3L48A

Crystal structure of the c-terminal domain of the papc usher
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
b'GKRLFAILRLADGSQPPFGASVTSEKGRELGMVADEGLAWLSGVTPGETLSVNWDGKIQCQVNVPETAISDQQLLLPCTPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane usher protein PapC
molecule tags Transport protein
source organism Escherichia coli
publication title Structural Homology between the C-Terminal Domain of the PapC Usher and Its Plug.
pubmed doi rcsb
total genus 15
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13953 PapC_C PapC C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l48A01
4J3OD 2XETA 2KT6A 3RFZB 3L48A
chains in the Genus database with same CATH superfamily
1G6RB 2OJEB 4MXWL 3HR6A 1A21A 1J0KA 1T4WA 1ZVSA 5H2BA 1NCAL 3ULVF 2XTJD 3QO0B 1ZANH 3KVQA 5IK3B 4J39A 5G4OA 5ISZE 2Y7QA 3KYMB 1Y0LB 4UIMA 4WDIA 3I6GB 3UGUA 4AG4H 2DICA 5IHHA 4BSVB 2YLKA 4EUPA 4CU7A 2FHCA 4F7KA 2FECL 4JRYD 1PMYA 4ZFOA 1A1MB 1P4IL 4PWJA 1SEQH 4HQQL 4HOXA 3AUVA 1VFAB 2VLMD 1MFVA 4QRAA 5KSAB 4ZTEA 1XGQB 2VLLB 4BD4A 3N42F 4LZKA 5ANMA 4X9IA 1E4HA 4ALAC 3O8XC 1UEYA 3WIIL 4NPYA 4HLZG 3FB5A 2FQFA 1OY3B 1HN1A 1KXQA 2VKXA 4NNYB 4AV5A 2VL5B 1UYWL 3NACL 1HHGA 4RGNE 4XAKD 2Q76A 1V7NL 5FW7A 1U93B 3G3LA 3U4KA 3P2DA 3VQLA 3MR9B 2FJHB 1L0PA 2V7NB 5HGBA 1A6ZB 4RIRA 3CK0L 1ACYH 5FECB 1JTPA 1YEEL 3CZKA 5J9PA 2OL3A 3V4UL 3AMLA 3CHXA 3KHOA 2YK1L 3IJ9A 3VG0H 2VLJE 4OB5H 3X1BA 1UWEL 4CILA 2X0UA 1JD9A 4V2BA 2NY4C 3H53A 5LCVH 1MEXL 2WXLA 5GZOD 4F57H 2ADJB 5FGSA 2NY6B 3BN9D 1BYPA 3QHZL 5D7JD 1MJ8H 3FB8B 1RUAL 4QJ5B 4FQIL 1D5ZA 4FLRA 2AQNA 3DGCR 4I4WB 2WUCH 1MF2H 3QWRA 1A4KB 2ZUVA 4IRJC 3P0YH 1L0XA 4R96A 4AXWB 4PP1C 2JK5B 2MPVA 1D6VL 4PRNA 2YEZB 4Q58C 4U6YA 3UZQA 3GI9L 2KI6A 4IRZA 4U0RB 4NENA 3OAZK 1BWWA 1XHHA 3OKNA 3QUXA 4MCYB 2AK4D 4KROD 3VMNA 4NI6A 2Z1KA 2V3FA 1KCRH 4RZCB 3C8KA 1NDGA 3BZ4A 2WO2B 2X42A 3RWDA 3ZUNC 3LKNA 5MEOB 3BLBA 2NQDA 1OAZH 1IBHA 5EF0A 3QEGL 1EZVY 4GO6B 1XF5B 4O58L 5J0BA 5LWYL 1ORQB 1YNTB 2C4XA 5M95B 4CVXA 2FATL 4LEOB 4AQ8A 4OVVA 1TETL 2RCSH 1KFGA 3T0EB 1W8OA 5JMOC 2HLEB 2K9FB 5GZOA 4XXDB 4P2QA 3JWDL 2YAQA 1DVYA 3NIGB 2IEPA 3BVNA 1SOXA 5IM7A 5EOCH 1EXUB 2IMNA 2ZWSA 3O0RL 4BK5A 1G9ML 4OZHE 4LVHB 4MZ2A 5I19H 4FFWC 2R0KL 3WTVA 2F54D 4ONOA 4PGBB 3L81A 4XE0A 3CSYA 3WXWL 3GFUA 3SE6A 1GR7A 3QNXA 4U1GC 2FNBA 3F12A 4G8FB 3V0JA 3VH8A 2B5IC 4CC0A 4LLMA 5ITBL 5C0CD 4UU9A 4HWZB 3O11A 2EKSB 3K72A 2R0LL 1EERB 1LO5B 3TF7C 4PJEE 3JYCA 3SOBH 4B0MB 4PUBH 1ACCA 4JN1L 4OJCA 3QFJE 4CBPA 4BFRA 5GGRY 1SDDA 4X4XB 3PWUA 1BF5A 2WUBL 4HLJA 4I77H 3AW5A 3PL6D 3FT2A 1YN7A 4HG4K 5D96B 5HYSB 3W5NA 2QPEB 2ZX9A 5GS0C 1DL7L 3WO4C 1HTYA 2I5YL 3CVHH 4WW2B 2DYSB 3BAXA 2IF7A 4N2KA 4U6TA 3RWHA 5F6IB 3V6BR 4L8BA 1S7XB 2XV2A 5KVFH 5JLZB 1QA9B 4JS7A 3R7QA 2EEBA 2VQ1A 1CIUA 1AGCB 1RUKH 3FFCA 5JTWA 4NKQB 4DW2L 5J1AA 1TQCB 2FJFA 2CZNA 4BHUI 4YHPB 3V5DB 1L9OA 2BIMA 2CRZA 3SDCC 3O9WA 1MDAA 2XV0A 4YIQB 4BFBD 3NJFA 4ZXBD 4X7CC 1CWVA 1IKNA 4N85A 5T1LA 1CK0L 2NX5B 4QT5A 4PREB 3WIFA 3RVXC 3C2AL 5DR5L 2H8PA 4TPRH 2CUHA 3IDXL 3CFMA 4PJEB 3O4LE 5CJQH 3QIUA 2K7PA 5L4JA 3IDGB 1LMIA 4KUZH 3TVMC 1NDMA 1VEPA 3CVIL 5GHWH 1I1AA 4Y19D 1HWHB 1PKOA 1Z5YD 4NKMA 3X2QB 2VYRE 3QWNA 3UH8A 3LV3B 1SEBB 4PBWD 4TL4A 3MRCB 1XF3A 3S97C 1KCBA 2X38A 4ECNA 1IC0A 2OK0L 2UX6A 4FF9A 3D25A 4Y16A 4KI5D 4E9YA 4B7IA 1D6EB 3VM5A 1E5BA 2HUHA 1MRFH 4K23L 4O51B 4PGDB 4ODVL 5GRVK 3O11B 2DWSA 3BSZL 4EI6A 2HVKA 2IPKA 5ID0B 4LCUA 3B5TA 3LXBA 1JGLH 4JQIA 4KAQH 4M9PA 2JK5A 4L1TA 4Q56A 2KDYA 1XSKA 4ADJA 5IV2B 1L7IL 5DURB 1MWAA 1X9RA 3SGKC 4ZI8A 1IIKA 2EDBA 3B9VA 1RH8A 3CSBA 2Y1AA 1J1XL 3RY4A 4PJBF 1I8AA 1X5YA 1S9YA 1MY5A 2UUDH 4M1GH 1J8HE 3ALPA 1OAYH 1A7QL 2WBJB 3GXNA 1QFWH 1RMFH 3RZCC 1HH6B 4F7EA 3SGEI 5FW8A 3DX7B 4K8RH 4PW4A 1W72B 4EIUA 3IJ8A 1AGBA 4QYAA 4UBDC 3LQMA 3ARRA 4H0LC 4U1JB 5DQ9B 1N59A 3Q8FA 1OP3K 2DEWX 2YC1A 1X5ZA 3PWLB 4DP9X 3BVNB 1DYZA 3UTZA 1ZLVK 3JQOB 4PJ7A 4LSQL 1T03H 2VN7A 3VSUA 2VXQH 2ZSWB 3KCPB 5KSVB 5CP7B 5AUMA 4JHVA 1BZ9A 2GTZB 1NOLA 3W82A 4IS6B 5C0AA 1PIGA 1KMGA 4AEFA 4P2OA 2DLGA 1JGLL 5FA4A 3MREA 4GSUA 1NL0L 4LDOB 4NKOA 3S37L 3SE4A 1YJDC 1T4KA 2QADD 4F24A 4OV5A 1ZHBA 2E3VA 3BEVA 4NAMA 1D9KB 2N7AA 4P46B 2OYKA 1M56B 1T6WA 4AQ1C 2OL3L 4LIQE 1XAUA 5A3ID 3FQXA 4LDEB 1MQKL 2FJUB 1EANA 3DRQB 3HG4A 2J44A 2WQVA 4Q97A 4LKCB 1E27A 3K1DA 3VXSD 5DTFB 1ZLEA 4FFYH 2ITFA 3SBWC 1BIHA 2YQ2A 3L2LA 4FP8H 1HSBB 5EZLB 5BRZA 1DQVA 2O5YL 1DVUA 2EYRB 1FDLH 2W80C 1DCEA 4FQXC 3S4SB 4P2YA 1QNZL 4R90L 3UYRH 4S2SA 2GK2A 1T7WA 1DVTA 1QFUH 2IQAB 3FCSB 3L1EA 5DR5H 2YIHA 4C59B 5GSRB 1RKRA 3VFMA 2QLVB 3MXWH 4QO1A 2AI0L 5GRZA 3TTSA 2KQMA 5F70A 1QHOA 2J56A 2OR7A 3C9NB 3PGCB 2FSEA 2HXAA 4HW6A 1FNSL 4J2XA 1OQXA 2B8OT 5F8QC 1GJIA 1KYOK 4UTBL 3B7RL 1LO4H 3P30L 3GMQB 2G5UA 2X5PA 4NN5C 4L37A 4FN0A 4XPGL 1JK9A 4B5ZA 4QKXB 2NY2C 3BWUF 2W38A 2Y3AA 3EG9A 5EU5A 4KO9A 1AD0A 4OCSH 1WAAA 3JUYA 4MVBC 2QSCL 1B4TA 1RK1A 2IAAC 1ED3A 5IEKA 3FOMB 3C6SA 1NCGA 1T89A 4HCFA 1IM3A 1PDKB 4HKXB 5IBLD 1L3WA 2XIBA 3NJJA 5AWNL 5C08D 2X3CA 5K39A 4U3SB 4UQAA 4IOSA 5IB4B 3BUYA 3PL6A 1MIMH 5C0ND 2YD1A 2F7RA 3MPCA 1NC4B 3NCJL 1X4YA 3OPZH 2G60L 5LJYH 4XR8C 2PR9A 4Q4IA 1IEAB 5AKRA 4JM2F 4MA8L 5AALA 1TEFA 5KSUA 3G6DH 4IDJH 5DMIL 2O6PA 1R1CA 5IGXH 2WLHA 1OGAB 4HK3N 2Y0SA 5GRJL 3WU1A 4DO5A 3HG5A 4FQPA 1GC1C 4M5TA 4X6CF 3STLA 5KTEL 5F89A 1ETB1 1FO0L 3LDBC 4NFDA 3DUSB 4K3GA 1DVXA 1GS8A 3T0ED 4FADA 5EIIA 5BW7A 1GY1A 3MFFA 2IWFA 1RPUA 4GFTB 1WBYA 4JFEE 1M1SA 1NCCH 2MQGA 2NX5D 2K7QA 2H1LM 4R84A 5DGRA 4CU6A 4JQIH 1CTNA 2RQ8A 3BW9A 4EVNA 3MDJA 1E4KC 4GRLB 2X6AA 5E5RB 1ID2A 1OSPL 5BS0D 3ZDYB 5E8PB 2IXQA 2WVSA 3MOQA 2X4SA 3QEQB 2FHFA 1EO8H 5HGHA 4AVIA 3VFOB 3MLVL 2CRYA 4JKPL 4DAGH 4JLRA 3QA3B 2XG4B 1TSRA 4NSKA 3WN6A 4Z7WB 4YNYB 2WKLA 3CV5A 4HS6A 4KJWD 3UP1A 1VADB 3ARDA 4P3DB 2VDNL 2EINB 2BIQA 2VZOA 4RRPG 1N5YL 1HZHH 1N0XL 1S9XA 3T0AA 1TKWA 3Q06A 4UQBA 3K91A 4KXZI 4TUKH 4A7GF 4XCNA 2TAAA 4PGEB 2ADYA 3ZJAA 3FONA 3HRPA 4UILH 4LPWA 5E6IA 1QRNE 4NEHB 1LO2H 2N7BA 3CFDB 3OMAB 5K1VA 3SODB 2X41A 5A2KH 1UURA 2R0KH 4KZEH 1OPGH 1WFJA 3ZKNC 3O45B 5EU6D 2ZCHL 2GC4C 3V4PH 3KXFB 1C5BL 1ADWA 2CMRH 2J21A 2VNCA 4JFPA 2D8KA 4MLIA 2DQHL 3TWCH 5MEND 3V0IA 4QYOB 1A4JA 4NS0A 4W9ZA 2YJLA 2DQMA 4DGVL 2Z31A 3TNNA 2AHIA 1EK3A 2Y9RT 3S3CB 5F1SA 4P5MA 4XNUH 1Q9LA 1R5IA 4N25A 4PRPD 4DUWA 5KANG 1NWPA 2R8SH 1DHKA 2PNDA 1ZT1B 4L9LB 3UYPA 5C09A 3RVWC 1T1WB 1J11A 2X40A 4EI5B 1KB9K 2A6IA 2LOEA 4JG9A 3OXSB 3GIVA 3L3OB 3HVNA 3WSQL 5HPOA 4R8WL 2FJGB 2LU7A 2R0WL 3CIAA 2VAAA 2X12A 1EVUA 3U2IA 2WMPB 2Y5TA 5FO9B 5E9NA 3W0WE 5JW4Q 4DOHE 2E6QA 2WANA 2HN7A 3CQFA 5KSVA 1QSZA 2ZWLT 4U1HA 4M48H 4NQEB 4OLZH 5CD3A 2YPVL 5LXGL 3OZ9H 4Z7NB 2WCPA 4WHTB 4Y4KD 4LKXB 4LCUB 1J9QA 4YL9A 5I6PA 3VG9B 3V4VL 5DZLA 4R2GC 4JFFE 2H0FA 1QG3A 1MH5A 3F2LA 4HWBH 1SRDA 2DOCA 3DI3B 3EYQD 4JRXA 3KW8A 4WIQA 1H3TA 2P24A 4M6AA 5CFHA 4F57L 5A2JH 5JORB 3Q6FB 5HDRA 2IH1A 1RZKL 4NQEE 3G9VA 1RJZA 4WV1A 3U46B 5AG8A 4EI5D 3GPSA 1IAOA 3N1FC 5CS7A 4LF3B 4R8WH 3FN0L 4RQQB 2OSLB 1IKFH 5HI5D 5F96L 2I85A 3MQIA 4RSYA 1RZKH 3KPQB 1B90A 2A9CA 1SXZA 3MTXA 3RI5F 3TURA 3GS7A 4ELKA 5LAXA 3PAZA 1H8SA 2HWZH 2J8UF 4ZSOE 4DEPC 3HZVB 2WTOA 2YPVH 2XWTB 2PPCA 3FQRA 4UANA 2BSEA 3O2DL 1KYUA 2JSFA 4PS7A 4G7VL 1SJHA 1HC1A 2X6MA 5FECA 1BG9A 4ZSOA 1TTGA 1CTOA 4ONHA 3WEBA 2B4CL 1W72A 4JKPH 3JUZA 3QHFH 5L0QB 3P11H 3V2AR 4XMPL 3SDDD 3FMGL 2KUTA 3L3IB 4DUXA 5I9QC 5H35B 4ODBD 5IEHA 1JNLH 5I0DA 3S35H 2ZTBA 3DJTA 1SF5A 3HC2A 3G6JB 4XBEH 1A7NH 3P4MB 5LQBL 1QWHA 4MKMA 2ID5A 3IKKA 1NIBA 4HIEA 3EJJX 4JFVA 5D7JB 5HDOA 3W1ZA 3ZDZE 2YXFA 4HSAC 4R4NC 2I9TB 4BWTA 3FSAA 2XKSA 4FXGA 4Y5XA 3ATDA 3IAGC 5TQ2L 2CNYA 4B6ZA 1ORSA 1UXSA 2J1WA 5IHUL 3TZVA 2ZG3A 4X0KA 3EFFB 1XX9C 3BH8B 3FQWB 4PJAF 3GSXB 5DS2A 3DO7A 3L4YA 3CQPA 1U58B 4FXLA 5TE6L 4YZFF 5DVMA 1HL5A 5D1XA 3UBFA 1FSKC 2X87A 2PPDA 4MAYC 3WO3B 2VLRD 4KDTA 2GCYA 2R83A 3MV8D 4LRIC 1E5YA 3E3QE 4BXSV 3BKJL 4AW4A 1T1XB 2FVNA 2FBRA 3FO0L 5D1ZD 3NJLA 4KKCD 4GNKB 1CD1A 3V7AE 4B9IA 1SYSA 4MA8H 3WIHL 3LD8C 4JM2B 5EZLA 3DGGB 5L7XH 2FECI 2IANB 3SY6A 2BC4B 2B14A 1MLCB 4QTIH 1MIML 2XN9B 5KBPA 1MZYA 3ESPA 4UNIA 2GFBB 2NTFA 4Z7VA 4G5ZL 1GS6X 1X6LA 4JFSA 4WAFA 1R17A 4HDIB 5HDBB 3M17A 5I17B 1FO0H 3ZIYA 5CGYD 1TQWA 2NTSP 1NGXA 1A7RL 3HZVA 4X80H 4RMBA 5GISL 3OR6B 3IU3B 2VL5A 5MENE 2M1KA 2C9UA 1MAMH 1MVFA 3WKML 5C0AB 1SGKA 4LEEA 1IGML 1V3JA 3BI9X 3FTGB 3PJSA 3IDUA 4HWZA 5FUZL 2LAGB 2OTPA 3V6FB 5EORH 1QI4A 3SDXA 2X4RA 1TCMA 4FLHA 43CAB 4G8IA 2QKIA 4ZTPH 2NCEA 2YARA 1A4BA 3GSQB 3X1EA 4DEWA 4X5LA 4X4YA 3T6QC 3GLAA 4DQAA 3A6CH 4ZZKA 4NRXA 5IESL 3HZKA 3ZYJA 5K9QI 4X6DE 4ZW6A 1T7YA 3QZLA 2AJYL 2A9AA 2NY3B 3ARGD 3N1QC 3BQVA 4N9GB 4ZPVB 1HH9A 4NHUA 2NSQA 3MUY1 4LCYB 2IAMA 3TV3H 5TQ0H 3RVUC 1OGAA 1W72H 3ULAB 1HU8A 4RMQA 4XP6H 2OJZH 1CGSH 1H19A 1GZQB 3OHMB 3EO9L 5SWZA 5DFTA 4X7FC 3T65B 4RETB 4YSDA 4UT6L 3FH7A 3WJLA 2R69A 1BJ1J 2BIIA 5I0XA 1S7RA 2V0AA 3WY4A 3E6FA 4M1CD 2OZNA 1AE6H 2SEBB 2X4PB 2WXOA 4W9GC 3B37A 3VQ2C 4X5XB 4GT0A 4EXPX 5C08B 1Y6MR 3K6DA 4LHUD 5A16B 2YZ1A 1XFPA 3RBSA 5AKTA 3WFBH 3BFOA 3HS8A 4O2CB 2EDFA 1FF5A 1OTUC 2ZNWA 1BJ1H 4LSPL 1Z9MA 3EFOB 3MRGB 4N0CC 1KB5A 2XIIA 1R9FA 4F8QA 1M6UA 1HHGB 1UUSA 2F19H 4JPKH 3APFA 1XF4B 2WQUA 3WLWD 2VDOH 1BXAA 5ITFA 5HVHC 2J57A 4X6DF 4ATWA 3Q01A 2QMJA 4ETQA 2NPLX 4X6CB 5F1NA 5DUPH 3U82B 2ZWZA 4WTXA 2KBGA 3RWFB 3ZSSA 1F18A 2BVTA 2NW2A 5LDSA 2XWJA 1KELL 2GJ6D 5FDWA 5E2WL 1F5WA 4B9FA 4Y4HC 1ZDQA 5JXEA 2PR4L 3O6FD 5F71A 2GTQA 1UOLA 3RWIB 5I2IA 3PLYA 1PNCA 5BOJA 3WUWG 4ZUUB 3MLWL 3EYSH 3KVPA 2KPWA 4JFQA 4FQHB 1RIHH 5CUSH 4H26B 3T0BA 3G5ZB 4J4PA 3IBEA 3N5AA 5EBMA 5JHDA 1G6VK 3G5VB 3CFCH 3QXDB 1CF8H 5IVNA 1OZUA 3W38A 4GRMA 4U1KB 1OD9A 2ROXA 4D0DB 2ZXEB 4I1RA 4L1BA 2QGCA 1KFAL 1RJZB 4IK6A 2K8QA 2WNGA 1JS4A 4WCYL 3WHE0 1P4LA 4EOWL 3EHBC 3L95B 5CEZH 4RQQA 2EDWA 1FC1A 2V37A 1SYVB 5DD0H 1LP9E 3RDTB 5L88L 1KBVA 3QJVB 4QLWA 5DFAA 3II3A 4FI8A 1MFNA 1YEKH 2ZG2A 3UACA 1N3NA 5ANHA 3HZYB 3LH2H 4ENZA 3FT9A 2WN3A 2VDLB 3DJZA 1WGOA 3SPCA 3PDGA 3DJ9A 1V5JA 4M1GL 4JO3H 4K2UH 4XMZA 1KY7A 4ZNEE 4Q0XH 1E65A 3DVIA 3PXJA 4B53A 3VXRD 3ZZQA 1IGFH 4YNYA 3VSVA 1J8SA 2BW5A 5EBWA 1FE8H 3D85A 5JHLH 2MMXA 4PJGF 2BINA 1Q0YH 3QDMA 1ECYA 1CGWA 4H2CA 5G4MA 5GIRA 2G5BA 4OVUA 4M4PA 1PZDA 2QKSA 5ADPH 3GJFA 3S88H 3TZVD 2Y7LA 4RGOL 4YK4B 3ULSA 3QXUA 5AD0A 3GZOA 5ACMA 1SNRA 3HLAB 2AXFB 4TVPD 1KN4L 2GHZA 3BKCH 2ENSA 3SDCA 3SDXF 2VUKA 1HESA 1KTLB 1A3LL 3IGAA 3NGBB 2VABA 2IAMB 4PI2A 5HVWA 5JHLL 1UA7A 1QHPA 2HVKB 2IPKB 1BEYL 2OKMA 3WI9A 4JZOA 3DRTB 1LEKB 3FO9B 5IBUG 3S3DB 3VXTB 5DEJA 1MFAH 5GZOC 5JNYA 3QYCA 2QQKH 4G80B 4LBEA 5FOJA 1WFTA 1I1FB 3OSKA 3QPQD 1YQVH 4ONHB 4ZJ9A 3BAEL 5TTRA 3H9HB 5LGKA 3D18A 4H5SB 2J1YA 2EDMA 2NW3B 4F80A 4HJGB 1DBKH 4GKLA 2O1AA 3UGEA 1X6NA 1CGTA 1JXGA 3BSHA 1NFDA 4ZXBA 3CPLB 2G3ZA 3BZFA 3CZJA 3HN8A 4G7YH 2AC0A 2HLAA 1CFVL 2YD5A 2HCZX 1CD9B 1YUHA 2VM3A 1O7SA 5F7YC 4JKLA 1AKJA 1FGVH 1YSOA 4NSKB 2PP7A 4EN3D 2L04A 3BAYA 2ZKXA 1VCBC 5J11C 3HIZA 1MFMA 2F58H 3MLUH 3BJLA 2AJSL 4YE4H 3QNFA 3HZMA 4WUUB 4L3CB 5BOZG 4JK0D 1TVDA 2P80D 2XPGA 4OZHA 4LL4A 3V4VB 4FABH 3POCA 3TN0C 1YEGL 4XZUA 3W2DH 4AVJA 4PRHE 3ZE1F 1NICA 3TNMA 2RR3A 2R0LH 3MX0B 4IBYA 3RWGB 5GZNA 5KS9A 3WJMB 3UBXA 2DKMA 1XCWA 3SDYL 5GS0D 2XTLA 3HS9A 1G1OA 1JYWA 1IU1A 2PLTA 1WA0X 1R3LA 2ZXAA 3MV11 5BQ7A 4JW3A 4P23A 1KELH 5HYIA 5ESQA 4N0FA 7TAAA 2I5YH 3CVHL 5JPNA 2DMGA 2VZVA 2HFEA 4X9GA 1FZKA 1KBBA 4TVPE 3WNOA 4A55A 3IJSA 4U1NA 3QUZC 3GSVA 5DJDB 4XI5C 3OBAA 2VABB 3BZ5A 1A9EB 1P5UA 3CXDL 4JFDA 5F0MB 2NCMA 3TIEA 4PRAA 1RLBA 2RD0A 5EUKB 3TFBA 2BSTB 3MA7A 5JYLA 4Q89A 2MOVA 3O3AB 3F00A 4PJHF 2KS0A 4LSVL 4R3SA 3B43A 2ATKA 5LG1A 2RCSL 3C2SA 4Y5VC 3IGFA 3RKPA 5KSBF 2VDML 1A3QA 4YMPA 3HC3H 1XGYL 3AQYA 4PGBA 5T3ZD 4PRHB 1AE6L 3U36A 4NUMA 1JOIA 1Q0XL 1I85C 3R7RA 1BX2B 4KZ0A 5CKGA 1OSYA 4YFEA 2DLFL 3TU6A 3RGHA 1O6TA 4P2RD 2FGWL 1BBJB 3T3PE 4GY4A 1MJJB 5T5NG 3LZNA 4F37K 1F2QA 4IRZL 4LEXH 3MN8A 3AWEA 1KB5L 3K6NA 4P57A 4U7SA 1RD6A 4PFEA 1KT2A 1ASQA 3B3IA 1T66C 4LARL 1NLDL 4K9EL 1WFIA 5DUML 2J8UB 3K0WA 5D71H 3OKYA 2Y06H 2FATH 1FAIL 3D25B 2G2RB 2WLZA 3WN5A 2CIIA 2XDHA 3VQMA 3BPNC 2PPFA 5C0IB 3QG6B 1ULVA 5MEOA 1IC4H 2F18A 2V7HB 1NMAL 1J5HA 3ZDYF 4Z7OB 4J3XA 4IRJD 3T8MA 3G5YB 1CFBA 1Y7VA 3N43B 2YSSB 4TNFA 3KJ6L 1GMIA 1YEIL 4JREB 3VB9A 3ULUC 3FO1A 2Z4QB 2DQDL 4JGMA 4KKQA 4QOKA 4Z7WF 5I1GL 3DMMC 3R0MA 4ZS7L 4PG2C 3T6WA 3TEUA 3M17B 5BO0D 2QGEA 4R7DB 5DWUL 1YNLH 2D7NA 3DUUB 5FX3A 1WISA 4QEGA 2NY5H 3ARBA 2JJSC 4ZUSB 3GLZA 2CR3A 1MRDL 3T3PF 1XBDA 1LE9B 1CFSB 2MCPH 1H3PH 4IGBA 4F92B 1ZY9A 5BXFB 3N44B 2J20A 2EP6A 5E1AA 3GRBA 3V4UH 2VIRB 3HS0B 4QIRA 4YBLC 4XNQB 4JQVA 5DD6A 3RGBA 4QRSB 4PRID 4U1LA 2WJ7A 1SEBA 1BCIA 3SKJH 1XGPA 3PWLA 4N87A 2A9ML 4JAMA 4BZ2H 2NY6C 2OCFD 3NCMA 3DC0A 3IDGA 4XNZC 1KG0A 1LO3H 3R1GH 4LGRB 1JDCA 4XODA 5I8EB 5TD4A 2ZUTA 3C6LD 4OGAC 2HFTA 4FQJH 1UCBH 3HC0A 3BH9B 1MJJA 2XIDA 1KXHA 1KNOA 3I9GL 5DQJB 3WHE1 1V05A 1Q94B 2WLMA 3T4AC 4EKXA 1R5WB 5C6TH 4MNQD 5TDPA 1M1XB 4IMKC 1WZ1L 4ZTPL 5CM1A 1KCWA 2F8XC 1AO7B 2FBJH 1OT4A 1CFTA 3E6FB 4OI9A 1EIBA 1GY2A 3BEWA 4RCAA 5JIKA 5KN5B 2VLJD 4TNVK 2V17H 2J88L 3HJEA 1JFHA 4Y4FB 2NSXA 1ZTXH 5I1LB 1JSYA 5GISH 3QUMB 4LPYA 1G0YR 5HHOE 1JD7A 4BUHA 1GSMA 3PWPA 1G7HA 4I3GA 4MXWH 5C70A 1WYJA 4FTVE 4WJ5B 4O2FB 2WVUA 1T3FB 3IB4A 3LHPL 1N7MH 3L4XA 4U6XB 2DJUA 3N41B 4QTIL 5F1NB 4LHJB 2VB5A 1VGKB 3ZL1A 1EDQA 3UTSD 2HWZL 4IMLA 2CGYA 4I18B 4XN2A 2ATPB 4JPIA 3WIHH 4AENA 5L2KA 3RL1A 3FNKA 2LABA 1A6UL 1DQML 2GJZB 2YD9A 4XN5A 4N1CA 3W9EB 4B9JA 4AIOA 3GSRB 4HUUA 1KPRA 1S7UA 2XV3A 3AU0A 1NDTA 4U3XA 4WWKA 2X3BA 2JQMA 1ZHLA 1U3ZA 2VGLM 2Z35A 3HHSA 4UT7L 5CIPH 3OLDA 1EEUA 3ZBMA 1YEFL 3CX2A 2JKXA 3TGXA 2WWMD 3IFLH 4KPHL 2CKBA 4J3OH 4PBVC 2VITB 3IN0A 4N20A 4AGOA 4ZD3L 1HFUA 4IMKA 4ZOBA 4ANVA 2ZWNA 4WK0B 1C16A 2XETA 1IGCL 5D1ZI 2ZNXA 1OK8A 3OC5A 2B39A 5E00A 3U4BL 3ZOAA 4OCNC 4CGTA 4ZT1A 3HAEB 4OFQA 5LQBH 4ODTL 5CEYB 3EYQC 1FNEA 1KOAA 1LP9A 1OARH 3LEXA 4ODUB 2IANA 4U1MB 1RULH 2VLRE 3CFJB 5DVNA 3BRGC 2ZAHA 4CVXB 4DETA 2VUYA 4HJTA 5KYNA 1OOWA 3TCXA 2L7UA 2Y2WA 2YFOA 5I28A 3RFZA 4DT2A 3VFVB 3WFEH 1KIRA 1S3KL 3FRPA 4JGNA 5AZEH 4L5FL 3LRGA 5CP3H 3DBSA 3D50A 1CMOA 2YAMA 3BEWB 5KN5A 4L18A 1TO4A 4O2CA 3SKOB 3PAYA 3KPQA 4OLEA 2NY2D 1BJ8A 2VC2H 3KXFA 1JWUB 4D2NA 5GXBB 2VJ8A 2VN6A 4HVBA 5C8JA 2NT1A 2GT9A 1WIUA 4JO2H 5D1QA 4BZ2L 3KYAA 4GOSA 4KX9A 2J1ZA 5LN4A 4H88H 3RQ3A 3MU3A 4GW5A 5AUMB 1OSEA 2VLKA 1JTOA 3LN5A 4FCAA 4BQ8A 1PG7H 4DGWC 4LU5H 3LEVL 2BS9A 4MNHA 4X7TA 3SJVB 2IH9A 1Z5LA 3BGMA 4WRLA 5D9SB 5HGDB 3NCBB 1FNGB 3ES6B 3OB0K 3MLXH 5FGBA 3A3YB 3EXJA 3OB0H 1U8IB 3JWDC 4PY7A 3BIKA 3K4ZA 2ZICA 1XZWA 4FX5A 5CILL 5F88B 4XOEA 2G9KA 2WXNA 2WBWB 2HT3C 1C7TA 2BRRL 2FX8H 4MS6A 3OZ9L 5FCSH 2GSIB 2XG4A 4QHKI 5DMGD 2OP4H 4ZS7H 43C9A 3LQZA 2NRDA 4IKKA 3QG7L 5BZZA 3RVVC 3WEAA 1OCOB 5A3IC 1UM4L 4G1EB 1JZHA 3BE1L 1VJSA 4XP9L 5FGCE 4PWIA 3P9MB 3QORD 5AVWB 5HP5A 3ZDZB 4EQ2A 1HNGA 5I1HL 3D8MA 2J8HA 4XP1H 1R5VB 5DJAA 1AGEA 3CHQA 4LXFA 1RIVL 4QUOA 4XNDA 1DLHB 1J1PH 2HTLD 4XN7A 5SWZE 3VXMD 2UXGA 3VB8A 5HHXH 1OAXH 5FLVA 3FCTB 4AY0A 1ZA3B 2K6WA 3ECVA 3L9BA 2XRAL 2N1KA 1IL1B 3R4DA 4I3RH 4QHMA 1MNUL 2ZUSA 4KZDL 4LARH 1A7PL 1YC7A 5B21A 4P2RE 3X1FA 5E6YA 4D0CA 1WD9A 3DX2A 5EC1B 4HUWB 1MPAH 2IV9A 1U8JB 4HAKA 4Y2OA 2PTTA 1R3KB 4MAUL 4NKMB 1QSED 2QPFA 3EYUL 5J12C 1LE9A 3T77A 2WXQA 4M8QA 5AVYB 2JJUA 4PRIB 2G0KA 3EAKA 2ZCLH 1H15A 1BOGA 1SXBA 2WLLB 1X7QA 1SLVA 3L5JA 3CLFH 4XB7A 1E5UI 4PRPE 2JCCF 3HCVA 2A6IB 2YUWA 4GW1B 5K9QG 4NQDD 4PWFA 3HUJE 4RAVA 1VENA 1TENA 1Z5LB 3BGMB 1SJXA 5HGDA 3QC6X 4BELD 2JJVA 4LLQB 5DRXB 5IB2A 4MNQA 4NRYB 5F6HJ 6FABH 3US0A 4HIEB 3LMJH 3MTRA 3BUIA 3P4OA 4HAFA 3WNKA 3BVXA 4Z7UA 4OCWL 3G04B 3ESMA 4NUGL 2YBGA 4M5SA 3NIFE 1E28B 1OM9A 4N90D 2J4WH 3DIFB 5C0NC 3D0VA 4K71C 2CLZA 1DBAH 4TQEL 4I0KA 2IH1B 3PGFL 2YGVA 2FH8A 5JQHC 4I2XA 4YHOL 1IM9B 1A9EA 4Q7DA 2OCJA 2W8CA 1KJ3H 5H94B 2EUXA 4UZGA 2BNUB 2FQGA 1VFAA 3GC3A 1IO4C 3QIBA 1DBBH 4PRIE 2ZX6A 1QPKA 1FNSH 3MRDA 1VACB 1ECZA 5I1LA 1QSVA 1F86A 1Q0EA 2BRRH 5C09E 1VFMA 1QWNA 1NANI 5CU5A 4N8CL 2HRHA 5LAXB 4ZW3A 4OR1A 1VEMA 4M6NL 5J12B 5L0QC 2WXJA 4KXDA 4IRSC 3JT0A 3DJRA 2Z8RA 4NQSA 4PVLA 4N26A 4WWID 2EDRA 1IARB 4XPTL 5LB1A 5C97A 3HZMB 4GBXB 4MQTB 1JNJA 5B38B 3QJTB 4NZJA 1KPVB 3MCYA 1M2VA 2NX5E 3HE6B 4OZGA 4J4PC 1BD2A 3CMOH 2WAQA 3V0VB 1H8LA 3ETBF 4BQ6A 4RVBA 4UAOC 2WQAA 1JPEA 2RACA 1R0AL 2WXHA 4FG4A 3SCMB 5IP4A 2DIAA 5C0IA 4NM8L 4AWJC 1TTUA 4XMUA 2PN5A 2CIIB 2BWDA 3S7GA 1GZPB 1I9EA 2AXGA 5BQ7B 1KJ2A 4JANB 4MJIB 1R34A 1F8TL 1HQ4A 1NL0H 1CLOL 4LLYA 4HKZB 4ZMTA 1L9QA 4YWGH 4H8WH 4GRWB 1BMWA 4NQCB 1XMEB 2X2UA 1FN4B 3PP3H 2DH2A 1CF1A 1MW3A 3NJGA 4RSVA 1FNLA 2ZF8A 3PWUB 2MOGA 3MKKA 4JFFD 4M61A 2MHAB 2VDRH 1KSRA 1V3MA 4OZIE 2X44D 3DSFH 5FGRA 2CGRL 2ZF9A 4LSUH 2UV3A 2Y2TA 3F84A 4HXBH 2QHLA 4P5MB 3TYFB 4PCSA 2XVGA 3U4BH 5K9JL 3O4OB 3QC5X 2APSA 4WUUE 3NCYP 3Q2CA 3PE9A 4LK4A 3F65A 2PUQT 1XDTT 5I66B 4P5TD 1DQJA 2Z7ZA 3HI1B 1PYWB 3SE3C 1KZYA 2VN4A 1IQWH 2XWBB 3LN5B 2NY1C 4KJYB 4HX1B 4UQEA 3NSDA 5DZOA 1UCTA 5JOFB 3OTTA 4PP2B 1MCQA 4NUJB 4HKJA 2EDYA 1FVEA 3IWUA 2CGRH 2OL3B 5MEQA 1KLGB 4HZLA 5C71A 4JL1A 5DLLA 1GMEA 4P2OC 1DE4B 4M8QB 3OGOE 1T5XA 3ESOA 2DQIH 4C56A 4AV4A 1AXIB 1F3JB 2EXTA 4PJDF 1GIGL 1M3JA 4ZTOH 2XQ0A 1J5IA 4JHWH 4PY8J 4LCCA 2VZ3A 2YQGA 3LQZB 3KM2A 1CS6A 3Q2WA 1D7CA 1V55B 4H1LA 4M7KH 3G7TA 5CBAB 3RFRA 5KSAA 1AR1D 2R7EA 3TPUA 5G4NA 5KJ4A 1LQBC 3D4CA 2BNRD 4RX4D 4YSOA 1EJOL 1F41A 2HT3D 5F7NC 3QUML 3K74B 5KVDH 4M7ZC 2Q10A 2KERA 2C5DC 3EFDL 1TQUA 3IDMB 1JRHI 1TVHB 2VMDA 1G6RH 1USZA 3ELAT 4NT6B 2AZAA 3RIFK 1PL3A 1OGSA 3C2AH 2CE6A 3D08A 5B7FA 1M3IA 4X8CA 2AAAA 3PP4L 3WTXA 2O5NA 4LSRH 1RZ8B 4HUVA 3L4CA 4JVWA 2EDEA 1E0OB 4M7JL 7PCYA 3BKML 3V9FA 5I8KH 1TEGA 1UT9A 3V8OA 1DR9A 4JPIB 2MWCA 3D07A 2QFRA 1WBZB 3SKMB 4J3OD 4OH2A 5F7MC 4I9XA 3SO3C 5DJ2B 3MOAL 1KT2B 3OVUB 5H4YA 3UIYA 1JWSA 1MCPH 2DLEA 5DU7A 5F8RC 4YEFA 3BX7C 4YXLH 3WN5C 3LKPA 1HEJC 5D8JL 4NQEA 3VFGH 3PNRB 4HWEH 4G8GE 2WLIA 2J4WL 4GKNA 4ETQB 5E4EC 1LO5A 5FAAA 4K4KA 3ZXAC 1MCHA 3B34A 4KHTH 4XPAL 3RPIB 2LHAA 4PJDA 1B3JA 3KLDA 1LP9B 2DWXA 1HXMB 1JF5A 3HKFA 3SE8H 4BH8B 3EOBB 2NY7L 3SCMA 3LN4A 2ZCKL 5CMAA 4H0GA 2VERA 2BDNH 1BG1A 1P7HL 3C5SA 2WKOA 4I3SH 3VXPA 3MLRL 2Y36H 4KXAA 5GGVY 4AL8C 3PQYA 4FQHA 3H2QA 3VFVA 3EO9H 1TO5A 3GBML 3MJGX 4PSRA 4YHYB 2VWEC 2LVCA 4X5XA 4P2AA 4JHUA 3JWOL 3V7AG 1OGTA 3EJYD 1D5BA 1PD1A 4N8UA 5IBLC 2CDFB 1G9MH 2BSRA 4FFVC 2BIPA 3QDGB 2HFEB 1U8MB 5FOBA 3KPNA 2W91A 4QOKE 1QEXA 2EDQA 4JDZA 3B2PA 2XNAA 3FCSA 3HA0A 5B8CB 4LVHC 5A7EA 1UD4A 4PB0L 4Y19E 2GI0A 1DQIA 1S7VB 5KVFL 4DK6A 2VOTA 3MFGB 1JK8B 1P5VB 3QEGH 4O58H 3VRJA 4Q52A 4LMQI 2HLFC 3GK8H 4NJAL 1S6NA 4R83A 1U8OB 4OKVB 3SYCA 1A9BB 4TOYH 4IM8A 4XP9H 4PJEA 2E47A 1UB5A 1T21B 3PQYD 1RFDH 3NQIA 3HB3C 4R96B 4NM4L 1INEH 4XPBH 4LSVH 5EBMB 2X2HA 4GAGH 1PQZB 4I7ZC 4KROC 3C75A 1T5WB 1ROCA 1SBSH 5LGJA 2XBTA 2CHNA 3UJTH 3R06B 3TASA 4JJHA 2QPSA 3TJHC 5AW8B 1NFAA 2B1HH 2CXKA 3QPKA 1JMZA 1J0YA 1D9KC 3M8OL 4P46C 3VXRB 2A83B 3C09C 1OWRM 1GGYA 4LFHG 3C5ZC 3EDEA 4TS6A 4W9CC 4A7SA 2QTEA 4JFXB 1S9KC 3S98A 2H3NA 3TA3C 2ZUXA 5L2JA 5L8KB 1G9NL 3DOSB 4UTCA 4Y19B 3ZHLA 1U4FA 1D2PA 2UY6A 2V9UA 4ZYKA 1F4HA 2Q76B 1RVFH 1L5GB 4WU5B 3CXFA 5K1NA 1B0GB 1GAFH 5C0CE 1L0QA 4ZFFA 1HYSC 1NIDA 4YHYC 3D30A 4AQAA 4ANWA 1VDGA 2BHZA 3B56A 4QRQB 1D3CA 3S2AA 1CDCA 5K9OA 3T2QA 1RZ8A 5CBEA 1JZ6A 1WZAA 3EBIA 4U31A 1JWMB 4OGYL 1PZ5B 1GW0A 4YSEA 2YSTA 1XMWA 3TPKA 1JNLL 2Q3ZA 3VH8B 3HTLX 4Y5VB 4P5TC 3ENEA 4FKKA 2J25A 2Z92B 1XZ0A 4S1SH 5GGVH 4EIZC 1NCDL 3BP5B 4L8DA 4MSWB 3P69A 3P11L 4Z7UF 1UH4A 3BE1H 3ZE2B 4MNGE 4LCWD 2W9LA 3JVFC 1MNNA 3T4AA 5JQ6H 1RULL 3GXFA 5FYLH 4HMCA 3FQYA 2YOCA 4PWGA 3SY0B 4ZMPA 1QYGL 4YHNA 1I85A 3ULUD 1ZHBB 3FOMA 5HGHB 2NY0B 3LEXB 2E86A 1RI8A 5E5LA 3QIWA 1QLRB 4J28A 1F90L 3U7YL 4AVKA 2QQKL 1E6OH 1FHNA 3C5JA 3O6KH 1NLBH 1UKTA 4FZEH 4S1QL 4XMWA 3L6FA 1AIFA 4X7SL 4AGQA 2HFFA 3T1FA 2AXGB 5FS5A 5SV3A 2XWDA 1FBIL 1H3XA 3H7BB 4DN3H 3PWPE 1MI5D 3KPTA 1CFQB 4B9PA 2QZQA 3WDJA 5I8CA 2E9BA 4G6JL 3B8YA 4KO6A 3GMLB 5E6IB 4OJFH 1ONQA 5AFAA 3QYNA 1PYWA 1VHPA 3LZRA 4GRWF 2BVUA 5EV7A 1N7ML 2AXJA 1C8QA 1DLFL 1KJMB 3FQTB 1BM3L 2ZP9A 2KDGA 1YPZA 5IFAL 2ATKB 2IC2A 3EW3B 4KKZA 4H8VA 1BECA 3O3AA 4F2EA 2KZ1B 4I9WD 1IRAY 1CG9B 5DYFA 2AW2A 3BIKB 3WSQH 2AQ3A 1JVLA 2J88H 4Q8BA 1KCVL 1TZGH 1RHHB 1C7SA 1FYHB 1S7VA 1X3DA 4NQTA 3WNPA 1GGTA 3VCLB 2X1XR 3EDKA 4PRHA 3APDA 2A1WH 1WEJH 4ZBJA 4WO4A 3VGGA 4JO3L 4K2UL 2BVYA 2R1YB 4JNXA 1EBAA 1OD7A 1NM4A 4KQ0A 4BEIA 4PJAB 3DMMA 5DFVC 2OTUB 4OQTH 4NQUA 4WTWA 4GSQA 4O5LL 4XMXA 5GGTL 2X9WA 5PCYA 5FYKE 5ETUA 4L8CB 1OLLA 2E59A 3FZUC 4ORGA 5CJXA 2WSPA 5KYWA 3CU1A 3BH4A 3MNWB 1BQLH 2FTAA 5DRNA 4ZUVA 3L1OL 3T4YB 4TLTA 5DJDA 3VRIB 1KJ2H 2YPKA 1EH9A 3OKLA 1EZSA 3D39E 2WNKA 3EOAA 2PCPB 4NIKB 3LZQA 4B7LA 4WZ9A 4ES8A 4J3TA 4BSWB 4DPRA 3CFDA 3LIZL 4HFWB 5EOQH 3JZYA 1BF2A 3CFNA 4BZ2A 2VO5A 1M6OB 5D7SL 1ES0A 4E0RA 3RWJA 1BGXH 2H9GB 2Q7YA 2HP4A 1WT5A 4H8PA 3FF8A 3MUJA 1BBDL 5LBSL 1A6VL 4KK6D 4HUVB 1IZJA 2OJ1A 2R23A 4R5VA 2YPLA 5DJCB 3WEXA 4BZ1L 2EYSA 2H32B 3ARBB 4FC3E 4GINA 1Q9LB 5IW1B 1PLBA 4G9DA 1I3VA 4R7NA 3WNNA 4PI0A 4LLVA 5DCCA 2F0CA 4JFED 5D70H 3VTAA 1R75A 1ANUA 3KJ6H 5GRUH 2DM3A 2NMSA 1RZIB 3L7EB 3NH7L 4P5KB 3S5ZA 3MREB 2NT0A 1JBJA 3IAPA 3K5SA 1JHLH 5DHVH 3CX5K 5JOEA 3MBWB 1I9IH 1JYNA 1W6LA 2D2OA 2Y1ZA 3JTSA 2OMYA 4FQ1H 3RPBA 1VGEL 4X98B 5IQ9A 4PQXA 5KTEH 3QG6A 4FQJL 3UX9B 1RZ7H 3OG4B 4K9EH 1KTDA 4QHPA 3W11D 5F7BA 4PIBA 2ZUQC 2AJXL 3I9PA 1S9VB 4JN2B 4PS8A 2IPTH 3BWAA 4QXTB 5LGHH 1S9XB 3A0OA 4PP1D 3F7VA 3DRTA 3G6DL 4IDJL 5DMIH 3SQBB 4OZFA 3I6GA 4NWTH 2J72A 3RTQA 4YDZA 5BO1L 5GSVA 3ATFA 1Y6KR 1OAJA 4GRWH 3UBXG 4MDIA 5T1KD 5LGHL 2O61A 3IGLA 1MCSA 4KK9C 3TBBA 2K1MA 1AZNA 1T0NA 2D31A 4JM2C 3IYLW 2H0PA 1ET7A 2WXFA 4XPFH 4AVHA 4ZW7A 5MEPB 5HYEA 1QOKA 1R5IB 4JM0A 4IHOB 2K8MA 3BAJA 4QXUH 5H8DA 3NFPA 4FLOA 4C47A 3RUGF 1AGDA 5F3HB 4EQ3A 2FL5B 1BDYA 4HGWB 1AQDB 4K71B 3QPXL 5I0VA 4DVRL 4R7VA 3HPJB 4YFLI 3P02A 1G7LA 2IWEA 1U8OA 4RZKA 3QDMB 3EUDA 1PIFA 5EO1B 3W57A 3MRNA 4WI9A 3WL9A 2K0RA 2VLKD 3H8NA 4OTXH 1NOAA 4RGNB 2B1OA 2Q5BA 5A6IA 4PJ8A 3PGDA 4GSDH 4UQ2A 4FNQA 1MCKA 3CN1A 3O9WD 4HIHA 4BZ1H 5K93A 4BWUA 2DB8A 2G2RA 2IGLA 1OB1A 1NBYA 4QWWD 4LLYB 3WN5B 3WJMA 2NUPB 4FTDA 4ZG1A 2WJ5A 3MROB 5EMYA 5IWLC 2R1YA 1K72A 1BVZA 1JGEA 3KEDA 4OQ1A 1F4YH 2WP3O 2BLFA 2XC8A 5AYQA 3BPOC 3ZZSA 1P69B 1KENH 4FOMA 3SD5A 5T1JA 3RWEA 4NQXA 1A6WH 1RPKA 3MUGA 5JHDE 3VACA 3VSTA 4DQOH 5BS0B 3ZMEA 1H5BA 1S5HA 5KYUA 5C0GA 4ELKB 2VAJA 3D69A 3F7RA 4G43A 3KDMB 5KVGL 1NGPH 2AQ1A 3U4EB 4RFOL 3L08A 2VXVL 1E9PB 4HJGA 3V79C 2CGZA 2W60A 3EJUA 3AM8A 1YNTF 3ABKB 1ZPLA 5AAPA 4K55A 3LKOA 1AQMA 3CPLA 3CH1B 2DTML 2HJFA 3CDFA 1BVLB 1MLBB 3LZFL 1PTZA 5D7IA 4NP9A 3TESA 1DJIA 2UZXA 2CBOA 3OGCA 3PDOB 1DZBA 2VR8A 1BQ5A 5EBLB 1A7NL 4H8UA 2GBVA 1XXDC 3ARFA 3IMTA 2YMXH 1PZ3A 2LU3A 4J7RA 4U6XA 4YHLH 4JFDE 5EPMB 4F7MA 2IDTA 1T83A 3NVQA 3OHXA 4XNXH 3MJ8B 3FH5A 1IX2A 1YG9A 4LLWB 4OCMC 2EYSB 5D7IE 1O6SA 5GJTH 4N3UA 1E8WA 2EUZA 1LWHA 2H6PB 2MIZA 5J7CC 2DDQH 3KPSA 2UX7A 3FMGH 1CLYH 4HD5A 4O02B 4DKFL 4HOMA 3TBYB 4MB3A 2HRGA 3UBXB 4NZTL 1IMHC 3FTVA 1ZVSB 3VJ6A 5C86A 1F97A 4U33A 4CGUB 3TT1H 2CO7A 4EDWL 3HBGA 2VITA 4NDMA 5A6MA 2QV2A 4XP4H 1B9ZA 2DBLH 3VXUA 1R6VA 3BH8A 3FQWA 4PJXB 2PCPA 2XXGA 1P5UC 5DJZA 2EC9T 1RJYB 3PY9A 5I23A 1IEHA 3T65A 1EHAA 3BN9C 2BK8A 4WTZG 3NZHL 1TTBA 2P8MA 4BE5A 5I1JH 3O9WC 1JDAA 3G6JE 5ICZB 1I3GL 2WB1A 5CGMA 1MJUL 4L8SA 3SBWA 1ZGLP 3KS0H 2CSPA 4QHUB 5ANMB 4J3VA 4UOW0 5TF1H 1IGJB 2A38A 3ZGHA 4HS8H 1TQBB 4ELMA 1SYVA 1VCAA 3U9PL 5DJ2A 4G3YH 3ESNA 1CZ8H 2IDSA 1J9TA 1TOXA 3UAJC 3Q7JA 1E8ZA 1UXMA 2Q3AA 5I1JL 4NC1E 1IC7H 1W16A 2DPKA 2XU9A 4S1RH 2DQCH 1BVLA 2ITDA 3VCLA 2D9QB 1KTRL 4FQCH 3VFUA 4PY7B 1S7QB 2G75B 5BZWB 4HS6B 2J2ZB 1CL7H 2EECA 1FYTE 4JRYA 4UIKL 5SX5K 5BOPA 4ZZFA 2QSQA 3CVHB 4GYBA 5CSGA 1JZGA 2NZIA 5A40E 2DEYX 1BYOA 5HHMD 3WLBB 5I76B 4XXWA 2PPAA 4GLRI 1J8RA 4AH2B 3FU0A 4JMXA 4NZUH 1SMAA 4MBRA 3ILDA 3L4ZA 4DTGL 2QADB 1KCSL 1VA9A 4GRLC 5D7KD 3NZSA 2NUTA 3MO1B 3QFJB 4MAYD 1ZLWK 3ZE0B 1SMOA 1ZLWH 1JV2A 3KYOB 4UV4L 4K7PX 3QJSB 2ZCHH 3KH4A 3ECWA 3MJ7A 4E41E 2VDMB 2BNRB 3VG9C 2PO6D 2CLZB 2BSSB 4PVBA 5IMMB 3UDWC 4G1EA 4KH9A 1Z9PA 2JJSA 3C8KB 1MELA 2XNAB 4O4YH 4OIIL 3MUZ1 3ZE2F 3X14A 4AEHL 2F19L 3AG2B 1QO3A 1FFOB 4TV3A 4XX1G 4MS8D 2W92A 4ATTA 5L9DL 3FUEA 3UAJA 5HYJB 1OB0A 5I15H 1K9TA 35C8L 5AVRB 5HTSA 3RWJB 1KB5B 4I89A 1VFBA 1JXDA 4XXCA 3GIVB 2J71A 1G5GA 5FYLL 1XZ0B 4E9LA 4M4RA 4UYQA 2YRPA 4O9HH 5AW9B 4NC2B 1OALA 1G1KA 1BZ7A 4O2EA 5DJ8B 5HVGB 2ETWA 1A7OH 4MTMA 1BPVA 1BOGB 1EO8L 2HFGH 3MLSH 3RRQA 5J56B 4R26H 1W8EA 3T4AB 3P0VL 3L4UA 2H32A 4X8GA 3UZEC 2ADJA 3MRFB 3ZUCA 2AQTA 1CFNA 1NUFA 4KQ3L 4CKVX 1DZ0A 4WKXA 4GKZA 1EFXA 3K80A 4WFFD 3K71A 5HHMB 1N4XH 4RISL 3HMXH 5TQ0L 4N9GA 3RX5A 3ZR5A 3QDGD 3VD4A 4TQIA 3Q6FA 4KV5E 4CMHC 4G7RB 4CMMB 1RQ5A 2DMKA 4PHXA 4AW7A 4X4YB 12E8H 4YDKL 1UM5L 2WLIB 3RWIA 5I2IB 3NCWA 4LEBA 4JDTH 1ILUA 4UM9D 1FCGA 4UNUA 4OLVH 1YC8A 2NZ1A 3KWWA 1F58H 4FXKC 4NWUH 4Y89A 3VRIA 5E8DL 3TONA 3D9AL 2E7MA 4HKZA 4KI5E 4OGXL 2OXHB 3W9DB 4Y4KC 4JANA 4MJIA 2Y23A 4L0PB 4GMSH 4UQ3A 4NC0B 2ZKWA 4NZRH 1I7ZA 3QJFA 1NUGA 3BT0A 4OFIA 4N6RA 4JZJA 2HKHL 2P5PA 5IJVB 1ML0A 1W0WB 1UM6L 3ZLQC 2VQTA 5F7EL 4TF4A 2L4OA 1WSST 3MNZA 4FQIH 1SY6H 1MCFA 2ZIDA 2CU9A 3Q8AA 4BK8A 2WINB 1NCNA 2BWQA 1F56A 1UWEH 4L2YA 3VSQA 4XTRD 3UZEA 4M6OL 1LYQA 1TFHA 4K3DH 4D9RD 4HWNA 2NW3A 2AJVL 2FDBP 5F7EH 4PJ7F 4MJ6A 2QSCH 3FO2B 4GP8B 3MCLL 2OX5A 3WDHA 3LAFA 4OD2B 4RNRB 2CJSA 1RY7B 4KQ4H 1PW3A 1JPFB 1LO4L 3SDAC 3WNJA 4PMEA 1HXYB 5E8DH 1ORSB 1UXSB 2NLJB 2V9TA 3FBKA 3NCFB 2ALAA 2IPUK 4NQVA 2XQYG 2BFVL 3WTWA 2UUDK 4FQQB 4FXKA 5IW6B 1AR1C 2RIKA 3QJHA 1IB5A 4PCYA 4WTQA 3TX4A 5BZDB 2G0LA 5C9KA 2X0WA 2WO3B 4JRYE 1AMXA 1K8IB 2OI9C 1L9MA 2X70B 4GO8A 1UD8A 2EACA 1NC4A 2LE9A 3SDAA 4FNPA 4N2MA 4ZMWA 4V1DD 3GI8H 1JGVH 2J8OA 3QDGE 4UOQA 5MEPA 3GMMB 4GQRA 3ML9A 3DSNA 3QULA 3MJWA 4YIQA 3HUJF 5JR1H 3D3VA 3NABL 5CWSA 5K9KA 2C3GA 5EZIL 5I17A 3ULVD 3B2VH 2P5EE 4P59L 5DUBA 2EXWC 2WXMA 1IGTA 3LIUA 1EZUA 3O3EB 3PWJB 4ZFZA 2NY2B 5I30L 4GW4B 5IJVA 3L9RA 2N0KA 3OMZA 1C08B 2DH3A 2ICWB 3RUGA 2YHGA 5E9DD 4YUEH 4LSSL 2CWRA 5AG9A 5IB3A 1A3RH 2EO7A 2NYZA 5CGYC 3SDXB 1KXVC 1OXYA 3LEYH 2Y5EA 3AFLA 2FH6A 5EPMA 2H2PC 2YPVA 4LHUG 4OJEH 4PJFB 4BKTC 3GUTB 3K7UA 3WNMA 1JXFA 5ACLA 2XX1A 4LAQL 1IT9L 1YMME 1LO0H 5D6CA 5G55A 4AH2A 4V1DA 2P45B 3LY6A 4L1DA 1WRFA 4CC4C 1N9PA 5JDSA 3U9WA 2BNQB 1JYXA 1NCWH 3ABZA 1XIWC 4Q4EA 3IJYB 2BJMH 3UG5A 2B9AA 5DK2A 3W37A 4NQQA 3OWRA 1QPXA 5IB4A 1M9WA 4OF8A 4RWHA 1KEML 3NT0A 3MLZL 3DJSA 4HBCL 1B0RB 2EICA 4U6VL 2FZ3B 3NSCA 1TVBB 3VXPB 4UUJA 3EH2A 1DO6A 1UXLA 2HX9A 1MCBA 2FJFB 5F44A 5H4ZA 5IUSA 1AZBA 3TPUB 5CIPA 3GJFH 3BP6A 1KTJA 3ZTNL 3WHXB 3UTTD 5CCJA 1WWWX 5JPNB 4YHML 1KIPB 2IQ9H 4GLRH 5IHZA 1L6XA 3H3BC 1SXCA 3F7YB 5F6IC 4MRCA 4Q6KA 3IU4H 1SN5A 4DEUA 3NESA 2WLKA 4KMTL 3IRCA 4P5TB 4YHZL 1UZ6E 2XQYK 3RB7A 2AAVA 4PJXF 2EDHA 5HHVL 3UAAA 1AO7E 3B3BA 4XC3L 2EEDA 1C5BH 2NNAB 1KGXA 3MVSA 4H25B 2WP3T 5K9OB 3LKRA 4KVCL 3HI5L 3NJNA 3DDFA 1M2VB 1BV8A 4M03A 1D5IL 2K6ZA 1IKFL 1YYLH 2IH3A 2PCFB 3IDJB 5IW3A 2Y6SC 5JW4M 2AMUA 2QGBA 1KY6A 1OKEA 1CDGA 2ZT9C 4EEEA 3D34A 1RK0A 2P7TA 3AREB 3LB6D 4KDTC 5DZ9A 2APFA 4AYEC 3FTSA 2DQTH 3HLAA 5E2JA 5A2FA 4JQXA 3UG4A 3DV4A 5KAQG 3HFMH 4TM9A 4Y5YA 3C09B 3ARGB 4JB9L 3REVA 1E9OB 3MUHL 2CLRA 3HNVL 1OO2A 1RUPL 4KFMA 5MHSE 4BSJA 4M5YL 3UTPD 4WSJA 2XTJE 2LLLA 2PW2A 4KROB 3TO4D 3Q5YA 3GBNL 3AXLA 3ZE1E 5AVSB 3FFCD 1N2RA 3JWNC 3NRFA 4NKDA 1W0WA 4N0UE 4YVNA 3HB3B 1F6LL 1J48A 4W9HC 2YPKB 4YHLL 1FH2A 4UQ3B 1S78C 2CNZA 4GAJL 4KOCA 1OZTG 3FTUA 4CAGA 3I2CL 4Z0XA 3C60A 1QBBA 5E4AA 4JFDD 1R24A 1MIEH 4NO3B 5ADOL 3CMOL 2WNXA 2DQJH 1C5CL 4W4OA 4ZO8A 4HZLB 3GXMA 2EEXA 3RIKA 4N3TA 1DP0A 3CLFL 5C0DB 1JP5A 1A5FH 3L8QA 3BC9A 4JFEB 2DN7A 2G5BB 2BP3A 3ME0B 3NP4A 5DGQA 2NY0C 4D8PA 1EAPA 2CJUL 1TTCA 1WTLA 4PB9L 3RWGA 4YS4A 1JGIA 5D1XE 3SKNB 1C5CH 3MLYL 2JKTM 3UERA 3ZSTA 2RQEA 1U3JA 5BV7C 5IF0B 3QUGA 5GQBA 3TA3D 4KU1A 4PJ7E 3DRQA 2LVEA 5DZJA 4XCYA 4NM4H 1KACB 1ZAGA 4MA3A 4YSSA 5ACZA 3D05A 4M61B 1THCA 3DWTA 2JVUA 1F3RB 1I9JH 5F9JA 5FO8B 1EWHA 4HETA 1XH0A 5EWIH 4EZJA 1YECH 5A2CA 1B3IA 4J3UA 1IQDB 1I8MA 1FVCA 5EFIB 3QEQD 3W9DA 5JHMA 4FI6A 3C5ZA 1G43A 3H9HA 2ADFH 1JZIA 5SWSE 4BDVB 4PJ5A 3PGCA 2YBRB 2OP4L 1RK7A 3FCUB 3QJRB 2QBWA 2JTDA 4F7TB 4JFZH 2DWDA 3QFDA 1FZJB 4U3CA 3GMQA 2RH0A 3VVVA 1TFPA 4AUJA 1CXFA 3BVDB 2YRLA 1WBZA 4P4KB 1JZJA 5SWSA 4D9RE 1MJ8L 1EMTH 4C4BA 4HUCA 5CILH 4A2MA 4PYGA 4X4ZA 4F8PA 4XC1H 1SFHA 5DK3A 1ZE3H 5I1AB 4LOUC 4AC4A 3L5HA 5D93B 2YPLD 5BXFA 4RNRA 3OKMA 4DZ8A 4A7GA 1FO0A 4K94L 1H6TA 5DHMC 2XFGB 2DI7A 5GGTA 1AG6A 4TVPH 3T0EC 1JPSH 3JTTB 3QRGL 1FPTL 3T77B 1BHGA 4Y4FD 2Z31D 4KK8D 3BP5A 4MSWA 2G60H 5EN2A 1SZNA 3FXIC 3OQRA 1BQRA 3ESVF 4MZ3A 4NNPH 5E6ID 1R46A 4Z0BL 3RTQC 5MENB 1JGUL 3EO0A 1UWYA 3NG5A 1H0DB 4JO1H 4I3RL 1MI5E 1K8IA 2AABH 4HMDA 3WY2A 1NIFA 2MTAA 3GPEA 3H3PH 3MJ6A 4WVRA 3UROR 4NUPA 4WV1B 2TRYA 3DIVA 3PRZA 3G5YA 4FDWA 4HPYH 1A25A 1NSNL 5F9AC 3RWCB 3VXSA 5D7JA 4B9YA 2N3JA 4MHHI 1JPTH 2UZPA 4FXKB 5IW6A 2V5TA 2V5YA 3M46A 2HKAA 4HWEL 1JHLL 1WFMA 4PRNB 4F5CA 4P2CG 1I7RA 1NA8A 3QJFB 4LCVA 1ND0B 4HQQH 2JQAA 5D2NC 2VZSA 2P8LA 1YZZA 3IKCB 3MLZH 1KEMH 4U1MA 3C87A 2VR7A 3RTQD 2IANE 1RUML 5C7ZA 3P30H 4JL2A 5E4IA 3LS4L 2M26A 3OAWA 2QDWA 2ZKHL 3L9RB 4PCTA 1G4RA 2X1WL 3BKMH 2R27A 3OJMB 2Z4TA 4EI5A 4KKBC 2IAMC 1BBDH 3BQUC 3NJMA 1QP1A 1DQKA 2GC7C 2J7LA 2VZ1A 3VD5A 1WPCA 1FSKB 3MV9D 4CN6A 4P2QB 3CCHB 3RIAF 1UFUA 3NA9H 4FJ6A 1FIGH 4OKDA 2XJLA 2C1OB 2ESVB 4L1SA 4PYHA 2AQRA 3GHEH 4GKZB 1CURA 3U0TA 4K15A 4LU5L 4Y2OB 3T0XA 2AP2A 3NRQA 5KBKA 1UATA 3MRPB 5IG7B 4GKSB 4ODXA 2H0JA 3IE4A 1HHJB 2FB4H 2VM4A 3U0PA 2YUXA 3HI6H 3FTGA 4IQHA 5LNGA 3LRMA 5DK0B 4X0KB 3DO7B 2V5RA 2CHXA 1LQSR 3A67L 3P4LA 5AW2B 3QNYB 3EYOB 1AYRA 5BJTB 3WMQA 4X4KA 2CA3A 3TLRA 5DDHB 1ZTXL 2EH7H 3OV6A 5DVPA 1U4EA 2C4FU 4Y2NA 1P0SE 2Y7QB 3PNWB 2A6KB 2IGFH 4Y1AD 4Y9CA 1MCRA 4BGLA 2G5RA 4UQCA 4B95C 3S3BB 3EGSA 4GRMB 2GIYA 4QRRD 1PZAA 3TCLA 2DQEH 4LRNL 1QFOA 4JM4H 1CGXA 2ARJB 5AOMA 5EZPA 2BSDA 2IBGA 2BY3A 1GGBL 4MDIB 5CR8A 1IGCH 5KYUB 3ZDXE 2B2XH 4HA1A 3GHBH 2ZPKL 3AS3A 2QQLL 3WS6C 2WQWA 5L4FA 3FU3A 1F6FB 2Q8AL 3KBHE 2KKQA 5IROD 2DM4A 1EXUA 3V5DA 3RI5K 2ZXGA 3FUDA 4I9WE 1ZMYA 2GIXA 3FCTA 1KYOJ 4KTGA 2R29A 5EIVA 4GEIA 4TUUA 2WPGA 3KM1A 4X5WA 1ZHNB 4P3CL 1XSOA 5FA3B 3PYCA 5FYKL 2D03H 1ZHLB 3HHSB 2YXWA 4HHAA 1KYAA 3SDXE 1XAKA 4F58H 4DK5A 5D1QD 2O6EA 2O6CA 2QGDA 1YYMH 2QHRL 1EUUA 4QRPE 4WEUD 3ULVC 3O8XD 1GOFA 3ARSA 1ZSHA 4PWHA 4K3DL 5F7KC 4YWGL 4NB7A 4MYWB 2QVKA 4KK9D 1SPDA 4XMKH 3OKDA 4OGQC 5EDXA 4ACTA 1HZKA 2I27N 3GSXA 4AITA 1B2WH 1E67A 3V6OC 2AK1L 1T5XB 3TEXA 3KE0A 4XO4A 3ET9F 5T5FA 1OCWL 3KYMA 4WDIB 3ATBA 3HHMA 1QD0A 3HMWH 3IWVA 4YN3A 2FBOJ 4G6ML 3MRCA 2EDKA 4GG8B 3C8HA 4HJJL 2OI9B 5D2NE 4A7TA 1FP5A 3L3GB 4JDVA 4QHKJ 2CLRB 4PD4J 5FCUL 3H56A 3FHEA 2CAKA 1KCUL 1HILB 2Z91B 1XGQA 5FYJL 5I6XC 1T2QH 4PJ9B 4PJ9D 1NPUA 1YPZE 3RWEB 4RA0C 1HCVA 2EJ1A 4L8CA 1JG9A 4ORZC 4S1DC 1ZWIB 3D12B 5ICYB 5IV2A 1CLVA 3L4WA 3OAUH 5MI0B 5C8JB 1U6AH 1WIPA 3NQKA 4FTVB 5IB5B 4I2XE 1JWUA 5KSBB 5EOCL 1UM5H 4ZUWB 1FAIH 5C0CB 5DJ0B 1I8IB 4YDJA 2WVTA 2PMZA 4HEMA 1DANU 2J1XA 1LO3L 3R1GL 3X14B 1OPOA 5F9DC 2YBRA 3ULUL 3LS5H 4BFIB 2ZONA 2FO1A 4XWGH 5T33H 5JHAA 3BUBA 3MGTB 3RY6C 1JPFA 3KGTA 3PGDB 5DC2A 2AEQL 2WTRA 3BFQG 2GK0A 3B7SA 4A6YH 1D5MA 4XVTL 3DLQR 3WXVL 3MBWA 4AM0A 1JRHH 5ITFB 1O6SB 3X1GA 1E4XI 3L5WA 3SCMC 1AHWA 5AKVA 3HC3L 4O00A 3BSZA 2GJ6B 5E24E 3OLIA 1NKOA 2DJSA 4L0YA 2ZXDA 5E00B 1B88A 1A4KA 5ACZB 1CFNB 3UADA 3Q3GB 3U0PB 3L2MA 3UJTL 1JAEA 1KUMA 4N2BA 4TRPH 4BFJA 1S9WA 1MF2L 3B7TA 3JWOC 2Y69B 1DFBH 3VA2C 2WYZA 1YVLA 2A77L 4LHUA 1G7JA 1MFBH 4ISVA 4NKDB 1WHOA 5FM8A 1FORH 2V33A 1SHMA 1XL6A 2DL2A 4IRSB 1SOSA 4P8QA 5DRZA 1CD1B 4L23A 3V6ZB 4DGIL 4OV5B 2WQ8A 5HHME 3DTXB 4DKDC 1CBVH 2Y7MA 3AB0C 3D69B 4RAUB 5HDQL 1BMZA 3GKZA 5EU6A 4KO5A 1F4AA 2UXVA 2GG1A 2QL1A 4XZ4A 2WLNA 1ZK5A 5HI4C 2BHYA 3GQFA 3OD3A 4L5FE 1GCYA 2DMHA 4Y4HD 5FKPB 4YGVB 4UV4H 2OXHA 4K94C 3CLEH 5AW7B 1EEZA 4DKEL 2DYRB 2JJTC 3BHBB 2GAZA 2NYKA 3PWVB 1T22A 2BVPA 2ZD0A 3IMWA 3NACH 3EH1A 1CLZL 3VFMB 4N1HB 4YZFE 1XGUA 5MERA 4J6RL 2AQPA 1YNKH 5E23A 3FUFA 5AW6B 3GS0A 5HHXL 1YY8B 3ZO0A 2W9DH 1CDYA 3EBGA 2HTKD 4NERA 2GITB 5KYXB 3P0VH 3F12B 1ZJBA 5INDA 1KLFB 1XF2A 3SE3A 4LDCA 4X42A 3U36B 3OF6D 5DLMH 4CVZB 3VFRB 3J2PA 4NO5A 4Y4KA 4WI0B 3ULUH 4CVUA 4IBSA 5E2TH 4JY4B 2J2ZA 3U30C 4K5MA 1DVQA 1UOVA 3BAEH 3WUZA 2ZSVB 4G8GB 4I48B 1KG0B 2NYYC 2YGNA 3TO2A 1CDJA 1O6VA 2I07A 1HEHC 2VMCA 2KC0A 3TS8A 2CBPA 3LRLA 5D1ZA 1MG2C 5CN1A 5BVJB 1A1OA 3CTTA 3ECBA 5IMOA 1XF5A 3GSUA 4Y1AB 5DYOB 1QBAA 1QLFB 3QFGA 4XVTH 3MHZA 1P84K 2J3SA 4JRWA 1SXNA 3MRKA 1A3LH 5C2UB 2R29L 3VXQA 2C9RA 3VWKD 3LX9A 2FAUA 2Z0BA 4I5BA 1VKXA 4JFXA 4YXKH 3VD7A 5HBBA 5CO1A 5M7QA 4NZUL 4GUPA 5ABDE 4YH6A 3APCA 1UKQA 4DESA 2H7WA 2VO8A 2OMBA 3FQ1A 1XO8A 4QMEA 5EIIB 4JPWL 5DZNA 4YE4L 1KLUA 1PS3A 2QQLH 4OM0L 3GKWL 4DN4H 4LSRL 4P2QD 2VDPL 1NC2A 2DBJA 4A7VA 3JV5A 4L4VA 4M1DH 1DQDH 1QSFD 2ADIB 2H26B 3CFUA 2DDQL 3ZMNA 5B1KA 1PY9A 1J8HB 2DIBA 1T0PB 2YAOA 3LQAH 1QUNB 3QARA 4JM4L 3X3GL 2BCKB 4JFFB 1D7DA 5D2LA 5E6UB 2DQCL 1LNUB 5I1IL 1QLEH 3QXWA 4XNXL 5JW4R 1WP6A 2VMJA 3QRLA 1KBWA 3ISRA 3LXAA 4WWNA 3W0WB 4OKVA 1U21A 4AK1A 3FQXB 4KOBA 4KKCC 1FWXA 2V8LA 1YQVL 1OTSD 5IQ7L 1WAPA 1L6ZA 4NO5B 4ZMAT 1KIQA 1NCBH 5TJWK 2W65A 2ICCA 2Z9TA 5K39B 4L9LC 3US9A 3K2KA 1FL5B 1HHIA 2R2BB 2XVBA 3FN9A 1IM9A 2CK0H 3LKSA 3MRLB 1OW0C 2JELH 3F58L 3SN6N 1LEKA 4C54A 4G82A 4QTHB 1HQRB 4XNMA 4LNRB 2GHWB 4E68A 3OKKA 4BE6A 1UENA 2C1PA 3TBTB 1JCVA 1GTFA 1D5BB 1UACL 1HOCA 4PCKA 3DUHA 5JOPE 4H8HA 4XNZB 2JV6A 4XN8A 1CT8A 1K5NA 3FDWA 4KGJA 1F4YL 2FL5A 3MBEA 4ZMZA 4V33A 1T04A 3G6AB 5B1JC 4QT5B 3UZVB 5L6YH 2CK2A 4WNSA 3WEOA 5JHLA 1AI1L 1LDPL 4MJIE 3T2NL 4O2EB 3GO1L 5DJ8A 3ZZLA 4B9GA 1GJWA 2ZPKH 2CM6A 4ANUA 3I85A 4WFED 2RFXA 2WCGA 3OJVC 1FH5L 3PABB 1G7MA 4DO4A 1PX8A 2XYBA 3HN5A 4PH8A 1CQYA 2YPLE 2A0LC 3DX3A 4O02A 6PCYA 5EEXA 1RUQH 4MJ6B 4ZFGH 4IS6A 4L37B 3CHPA 4Q0XL 5T1MA 2DQFA 5HSFA 1J87A 4APQC 3E6HA 4QKTA 1ZT1A 4YE0A 2WK2A 3E8UH 2B0SH 1UKSA 1XH3A 4QLRA 3FTZA 1FRGL 3QNYA 4YAQB 3ASOB 4XI5D 1UGNA 4FULA 1CLOH 4O02H 2OAAA 2VN5A 3VFTB 4BCYA 3CN2A 2HX8A 3D39A 3L3JA 3MJ7B 2VKWA 3LKQA 2E27H 3GNML 1XR8B 2B16A 5KVGH 5FYLE 2W95A 4EOWH 3TYGL 4NKIH 3ILQC 4KTDH 1XB3A 5JORA 1EJFA 4OSUL 1CGYA 1TJIH 2FYYA 4KY1L 1FL5A 2R2BA 5GJSH 3QDHA 3VW3L 1E4XH 2CDFA 3QXAA 5F7LB 3FW6A 1HILA 2Z91A 1ZD6A 2C3WA 4OIAA 2WIMA 4FG0A 4FNLH 4QWWC 5F3BB 3DVNA 3NCEB 4ZX6A 3FSOA 4JG0L 1KDJA 3ZDXB 1RIHL 2XFXB 5A2AA 4ABVA 1RZ7L 3F01A 4TNWK 1PF3A 2MNUA 4HPYL 5HJBA 1CCZA 4WO4D 4DCQB 3GIZH 1SJEA 3WS3A 1ZHKA 4OT1L 2DWTA 4UZUA 2B08A 1M6OA 5IFJB 4HG4J 1JGUH 3VM7A 4KVNL 1REIA 5E6RB 2XZCL 2CPCA 4FQLL 2GK0B 2YA1A 2DQGH 5BRPA 2Q9OA 3WEMA 1FGNL 1U93A 3CVCA 5CP7A 3UAEA 1JCKA 1F1DA 3ROOB 1F4XH 5JDJA 4NNXB 2OTWB 5ELIA 1NC2B 1QEWA 2B4CC 3BW9B 3HNTH 4JPKL 5BV7B 2P8PA 3ILPB 3CQQA 1DQLL 2X4UB 4HCRL 3TBCA 4KVNH 2VXSL 4XC1L 3KWUA 3ZE2E 3EUUA 4RRPA 4BUQA 2I60L 2JI3A 4YR6B 3VWKC 5EO0A 3EOTH 4JBSA 4NCDA 4IBLT 4CRPA 3L3KA 1WWAX 2R69H 3T8VA 2BERA 2A2QT 2A3TA 3V6OE 2OZ4H 4LSTL 3CDZB 1YO4A 1N26A 4MB1A 4OU3A 1SM3L 1BFVL 5ESAA 1EJ8A 1J9SA 3LIZH 5EOQL 1IAII 3QIWB 1YEHH 3I75B 4IRZH 3GSUB 3MV7E 4NZ8A 4UDUB 3UTSB 5JIQA 5JW5B 4AM0Q 5BO1H 4Y2DB 25C8L 4QPEA 2BS71 3AMKA 4LLDA 2Y72A 3TO2B 4JFUA 4R4ND 4PU2A 1DSWA 3L2NA 1KJVB 3F58H 3TZVC 3L3HB 1M7XA 2Y6TE 5C0CA 1Q9WA 4FTVA 4XVSH 5IB5A 3O2VL 3MXVL 4BINA 3H9SE 1KGJA 3ZHDA 4TTGA 4YBQC 5DUBB 4TYUA 5TGBA 3FQ4A 1WLHA 5IHUH 4JREC 4O02L 4QGTA 3ARYA 4MCZB 4QDGA 5FGCB 1URLA 5AOZA 4JCLA 4K3EL 3RA7L 3VFPB 2HTKC 3T0EA 4PRPB 1DUYB 3NEOA 3E8UL 2NXYC 4I8DA 1WEJL 3ARDC 4U3HA 3QZNA 1X4XA 2P5WB 3GSRA 4HUUB 4F9LC 3EJSA 2E7LC 3FPYA 4ZMLA 2D9CA 3GXPA 1OT2A 2X4NB 4IMLB 1UZ6F 4MJ5B 4KWUA 1JHKL 4FFVD 3QUXD 4H1LG 3CWGA 4Z5RA 3JZ7A 2CKNA 5L2KE 3RZCA 4HFUH 3ZL4L 4AKPA 5I0WA 2O4EA 2AJUH 2IDUA 2PXYD 2EIZB 4XB8A 1JV2B 3QUZD 1L9RA 3QO0A 4HC1H 3V9EA 4NOBA 5DC9B 1U8IA 3LV3A 4KRPC 4MKTA 1M7DB 4F5CE 1BFOA 1WFOA 5EN2B 5KVMC 1BW8A 4GAJH 1DO5A 5M94B 4G9FD 1C1EH 1QBLH 1RURH 4P9HH 4PW9A 4EI0A 4ONFL 4DWHA 4G8GA 4A2EA 2FIKA 3K8KA 1A14L 2XWRA 3GRGA 5JPMA 4Q6IB 3V0DA 2D0FA 4LCYA 4IOFC 3I75A 4UDUA 3UTSA 4DKAA 3I6LD 4E42B 2YD6A 4LSDA 3THML 4H40A 1TJXA 3U4AA 1D5IH 5C07E 5KEZA 5JPNC 2GY5A 1PG7L 3VFNA 1TLMA 1F6AB 3OKEA 4HIJA 3QIUD 4HV8B 2VH5H 5JXAH 2MHAA 3GSOB 5DRWA 3V4VH 3WKNA 3TFKD 4RBPK 1AGCA 4JPVH 5CJOL 3I2CH 1I4FA 2F8IA 2NNCA 4LFHD 5E5UB 3HG1D 5L2KB 3VYOA 1EGJA 4N0UA 3FH8A 4RMWA 5EN3A 3H42H 1AGDB 4GMTL 4OLUL 2OR9L 2YWZA 1N3NB 3GXIA 3G5WA 4OD2A 3A23A 4R4BB 4RDBA 1XIWB 3VFPA 2VAAB 5J6GA 3TJEL 4APXA 4LVOB 2W9DL 3EJTA 5GS0H 1X9UA 1KN4H 4OGYH 1UWXK 2R8SL 3AT8A 4F7CA 4OCXH 1OARL 4Y5YB 4R7XA 4S1DD 4G59C 1T6VN 2BNRE 4ODXB 1GC1L 2IG2L 5FF6B 1UVQA 4XMTA 4UTAA 2PYED 4Z5RB 2IPUG 1PD0A 3Q2VA 2NUPA 3VJ6B 2AQ2A 5IIEB 1T1XA 4K8RC 4KRLB 3OLGA 5HJGA 3OKKB 4ZQTA 4X6DA 3LKNB 1ZVYA 1G7IA 3GYRA 1CD8A 4EJ1C 5CD5C 5KUMA 3AZUA 3IFPB 3OKNB 3RBGA 4Z7VE 1XQ4A 4J12A 1RP9A 5AOLA 3F04A 5IQOA 4S1QH 2KH2B 3P9LA 5CZRA 5LG6A 1U3HD 3D0LB 4AJVA 1T20A 1VPOL 4FCHA 1N6QL 5LXGH 5F3HA 3VI4B 2W94A 1PJWA 4GXVH 5B1BB 2VDPB 3FT0A 2XN9A 2BP8B 3LVTA 4H7VA 2Y07H 3DARA 4C56E 3NZ8A 2ADGA 3NGBC 5C6PB 3IDNA 3HAEG 2NY1D 2XJKA 1H9VA 3NFSL 3B9KA 2NY1B 3HBZA 3D33A 5EA0L 1NPNA 5CLTA 1U36A 4PRPA 4PIRF 3U6XS 5J9PB 5IFJA 4U1JA 2NZ9D 4ODSL 5T5FH 3CCHA 4A6YL 1HK6A 1G7MB 1OP5K 1NMBL 2QSVA 2H8PB 2IJ0C 4L05A 3GMOA 5C0DA 1KLGA 1P7QB 1TPXC 2APWA 5HHPB 3QQDB 1WWBX 1OE3A 3REVB 1D5ZB 4YC2C 1GRWA 3V9CA 5HI4D 2XZQH 3MV01 4OFVA 1O9WA 3TBYA 4H8QA 4IBWA 3DHUA 5F2FA 3CVHA 4ZUVB 5HY9B 1RZFL 3U25A 2CMRL 2L7EA 4M62L 4PM1A 3JTSB 5GS2D 4QF1A 5K69A 3LKSB 1BQUA 1FL3A 1I3RB 2UY7B 4CBZA 5JW5A 3UEQA 5JR1L 4LCCB 4MNQE 1HH9B 4NHUB 1GGCL 1TJGH 5GRJH 4KQ4L 4EE2A 1PKQB 3CDCA 4PGDA 2LU5A 5HI3C 4EAEA 3SYQA 3A4FA 3WJJA 3ZO9A 2W88A 4M3HA 5SV4A 1YJDL 3RDTA 3OPZL 1R24B 2F6AA 1MCOH 3X11A 4HGWA 3TC9A 2Y24A 4HK3J 1DUYA 5GS1C 3WOVA 2IQAA 1ZLSL 4JR9H 3ROOA 1XD0A 1PLCA 2EDJA 3ME0A 4IRSD 3N9GL 3QNXB 1EAOA 4I13B 3GINA 3Q2LA 3BIAX 1YJDH 2RA1A 3CSYB 3QHTC 3VI3B 2AEQH 2HKHH 4N68A 3BQUD 3ZMRA 4A7QA 4CMHB 4F58L 2BVEA 3ECUA 3N85L 3KAAA 4L9DA 3Q9PA 5K59E 2GJPA 3QIUC 3VFTA 5E1GA 2UWEE 3HE6D 2BP0B 5DS1A 5C0RL 1UOKA 1X5JA 3E9UA 2QEJA 4OZFG 1GGIH 2FD6L 3FULA 5FDWB 1IC5L 2LFEA 4J8RA 5B4MD 4UF7C 2AQSA 1TMCB 2ITCA 4YDKH 2EDTA 5IMOB 1P4UA 3ULVL 1LK3L 1XB6A 1W9XA 1ESOA 4WW2A 4PJHB 1ADQL 1NLDH 1FFPB 3M1OA 4IU3A 2R4SL 1BVKA 1GKOA 5BJTA 5C0RH 3ALWA 4MAZA 4XHJC 4Z7OE 3DTDA 5FYJH 1XR9A 2OFQA 3HW7A 4IHBA 1ZK9A 3SKOA 1NMBH 1T7XA 4LT7A 3Q8EA 4OBRA 4ZX5A 3OKEB 4HIJB 1NGWA 1X5XA 3SQOH 5E4EB 4IHOA 2YS4A 4KKLD 3WIAA 2XPZA 1L9TA 3EYVB 4NO0D 3BP4B 5D7KE 3DETC 2ALWA 3MZTA 3BT2L 1CLCA 2OL3H 5IT2L 1EEQA 3SBPA 2XVLA 2PTVA 3OQ3B 2XOTA 4C83A 3SO3B 2WBJA 1GOGA 3KPRB 5ICUA 1MG3C 3T8XB 2HLAB 4N2OA 4K7PL 3ARDD 3MV8A 1XB8A 5AW4B 5I6NA 1BLNA 3D85B 3AG3B 4MWFA 4OCSL 3V0FA 5BV7L 3DXAD 3EJCA 3FFDB 2BH0A 4RESB 2VXQL 1E2ZA 3LRSA 3D2TA 4GEJA 3ZVVA 4DERA 2D03L 5JUEH 3JVGA 2VZTA 4PRDA 4PJ7B 4BFKA 3D1MC 4J3OF 3FRUA 3UBGA 2HRPL 2XWEA 3OJDB 4TLSA 3K2UH 5DHVA 1Y18B 2NQCA 5HHNB 4MJHA 2X05A 5DFWH 4APQB 2VXTL 1OE2A 1A6AB 1ZXQA 2AI0H 3GXTA 5HDLA 3QORC 3QCVH 3FOLB 5IQLA 4GXVL 3Q9QA 2CHDA 4P46D 3VX0A 2ZKHH 4XE5B 2IG2H 2QT6A 2NQ3A 5DVLA 1IQDA 4O4YL 4OIIH 1I8MB 3B9AA 1T5WA 5T1LD 3V0HA 2EXYC 1CICC 2PYEE 1A6TB 2X6UA 5GS0L 2G4GA 2AITA 2IGFL 4NT6A 3QB7C 4TLKA 1X5MA 3NMEA 3RB5A 2DM7A 4QRRB 4KK5D 4G6KH 1JZ4A 4Z7NE 5EF1A 4KH2A 1VZIA 1CR9H 4D8OA 1UA3A 1JZ8A 4IBVA 4M62H 3UCRA 1IC7L 2GJ6E 5IMLA 3AT9A 2V2TB 1SQ2N 1E5CA 2WM0A 3KYNB 1P5UB 1YEDB 3GJEB 3VXQB 5I15L 5I75C 1SVCP 2FNWA 4MDJA 4B50A 3STLB 5C92A 1VPOH 1B0GA 4U49A 2ICWI 1JIBA 3GMRA 1JXKA 4Z0BH 3KPPB 4CJ1A 1PZUB 3ARBD 1SHXA 2JJTA 1U8CA 3NZHH 4KKBD 1AZZC 4X9BA 4KUZL 3O4OC 5ECJE 1C5DB 1FIGL 3R18A 5FM5M 1WAEA 1AC6A 2KT6A 1KF9B 3TNMB 1F02I 3S4SG 1J1OL 2DAVA 6PAZA 1DDHA 1AQ8A 2Y07L 5EEVA 3NIDE 4CMMA 3E1ZA 4G3YL 5T3XL 4KDVA 2W0FB 4R97B 4TMPA 1N6QH 1KCSH 1RZJL 2NLJA 3MMEB 2QFPA 1CICB 3KWXA 3GSNL 1RUMH 4AL8H 1PBYA 3WIHA 2ADFL 4JRFA 3LN4B 2CDEB 2BNQE 2A4ZA 3A5VA 3OAZH 5JHDD 2XN0A 3KL3A 3VDBA 5IK3A 1I7ZB 2MKWA 2E7BA 1RCYA 2HH0H 15C8L 2BVOA 3VFSA 2YOAA 4JEGB 4IIZA 3CZLA 3HN3A 2XN2A 5EU7C 2FR4A 2K3TA 4QD2E 1AO7A 3TJPA 1PKQA 1ZA6A 1NSNH 2WKOF 3VXUD 5C9JB 3KYKH 3GXUB 4ICXA 1Q9KA 1TYRA 3LPPA 3HE6C 3ZL2A 4IBTA 4XNUL 3GB7B 2VCOA 2BZCA 4R4BA 5G5DA 4HZAA 1QPPA 3ZDYE 4BSWA 2XQBL 1YEKL 4NBZB 2DQHH 1U8MA 5FOBB 4POYA 2GBUA 5I6KA 3P3YA 1GYUA 2WQSA 2X2YA 3DTUB 5BUAA 3CFTA 3AWGA 1WBYB 1KTKE 4WSGA 4A2DA 3SGJA 4I85A 4UDTA 3VVWA 4IJTA 1JFQH 1YUKB 2XV6B 4L3AA 4GG6B 3V0VA 5IB3B 1NC2D 1S7SB 1BD2D 4PD4K 3SEPA 3U30B 4X7DC 4WNQA 3OR6A 4QCIA 4GMTH 4OLUH 4WUUA 3LDBB 4W6YB 4WLCA 3D4YA 1AH1A 4L4TD 2CO7B 1U3HB