3L48A

Crystal structure of the c-terminal domain of the papc usher
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
b'GKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane usher protein PapC
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 15
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l48A01
3RFZB 3L48A 4J3OD 2KT6A 2XETA
chains in the Genus database with same CATH superfamily
1Z9LA 4XNDA 5JMRA 3GBNL 5IHZB 5DHYB 5D1ZA 1IJ9A 5BZZA 3P0YH 3H55A 1AZZC 1JWUA 5E9DA 3BW9B 1BAGA 3MJ8A 2LOEA 1EZVY 5EUOB 3HOGA 2A77L 4WKXA 4FXGA 1FJ1A 1B0IA 3IKKA 3X3GL 2A1WL 5TDOA 5AFAA 4JFUA 2CWRA 4JE0A 2YPKA 3CCHA 1IB5A 3K6SA 3ECQA 5J9PA 3U9UA 4KRLB 3NMEA 4XMPH 4P05A 1NLDL 1S9XB 4BFJA 1UWGL 4TUUA 3WIIL 4Z23A 2Y7LA 2XG4A 1N0XL 2AEWA 5KS9E 1T89C 4PJ6A 4CVXA 2AK4E 2BO0A 2HFTA 3MR9B 5GQBA 3UXFA 1SJEB 5L9DL 1DQLH 1S7WA 3GBMH 3T0EB 4NIKB 1DTUA 1RHFA 3PGDA 3UTPE 3V6ZA 4RZCB 2WQAA 5B39A 3WJJA 2CDFA 4HMCA 3M07A 1FQ9C 1HHIB 3RJQB 5GGUA 3BSHA 1MCLA 3JV0A 4L4TA 2EYSB 3EYUL 4QEGA 2JIXD 3FQNB 2PXYA 4QNPF 3RNQB 4DFIA 4KKLD 1UD8A 4BD4A 1D5XB 4KVCL 5I1GH 1Q1JL 3QS3A 5E5RB 4LDEB 1TITA 1SLXA 5TK2A 2B77A 3U0WH 1M56B 1V7MH 2ZUXA 5BCAA 3BPOB 2EYTA 3FU6A 1WTLA 5I17B 3VQ1C 2JCCF 4JFFE 1A3RL 5HXMA 3DNKA 2QPFA 4PRPD 4RIRB 3FQ2A 3BYYA 4BV1A 3P73B 2OCCB 4ZOAA 5K9QI 5J6GA 1ZV2A 3UPRA 2A4CA 3ATAA 4QKXB 4HKZA 2ZOTA 3L9EA 4MJ2A 3ZL4H 1KYFA 1P7QB 2R29H 4HXBH 1TNNA 3QO1B 4UIKH 3C6SB 1NUDA 3SBQA 2QTEA 2LVEA 4M8QB 3BVTA 2ZXGA 3PABB 3PDDA 1BREA 4PW4A 3VX0A 3GB7A 3A22A 2XV3A 4G7RB 4HSAC 5I82A 4M43L 3MYJB 1J12A 4BH7B 3CDYA 5CZXD 1KJVB 1X5GA 2ILLA 5H4YA 5L6YL 2ESVA 2GFBB 4YSQA 3BGFB 4HSQA 3M1CA 4NZUH 2ALAA 2R56L 5PCYA 3VG9C 4CA4A 2DBJA 5J7CC 2GUOB 3U4BH 5HDWA 2ETWA 2J72A 5ESVA 5ECGA 2X89D 5JA9A 3H85A 4L4JA 4IBWA 3CPLA 4N2IA 4OLVH 3G08B 1YY8A 3H2QA 2VXUL 1AGEA 3BP4B 4XPAH 5HHME 5M94B 3L08A 4C56A 2AEIT 2C34A 1HI6B 4XCYB 2FYYB 2YA0A 1GRWA 4G7VL 2HFEB 2VR5A 2Z31D 4P07A 3RL2B 5DMYA 3PHAA 3NG5A 3P9WB 4DZ8A 1YDPB 4BDVB 1QWUA 4NWTH 2Y2YA 4Y7OC 4H20H 2CK0H 3O6LH 3FQRB 1CXIA 4R9HA 1JL8A 1XTMA 3TCLA 2AABH 1C1EH 5I1KH 3SPCA 4PJIE 2CLZA 2HPTA 3MNZA 1FIGL 2RB8A 1A4AA 2X3CA 4KKNA 3KLDA 1CJYA 1AXSB 1VFBA 1CXHA 4G8FA 4ZUTB 2OCFD 3VA2C 3L1EA 1JPEA 3LKSA 3OKEA 3V7AG 5EPMA 3NSYA 4Q8BA 4Q4EA 1S8DA 1AQMA 3L5HA 1O7DE 3M17A 4DT2A 2AEOA 2CGRH 2EDKA 1LTXA 2YAMA 3RQ3A 4NNYB 1YYML 4ONHA 2WNKA 4JFED 5AVVB 3TYFB 4N2LA 3TH3T 1OSZA 3MCKB 3EXLA 4LEXL 2W91A 3NA4A 3QEHA 3WS3A 3AMLA 3X13A 1IGFH 1JPSH 4MX7B 5D1XC 1UB6B 4P5SA 4P23A 2VW7A 4NM4H 3PDGA 3VAEA 2OL3B 3DXAD 2L0DA 2W0KA 3LQAC 2QSVA 3U46B 2BSSA 4QRPB 1HYRC 1DZ0A 5EO9B 2KI6A 1BZOA 2XWBB 3OXSB 4MLSA 1JF6A 3Q2VA 5GGVL 2IWGA 3CVHL 4G2AA 4KKCD 1BZ8A 4E0RA 1CFTA 4GINA 2OR9L 4N5EC 5FW7A 3RIFF 3ZDZB 3LXCA 3WELA 1HWHB 1AFVL 1PNDA 1NKRA 3EGSA 4IMLB 2AJUL 4RX4A 2EH8L 3B9KD 2VDML 3MCG1 3SBWC 5JTWA 1QLRB 2PP9A 4H8WL 4I48A 2JELL 3I3EA 3QPKA 5E8EA 1CQKA 1PLGL 4RSYA 5FYLL 3MRCB 4GXVL 5CNHA 4XCFH 5AZEH 5F1IB 1XH3B 5AVYB 2K4WA 1IGJB 3VXUA 5FDWA 2IALA 4PB0L 4L1HA 4URTB 3NIDB 1ZHKB 3F7RA 4NO5B 4Q2ZA 5CLTA 3X11B 2VRAA 4IKJA 3GBDA 4BHUA 5F7EH 3SDDC 3QUXA 4Q14A 1W8OA 4HJGB 4FGMA 1K9TA 3DROA 4RDQF 1AY1H 4N1HB 5CEZL 3SE8L 3QJFB 3MXVL 4GRLB 3O45B 4U3SA 3V4PL 4OQTH 1DZBA 4LVHB 4PRHE 4L0PB 3O9WA 4QRRD 5D70H 1CUOA 5CJQL 4I2XA 4EI6A 4KROB 5DLMH 4LESA 3EFDH 4Q4IA 2L7EA 1AD9B 5GGRY 1PDKA 2ZF8A 3RU8L 1N59B 3LQZB 4PJCE 4ZD3L 1J87A 3WFCH 1JHLH 3W5NA 1WZAA 2AANA 2C3VA 4PJ8C 3RL1A 3ZIMA 1UHVA 3BFWA 2AJVL 1ZY9A 4DN4H 4QXUH 3DV4A 4H8QA 5KANI 5IFAL 2F0CA 4HWZB 2BMKA 1KJ3L 2AKRA 2AXFB 4R3SB 1ZHNB 1FVEA 3AY4C 1NAMH 1IGIH 2O6CA 4OZIF 3D39E 1IC5L 2WINB 3AROA 3NTCH 2BJMH 1JNNH 2W0FA 1W72B 1OGAA 3B5TA 3QIUA 3U82B 4P5TC 4R97C 1U8JB 4CAGA 1U36A 4CMMB 3F3HA 2BP8A 5F1NB 2VDOB 4JRWA 5F9OL 3U0TA 3BZEB 2FWUA 4W9IC 1BM3H 3BT0A 4X7TB 1SLWA 4YO0A 5JW3L 4GAJL 5G4MA 2JCCA 1F6AA 1CK0H 2R4SH 4IKLA 3N44F 4YC2B 2G4EA 3QQXA 3VCLB 3O11B 2NXZC 4JFZL 3TBVB 4EUPH 2V2TB 1C12B 1NGPL 3VW3L 1SJHA 3ZE2B 4FNTA 2WO4A 4J1UA 4WHTA 2IGFH 3TV3L 2QVIA 4HD9A 1LEGB 4ES9A 1WIUA 4GSXA 1RJCA 2FJGA 1NGQH 1EJ8A 1YEFH 4JQIH 4L8DB 3JUYA 3SPHA 4BE5A 5AW9B 4RETB 1T3FA 2BERA 4LRIA 4BQ9A 4K55A 3HTLX 4AVKA 2MRYA 2V7NA 4TLTA 5IJVA 3CFNA 2PCXA 1G7JB 5DUBB 3ZOAA 5BS0B 1UFGA 1OB1A 4RZKA 1I3RA 3O3EA 2EIJB 3VRLF 3GO1L 5MHSE 1GY2A 5I0YA 4YBLC 2BSRA 3CVBA 2J8UB 4FLOA 1ZGLP 4LSSH 1J88A 1EJ6A 3H9HA 3IM1A 4NUJB 2PXYC 1ACXA 5SWSD 4XWGL 1KXVA 1ZGLA 4Y9BA 4DCQB 1U3JA 3EOBB 3AXIA 1DQKA 3GM0A 2QBWA 3NT0A 3B3IB 4HH9A 5H94A 4HLZH 2KL6A 3QZNA 1G9EA 3ALWA 4AQ8C 2DTMH 3MLWL 4DNLA 2NYZA 4K3EH 5KVEH 4FNLH 1JK8A 4PWIA 5HHOE 3FFCB 5DRZA 4J8QA 1RZQA 3HHSA 3V4UL 3SGDI 3QPXH 2Y07L 1QLFB 3LKOB 1XZ0A 3FT4B 3DETC 2I32A 4B9JA 1TCMA 4HLJA 4YDZA 5C0CB 2VJXA 3K4AA 3WUWA 3R1GL 4IU2A 1TPXB 4TMPA 2G60H 3OAZK 1OKEA 1A2YB 2O5NA 2X0VA 4TVPL 2V17L 2WBXA 2X7LB 1DQJA 1RLWA 3VGHA 2DLEA 1A7RL 1HINL 4J3SA 2NX5E 1AZUA 1HHKA 1WO2A 2CBPA 2FX7H 4PTUB 2YPLB 4X9FA 3WIFA 4X8CA 1TZAA 3RVXC 2WBKA 3E9TA 5SX4H 4KGLA 1T6VN 5CJXA 4PRNB 4RMWA 2PCFA 1QWHA 3L3OA 4GI9A 5EUOF 2Y6SC 3AXLB 1EFQA 4KQ4L 5CP7B 4QJ4B 5IJKA 3I6SA 4E9RA 1FO0H 3OZLA 3ESVF 3CN4A 5GIRB 2IAMD 4FQ1L 1WRFA 3KL0A 5ALCL 5AW4B 2V5MA 1MRDH 3AUWB 4TNWF 4KDVA 4P4KB 5D1XD 3ULVH 4AL8H 1PY9A 2Q20A 4JG1H 1JK9A 1LDPL 5KEZA 2EEBA 1GZHA 1E8YA 1DDTA 2SEBB 1CI5A 1L9SA 3RWCB 1TVDA 2IGTA 1DSFL 2OR8A 2QKIC 2XHNA 3EJSA 5DVNA 4XAKD 4WW2B 3HNTH 2OMVA 2G5UA 2WIIA 2Y72A 5AW8B 1OT4A 3IJ7A 5CR8A 1G0DA 2XLLA 2FNWA 4N5ED 1MCBA 1CIDA 3UP1A 5F6HI 3QUZC 4BCXA 3FQUA 4U1HA 1AD0A 2AJZB 3GSVA 1N19A 2XQBH 3IDIA 2X1QA 5KBLA 1U8PA 3BVNB 5JIPA 4OFKA 1F90L 3BVDB 1JZJA 3FTVA 3KYNB 4DKTA 4FE9A 4MD4B 1MRCH 2P8PA 3F5WA 5CSZB 1AYRA 3ZSTA 3Q8BA 4LSPL 1FV1B 1V27A 3PHOA 4XC3H 3RWDA 2NXYC 1PYWA 3FN0H 2XICA 2C3WA 4NAMA 1SUJA 2WO2B 1K5NA 4QRQA 3LZFL 1QUNB 2J1XA 5HJ3A 4HIHB 4MSWA 3WENA 1IE4A 4OCSL 1XGTB 5B38B 1AR1C 3SDDD 4NQCB 4W9DC 1LMIA 5ESAB 1K2DA 4UOZA 3QDMB 5ITBH 4DKDC 3MODH 2E6JA 1L7IH 1QW9A 4Y16B 3QH3B 5DK2A 5FX3A 3TEYA 2BXZA 4P2CG 1JZ4A 1XF2A 2QJDA 4X4ME 4IEFA 3PAYA 4YE4L 1IEBB 4OZIA 4XPFH 4F7TA 2QR0A 2H8PA 2PETA 5AOZA 4I3GA 1E5BA 4M62L 2E4TA 3PXJA 3S37H 1ND0A 3KLKA 4NM8L 1LD9A 4AE1A 4EBQH 3OKOB 1TETH 3A23A 4PJ8D 4B96A 1DUYA 4M93C 5BRZE 3IGLA 1X7QB 4JG0H 1NDGB 1Q9LB 4P9HH 2FL5B 3ELAT 3RIFK 4P2AA 4LL1A 3E6HA 5A7BA 4D8PB 4FCAA 2D9CA 4HC1A 5CZRA 4ODSH 2B4CC 5JHLL 3FOLB 4P2RA 3PHSA 4L05A 4P5TD 4F37K 2BHUA 4UZGA 1NPJA 2JFCA 3QHFL 4CVUA 1T4KB 3MX0A 3HB3B 3GSQB 3QRFM 4G7YL 4E41B 1RZKC 3ZRFC 2CU9A 2IGLA 2JJVA 4ISVB 5F7FA 1UGNA 1ZEAH 2Y4SA 5E9DD 4U7KA 4JY5H 5LCVL 1PLBA 3ULUH 4A7VA 1JV5B 1H8NA 1DJSA 2YARA 1FDLH 1P5UA 3CC5A 3KGTA 5IB4B 4JDEA 2OSYA 4R84A 4Z95L 1FC1A 1Q4NX 3BVUA 3RDTA 3LEYH 1A7BA 1FNEA 1I7RA 1PNCA 3DK2A 3KHQA 5TQ0H 1OAKL 1ZLVH 3DVGA 3LIZL 5J4MA 5E51A 5HYJA 2ITCA 1EGJL 2P47B 1G7MB 4GLRH 3AB0B 4LPVA 1I9JH 2WXGA 1DJGA 2CDGB 4LMQE 4MJIB 4P99A 4XN9A 1DVFA 2ZXEB 3NCXA 1Y07A 3NJMA 4Z0BL 5TE6H 4JZOA 4QI3A 1PL3A 1K72A 1QRNA 3Q3GB 5E5MB 3BISA 1MIML 1T0NB 2DRUA 5IB2A 5JHDB 1JGLH 3BLBA 4Z3JA 4M7LT 4QTHA 1PS3A 2PXYD 3O8XA 4NZTH 4RLDA 4UM8B 4HIQA 5E1GA 1KFAH 5DD6B 3FT1A 3GKWL 1MQKH 2VDOH 3QJXA 4OF7A 5IB3A 1TUPA 5L2JB 3WN5B 5GS0L 5ANHA 3KHOA 5T33H 3I74A 2WQWA 5AVZB 3T8MA 1QBAA 2AQ2A 4D0BB 3QUYB 4YAQB 5H2BB 4UT9A 5LBGA 3IFNH 3DUUB 2V37A 2GIYA 3DBXA 1TKWA 4OVVA 3T0BA 2XFXB 4CU8A 3EG9A 2NNAB 1TVBA 2QGCA 3S36L 3NIDF 3CE1A 4PRPE 1YYLL 1P6WA 1G6RB 1N64L 3DETD 5IHZA 5DHYA 5EZLB 5D9SB 4YSEA 1QKZL 1OQOA 2DQCL 3BW9A 3N55A 4HK0B 4KC3B 4AQEB 5EUOA 4PRBB 3FTUA 1JVKA 4UBDC 1GYWA 4ZTEA 3QZWB 3UGUA 4Q9RH 3LEXA 5C2UB 2HRPL 2ZWNA 2AQRA 2YD8A 3SO3C 2R1XB 2K7PA 2UX6A 4YS4A 2Z34A 5ID1B 2XN1A 3T65B 2ESVD 3RVXD 1MFUA 1I1YB 1PZDA 4N24A 1S9XA 4RFNB 2FX8L 5EU5B 5IVXB 4Y4KB 3SYOA 1MWAL 1AGBB 2OMTA 3MR9A 5EU6E 2CDEB 1HYSC 1SJEA 1Y1DA 3O41B 4I89A 2Y6SD 5CGBA 2JWYA 1MZYA 3ZKNC 3ZKSD 4YDJB 4E9LA 2XWZA 4C56D 4ELMB 1U8HB 1OSYA 2XWRA 2MSPA 1NFIB 1HHIA 3I3BA 1BA9A 2EYSA 1A02N 3FQNA 2NNFA 2G9KA 1KCSH 5AB2A 1B2WL 2NUPA 4L1DA 4P46B 2DBLL 1IFHL 2CKNA 3RVTC 3UMTA 4XR8C 4Y5YC 3MV9D 3MGTB 1GY1A 4ICXA 2VLJA 3R0NA 1QNZL 5CJXC 4AEIL 4YPGB 5I17A 3DDFA 4RIRA 3P73A 4NCC1 1OE1A 4R7DA 1XH0A 4S1QL 1P7QA 3QUZD 2Q87A 3QO1A 3C6SA 3FQ1A 1NCDL 2G4GA 4MA7L 1SFHA 1M7DB 4P2OB 4RA3A 4M8QA 1U2HA 4ONFH 3MRGB 3ILEA 2JB6B 5F0LB 4YHLH 4DVRH 4JFEE 4KY1L 3WO4B 3PWLB 1X9UA 1KJVA 3PCYA 5FK9B 2VN3A 3U1SL 1SM3L 2GFBA 4PSPA 1KENL 2GUOA 5I5JA 2NXYD 1GZHC 4JG5A 3A5VA 3CZUB 4UQ9A 3CC1A 5A3IC 3NVQA 4TQPA 4JM4L 3VFWB 3ZU8A 4K94H 1AR1D 3BP4A 3UTSD 4DGVH 1OARH 3PGCB 1RPUA 1HI6A 1JPGB 4XCYA 2R0ZH 2COQA 3KH4A 3H9SB 4LSVH 5F9JB 2HFEA 2X4SB 3JTBA 4I0PB 3MNVB 3RL2A 1MFBH 3QDGD 2ZOKB 4BDVA 1H5BB 5FA4A 4UZUA 5GZOC 4JPKL 4TNWK 1MAKA 1BVLB 2F54E 3FQRA 3HMXH 2FAUA 5IFHH 1NBVH 3BAIA 2H32B 4L9LC 1D7BA 1UXSB 1RCYA 5E1AA 4PWFA 1JFHA 1AXSA 2X9WA 5TDPA 5GZNC 3QPQC 4HUMB 2BZ7A 4ZUTA 3ML8A 1I9EA 5FW6A 3VRIB 4B9IA 1EJFA 3S8WA 5DJZB 5A6IA 1GPOL 5FKAB 2FB4L 4MB1A 1ASPA 3BP6B 2BLFA 5IMOB 5DRWB 3FQWB 1FG9C 4OI7A 5F3BB 3F8UB 3II2A 4PRDB 3OZ9H 2N7BA 2Z65C 3GK8H 3P0YL 1E4XI 4FQXB 4I9XA 4JRYA 4NNYA 2E47A 4ZXBB 5ELIA 4CVZB 3TYFA 1ED3A 3LN4B 3FT2A 2GI7A 3WEOA 3MCKA 5IV2B 4N2BA 4U4BA 3IDXH 4HBCH 1MRFH 3BH9B 4X9BA 1FL5B 2A99A 2D3VA 4MX7A 3O6KH 3KPMB 3HS0B 4NDMB 4QRRE 2W81C 1J8HD 4XMPL 1CC3A 1EXUB 3DX7A 4BFBD 3VD3A 2DYPB 4RAUB 1E5AA 2D0FA 2OL3A 1QFPA 4BFEA 3PDOB 2I9TB 4QRPA 1ODAA 5EO9A 3AAZB 2XWBA 1DQLL 3BDYH 1QRKA 4MQSB 4L3CB 3BPLC 5FUCC 3IMWA 5AQ0A 1QSEB 3W5MA 2E46A 3AMKA 1FA4A 2ZKHL 1BQKA 4YQXH 1KCRH 4NNPH 2PKDA 1IT9H 2Y69B 4JKPH 1OGAD 1RZPA 4DP9X 2FO4B 4JHWH 3BLPX 4KK9C 4NQEE 5I1GL 5LN8A 3PQYA 4I5BB 1KYOJ 1U42A 1ADQH 5GJTH 2QGDA 5AG8A 3U0WL 1TQUA 1V7ML 5H37A 3MRCA 4YSSA 4HU2A 5KSAB 2XKSA 5F1IA 1XH3A 2OYPA 3KXFB 4BRJA 4WF7A 2XA8H 3WSQH 5JW4Q 1ZHKA 2FJFB 4NO5A 3I6KB 3ZTJG 1E8XA 4H13C 3X11A 2GK2A 5IVZB 4BQ6A 1AZCA 3GUTB 4GBXB 3ZL4L 2R29L 4HXBL 4IJ3B 2YA1A 4UIKL 5FGCE 4PY7A 2MFNA 5GGTH 3HZMB 2YUVA 3QJFA 2A83B 1JMZA 4A67A 1Y6KR 4GRLA 4GQRA 4F7KA 4ZMYA 5C0CD 3O45A 3GQFA 5ANME 1PX8A 4WQOA 3FU9A 3UFIA 4F20A 5CHNB 3T6VA 1LE5B 4KV5E 3CNKA 2WGNB 4NZUL 1WITA 3QEQD 1AD9A 4XNMB 3U4BL 1N59A 4W9LC 3LQZA 5E2UH 1NBCA 3MRMB 4K4KA 3DA0A 3O8XC 5C8JA 4OLVL 1U4FA 1XCWA 2BP3A 2Q1EA 4UAOC 4U31A 1SOSA 1E9PB 3H8NA 5SWSE 4XPAL 4HWZA 4MXWH 4R3SA 5CS7A 1ZHNA 5IB1B 1YSOA 1ZHLB 3KPSB 2DW5A 1NCWH 5EZJB 2D2CC 5CN2A 5INCB 2QVTA 5LQBH 1YY9C 5I1DB 2QFRA 2FR4B 4Y9GA 2BY1A 2BNQE 1W72A 4NWTL 1BF5A 1HYSD 2WIMA 5CILH 4Z6AT 3QXDB 2WPGA 1TSHA 3MACH 4H20L 1U8JA 2CK0L 3O6LL 4WUUB 5TDNB 2P8MB 3JWDC 2VR6A 2AABL 3ZKND 2VUOA 1C1EL 2ZUVA 2PTTB 2WCSA 5I1KL 3UG5A 2I25N 1OV8A 4NKIH 1Z9OA 2DJ4A 4X7TA 1CICC 1EAPB 1S4IA 2CHZA 2ZKMX 3BPNC 2YWYA 3KBHE 1ZVYA 5GS3A 3H7LA 1T66C 1TG8A 4KUZH 3TBTB 4JO2H 4WWNA 3TBVA 2V2TA 1X7TA 3BWZA 2CGRL 4I85A 5HGBB 3RVTD 4L29B 3MV8B 5D55A 2HN7A 5EC2B 2EIDA 4FFVC 3T2OA 3T3ME 4UDUB 3BSZA 3LKNA 1KB5H 4PIRF 1MCEA 4GRWB 4NRYB 4L8DA 1HE7A 4M1DH 1Z3RA 2DKSA 1IGFL 1Z1WA 3D51A 1JPSL 1JG9A 2HJKB 1G7JA 2XETA 4W9HC 4C55A 1HS6A 5DUBA 2WKGA 4NM4L 4IMKA 2WTRA 2R1WA 4IRJB 4OCNC 4JEGB 4HJUA 5BVJA 4WO0A 1SN5A 4UMSA 2OXGB 2JCWA 4H26B 1KN2H 4DCQA 1CLCA 4LVNB 2H0EA 3EOBA 3UPAA 3FCBA 3V55A 4QPEA 3B3IA 2FK9A 4MZIA 2DMCA 3MBEB 4QHKJ 4IIZA 1X9RA 4ODTH 5D1XE 5FYJE 3K80A 4F33B 1HHHB 1EXHA 4JFOB 2NZIA 5A3ID 1HAWA 4PREB 2YBRB 3D4YA 3GYRA 1BM7A 2ZXDA 3ARQA 4ZX3A 2M8XA 3BKCH 5HD8C 3QC6X 3QULB 4XAKE 1QLFA 3LKOA 3IF1B 3FT4A 4HFWA 2Z92B 3FCUB 4XCFL 5AZEL 4ETQA 2WZ0A 2EC9T 3T2NH 1FCGA 1A2YA 1G9MC 4BFGA 4KOCA 4GI6A 2UZPA 1P69B 2X7LA 3VDBA 1KZQA 5GZOD 4A7SA 4B97A 4X6DB 5F7EL 3BCDA 2F8OA 4PTUA 2YPLA 3VI3F 4XXCA 1H3TA 1AY1L 4Y4HC 5GZND 3U30B 1SEBB 3QPQD 3NUKA 3ARDC 1QQDB 3B37A 1HH9B 1I8IA 2VQTA 4JKWA 4L3FA 1QPXA 5D70L 3N0AA 4MNQA 4M8UA 1AO7D 3ZZQA 3HG4A 3H42H 1CG9B 3HG1D 2X1PA 3AXLA 3CTTA 3POHA 5CP7A 5DLML 3EFDL 4M7ZC 2R8SH 2RMNA 2R0LL 3MZGB 2X70B 2CD0A 5DGRA 3WFCL 5GIRA 1JHLL 2GTZB 3IETB 3KNBB 4FHJA 5IVXF 5C7XH 1A6WH 5L8KB 4DSYA 4TVSa 4DN4L 4QXUL 5JNYB 3QJZA 1YC7A 5IMLA 3FW6A 4CUCA 3BJ91 4P4KA 4E5XG 5E6YA 5DMKB 2V3EA 4BKLB 1R3IH 3PHQB 4X6EA 1NAML 1IGIL 2YHGA 3A4DA 4LKCA 3R06A 2SEBA 1RERA 3GXNA 3NTCL 4FXTA 2BJML 4LHQB 1JNNL 3QXTA 3RWCA 3ZDYE 4ELMF 4LLVA 3TV8A 2FGWH 1G9HA 4WW2A 5C6PB 4Z1PA 2P28B 4GKZB 3NGBB 5B7FA 2YD3A 1BM3L 4QYAA 4Y1AB 5LVEA 5A16B 2AJZA 2FEEI 3IWVA 2R4SL 1CK0L 2QHRH 3K5RA 4TLSA 2A0LC 4DPBX 2VT0A 4ENZA 4L2YA 5CEXB 3M46A 1H6UA 3BVNA 5IMKA 3TBBA 4KK9D 5HHXH 3EBIA 2R9HC 5IIEB 3ARRA 2IGFL 1XD0A 4YR6B 1EUUA 4MD4A 5CSZA 2P43B 3SCMB 1YPZB 1FV1A 2KS0A 3QDHA 3ATBA 1ZA3B 4F15B 1AZBA 1YEFL 4JQIL 4ZFQA 4BIKA 4OCMC 3AQXA 3G5YB 4LSUH 1HHGB 2Y5TB 5E9DE 1MW2A 1Y6NR 3APDA 1DL7H 2Q7YB 1NM9A 4BH8B 4PJDB 1AAJA 5B38A 2XTSA 4MJ5A 3L1GA 5ESAA 3B3BA 3QDMA 4J2XA 1A6VH 4LSSL 1BZ9B 2X40A 2AV7A 4YHIB 3QH3A 3ULSB 4J3UA 3K8KA 1CDHA 1QTYT 3QXAB 5CFAA 1HEZB 2KHAA 1KXTB 3KPNB 4JDTH 4XMZA 2AXJA 1E5CA 3AREC 5EFIB 4NC1C 3UAJA 5AAPA 4RMRA 2FBOJ 5DYFA 4OI8A 1QRND 3BYTA 2DTML 5J89A 4K3EL 1JCKA 4M6MH 5KVEL 3JT2A 5DFVC 4WV1C 4FNLL 2FHFA 3O8XD 1WFNA 1TVHB 3OKOA 4LSRH 4RWHA 4L4TE 1T04B 1X7QA 4GRMA 3QPXL 1Q9LA 2MPAH 3WXWH 2FL5A 5E5LA 1JWMB 4OLZH 1UOVA 2KPNA 3NCJH 3O6FA 4UILH 1HTYA 2C8NA 1JS4A 4HEMA 1MCHA 2CJSA 1CLZH 1YY9D 2G60L 1BVZA 1TQTA 3VB8A 2Q3AA 4Q9CA 1CL7L 3BPCB 4PS8A 1DO5A 4KDTA 4LEBA 1FP5A 3OR7B 4Z9KB 3GSQA 1IM9D 4W93A 4E41A 3QFGA 3K7UA 4MA1B 4B9KC 1CICD 3PJLA 4PRIB 4LHUG 5LG6A 4UYPA 1XBDA 1MNNA 1T66D 3PWPD 2DWDA 3GFUA 1JV5A 4OZGB 2IMMA 3RTLA 1I9RH 3RZCB 4LOUC 1B88A 2H2PC 3ETTA 2W5PA 3OAUH 5DC4B 5IB4A 4HEPG 3FQTB 5DA0B 5DZJA 3C5SB 4RMVA 3S8FB 1PKQB 4FFVD 3TEZA 1FO0L 1G7MA 4LGRB 3O2DA 2ESVE 2IANB 3IMRA 4NN6B 4MXVE 1J0HA 3TLRA 2CDGA 4J3VA 2VLRB 1MRDL 1FNLA 3ULVL 3CZGA 4AL8L 4I18C 3ASNB 4JG1L 4F91B 5I5IA 5B7MA 5CFHA 3RVWC 3Q3GA 5DVOA 1OF0A 4U1JB 5E5MA 4ZUVB 1OAJA 3KYMB 5LHDA 4C56E 3OZKA 1QEWA 5I0DA 3HFFA 1JXKA 4UINH 3HUJB 1I8KB 4H25B 4UM8A 3BH8B 3RGVB 3HNTL 3J07A 5CJ5A 2K9FB 4DP8X 5DD6A 2K8MA 4HU8A 5I6NA 2AJYL 4J3OG 2XQBL 3WIHH 1INDH 2VLJD 1NOLA 1T7XA 2X6CA 3DTUB 4YHYB 1C16B 5AVTB 4PVBA 5HSFA 4D0BA 3QUYA 5BQ7B 4ODWB 4YAQA 5H2BA 5E2TH 4L37B 1QSFB 4FXLA 1LQSR 1X5KA 3DUUA 3L3JB 5C0AB 4CKQA 2X0UA 1B90A 3VI3A 2NNAA 4HD5A 4U2YA 1MRCL 5HD8D 2F08A 2X4RB 5TH2B 1G6RA 2VDQB 3UEZA 4GNKB 2C26A 1P7HL 3C60C 5EZLA 5D9SA 1JERA 2EXWC 3FN0L 1OL0A 1SDDA 3OVUB 4NYLB 4DKFL 5LNGA 4AQEA 3W2DH 4PRBA 3T6WA 1GZQB 3EJZC 5BV7B 3QZWA 2OMUB 4EKXA 2QDVA 2RHEA 3LVTA 3CSPA 1SVBA 2PABA 2R1XA 5K69A 1U8IB 3VUAA 2G3MA 5F88A 5ID1A 1RZGB 3T65A 1LO5A 4FEMA 5ITBL 1I1YA 4Y4HD 5J1TC 3B2MA 3WJLC 5T1KD 3MODL 5IVXA 2J1ZA 5EU5A 3ARDD 4Y4KA 1HCYA 1RULH 4QO1A 2OL3L 3QAZB 1AGBA 2J71A 4TQHA 1CDYA 3L4XA 2CDEA 3JV6B 3O41A 1N5AB 1ZTXH 1PIFA 4XPFL 3WMQA 1V7NH 1RK0B 1SHMA 1TIUA 2X10A 3LD8C 3QDJB 3J7HA 5D2NA 3FPYA 3BQUC 1CBVH 4ELMA 2VR7A 1U8HA 1TQSA 4YDNA 1NFIA 3UTSE 3MJGX 3D87B 3BSGA 3P9LB 4YH6A 3S37L 1RUMH 1Z3GH 4L1BA 2VC2H 2F7QA 4EBQL 1TETL 2XWJB 2C9QA 3CFBB 4JG0L 5D1QB 4P46A 4NZRH 4P9HL 5I8OH 5I2IB 2WBJB 4JRXB 3HN8A 1LXMA 3MGTA 4YFLI 1I3UA 2G9HB 4XXCC 1UXLA 3RI5K 5FS5A 5C09D 4AWJC 3P1VA 4ODSL 4YPGA 3RIKA 1MREH 3OB8A 3BKMH 1KEGH 4H8WC 4OKDA 2VSCA 3M86A 4PW3A 3ZMEA 3AGVA 3BUQA 2VN4A 4RISH 1ZEAL 3D4ZA 3BAWA 3S37X 3DPBB 4JRYD 1M7DA 2A0LD 4JY5L 4P2OA 2G30A 1UD3A 4ONGH 4R83A 5DURD 1CFVH 4V1DD 2NTFB 2E0PA 5BUPA 3ULUL 3VB9A 1XQ4A 1FGNH 2FQDA 4LIQH 1FDLL 3ZRCC 1C5BH 2ICEC 3ZYOA 4GRWF 1KTDB 5FCUH 2R9HD 3PWLA 4OJCA 3TO4A 3P4MA 2GTWA 3LEYL 2TRYA 5TQ0L 3KH3A 4I2XE 1J8HE 4F1SA 1I9JL 3FUIA 2ARJB 5J1SC 3IE9A 5C0FB 4UQIM 1NICA 1L9NA 1URZA 3VFWA 5I71B 2IDSA 1BF2A 5TE6L 1PG7H 3GS4A 2ZCHH 5DMIH 4XBEH 4F7TB 1JPGA 2W60B 1PQZB 1OSPH 4GXUM 2DKMA 1JGLL 3BWUF 3CFKB 3H9SA 2X4SA 4I0PA 5F9JA 5T5FH 3QWRD 4NZTL 2WTOA 1AIFB 2E7LA 2ZOKA 4QNPE 4JKNA 1MLCB 1KFAL 3PQYD 4JGMA 4R7NB 1BVLA 1OGAE 3ARED 1MQKL 4BA0A 2VDOL 3CXHK 2H32A 1UXSA 5T33L 3NRQA 1Q90A 3RUGF 4X8GA 5M7QA 2NNCA 1UOLA 4QUOA 2DEYX 4HJ1A 5DI8B 3VRIA 5DFVD 4UDTB 5DJZA 3L3DB 1ORSA 1M53A 1WJ3A 2JCCE 4K5LA 4HAFA 3C6LC 1GKOA 2HFGH 1KYAA 3BP6A 1IAMA 3HC2A 5F9WC 5IMOA 5DRWA 5F3BA 2EE0A 1H19A 4PRDA 3N06B 3X1GA 4ZXBA 2D31B 1KPRA 4FQXA 4CVZA 2XXFA 2PNDA 5BXFB 1FZOA 3LN4A 4MHHI 5IESH 1W0YT 5IV2A 4Q9RL 3UDWA 1MFNA 1MCRA 4AM0B 1ILSA 3BH9A 1FL5A 2CAKA 4LB8A 3P11H 1IFGA 4QRUB 3KPMA 3HS0A 1D2OA 4NDMA 4QXVA 3KCWA 3UAJC 2Q6WB 1NFDB 1IU1A 3WFBH 3IGUA 1EXUA 4BEIA 2XTLA 2DYPA 4RAUA 4ZUUB 3EOTH 4BWWA 2RACA 4H1LH 2FZ3B 2EIZB 4LOUD 2H2PD 2JJTC 3AG1B 5EO0B 3V0VB 1SOXA 4Y8AA 1HOCB 4Y2LA 2CM6A 3RNKB 4D9QD 4L3CA 1HDMB 4PGJA 1JI1A 1QSEA 3HE6B 2IDCA 5F9DC 3O6FC 1SJMA 1XSOA 1KCSL 3OGCB 4I8DA 4QRBA 3D85D 4QYOB 3BD3A 4ODVH 1OLLA 2FO4A 3PWNB 4KDTC 4YVNA 5HY9B 3OKLB 5EOQH 3LRSA 1PD1A 1SJXA 4Z77A 2BH0A 3MRKB 3RVWD 3NRPA 4UQ2B 4W9FC 1E5UI 2ZUUA 3KXFA 1ET7A 3TWYA 3FNKA 5JIKA 2FJFA 4TPRH 1JGUH 4KKQA 5IVZA 4GBXA 5D93C 2ZOLB 4ELDA 5KUKA 2Y23A 3HZMA 1ZVHA 1BLIA 3KZ8A 2HRHA 4ONFL 2A83A 4GI8A 5F6IB 1BJ1J 3EXJA 4DVRL 4YHLL 1ANUA 1U58B 4K5OA 3FB5B 5BOJA 1IBYA 3K2MC 5J6SA 1SRDA 3NFNB 3QFDB 4MMZB 5CHNA 1LE5A 3RKDC 3GRGA 4Y2NA 4NZ8A 3W11C 3QQ3B 3C60D 4PJDF 2OV0A 3HZYB 1KBBA 4L5FE 3HJEA 4XCEB 3E0GA 4XNMA 3UYOD 1LL1A 3EOYG 4LLWB 5HYEA 3GJEB 3EJZD 3IAPA 2VO5A 1FLRH 3MRMA 3CMOH 2QZ5A 4JPSA 4K94L 3E8VA 4Z7VE 1E9PA 3UGXA 3QYMA 2CA4A 1OARL 3HRZC 2B3IA 4W6YB 1KIQB 3F58H 3CQPA 5E4OA 5IB1A 1IEAB 3M45A 2R0ZL 1ZHLA 4NKOB 3KPSA 3IN0A 3ZVVA 2SODB 4LSVL 1UWYA 5INCA 3FFOA 3VW3H 5I1DA 1MFBL 2B2XH 2FR4A 2H47C 4NAJA 2DICA 4LLYB 2H6PB 3UERA 2EVJA 2UY6B 4WUUA 1DCLA 4OLEA 5F3HA 4N1EA 2P8MA 3HMXL 1UH3A 4JHAH 5TDNA 5IFHL 1NBVL 1DJHA 2PTTA 3MU3A 1Y18A 3IDMB 3WIHA 1GYAA 3BQUD 2CM5A 4BINA 2BIIA 1EAPA 4JZJB 4CVWA 3UZQA 1OPGH 3UGEA 2Y0SA 1AMXA 5IF0B 4QRTB 3POCA 1WGOA 1AACA 5AVXB 1WE5A 3GZPA 3Q2LA 3KWXA 3TBTA 3V6FB 4MJJA 1PCXA 1P1VA 3ZL1A 1A47A 4W9EC 3P40A 3TZVA 5HGBA 5TGBB 4N5UA 4L29A 4YDMA 3MV8A 1BLNA 3NJKA 2O30A 2YPLD 3GSXA 3GK8L 3OZ9L 1NANH 2DM4A 3J27A 2FRGP 4GOSA 4TSBH 5EC2A 2G75A 1NINA 2VDQH 3DMMB 3PJSB 3V9CA 4UDUA 1YJDH 1FUNA 1AOHA 1SXAA 2EABA 2OZ4A 3IDXL 1QG3A 1MRFL 2A9MH 3ATEA 3H4HA 5F7DB 1J1PH 4MNQD 3FCSA 3IE4A 4NQUA 4XVUC 3O6KL 5KS9B 5EOCJ 3GMPB 4W9CC 3FT9A 1E4HA 2UWEF 5D1ZI 1IAKB 3UO8B 1OP3H 1T1YB 5D2NC 2YS4A 4ZSOE 5K33A 2GYSA 4N2FA 2BW4A 3P9MB 4IRJA 1GGCH 5I1IH 3O6MH 2OXGA 3EUUA 3SDCB 5ADOH 4J12A 3UO1H 1NTDA 5IK3B 5DS2A 1HNFA 5A1AA 4RGMC 3W0WB 4RAHA 5KVDE 3S3JA 1CE6B 3MBEA 1L3NA 4NQXA 3WJMA 4OZIE 5B22A 4F33A 4YQXL 1KCRL 4NNPL 1HHHA 1IT9L 3K81A 4JKPL 4JFOA 4PREA 1ZT1B 2YBRA 4JHWL 5IEHA 1QZNA 2F53B 1KFGA 5D6CA 1YNTF 3HUJF 4ZQKB 5F21B 1ADQL 4JFFB 5GJTL 4ANXA 3RUGA 2CXKA 3QULA 5A2BA 1H3WM 3IF1A 5HVWA 3L8QA 2Z92A 4UOQA 1YN7B 4HIEB 4S2SA 4KO9A 3U0PB 5ABDE 3ARPA 5FUCE 4NHUB 1XXDC 1RURH 2XA8L 5CXPA 2VDKB 3WSQL 3UADA 4JUSA 5CZKA 4JREB 2ZF9A 2BFGA 3OJDB 3TO4C 3V10A 3F7YB 4X6DA 4P2RE 4UT6H 1UWXH 3QT2A 3LS4H 1MFDH 1R5IB 2VDPB 2KT6A 4Y2DC 5GGTL 5KYWB 4U1LB 4JJ5B 1JGIA 1SEBA 3EGXB 1QPKA 5A2AA 3DO3A 1U0QA 5BZXA 1QQDA 1HH9A 3HG5A 4OUUB 4G42B 1N7MH 4YFEA 3OQ3B 3C6LD 5D7LB 4AIEA 4ZG1A 4WWKC 1EAOA 1KV3A 1YQVH 1ULVA 5F7WC 1PZ5B 5LBSA 3GSRA 2GIXA 3VRLE 4I0KA 1MCOH 2EILB 2BNUB 1WP6A 2X70A 5KJRH 5E2UL 4WJKB 5HHMB 4F5CA 3ARBB 4PS3A 2GTZA 2KKQA 3IETA 3KNBA 2E7LC 1B4JH 2FATH 5JNYA 3KD4A 5HDOA 1H9VA 3AZUA 4AEEA 5DMKA 4D0CB 3SGKA 3DRTA 2V3DA 1A7NH 3GIVB 2Q86B 3UAJD 1NCWL 4WW1B 4NS0A 5LQBL 3WDJA 3BUTA 2BIOA 4PJIB 4CC4C 1CE1H 4HIJB 1QRNE 3DX3A 4IBUA 5CILL 2YEZB 3MACL 1G0YR 1UD6A 2F5BH 3NJVA 5AVSB 2PWEA 1KLGB 1REIA 4A7GF 1CGUA 4PCYA 3TH2T 4NKIL 4Y1AA 5A16A 5I6KA 3O6FD 4AQ1B 4BGDA 5CEXA 1CZ8H 3BESR 3NCYS 2CR6A 4KUZL 4JO2L 2P24B 3UDWC 4AJYV 2FX9L 1P4IL 4MDIB 3JWOH 2J6WA 4B41A 3BIKB 1SF5A 4G6JH 3ERXA 4YR6A 3ROLB 5EU7E 4G9DB 4E41D 1GW0A 4POUB 1JFQH 3GMQB 2X1XR 4KH2A 2UV3A 5E7FA 3SCMA 5I23A 3TVMB 3SY6A 2FD6H 2E59A 1KB5L 1JNHA 1ZA3A 1DVQA 1FFPB 2LR4A 5DFWH 5K9QG 1H6FA 4XO3A 1L5GB 1GL4B 3G5YA 4M1DL 1ZK5A 3TBSB 3LPFA 3PXHA 5JIHA 3W9EB 1RZJH 3PWPE 1G5GA 2Q7YA 5EUOE 4BSVB 2X44D 4BH8A 4PJDA 1BEYL 1JWSA 2OM5A 3PL6A 4DQOH 1WBXB 4KTEH 4AGOA 4NC0B 1OVZA 3TWCH 5DHVH 4IDJH 5AEAA 4YHIA 3O3AB 5AENA 5C0EB 1WFTA 2OFQA 4ECNA 1JZ7A 1SDAB 1L9TA 3CZNA 3QXAA 2X6MA 1KN2L 2DY2A 1HEZA 2YAQA 4L1TA 4M3KB 2ROYA 5F7AA 3KPNA 4EKJA 2GJJA 4WWPA 3RKDD 3IS1X 3W11D 4WDIB 3ZR6A 5EFIA 2CGZA 2DMKA 2HSIA 4WFFE 1UJTA 4XZUA 4YN3A 4ODTL 4E5XB 2K7QA 4UM9A 2XC8A 2NW2B 1MPAH 1ZTMA 2VUKA 1TVHA 1ZT7B 2HJLB 1BCIA 4MZ2A 1T04A 3IPBA 2B1AH 2L04A 4DUXA 2YMXL 2ZUQC 4YIQB 3Q6GH 3BAXA 1ICTA 2J1YA 3QUMB 4IJ3C 3TEWA 2ATKB 3WLBB 4UTBH 3CFEA 4OFYA 4GUQA 3T2NL 4XP1H 3TONA 1WA0X 3AG4B 2VLJE 2D3NA 3UG4A 5MP6H 4NLAA 4XP6H 5C0NC 4KNTA 3OR7A 5C0JB 4KGJA 3RP1A 2OKMA 4Y9FA 2EE9A 4JL1A 4KZEH 4PRIA 4M5ZH 3S2CA 1ZE3H 5BMFH 3B4NA 1U3HC 1QI5A 2IV9A 3MOBL 4HGWB 1IBBA 3DJZA 4KRMB 2DDQH 2QQKH 3H42L 1N26A 3FQTA 3OL2A 2LLGA 2WWKT 4DESA 3LS5H 1PZCA 2R8SL 1SJVA 2CQVA 6PAZA 2Q8AH 4JX0A 1CO1A 4KKPA 4RGNC 3ENEA 2A6KB 4FERA 4MA8H 5G2NA 3S5ZA 1THAA 1NFDF 2IANA 3IU4H 4JY4B 4F3FB 3AQZA 1ZV9A 5C7XL 4B9ZA 1A6WL 4N85A 5AZ2H 3JWNG 3DVFA 5DJYB 5TQ2H 3T4YB 4F7EB 3JTSA 2TSAA 4HCGA 1G7LB 4XVUD 2VLRA 3B9EA 3CBKB 1JIBA 2JB5H 3OHXC 5DQJB 1N4XL 1CU4H 2P49B 1R3IL 2JI3A 4JMXA 4IIQC 3AITA 5GS1A 4U1JA 3IN2A 3KYMA 1AQ8A 2ZX5A 1O7VA 2VABB 3HUJA 3OV6A 1I8KA 4H25A 3G5XB 2FGWL 4H8PA 3BH8A 3RGVA 4ZW7A 5DLLA 4LSTH 5F1OB 4PH8A 3TZVC 4WFHD 4ODXB 4I0CC 1ZVSA 3U6XS 3QQDB 2QHRL 4K3DL 2NY1D 2H1LM 1C16A 2AGJL 4NO2B 3UJTH 4YHOH 4XRCB 2E7DA 5BQ7A 4ODWA 4P49A 3WXVH 1QSFA 4PJBB 3LVEA 4N3TA 3KE0A 3L3JA 2J2ZB 1EEUA 2DS4A 3LOWA 5C0AA 1PW3A 4MASA 3TN0B 3ALXA 3IMUA 3KLQA 2OSWA 2G2RB 4KJPC 3T71A 5TH2A 1G1YA 3GMOB 3ML9A 2G0LA 3TX4A 4NYLA 1DVUA 3HAEH 1FN4B 3QNZB 4LHUB 2E27H 1GZQA 4LSUL 4JRYE 2OMUA 2XG5B 1DL7L 1DJXA 3TO4D 3S7GA 1AHWC 2C4FU 3A24A 6FABH 4FQHB 1RZGA 4Y2DD 4XP4H 1F4WH 1HH6B 2V8LA 4LCWB 1A6VL 1GGTA 1SLUA 4BZ2H 2XZCH 4U6VH 3I50H 4WI4A 4GKOA 1CFSB 1I75A 1HKLH 4MA3B 4JDTL 1N5AA 4LL9A 4WWKD 5JORB 4QRPE 3TIDB 1RK0A 1OPOA 5IJCC 2CRZA 4J6RH 5HHOB 3V2AR 1WCBB 4S1SH 1UZ8B 5T5NG 5SWQB 3I9AA 3P9LA 1MDTA 4M6ML 3VXMD 2ROXA 5KANG 4LSRL 4MJ4A 2XWJA 4PS7A 3CFBA 4U1MB 4A7GA 5L2KB 2Z4TA 3WAJA 3RTQC 2MPAL 4X5XA 3WXWL 5C6WH 5I2IA 1U8MB 3C2AH 4OLZL 1MJUH 2HKAA 1AQDA 1BFOB 3NCJL 4UILL 3PQYE 4LPWA 1BBJA 5DD5H 5LXGH 3KCPB 1CLZL 3WTSA 3TH4T 4ELKB 3U6RB 4AITA 1OSEA 3FQ4A 1DQQB 3ELQA 2EXSA 1F56A 1A65A 1NAKL 4O2FB 4XI5C 1FAIH 2BSED 4CBZA 3BKJH 1UURA 4HLEA 4B7LA 3NIDE 4BM7A 3U2IA 3MUJA 4PRAB 3DPBA 3EJJX 2OMYB 2BZCA 2NTFA 1BFSA 1I9RL 4G3YH 3VSTA 3OAUL 1XB6A 1YLBB 1OE2A 3C8HA 3FTSA 3BEWB 2BP0B 4RH4A 3MI6A 3HI5H 1GS6X 3SGKC 5KS9F 3HS9A 3QG6B 4FTVB 1ETB1 5IHWA 1YHPA 2PWDA 3O4LB 3L4UA 3L5WB 4PJHE 4ZAKB 1TJXA 3P4OA 3FHEA 2HRLA 4M1CC 2EECA 5E8NB 5J06A 5C0FA 5IQLA 3OR6B 5E6IB 4CL7A 1KCWA 4OCWH 1PTZA 3MREB 1H8SA 1D5ZB 4FNUA 3LPWA 2ADJB 3PGFH 1BG9A 4OZ4B 2W60A 3LZOA 3CAFA 5C07B 4JCMA 3VXPB 3FO0H 1WH0A 5EZOH 1FVCB 1J0JA 1XGYH 4UINL 4GP5B 2AEQH 1AIFA 4N86A 3IGFA 1MLCA 2HFFB 3E3QE 4FKEA 4HJSA 5D7JC 3SYQA 3V5HB 2VL5B 4R7NA 3SD5A 3WIHL 1INDL 4FFYH 3SCMC 3H3PH 3HKFA 2R2EB 5DI8A 4NO3B 4UDTA 5E2TL 3L3DA 4MB3A 2P5WB 1VEMA 2ZXCA 2YN3A 4PJ7B 4TRPL 2ZQKA 2D3LA 5CBEA 3LV3B 5G4OA 3SY0B 3PL6C 1LO3H 2NZ9C 2D31A 3JVGA 3VXSD 3ECBA 4UQ3B 5BXFA 3W2DL 4TOYH 2PW1B 2CRMA 2VMEA 3L4YA 4NO0B 5C0ND 3BH4A 4AM0A 4DZBB 1N0LB 4PN6A 4QRUA 2ZYSA 4CSSA 4J3WA 3IJSA 2Y1VA 1RVFH 1OP9A 4FQ2H 1AQKH 3WE6B 1NFDA 2EQDA 1KGYE 1FFNB 2B59B 1W9XA 1YN6B 1TLKA 1RULL 1U3HD 2X6AA 3TEXA 5HYSG 5AUMB 3ARFC 3VFOA 2FZ3A 3GUFA 2EIZA 2H3NB 2QZQA 1K4DB 1P6AB 3V0VA 2DH3A 5D4JA 3LNHA 1ZTXL 5I6XC 1FFQA 2VMDA 4HT1H 3STBA 3W82A 1V7NL 5BRZB 3RNKA 3E2HB 2IOIA 1HDMA 1CBVL 5GGVY 1N6VA 4GPVA 1PF3A 3HE6A 4RGND 4X4YB 5C0GB 5GRVL 1RUML 1Z3GL 4OZFG 4TNGA 2VC2L 5JR1H 4K71B 2VDNH 2MKLC 3CH8A 1U91A 3ILQC 5G5DB 3IJEB 1KJ2H 1AKJB 1VA9A 1YEIH 4QYOA 3JV4A 4LF3A 4NZRL 4WUUD 5I8OL 1TQCC 2NZ1A 1Z6JT 3CSTA 4M6OH 4M61B 4UTBA 2VXQH 2DQTH 3MRKA 1J8KA 4UQ2A 3WG7B 1UUSA 1RSFA 1BXUA 2DYSB 1SYSB 1PAMA 3L54A 5JDSB 1MREL 4FKHA 4OJAA 3T2PA 3BKML 2WXIA 3KG5A 3UZEA 5IQ9B 1KEGL 1RIUH 3AADB 3LRMA 4FQQB 3US0A 3TZVD 2PPFA 2Z91B 3GI9H 3RHWF 2ZOLA 2H5UA 3FDWA 1QEXA 2DQGL 3IJYB 4RISL 1MQ8A 4ONGL 2N1TE 2C1PB 4YL9A 1CFVL 4F2FA 2YPLE 3B7SA 1I3GH 1FGNL 1OCOB 4LIQL 5F96H 4NOFA 1OAYH 1C5BL 1U58A 5FCUL 3FB5A 3ARVA 3REWB 1CXEA 2PYFB 4FS0A 3NFNA 3QFDA 2HPOA 4MMZA 4OLUH 1N5YH 3NZ8A 4KJPD 1YEDB 4QHNB 4MNQE 3MV11 2F5AH 3QQ3A 4DEPC 3BIAX 3HZYA 1GHFH 3GM8A 1PFCA 5GS1C 4LLWA 4HSCX 2EO7A 4LCVA 3GJEA 5A2KH 3MLUH 1A3LH 1X5HA 1R5WB 2J43A 2XX1A 4Y4FC 3SKNB 1GGBL 2KLSA 4LP5A 4XVTH 5GSVB 2C3GA 1PG7L 2Z93B 2ZCHL 5DMIL 4XBEL 2OI9C 2JIXB 2VGLM 3MUUA 1IEAA 4JVUA 4NKOA 1OSPL 3K72A 1HOEA 4O00A 4NNXB 2PR9A 1E8WA 4FXKB 4NKQB 1RMFH 1UWEH 3H54A 3QR2A 1FE8L 3QYCA 4LLYA 2UY6A 2L7QA 4GO9A 3SE3C 2K6YA 4B6ZA 3MRLB 2KPWA 3K2UH 2ZG3A 1JGVH 3P69A 5IBLC 2GSMB 2KMWA 5ITFB 4JZJA 3V0DA 1FHNA 5JOFB 3SDYH 3GRWA 4PRPB 1W6WA 1M1XB 4QRTA 5IF0A 5ES4B 1OM3H 2P5PA 1PKOA 2D4DA 3TFBA 2WYIA 2OJ1A 2W59A 3GJFH 3MGAA 3W3BA 2HFGL 3RTQD 2D7PA 1PG7X 4U6XA 5TGBA 3SQRA 4CNIB 4YXLH 1ZS2A 2XDHA 3D33A 3AUVA 2F18A 3BP7B 3T4AB 5CU9A 3DMMA 2JLLA 1CN4A 1X5ZA 5IESL 3ESPA 4KK5C 4WI7A 2C9XA 5FLVA 1EJOL 4X6BB 5BJTB 3CFUA 3FH8A 4XI5D 5F7DA 2ZYHA 3P11L 5KS9A 1EEZA 3NCCB 3GMPA 3CFMA 5DZLA 2CLRB 1IAKA 1CGSH 7PAZA 3RGHA 3ECVA 3C87A 3OXRB 4WRLA 1ZLDA 3EOTL 3QJQB 4G80A 1MFAH 4W9GC 1LILA 1U95B 2NW3A 1F6LL 4HUXB 4D94A 3L2NA 2WJ7A 4X0KB 1OB0A 3OKNB 2XZZA 5HHPB 4FFZA 2Z31B 3W0WA 3ZKMC 1CE6A 4AZUA 2BVTA 3BEVB 5BVPH 3TA3C 3WKNA 2DM3A 4M1CD 3Q5YA 1ZT1A 1FF5A 4ODVL 3Q7JA 3VNZA 5IR1B 2F53A 3BMWA 3UZVA 5EOQL 3WDHA 1NKGA 1VZGA 4QLWA 1R9FA 1MDAA 4JFFA 4HIEA 3U0PA 5IWLA 2UUDH 4WO4C 5IOPA 2AXGB 1A22B 2NR6A 3FUHA 4NHUA 5E4AA 4FG0A 2K4AA 4CADB 2ICWI 2YFNA 1CI3M 4TPRL 4HEME 3OMZA 1IBGH 5D7JD 3OJDA 4DWHA 4RSVA 3MV7D 2EEXA 1M7UA 4JFEB 3IJ8A 1BXVA 1CGTA 2ZP0T 4KI1A 4PJBF 1R5IA 4XPTH 3V4VB 3WNLA 4GS7B 3SKUD 2A4ZA 5KYWA 3KDMB 4TQ8A 1ZLVK 2RQEA 3EGXA 4E41E 2WUCH 3QQ9C 1A1MB 1CL7I 2AXWA 4Y5VB 4RBPK 3UTZB 1A1NA 4G42A 1M05B 5D7LA 4EIZC 4A66A 4AC4A 4LXFA 3ZTEA 5SX4I 2IH1B 5EEWA 2NOYA 5F7UA 1PZ5A 3DXAB 4NKDB 3PL6D 4LZKA 1I85A 2NZ9D 1UH4A 4Z3HA 2BNUA 1MG2C 4PG9B 2WTPA 3ARBA 4EN3C 1FLRL 3CMOL 5DJ6B 4PP2B 3OAYK 1GMIA 2J1KA 2GEEA 4HWBA 2QGBA 1A14H 3L1FA 3FKUS 1CR9H 5B4MC 3F58L 1NCHA 4P57B 1J10A 4CC0A 4D0CA 3B9KB 2W9EH 3GIVA 2Q86A 1NCGA 1M71B 1YEKH 3DX6B 4WW1A 4XMKH 5J12C 3VWKC 4UM9D 4KQ0A 1LVEA 2QKSA 2B2XL 3ARFD 3HHMA 2WC7A 2X09A 2YEZA 3ZZSA 1VCBC 4CKVX 2GC4C 2K6WA 4WEMB 3ULVC 1KLGA 4L8SB 3FT0A 4FFYA 2QSCL 1NCBH 1XIWC 2WSDA 3B7RL 3KVPA 4HUKB 3A6CH 1OPGL 4AQ1A 3JVGC 4LLUB 4OFYD 1HCVA 3T09A 2X42A 1ZIBA 5HHVH 3ILQD 3P3TA 4XH2A 2B14A 4J3OF 2P24A 1CVSC 3V5DA 3WDIA 4O58H 4PJFF 3SB3A 1HL8A 1UFUA 3WEMA 3BIKA 3VD9A 4G9DA 5I24A 2CGYA 3GMQA 2V5TA 4TSBL 3VI3E 2VDQL 3S4SB 3TVMA 1YJDL 4G11A 4KO5A 3VXRA 4QRRB 1FFPA 5BZWB 2DN7A 1B3IA 2EIKB 3RY6A 2A9ML 3CDZB 5EC1A 3W9EA 1J1PL 2LTQC 4QD2E 5JQHC 1ZLWK 4NEHB 3ME0B 1G7HB 4EDWH 5K59F 3QXVA 2NNRA 1IGCL 4BK4A 4JPQA 3TT1H 1PX3A 1WBXA 1KGCE 4F8PA 2QPDB 2NMSA 3F05A 1F4XH 2XKUA 1GGCL 3O3UN 5I1IL 3O3AA 4FYSA 2UZIH 3QA3B 4M7LH 3KPQB 5EIIG 5C0EA 3G04B 5IVXE 5ADOL 2D8KA 3L6FB 3UO1L 2WOYA 3VH8B 3D5OF 4A2FA 3PV6B 3D7PA 4Z18A 4WDIA 3WHXB 4AV5A 3KVDD 1U93B 3VM5A 5LAXB 1PAZA 2AVGA 4U0RC 4HG4K 3ZTNH 4E5XA 1NCOA 4HQQH 5D2NE 3SDXE 3ZDXF 2DJUA 4ELME 5JZ7C 5HHNB 1EBPA 4Y5XC 2NW2A 4UTAH 4Y4FD 1P7BA 1ZT7A 2GK0A 2YD9A 4XXWC 5A2LH 3UZEC 4JFDD 2IADA 2YPVA 4PGEB 5ADPH 1BMZA 2GJZA 3F62A 4YIQA 4KDWA 1XR9B 2P80D 1F3JB 3QUMA 5IJDC 4WHYH 3BAEH 5FC9A 1VGEH 2ATKA 5F7NC 3T8VA 4GAYA 5FGCB 1RURL 1TMCB 1MN4A 4DIXA 4NJAH 5EUKA 3PG2A 5F7LB 3T04D 4AC2A 3IFPB 1CLOH 5C0JA 4UT6L 3LS4L 1HNYA 1MFDL 4PJ7F 5ANMB 2FWOA 2LU7A 3NSDA 3MLXH 1KIRB 1MZZA 1ZSDA 4WFGD 4LOFA 2NY4C 4GW1B 4HGWA 1TZ8A 1KCLA 2W95A 2CALA 3VTTA 4Y89A 4N0RA 5J56B 4WHCA 3RHWK 1E43A 4IOFD 1LWJA 4P5MB 2YUZA 3GMNB 2X2JA 4ANKA 1MCOL 5KJRL 5SWSB 2A6KA 4KK5D 3ULUC 3IDYB 1IGTA 3CSYB 3DHMA 1IGYB 4JY4A 4F3FA 1B4JL 4F7EA 2FATL 5DJYA 5C97A 5HHQB 4LAJH 2R0KH 1VRSA 1G7LA 1S7QB 3RPIB 3VG9B 5F3FA 5DQJA 4YLQT 3EZJB 1GZPB 1A7NL 4LFHG 4GLRI 1SHXA 4LLDB 5G55A 4NQDA 5CIPB 5GGRA 4LAQL 1CE1L 5LKNA 3IT8D 4Q7DA 3G5XA 2F5BL 3VXME 4C83B 5I18L 1UM5H 1H3UA 1U30A 2HLEB 5LN4A 3D69B 4LNRB 2ZNWA 3WY2A 3LDBC 3ZKMD 3LPPA 5TD4A 5ACZA 3QQDA 4PJ5A 4JPVH 1CZ8L 5LAPA 3DMMC 3TA3D 1I31A 3GGWB 4NO2A 4MS8C 2NLJB 1GS8A 4XRCA 4YLCA 3D50A 3E7JA 4JRFA 3T3MB 1A9EB 4PJBA 3JWOL 3ZXAC 4ZO7A 2J2ZA 3TN0A 2HT2C 4G6JL 4AUJA 3EOAB 2G2RA 1D7FA 1JFQL 3I75B 1NOFA 1TTFA 3DX9B 3GMOA 3D25B 2FD6L 2BINA 1V5JA 4HUUB 4WO4D 4JAMB 3PAVA 1FN4A 3QNZA 1FNHA 4LHUA 1V10A 3L2MA 3LHPH 4JFZH 1RZJL 1O0VA 2BDNH 2XG5A 4A38A 1E5YA 1W80A 1A6AA 3L7EB 4YSDA 2VQ4A 4HEPA 5CM1A 4DQOL 4KTEL 1I7UA 2IAMB 2O1AA 3HA0A 3MN8A 1HH6A 5TF0A 3VGBA 5L4JA 4LCWA 2CZNA 3TWCL 1MVUB 4IDJL 5KN5A 2AQNA 3PPEA 1HU8A 2GB2A 1A6PA 5KVFE 3C09C 5D1XB 2BWIA 1CFSA 5D7KD 3ZMRA 1Q0EA 3QRBA 4MA3A 4HJIA 1KTLB 2Y36H 5JORA 4NUMA 3TIDA 3S5LG 4UUJB 1Z9MA 1WCBA 4YSAA 5E1HB 1UZ8A 3BGMB 3IFOB 4G82A 4WVRA 2NR6C 1XCTA 4EN3D 1TQVA 4FYQA 2APBA 2XY1A 1QSEE 4EXKA 1Q1JH 4U1MA 4GG8B 3A3YB 5L2KA 5E6SB 5DZNA 2B1AL 3MV01 3QIBC 3NEXA 3RB5A 1JTTA 2ZD0A 3Q6GL 5B4MD 1U8MA 4B0MB 4EAEA 5HYFA 1K8IB 2E7MA 4UTBL 1R3HB 2WYTA 5CWSA 1PLCA 5DEJA 3VWKD 4FJYA 1L0PA 3NK3A 4XP1L 1ZK9A 4MB4A 3VMOA 4KJWC 5FECB 3U6RA 4ELKA 4PJFA 2PUQT 2OSLB 4WNJA 5MP6L 4XP6L 3MLRH 2N4IA 4DO6A 3KXFE 4O2FA 3DWTA 1D9KA 3ULVD 4FNRA 1FFOA 2WOBA 3P77B 3MLTB 4LLQA 4FQLH 4M8RA 3V7AE 1XIWD 4KZEL 2Z64C 3HZVB 3V4VH 1Z9SB 4EQ3A 4AKQA 3CVDA 1CWVA 4M5ZL 3S35H 4IKIA 1NCUA 1KCUH 3ARBC 4RDBA 2EDXA 3VXSE 3SDDB 1F0LA 2KZKA 4AYFB 4IBSA 2DDQL 2QQKL 5BW7A 1M3IA 5AW7B 3FZUC 3U9WA 3N6YA 4N25A 2GQHA 2BP0A 3LS5L 3D48R 3LX9A 4QWWC 2Q8AL 3QG6A 4FTVA 4OF6A 4I3RH 3PV7A 3TNNB 3DK0A 3O4LA 4MA8L 1BMWA 4FA6A 3L5WA 4ZAKA 3IU4L 2VDLH 2ITDB 1Q9WB 4OR1A 2EUZA 5AZ2L 1IC4H 5E8NA 1G0XA 2YIHA 1NEZB 3OR6A 1E42A 3MREA 3B34A 2JB5L 3DIFA 1BVNT 1CU4L 1D5ZA 2EVIA 4A55A 4G7VH 2RAMA 5BUAA 4OZ4A 4PJ8B 1JXGA 5C07A 3VXPA 3M7OA 1FVCA 4RGNE 2P8LA 4KMLB 3MUGA 3KPSE 5DHMC 1J0YA 1OHQA 2ZIDA 4GSUA 2HFFA 1V3MA 2Z0BA 4K94C 4LSTL 3STLB 4NUPA 3V5HA 3MRBA 4A1RA 3I2CH 1QASA 3DSNB 5ISZD 1JZEA 4U33A 4WUUE 4R4NC 4QGYA 1XAUA 4P5TB 1GJUA 4PWGA 4R97B 2R2EA 4YHOL 3K6IA 4Z3IA 1DJIA 5JZ7D 5TPWH 3ESOA 2W1NA 3WXVL 3RJDA 2P5WA 4N26A 1T6WA 3G5VB 1RUPH 4HHWA 3QP3A 2P26A 4PJ7A 4MVBC 4PY8I 5IHLB 5E9DB 1JWUB 4NC2B 3LZLA 4EO5A 3ZBMA 3LV3A 1VAHA 5FFOA 4HCRA 3SY0A 2A9BA 2W88A 5E8PB 1IM3A 4LEXH 2Q5BA 1FJ1B 1KTBA 1J1XH 2IC2A 3MV8E 4AYID 5FGRA 2E27L 2PW1A 3MC0A 4J4PC 1TT6A 1AQHA 4NO0A 2GIMA 1KNOB 4MNHA 4DZBA 4WHYG 4GRWE 1N0LA 3NZHH 4TM9A 2WXOA 2UY7B 4LDOB 4TUKH 5AKTA 6FABL 5HI3C 4MD0B 4XP4L 1ERNA 3NA9H 1F4WL 2XBTA 5DD1H 1FFNA 2B59A 2NY4D 1YN6A 2XZCL 4NBYB 4U6VL 3I50L 5AUMA 3SPGA 2H3NA 5SWZD 1HKLL 4B60A 4MDRA 1BPLB 1K4DA 1BG1A 3V6ZB 4D3CH 2GHZA 3OQRA 4HH8A 5HJBA 1HCZA 4YBLB 1C08B 4NN7C 2X5PA 4J6RL 2NCMA 3Q6FB 1BOYA 1QVOB 3NJIA 5C0GA 3C5ZD 1GOFA 3ULUD 1Z9PA 4AGPA 5EN2B 3I84A 4W6WB 3GTNA 3IJEA 3Q2CA 1AKJA 2P48B 2WLZA 3C2AL 3V0EA 1HX0A 2EYTB 1MJUL 3OKYA 4K9EH 3W81A 3RWHB 4M61A 3ZW3A 4LCYB 5DD5L 2H41A 4U3XA 4PB0H 2IDUA 2WQUA 3RUGE 1A25A 5DJXB 5KUMA 2QGEA 1SYSA 1YECH 5HTSA 4YL4A 3IYLW 2DLGA 4HKZB 4YWGH 1TZGL 2ZYIA 1FAIL 1YA5A 4NB7A 3BKJL 4KHXH 3LH9A 3N50A 4HX1B 4YPJA 2Z91A 4AKOA 1XSKA 4G5AA 3IJYA 4WGWB 5SX5H 3SE8H 4F27A 3GB7B 3HG0A 1BJ1H 1QACA 1YEJH 3VE0B 2N56A 3HMWH 1QHOA 4MS8D 1ZLUK 1MW3A 2EH7H 2QQQA 1YNKH 4BJLA 1F18A 2DQJH 5I74C 5CJQH 4YMPA 3EDJA 1Z5LB 2ESVB 1OO2A 2HT2D 3REWA 2PYFA 1AG0A 2AXHA 2EO9A 3HI5L 1ET5A 1YEDA 4QHNA 5ESVB 5HDQH 3MROB 3VSUA 1FNSH 4IBLT 4JDVB 2FEJA 1J5IA 1F13A 4BUHA 1R5WA 3QNYB 4HMDA 1E9QB 1PSKH 4OCWL 3SKNA 4F5CE 5IBUG 5LGHH 4C56B 5GSVA 4TL4A 12E8H 4I77H 4XPBL 2GT9A 5KVGE 2ALWA 2Z93A 2FBRA 4FMVA 3PGFL 1E4WL 4I13B 5EEXA 5DU7A 3CSFA 1WISA 2HX9A 2JIXA 3Q8FA 5IFJB 2D7TH 1CXFA 2VITB 3WN6A 4OB5H 2J1WA 1SQMA 3FO0L 5EZOL 3ZJAA 2VSDA 1EWHA 1XGYL 3WTWA 2AEQL 1TQBB 2P5ED 1UZ6F 3MV9B 2PWGA 3IWUA 2JKTM 3MRLA 3IJ9A 1IAIM 4HHAB 2MCMA 3AC0A 3TN0C 4F2MA 4NRXB 4F58H 4JR9H 4FFYL 3OKEB 2VLKD 5ITFA 3H3PL 1EHLH 1DDHA 2QKIB 4NPJA 4CJ0A 4DKEH 4ZQTA 1S7RB 5E4IA 5JOFA 4PRPA 1S5IH 1DHKA 4S11A 4Y1AE 1OP5K 5C70A 3M17B 3BJLA 4PTTA 4ZI8A 3T5WA 3QVAA 1U8CA 3FTZA 3J2PA 3AG2B 1LEKB 3QUZB 3QIBD 2FH8A 4UIMB 3BRGC 2CG9X 2XVLA 2BY0A 4XE0A 3KM1A 1LO3L 4NI6A 4Z3FA 4OFVA 4ADIA 4BFKA 3MV7E 4R7LA 3MFFB 4KJWD 4HAGA 3X13B 2I7OA 4X6BA 1IKOP 1AXIB 4IU3B 2VOTA 3MRQB 3APCA 4MD5A 4YSOA 5I6MA 3O3DA 1UXMA 1JP5A 5C2BL 2NXYB 1I9IH 1RVFL 2CLRA 4FQ2L 2X89A 4PAZA 4PJDE 4PP1C 4I9WD 1N6QH 2J7LA 5FV2A 5TFSH 2J25A 1AR1B 1VFMA 2R51A 3UTSB 5FGSA 1CFTB 1U95A 4E0RB 1FYHB 4HUXA 4HT1L 4K5MA 5FYJH 1EMTH 3U4KA 2NY3C 4G7QB 3TASA 5EF3A 1MELA 5T3XE 4QWWD 1KCBA 2Z31A 1WSST 1BW8A 3LQAH 3QDGB 5I0WA 1QUPA 4HKXA 5F0MB 3BEVA 5JR1L 4J3OC 2VDNL 1AXTH 4PSRA 1ES0B 1CQYA 3WGVB 3WO3B 1KJ2L 1OIOA 1UB5B 1YEIL 4CN4A 4IK6A 2WXHA 1IVTA 3TC9A 1G94A 4XTRC 3V8OA 3JV5A 1PG7W 3ECUA 1D9KC 2EEFA 1XZWA 4M6OL 2VXQL 3LAFA 4K5PA 1VFOA 4TVPH 4JLRB 4M4PA 3NCFB 1PZ2A 1F8TH 1WFJA 3UYRH 4B50A 1VEOA 3BVWA 2PO6C 1KT2B 1QHPA 2BY2A 3IDJB 4WCYH 1RIUL 5I8CA 1WFIA 2A6IB 5BW7C 4B27A 3HEIB 3GI9L 3T3MF 3DIVA 4JFEA 3V4VA 4R4ND 1M9SA 1SXSA 2LABA 4JQXC 2XWXA 3UABA 5AB9A 3VXRD 3FQYA 1I3GL 1A1MA 4ZAKC 4Y5VA 1TMQA 1HN1A 2B20A 5J3HC 3UTZA 1OAYL 1MCSA 2FT7A 2H0FA 2IFFH 4PRIE 3P0GB 3SO5A 1J8HB 1M05A 3EO1B 4XT1C 5DHDA 5FO7B 2V4LA 4MVBD 3U2JA 4OLUL 1N5YL 4JY6B 2IH1A 1PDKB 2F5AL 3DXAA 4NKDA 1S3RA 2UWEE 1GHFL 1FYTD 5DJAB 4PG9A 1UACH 4MQXC 3MLUL 4JS7A 4J4PD 1A3LL 1QBBA 1JSYA 4Q89A 3GLAA 3DV4B 5DJ6A 3MKGA 5EULV 2AKRB 4XVTL 2PP7A 2IANE 4KHTL 2DLIA 5HI3D 4P57A 3T77A 3B9KA 4EZMA 1M71A 1OGAB 1MCFA 2AQPA 3DX6A 4KNSA 1G7QB 2YAHA 2FT8A 1RMFL 1UWEL 3U0TB 1UD2A 3JXAA 4G5ZH 1OCWH 3EF4A 3K2UL 4UMGA 1AKPA 3MTXA 3ET9F 1UZGA 1JGVL 2JCCB 3C5JB 3F12A 4L8SA 3RB7A 3VD5A 1SF3A 2E3VA 3EDDA 5IM7B 4OGXH 5BO1H 3SDYL 1N68A 1GOGA 3N43B 4LLUA 5DJDA 1AS6A 1OM3L 1EHAA 5J8OA 4A7TA 2EO1A 1MF2H 3Q0HA 4UQDA 3VGAC 4LRNH 4YXLL 4LDLB 4LO9A 3BE1H 5C0AE 3QIWC 4OF3A 1MAMH 5F7HA 4LOEA 4MDJB 4QRRA 1K85A 2PMZA 5BZWA 2V7NB 3SZ6A 3P3UA 4HOZA 1QAWA 5GRJH 4WFGE 5FO2A 3UC2A 3CDZA 1OB1B 5HBBA 5FYKD 3L13A 1X6NA 3QEQB 4U3CA 1G7HA 2XZAH 4X6FB 1YEWA 1CGSL 1EX0A 4K2UH 4XCNB 1MJ7H 3VMNA 3RRQA 4HGMA 4J3BA 1CVRA 1B2YA 1RV6X 1MFAL 2EADA 3SO3B 4K71C 3GC3A 3QA3A 3KPQA 1IE5A 4UQBA 4FJ6A 3G04A 4N2EA 5I9QC 3L6FA 3VH8A 3GRBA 1KB9K 4YUEH 2VLLB 3PV6A 3CXHJ 1TTBA 3WHXA 1JZ3A 1U93A 3B1UA 1T89A 3D3VD 4Q6IC 4PWHA 1HIMH 3QWQB 4NQDD 5BVPL 1JK8B 5GRYA 2ARJQ 1JAEA 1EFXD 5HHNA 2Y7NA 4Q6YA 4X9HA 1II4E 1XZ0B 3N3EA 2ZP9A 3EYSL 5T5NF 1DBJH 2L7JA 4PGEA 3L3KB 3V6OA 3M8OH 2Z8WC 3WUWB 1BZ7B 2BK8A 3GSNA 4PJ5D 4ZMTA 4DUWA 5HVHC 1TFPA 1T20B 4MZRA 1HHKB 5MEPB 4Y5YB 1S9KC 2ARWA 3WIFB 3EFOB 4IBYA 4XPTL 5IQOA 1F3DJ 5J11C 5ANMA 4NQSB 1CIUA 3GLZA 3UTQA 1I7ZB 1KB3A 1KIRA 2WUCL 3BAKA 1MH5B 4PFEA 5DVPA 4GW1A 2EEDA 2IBZX 2OTUB 2QSTA 1QI4A 5HDBF 4O4YH 1J5CA 4NZFA 1YO4A 5IEKB 3C9NA 2XV0A 1WFUA 1I8UA 3UCRA 4MHHG 4P5MA 3GMNA 4IOSD 1J9RA 4Z7VB 3DI2B 1SOKA 5SWSA 3PP3K 2P4AB 3KMDA 1UD5A 3CSYA 4AM0Q 1IGYA 3WU1A 2ZT9C 4ABQA 2KQNA 2XWTB 3NJGA 1A14L 3ZZ1A 1GAFH 5EO1B 2I5YH 3RPIA 1NSNH 5AAMC 5D7KE 4F9LC 3U25A 1GZPA 2W9EL 3HC0B 3L1OH 4LLDA 5A43C 4PP1D 1A9BB 2GY7B 1YEKL 3BUDA 3X1BA 2VQ1B 5CIPA 1J5HA 2OMVB 4G8GD 3TM6A 1VCAA 2CUIA 3ROOB 3VXTA 2HCZX 4IGBC 3SBPA 4YEEA 3FO9B 4BCYA 2O61B 3DYPA 1AD0B 3ZYIA 2NY3D 3SPVB 4QHPA 1PX4A 4WAFA 3D69A 4LNRA 4XP9L 1ILUA 3A6CL 5IQ7H 5DUML 2IG2H 4LCUB 1M7IA 3ABKB 4J3OD 3LNIA 3GGWA 5HHVL 5FO8B 2NY2C 3RA7H 3SJVD 3KPRD 4Z7OE 3Q9QA 3HBQA 4HWEH 2GJ6B 1A9EA 4O58L 4L9LB 2DIEA 4LSDA 4XTRD 4XPHH 2GTQA 4GKNB 1D9KD 4M00A 4OCXH 5T3ZD 3EOAA 3RWDB 2WXFA 3TIEB 2ENJA 3ZN6A 3DX9A 5F71A 3MUHL 2N0MA 4QRQB 1R5VB 3D25A 1EDYA 4HUUA 2ZKYA 4JAMA 3ZUNC 1AO7B 4R0LC 2PO6D 1EVUA 4YSPA 4ZSOB 3HG1B 5DD0H 3KL5A 2AHIA 3OMIB 3B56A 1K2DB 3L7EA 4Q9BA 4EDWL 3OM3B 2QLVB 3TT1L 3ZO0A 3VFNB 2HYMA 3ARGC 1UD4A 2IAMA 1F41A 4YJZL 3O4LD 1F4XL 4ZOCA 1MVUA 2J5WA 1XF2B 3KM2A 2UZIL 4M7LL 4DGIH 3FU8A 2HJFA 3L9RB 4P9MH 3RVUC 3QCUH 5C3IA 5AG9A 3B9VA 2H8PB 1KTLA 5E56A 3F85A 1COBA 5EG6C 3SYAA 4DUVA 4UUJA 3RJOA 2BFVH 4X83A 1IAOB 3BGMA 1M42A 1LD9B 3IFOA 1ZOXA 4HQQL 4WNSA 1RJLA 3FSOA 1B2WH 4MQXD 4N2HA 2GSIA 4V33A 2ZSWA 2GKIA 1A64A 4PJGB 4GG8A 3BPLB 4Y1TA 1N70A 4ZZFA 2HB0A 1J1OH 5ADPL 1Z7JA 5IY5B 1IBDA 3NSFA 2CBMA 3BAEL 3MKKA 1VGEL 2QADC 2ZAIA 1K8IA 4ENEC 3SBWA 2WK2A 3VWJA 1FORH 3UP6A 2CHDA 4K8RH 5FECA 1B4TA 2BNRD 1CDGA 4X4XB 3WTTA 2OSLA 3CX5K 1CLOL 1E6OH 3NAAH 2YGVA 1UEMA 3P77A 5B1JA 5F7KC 3TBYB 5JIMA 3MLTA 1CGXA 4G9FD 3VFGH 2NY5L 1WTGT 3HZVA 3MLXL 1UENA 1Z9SA 3PRZA 1IM3D 5JQIB 2B4CH 3CC5B 2I27N 2WLNA 4JDEB 3GS0A 2B3RA 3HLKA 4AYFA 1FNEB 1SM3H 4Z78B 1RZKH 5E6UB 3MJ9A 2X2IA 1ACYH 2PCPB 2P46B 1U2CA 2YD7A 3QIWD 3WY1A 3FQXB 4JO8A 2RFXA 2ITDA 1Q9WA 3GMLB 1T1ZB 2XCMC 3Q5OA 4AGQA 2DM2A 2KLRA 2R0KL 1IX2A 1IKNC 4X9YA 1Y1UA 2IF7A 1QRNB 4TUOA 2DYRB 1UA7A 5IB2B 1UJ3C 3OAZH 3X2QB 4ZOEA 3O8XB 1MSPA 4PJ8A 4QDGA 4BZ1A 1IRAY 2HKHH 4UAOB 3WKPA 3NJLA 4PPTA 4WTXA 2J6EA 3OJMB 4X5RA 4ORZC 5IVOA 1WBZA 1V54B 3TJEH 3L5IA 4E36A 3V8CA 2CKBA 3ULUE 1UM5L 5H4ZA 3AY4A 4JKLA 3STLA 3WCYA 2NY0C 4UV7H 4MQTB 3R4DA 1F4YL 4GEIA 4BGLA 2K70A 3FO2B 4JPVL 1TXKA 1B3JA 4AZ8A 1XD1A 5F7YC 5EBGA 4TV3A 4OTXH 1TVBB 3WI9A 3BVXA 4DHLA 1IM9B 2EKSA 3G5VA 1YEHL 1CICB 1E7VA 3BPNB 2WWKO 1WD8A 1ZMYA 4CMHC 5FR3A 2VKWA 3PWPB 4KZDH 2YOCA 1PLAA 5E8PA 1OP3K 3G5ZB 4XAWH 3LEXB 3LRGA 3QUKA 3ZK0A 1WWCA 1A8ZA 4IYKA 2K0RA 3LHPL 3MA7B 2BDNL 1U9KA 4KRNA 3FUFA 1KNOA 2OJEB 3ZE1E 2UY7A 1QP1A 4HKBB 2X3AA 4LE8A 1M2VB 3HR5B 4MD0A 5K5YA 4DK6A 4E68A 1RPKA 2OMTB 2A6JA 1C5CH 2EE2A 4FADA 4LP8A 4AK1A 3ZSSA 3NFPB 2EICA 2JMRA 3AU0A 4KKAC 4XE5B 1XHHA 4U1NB 3A0OA 2Y36L 4PJXB 1NIFA 2E7CA 2N3JA 1C08A 1TJHH 2VISB 3CH1B 5K1JA 3V6OC 1OK8A 2ZKHH 2ED9A 3Q6FA 4WNQB 5SV4A 3C8KB 5BOZG 1QVOA 4ZTPL 2NUPB 1MEXH 3A6BH 1RK7A 1NPNA 2IPKB 5EN2A 3D4GA 3W0WE 2DH2A 3GXPA 2CUMA 1ZLSH 2IEPA 3QHTC 2VLJB 1U8KB 2MEJB 4AQ8A 5KYYB 4KI5C 3RWHA 2F53E 2W9DH 2XIBA 4LCYA 2EDLA 3B5HA 4M02A 3CFIC 5DJXA 4NP4H 3ZHNA 2VLKE 4PI0A 2JJUA 1PJWA 1KTKE 3N43F 3MLRL 4R7DB 4IGBD 1IC0A 3GSWB 5JHBA 4HX1A 4BSJA 2J73A 2WQRA 2A3TA 4FQLL 5DVLA 1A3ZA 4D2NA 5LUMA 4YX2H 3V4VL 1URIA 3VE0A 3HBGA 4B9YA 3S35L 2NY2D 3CFJB 3NDZE 1XBRA 4XOEA 1KCUL 5F97E 3IDYC 3VU2A 5MEOB 2CR0A 2XY2A 3DOSA 5CMAA 2D4FA 4NUGH 4L5FH 1Z5LA 3FK3A 2UVEA 1R6VA 4Y4HB 5T1KB 3CK0H 3ARDB 5D7LE 2ZWLT 4WEUD 4I3RL 3MROA 4YEFA 4JDVA 4H40A 3FB7B 1BQLH 2VDLL 2IDTA 3VGEA 3RYMA 1I7TB 4HVBA 1MFVA 1YEEH 1IC4L 1SY6A 3QNYA 4I9WE 5C3TA 1KBPA 3BUIA 5HYSA 4Z3EA 1E9QA 4M7ZB 3TT3H 4NBZB 5DEZA 4LPTA 2BRQA 3ARGD 3MOAH 5IFJA 1SFDA 1BD2D 2VITA 4IBQA 4MMYA 3S35X 4FFWC 5FA4B 3MBXH 2ZXAA 4GXUN 1F00I 2MCPH 4JFWA 4OZFA 3RVUD 4QOKD 3LZNA 4LT7A 3MV9A 5I5RA 1HHJB 2FJHB 3I2CL 2FCBA 4HHAA 5E1AB 4JHBA 5TDPB 2GBVA 4NRXA 5FUZH 5C09B 3IBOA 2CIKB 4L23A 3M1BB 1KLUB 2QKIA 4GQ9H 3X14A 4APXA 4G83A 1S7RA 2C3XA 1N8ZB 3P4LA 4S0SD 5TPWL 5EF2A 4KITB 2XN9D 1AJ7H 3F84A 4HP5A 1RUPL 3OPUA 1SPDA 1LEKA 3QUZA 8CGTA 4UIMA 2AJSH 2VCOA 3S97C 2ZXBA 4JRYB 1FH2A 5DURB 2R2CA 4QTFA 4V1DB 4XVOA 1AGCB 1ED3B 2QADD 3FT2B 4N1CA 4ENED 3S8GB 4AI7A 3RIAF 1MI5D 2EDOA 1J1XL 1A7PH 2IAMC 2BZDA 3D09A 3AVEA 2D7MA 1AHMA 1BBDH 3MFFA 2A73B 1KN4H 5IP4A 3DC0A 4IU3A 2YC1B 2WCPA 3VXRE 3MRQA 3VSQA 1WGVA 3NZHL 1XB3A 4Y19D 5I16A 4TUKL 1NANI 2ED8A 2WWMC 1IAIH 3DX7B 3HVDA 3JWNC 4PGCB 4D7PA 2DI7A 2EDMA 3FB6A 5CEYB 3NA9L 5FW8A 5DD1L 1YJDC 3IMBA 1DEDA 3F2LA 4PR5B 3TYGH 1LM8V 4CU6A 4Z7VF 2WXJA 1DLFH 1FYTE 2LW3A 3DUHA 3UTSA 5KVDH 4D3CL 3DX1A 4RFOH 4KFZC 4AXWB 4QR7A 3BN9C 3STZB 5IBUB 1ASOA 5DJ0B 2QQLH 2BWQA 4N3UA 3WNPA 3ZPDA 2ADYA 4JE4B 3QDGA 2C9AA 2AITA 1YMMD 2VZOA 3VWJC 3VG0H 4F37F 1UKTA 3CBRA 4NHCH 1ES0A 3PQYB 4OCLC 3IDUA 3AREB 4YK4C 1UB5A 2PPEA 3ARSA 4LBAA 2O5ZL 1VADB 3MPCA 1CTMA 1KZYA 4K9EL 3K5SA 5B1JC 1MCIA 8FABA 5DC9B 4X98B 1A4CA 3ULAB 4HC1H 4WV1B 2LU3A 3KYAA 3W9DA 3MRDA 4JLRA 1YQ2A 1YECL 1JDAA 5FO9B 1KT2A 4YWGL 4CSZA 3HNSH 3IDJA 4KHXL 4C59B 4PY7B 2A6IA 2NY0D 1QTSA 4FULA 3WEXB 1TSRA 3VMPA 2KLTA 3OHMB 3ARWA 4DN3H 3QJUB 1YEJL 1BF8A 2APXA 2EDYA 1FGVL 1GOHA 3HMWL 2ODIA 2EH7L 1YNKL 3CD4A 2DQJL 1J5OH 1ECZA 4PJHB 1FHGA 1ID2A 1J8HA 3EO1A 3N85H 5FO7A 3HZKB 1IMHC 4JY6A 1T7VA 4FG6C 4KRPD 5D7IB 2R0LH 5FYKE 5HDQL 2ZAHA 3P0VH 1FNSL 3AGWA 4HAKA 1KY6A 3LKQA 1THCA 1CYGA 5DJAA 5C8JB 2JQAA 3MXWH 2LLLA 4E9VA 1PSKL 5D5ME 5LGHL 12E8L 4I77L 3F7QA 4L0YA 1JGEB 3L7FA 1XGQA 2D7TL 3PWVB 3ZHFA 4OB5L 2JTDA 3D85B 3WNNA 3B1TA 1FAKT 1G7QA 3K0WA 3D3VE 4LP4A 1FFRA 4NQDE 4KKAD 5E94B 2HT3D 4I18B 5I8KH 1YEGH 3VFVB 1K8DA 5JQ6H 1KSRA 2HLAB