AL8L 4CMHB 5JHDB 2D4DA 3HS8A 5E4OA 1YN7A 3MXVH 4OLUL 1T7YA 2Z1PA 4NWTH 3JWDC 8CGTA 3UC0L 4F58H 3AXLB 4ZFGH 2C4FU 5KYWA 3FQNB 5HVWA 4RGNB 1OL0A 1KBKA 4N6QA 3ROOB 4H2AA 4U6YA 2H47C 5B38G 5KSUB 1GMEA 2ALWA 4N1CA 4PP1D 4AQ8A 2JJTA 5E00B 1FYTB 1MEXH 4JJ5B 4IRSA 3QUXC 4IJ3B 2IMMA 3QFDA 2HJKA 4LBAA 5JLZB 1YC8A 1SNRA 1IBHA 3E6HB 1UEMA 3HPLB 5F7BA 3VFUA 4Z7QE 4FLHA 3PQYE 1TTAA 1HKLL 1G94A 4JVUA 1YAZA 5JXEA 4BXSV 1HHJB 2OSLA 3NJFA 5E5LA 4JB9H 3RZCB 2Y23A 1NLDH 1W72A 1QEWB 1AIFA 2VM3A 2XZQH 2XIBA 2UXGA 3T1FB 1N70A 4AUJA 4FHKA 4P59L 3P11L 1XF4A 4LL4A 3JVGC 4EN3C 1F45A 2OYPA 2DDQH 3H0TB 5I66A 1NUGA 5KBMA 2VQUA 3OKMA 3V6OE 4MCNA 4BK8A 1ZVSB 2WXIA 1I8KA 2FEDD 3IT8D 4G7SB 4JY4B 4KK6D 1ORQB 2BHUA 3VU1A 5H94A 3V7AE 1CICC 1DHKA 1U42A 2KZ1B 2WLNA 2X1OA 3RWJB 2HRHA 1BEYH 1CTNA 1RJYA 1UM4H 2ENYA 2HKHL 3K3QA 5L6YH 1BVLB 5IF0B 4PJFA 4WK2B 4ZD3L 2ZUXA 4ELMF 2YPKB 2IGFL 1SHXA 5EZJA 3BWUF 3BCDA 3MLYH 3O6MH 4KXBA 4XBPA 5C0AD 3UL4A 4QYAA 5D55A 1SOKA 2YD6A 4UYQA 4TOYL 4JW3A 4RBPK 4BCZA 4WU7A 1MFUA 1TO5A 1YQVL 1WIOA 5IEHB 3N5AA 3UAAA 5TDPA 3RUGB 1YMHB 3C6EA 4W9DC 1EJ6A 4XMLH 2D7OA 1FL5A 2XTJE 4FTVB 3AWGA 4IRJB 1KZQA 5E95B 1T80A 3DO7B 1I9IL 1OT2A 4HLEA 4WHTA 1F97A 1OSYA 1U8KB 3C6SB 3WIIL 3ZXAC 5I1HL 4JFUA 4M1GL 4LLYA 1JGIA 5D6CA 3RY4A 1E2VA 2GC7C 3FDWA 1E5UI 2EACA 3JV6B 2CSPA 4PWKA 1EEYA 1QACA 1WYJA 2WXLA 4P9HL 3KG5A 1A65A 4HPOL 4CU6A 1MI5B 3F58H 4C4BA 1U95A 1HOCA 5IKCB 4OH2A 5T1KB 2GFBA 3W81A 4WTWA 3U30C 5C0CA 1U8NA 1MQKL 3FO0L 4OBRA 4JO8A 1TTBA 2I60H 4HZLA 2XUWA 3PHAA 3BIBX 4JMXA 3L5XL 2GBAA 4BUGA 5F93C 5HHPB 5T1MA 3ATFA 3QPKA 3ZYOA 1XXFC 2P5EA 3OMAB 2Q3ZA 4DO5A 4BZ2H 3UTTE 4RMSA 3P73B 5A40E 5T3ZL 3WLBA 4AYMC 4LSRL 1CGTA 1IGTA 3VGBA 1AZUA 1W0WA 3S9DB 3TF7C 1G6RB 1UD4A 2P8PA 4P2QB 4HOXA 2D7TH 4LGRB 4AT6B 3PJSA 1YNTF 3L4WA 3QUYB 1DUZB 4UQEA 1R1CA 2EIDA 4DO6A 2WSPA 3QZOA 5IVXA 5GGSB 3DX6B 1JFQH 3PG2A 3B83A 1SXCA 4X6DE 4G6JH 3ARGA 3DYMA 5LVEA 2X53A 1E27A 1SBBA 3U48A 2F7OA 3MKGA 5I8EA 2J73A 4OJYA 5AVSB 43C9A 1V3KA 4ZW5A 3QO0A 3L9RA 1WBZA 1A1MB 3EJRA 4IU3A 5FUCC 3S2CA 3VWKA 4N8VA 1VGEH 5ESVB 2FD6H 3QFGA 4PJXF 4YDIL 5DUPL 5FO8A 1RK0A 1VAHA 1CDYA 2HT3D 3MLUL 3RKDD 3SDCB 4ZTEA 4HIHA 1G6RL 5LCVA 1J0JA 2P44B 3EJTA 2IJ0C 3VFGH 1NCJA 1PZ2A 5HHQA 2BZCA 1ND0A 3CMOH 3H85A 2IFFL 4E5XG 2G2RB 3FUEA 5D7LE 4I3SH 3TVMC 5CP7A 3VD7A 3IU4H 4LHUB 3T3MF 1SDAB 2MOVA 1Q0XH 1LGVA 1P7QB 3BVNB 3H9SA 1PLAA 5DJXA 5TF1L 4LU5L 1R0AH 3T0AA 3UPRA 3HE6A 4RRPM 4Z7QB 2FE0A 3PQYB 1N6UA 3ECWA 4OU3A 3DO3A 2QGDA 2ZUWA 2H0PA 4W9JC 1RHHA 2K4AA 3KPOB 1UA3A 1WBYA 1QSVA 2YGOA 2M8XA 1JGUH 4O51A 4GT7A 4JUTA 3RGVA 3WNIA 2CA4A 2I85A 1WP6A 3GRGA 4HWZB 4NAMA 1OP3H 1JE6A 4ACPA 1CU4H 2D0FA 1HCYA 4MFHA 4W4OC 2GTZB 3HUJF 3HG1D 2J1ZA 1JCVA 3H1ZA 4DGVH 3MN8A 2ARWA 2N56A 4NO0B 3I2CH 3ULVL 5FXCH 1ZSDB 4K3HA 1B4RA 2CBPA 2D0HA 4NQVB 1N59A 2GJ6A 2IALB 3DOSA 3KPPB 2OI9B 3W0WA 3I9PA 3UYRH 2ORBH 2LV4A 2NW3B 1CQYA 1Z9NA 1ZE3H 3IVKA 2X1XR 2EDNA 2QPDB 4CBZA 4LIQH 2GW5A 1SJHA 2BP8B 2R69A 2W07A 3OM3B 4M02A 4P23B 3WXVH 1FYHB 2R7EA 1F4YH 3F65A 3BESR 4UOW0 4BEIA 2XTJB 3WDJA 4GAAA 4KQ4H 4L4VE 4DHLA 5FYJL 3UTQB 5LLIC 3K71A 5CJQL 4AENB 3EKCA 1NCCH 3H8NA 3M8OL 3MBXL 4S1QL 2WQ8A 4FFVC 4HKZB 4TNWK 1K4CB 4UAOC 5ITFB 5FPIA 3TEXA 5D2LA 3TOPA 1BFVL 4LCWA 2UYLB 1Q1PA 3QAQA 4M5ZH 4ES8A 1F90H 1LWHA 3KLAA 4JMNA 2NSMA 4WTXA 5E1AB 3FTSA 1TQBB 4ANWA 4U6VH 5C6PB 5L4JA 4JANA 4EOWL 2AAAA 2BSCA 3RWHA 3L17A 3GM0A 3DWTA 1GJIA 3LKQA 1FFOB 2K9UA 4C83B 2DIBA 4BWUA 3GT6A 1ES0A 1F4XL 1DL7H 5HI5C 2J1WA 2QLYA 1E9QB <