3L49A

Crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SLEGKTIGITAIGTDHDWDLKAYQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQKPDAIIEQLGNLDVLNPWLQKINDAGIPLFTVDTATPHAINNTTSNNYSIGAELALQMVADLGGKGNVLVFNGFYSVPVCKIRYDQMKYVLEAFPDVKIIEPELRDVIPNTIQSAYSNVTDMLTKYPNEGDVGAIWACWDVPMIGATQALQAAGRTDIRTYGVDGSPEFVEMVADPESPAGAVAAQQPSEIGKLAVQNVARHLAGQEVKPFTFAPAVLITKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF ABC SUGAR TRANSPORTER FROM Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transport protein
molecule keywords ABC sugar (Ribose) transporter, periplasmic substrate-bindin
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A01
4XFKA 3CFYA 3JPYA 5DCLA 1QQBA 3OLYA 4EYKA 3NNSA 1YMVA 4YP9A 4HYEA 4RDCA 1ZN2A 3QLVC 1YMUA 3GA5A 3QLUC 2FN9A 2FKAA 3IP7A 4MYRA 1E6KA 4WXMA 4CBVA 4Z4CA 3F73A 3N0WA 4H3KB 1P6QA 3QX8A 4H60A 1K66A 1LJLA 3EODA 5B3JA 4OBBA 2AYXA 1QPZA 3EAFA 4WZZA 2PE5A 5JNWA 4LRQA 1JFSA 2M98A 1AB6A 3KCNA 3ROTA 3LUAA 5GOTA 2MSWA 3QLUA 1DCMA 1DBPA 3MM4A 2MSLA 4ZYLA 4Q7EA 2ID7A 4RY0A 1GCAA 2FEKA 4G0MA 3H5OA 5JNSA 2PUAA 5B3JC 3CLKA 1UDRA 1J56A 5IC5A 3OQOA 2ZAYA 3RVQA 5BRJA 3C3MA 4W5TA 2ID9A 2QU7A 1EWVA 2AYZA 3RVSA 1NY5A 4Y9TA 2PUDA 3KTOA 2VYCA 1LJUA 4LDAA 1GCGA 4P1ZA 3EDCA 2IYNA 4HNRA 4LZLA 4PYRA 4RY9A 4WWHA 3KS9A 3OMWA 2QR3A 3RQIA 3UUGA 3Q15C 4IMIB 3CG4A 4E7OA 1BAPA 4PE5B 1VPWA 3K4HA 4EGSA 3E61A 3MIZA 4KQ9A 5FWYA 2JRLA 4MR7A 4UHJA 2A9OA 1DJMA 3QEMB 3HCWA 1DBQA 5CNMA 5JNVA 1DCKA 1C0EA 2CHFA 2Q5CA 4N03A 1EWKA 2KYRA 4M88A 1KRWA 3BREA 4QPJC 3O2SB 2HJ9A 1Z15A 2PUBA 1ZHHA 4EVQA 3O74A 3NNDA 3LUCA 3Q41A 3MMNA 1D2AA 3LKBA 2FSPA 4N76A 5E3JA 1ABFA 2HQOA 4LDZA 5JNUA 3SNKA 4NCBA 2J48A 3JVDA 1LBHA 2FEPA 2FN8A 2HPHA 3KYJB 3L6UA 3N75A 4G0QA 5HKOA 4MQFA 4ZMSA 3BRSA 5IBQA 3M9XA 1ZH2A 2E4VA 2FVYA 3RVJA 1YS7A 1ZH4A 3FGZA 4G0PA 2IPAB 3N53A 1VRVA 2LBPA 5DGCA 1KGSA 3DBIA 4PZ0A 4Z4GA 1CHNA 1ZGGA 1MIHA 1TMYA 1M2EA 2JBAB 3OLVA 5EWLB 4D6XA 3MF4A 2R48A 4ML3A 3GT7A 4WXEA 3JY6A 1EFAA 3GV0A 3TO5A 3HS3A 1A2OA 1NXWA 4D74A 1OXBB 2RDMA 3CHYA 4ETNA 4P98A 5JNTA 4H3HB 4F06A 3C3WA 1JL3A 1TM2A 2QXYA 4KREA 5JS1A 3CZCA 1E2BA 2JBAA 3ILHA 1EWTA 1MB0A 2FMIA 1A04A 4MR8B 2H0AA 5KI6A 3T38A 5IULC 4F11A 5KQMA 4ZJPA 2CD7A 4LE2A 1APBA 4OG2A 1W25A 2R25B 1U04A 3M6MD 3Q9SA 3IDOA 4IRXA 4RZSA 2LUOA 4NCAA 1QO0D 3HVRA 2E4WA 1SRRA 5KQPA 4YCSA 4S05A 4DQDA 5T3YA 1PHRA 1LK0A 5TPZA 5IUKC 1M5UA 2A9QA 2PL9A 4KNYA 1H9CA 3ILYA 2FQYA 2L18A 5FBHA 3OLWA 3CZ5A 1CYEA 2PMCA 4OATA 2NT4A 5KWSA 3LUDA 4TN5A 3Q7SA 2FMHA 3FDFA 3FFXA 4HNQA 3CTPA 4MR7B 1ZGZA 3OO1A 4Q6WA 3RVRA 3LKVA 1JLKA 1JDPA 3OO0A 2IKSA 3NHZA 1I3CA 3OQNA 1OXKB 7ABPA 3URMA 3QEMA 2N9UA 2WJAA 4MRMB 1SXGA 3OMXA 1RPJA 1JHZA 2PUGA 4L4UA 4XXHA 2JK1A 3NHMA 2IOYA 1D1PA 5CNKA 3G85A 4RKRA 2XDYA 5T7BA 1DC8A 2FMFA 1QMPA 1E6LA 3JPWA 4W5NA 3H75A 1SXIA 3BRQA 3GL9A 2QSJA 3O75A 4KRFA 2MYTA 5GQSA 1MVOA 1NXPA 3FMVA 4RXTA 3W9SA 3N6VA 3KSMA 3SM9A 4KQCA 3IPAA 4O5AA 4YV7A 3EJWA 2WWVD 5C5CA 4E7PA 1L5ZA 2CHEA 4IGAA 2GI4A 4GNRA 2L17A 3F6PA 2JVJA 1F51E 1FSPA 3IP5A 2FW0A 5CNIA 3QELA 3LUHA 3KLNA 1DBWA 4RK1A 2PAFA 4RSMA 4NICA 4MR8A 3K9CA 2FQWA 3HDVA 3O2QB 4LE0A 4ZPJA 4RXUA 4RK0A 5CHYA 4YR7A 1QNLA 2PLNA 2GBPA 3QK7A 4KVFA 1ABEA 4QYMA 4G0XA 4IILA 1DRKA 1Z13A 5TPWA 3HUUA 1QP4A 1QQAA 3QEKA 3DLBA 1TLFA 2B4AA 2W42A 3CRNA 5BR1A 2X7XA 1BVHA 4Z4EA 6CHYA 1YK1A 3H5WA 4N47A 1JWLA 4FE7A 2MSKA 4MAAA 5EWJA 2L2QA 3SAJA 5TPZD 1ZAYA 1ISRA 1EAYA 1AB5A 3G1WA 4MS3B 4TLLB 1FQWA 2NZVG 5PNTA 1U2QA 4S04A 2F8TA 4RS3A 2F8SA 1MAVA 3RVPA 3OLXA 3QLTA 4XAQA 3F7NA 1IIBA 3C6QA 3N0XA 4N0PA 1ZVVA 1GUDA 1C4WA 2RJNA 3A0RB 2QV0A 5DTEA 5ABPA 4MS4A 1NXXA 4RK7A 3H1FA 4KZKA 4YRZA 1PNTA 2H3HA 1PUXA 3CU5A 3H5TA 3L49A 1RNLA 4Z99A 3UK0A 5TQ0A 1NXVA 4KK3A 4N41A 3NNNA 3H6HA 3TX6A 4KFCA 2FLWA 3H6GA 2NUBA 3LFTA 4FB4A 5BRAA 1Z12A 3I45A 3EULA 5HM6A 3OLZA 4MS4B 4Z0NA 1GLGA 5EWMA 2WY2D 1TJYA 5JNRA 4YGXB 2FEWB 4JASB 1P6UA 1MB3A 1QKKA 3OQMA 4MQEB 4Z9AA 2FMKA 3LUKA 2M1ZA 4Z9BA 4JOQA 4RY8A 5JS2A 2WMYA 1Z17A 1FFWA 3C3KA 3DGEC 3N0RA 4KPYA 1YS6A 2QZJA 3HEBA 1QP7A 3D02A 1S8NA 3LTEA 1DG9A 2LP4Y 1D4ZA 2QW1A 4KMRA 2TMYA 3QELB 2IPNA 3E3MA 1JDNA 1FFGA 1T34A 2JVKA 1DC7A 3M9WA 3B2NA 4G0YA 5IUNC 1RZRA 4L85A 2YHBA 2A9RA 4MQFB 4O1HA 2HQRA 5HQJA 4YWHA 3KHTA 4OLAA 3F6CA 1BDJA 3EQ2A 4YLEA 3D8UA 3ROFA 1K68A 4HNSA 3KLOA 5TQJA 2A9PA 4XARA 4F8JA 1R8JA 4G0ZA 3TD9A 1QP0A 2HQBA 3O1HB 2E4UA 5TPWB 1B00A 2E4ZA 5EWLA 4Z4FA 4ZMRA 4F12A 1KRXA 5TQ2B 4EYQA 2R47A 4EYGA 2PL1A 2YHAA 3O1JC 8ABPA 4F3TA 4YS6A 3FFTA 4GPAA 4MS3A 1M5TA 1YIOA 3MQ4A 2FTKE 2L19A 1JF8A 3CNBA 4N0QA 4PEVA 1VLZA 4TLMB 2MYPA 2O20A 5FBKA 1P8AA 3HDGA 4G97A 2OQRA 3CKMA 2FQXA 2VUHB 3VNBA 2RJOA 3LUFA 3BBLA 5FWYB 1SD5A 1ZITA 3HSYA 3I42A 5IUJC 1HEYA 3JTEA 1JX6A 1PEYA 3CG0A 3T8YA 1KMIY 1NATA 1F4VA 1ZDMA 3RVMA 3QX9A 2VK2A 2E4YA 3RVNA 3S99A 1USKA 1PEAA 2HSGA 5DKFA 4EVRA 5FWXB 5TQ0B 4D6YA 5IEBA 2GX6A 1DP4A 5KC8A 2IPLA 5KQLA 3GBVA 4FE4A 2VUIB 4NV3A 3RH0A 3HO1A 3EQZA 1SXHA 4G86A 3SG0A 1YVUA 2JB9A 3HK2A 4EUKA 4TMYA 4OTZA 2ZWMA 2JVIA 4RV5A 4RU1A 3R0JA 3JS5A 2BGGA 5EWMB 5C5EA 1XHFA 4G0OA 1TVMA 2DRIA 3LUGA 4EY3A 3HXMA 4QYWA 5IX8A 4EYOA 1NXTA 4MQEA 5IEJA 2IPMA 3IPCA 3N8IA 4QICA 4RK6A 3OM0A 2PUEA 4RXMA 3A10A 3EGCA 5I4CA 3UKJA 1URPA 2FXIA 3LMKA 1NXSA 3LUJA 3Q7TA 2I6FA 1VKRA 1W9HA 2NZUG 3VNAA 1U0SY 2GKGA 3KJXA 4MR9B 4RK4A 2R4QA 9ABPA 4W5OA 4JB0A 5CNJA 3KKEA 1FFSA 3A0UA 1QO0A 2LPMA 1M2FA 3H5IA 3LOPA 3RVOA 1JYFA 2P9HA 5TQ2A 1JH9A 3DZDA 1DCFA 4DADA 3TB6A 4EVSA 1USIA 2MYUA 3H5LA 3Q7RA 3HUTA 4WUTA 3A3KA 5HSGA 4Z4HA 1NTRA 1LBIA 1WETA 4MLCA 2NT3A 3JVIA 4IMJB 5DLEA 4MGEA 2JCGA 1P2FA 3BILA 4IF4A 1D5WA 1Z26A 5D2CA 3T95A 1CEYA 3H5VA 1XWWA 3DGFC 3MA0A 4LE1A 1D1QA 3RVKA 4W5QA 2RGYA 4Z4IA 3HJFA 1DZ3A 1NXOA 3I5AA 4Q6BA 1RZRD 2IDMA 3HM9A 4XASA 4JP1A 1JFVA 2E4XA 3MYYA 4PICA 4JA2A 3TMYA 4ETIA 2WJWA 6ABPA 4LX8A 5BQ3A 2V0NA 1BA2A 4RWEA 5TE9A 4O1IA 2P4UA 1Z25A 5EWJB 3O21A 1U2PA 1YK0A 3FFWA 2QVCA 1Y1LA 4MRMA 1Z2EA 3O1IC 2LIVA 3HZHA 3IP9A 5ED4A 1DRJA 1RXEA 4NQRA 4JB2A 5FWXA 1Z18A 3I09A 2PUFA 4JAVC 1ZESA 3T6KA 3GWGA 3H1GA 4MS1A 4DN6A 4ETMA 3GBPA 3GRCA 1L5YA 1JYEA 3SQNA 3NBMA 1EHCA 2MYNA 4MPTA 4RK5A 1JBEA 1RXIA 2CWDA 1BDIA 3DLHA 4B09A 3H1EA 1Z2DA 2QVGA 3CS3A 2FLKA 3OM1A 4MLDA 5KC9A 3IP6A 4YO7A 4KK4A 3P9YA 3KG2A 2WRZA 2GWRA 4W5RA 1U8TA 1E6MA 3QLVA 2PKXA 3GYBA 1USGA 3O2JA 5F64A 4OLBA 2WB4A 1XHEA 4KV7A 1PNRA 3KYIB 1JFTA 1ISSA 4MR9A 2PJUA 4UHKA 2OENG 3RVLA 2PUCA 4MS1B 4RKQA 1YTUA 1BDHA 3HV2A 3C97A 4XLTA 3SY8A 2B1JA 4WT7A 1ZY2A 1GUBA 1Z16A 1A0OA 5KQGA
chains in the Genus database with same CATH superfamily
5D7NA 2P2YA 2GPYA 3QFHA 2C4VA 3RNOA 3ISTA 1XTUA 2W6PA 1YR6A 2I71A 3EDMA 3PR2B 3UM9A 3VX3A 3VNVA 1YB4A 1ACMA 3ER9A 1CY2A 4EL0A 1N2SA 1GL9B 2JGDB 1QQ7A 2Q9UA 4OPMA 2WZQA 3RROA 4RADA 2XUDA 1G5QA 1PWZA 3QX8A 5CJ2A 1J8QA 5B3JA 1GIAA 4RQBA 1OI3A 1QPZA 4H4CA 2HJHA 4NYJQ 4CG1A 1XKTA 4KO3S 3RD5A 1K2WA 1UODA 2D74A 2OHGA 4KO1S 1VI2A 4HDRB 4ZTUB 3N8DA 4CG0A 1CJCA 1ZIXA 3PRKE 2ENUA 3IGFA 1IWPB 2C3PA 1XRNA 1E2EA 4L50A 4XIYA 1Z3IX 2GBCA 4KSYA 3W5VA 4EK9A 2ZE6A 2B3DA 2WVJA 2J3QA 4P3XA 2BFWA 5EQTA 4KXUA 3N28A 1EJBA 1XQ9A 2RIRA 2H31A 4N5HX 1V95A 4QOIA 1BMFD 1EFLA 5JHGB 1QP8A 1PJSA 1QOQB 1J56A 1G2PA 2GPTA 5L45A 5BRJA 4RLQA 4DY4A 4RW0A 3VOSA 1T8UA 1Q7RA 4A2PA 3VV2A 4AJPA 4F91B 2B8EA 4EITA 4HAIA 4E2XA 3STVA 4RDHA 4RIGA 4E5YA 1TVCA 1UBLS 3ORYA 3GRRA 3LF2A 1UFRA 3ZZMA 2X8BA 3PUZA 2YFQA 4IGEA 2Y71A 3G82C 1OX6A 3JQEA 3LLVA 4IMIB 2MDTA 4CQMB 5JASA 4Y7CA 2OXIA 3TE7A 3G2KA 5L3QB 1P1KA 4LRTB 4U6QA 1WNFA 4ZDJA 2JFQA 4OIFA 4BV2A 3LGAA 2CVPA 3PD0A 4F4IA 1T1JA 2PUVA 4BNFA 3DZ8A 4RACA 3BCSA 3JCZA 4FYYA 4Y6RA 3VZQA 4GI1A 5AW2A 1Y6FA 5DK6A 3T5MA 4EVQA 2YDYA 1R15A 3UMSA 4ZQCB 4B7UA 3AP2A 2FSPA 2VQDA 5AOVA 2CHGA 1CR2A 2Z1NA 5FFMA 4AJEA 4BVJA 2VYVA 2QSUA 3DE3X 4M22A 3N75A 2IBSA 3LP8A 1VCOA 2XQGA 1IBKB 2O8FA 4Q9KA 5K8JB 3QOYA 5LKAA 1YC5A 4UCFA 3RVJA 5AXCA 5BSFA 1GDDA 3PVSA 4V0LA 2LKCA 3FGZA 1E4OA 4EARA 4JQZA 4TQ9A 2OFWA 1GXSB 3C15C 3ZHOA 2BP7B 3LSTA 3RRXA 3NYWA 1BN7A 5AK6A 3WIUA 2ZIEA 4H3SA 4R5MA 4WA7A 2HI0A 4BO6A 1PQ4A 4WFKA 1CNEA 1KVSA 1LPSA 1YKGA 2IWRA 3RRFA 3JY6A 1E1CB 2I6UA 4NBWA 3W6ZA 2Z09A 4IQ4A 4DMLA 1YRYE 1A2OA 3QWBA 4GOND 4WESB 4UJ3A 2ZRBA 2QE7A 3HVJA 2ZIFA 4QOGA 2FPRA 3U81A 4A5SA 5GTDA 4Q1VA 5JNTA 3PJRA 3Q3CA 1RT9A 2FPPA 1NXQA 3K1AB 3REQA 1GG9A 4DIEA 4JJEA 3SQLA 1CV2A 2W2MA 4ATNA 5DBIA 3F90A 2AZDA 3V2IA 3I6IA 4I55A 1SG6A 1B0PA 3MTJA 4XSVA 5F52A 3DE2X 4OL9A 4MB6A 4DT1B 3PX7A 1O94D 3EDRA 1I7SB 5TS3A 1WB6A 3H7IA 1YJ8A 1YQEA 2DX7A 2JCSA 1O0CA 1XU9A 3I05A 4RJKA 4BMXA 1E5LA 1OBCA 3A1TA 1V8DA 4NBRA 3WMGA 4BO1A 4DQDA 4GWGA 5KQGA 3V8PA 1E98A 1LK0A 3D6JA 2VK8A 3A4LA 3PNPA 1WXHA 2QN2A 4KNYA 4KAAA 4IYRA 4YUWA 2A1TR 4QGFA 4EG3A 3RYHA 4LZJA 3S2IA 1XVVA 2POCA 1ZD3A 3ZXYA 2GBGA 3ZJ4A 4PZYA 5EFOA 4TN5A 1XDBA 2XTMA 2FZCA 3DMTA 3TBFA 3RHZA 3OY2A 4PYMA 1W0JD 2IKQA 4KXXA 2XITA 1I3OA 3OE5A 1IQRA 3PGMA 4X8MA 3RIXA 5C4MA 1CQWA 3HCOA 1X7XB 4XVHA 1FMLA 4R7ZA 3NHZA 4TX1A 4OHYA 5AM3A 4BUJA 4KE9A 4HDNA 5L4SA 5KJ1A 4HVCA 7ABPA 3ECSA 4L5BA 3QEMA 2N9UA 4Z3KA 2WJAA 3QF4A 2C92A 3L5OA 5EKSA 4OI1A 4IHQA 1M2WA 2OGWA 1RI1A 2WILA 2WUFA 5DGTA 1XTVA 2YN4A 3M8KA 3R09A 5EFZA 4F5ZA 3L7JA 2YV1A 3HXKA 5A3VA 5EAIA 4DSNA 1T6BY 1GDHA 3K09C 1LW6E 2R8OA 4TUYB 2EVWX 4W5NA 1Z08A 2FRDA 1AE1A 2VSFA 5CYGA 1EVEA 2P2SA 2QM8A 1SXIA 2X1LA 4O2BF 4E03A 2YQ4A 1Q74A 3WWOA 5CA0A 3R6LA 1NXPA 3EZYA 1M34A 4RPGA 3X43A 1SXQA 5AM4A 1XTIA 4P8RA 1EVJA 4I2VA 1J0BA 2D4HA 1G8SA 4TTAA 4OHOA 4YI5A 3NOXA 2QQ5A 4ZQGA 3JASB 1FMTA 3LDFA 3NBQA 5JIBA 5K05A 3Q9UA 1E3DA 4G63A 4FINA 1MF7A 1U0RA 1R9MA 3ILSA 4HH4A 2YVQA 4EUFA 1SIBE 2WQ6A 3IDQA 5DYGA 4JJZA 3RUAA 4Y0AA 4GNRA 5GZ1A 3NVAA 1TK9A 3VO2A 5JMOA 2NTNA 3IP5A 1JMYA 2FW0A 3F9RA 5CNIA 4ZQHA 1QV7A 1ZK0A 4BWGA 3K8OE 4YXFA 4TTVA 2E1RA 4F6RB 1DBWA 2KE5A 3KSDO 2PAFA 5IXSA 4M0MA 2NU7B 1WF3A 1H93A 4M1ZA 4AG5A 4DZRA 3WWYA 4AL4A 1C8KA 2R60A 1UFOA 1NVMB 1JFFA 1PFUA 3MIIA 1XO1A 3QUTA 2HA0A 1L5FA 4F6CA 3INYA 1ZJWA 2ANBA 4U0KA 2PLNA 4YR7A 2P41A 1KR2A 5C46F 3QY9A 3D5EA 3KU4A 2I6SA 1FNSA 4NZNA 1HSOA 4D8WA 1Z13A 3OJ0A 2YN2A 4TKVA 3QQ5A 3W6PA 4GR5A 2XRYA 4YXWA 4RHCA 1RM5A 3IDZA 3BK2A 2ZSFA 4JUAA 4Z4EA 3AINA 6CHYA 4EA8A 2IVZA 1EXMA 5EZSA 4UMFA 4AIIA 3WYNA 4IH1A 1FQWA 3VKFA 4FBLA 5ICCA 3IJ5A 1XAJA 3D2AA 4TSFA 2L42A 5AVRA 4TS1A 1RR6A 3V2GA 1TZMA 4R3WA 3R8FA 4PCAA 1A50B 1HYHA 3ISJA 1P4JA 3JVVA 7AT1A 1RPTA 4LOKA 4BFSA 3FI0A 3MWKA 5CG1A 2I34A 4MW2A 3KB1A 1J23A 4XR4A 4G37A 3ZQJA 1G3UA 1VCHA 2NZ2A 3B1JA 4FZRA 1PS0A 3UH0A 3AFHA 4L72A 1AS3A 3HR7A 4QYXA 1AG9A 2W6QA 3FDZB 4MMYB 4TYNA 3QV1A 4ZQIA 3TPCA 4YRAA 4LXYA 2AXNA 3NASA 3G2PA 1IJFA 1RDFA 2IBTA 1KFEB 2IPXA 4FK8A 2A84A 2EFJA 1SUPA 3R3YA 5BRAA 2XGGA 2FG7C 1P0PA 3JWGA 4WDQA 4NEHB 4L75A 2C3MA 1RKVA 2W6ID 5EWMA 1DJLA 1TJYA 3W6OA 3ZNNA 1DLJA 5ALMA 4JIMA 5GADl 2W8ZA 4BUCA 3MLBA 1A9ZA 3DZFA 3KV1A 3OQMA 3CMMA 3K5HA 4RH1A 4P4UA 2CYCA 1BHQ1 2QTWB 3IP3A 3VC7A 4F4UA 3GDWA 4GRIA 3K9GA 4GO1A 1IN1A 1XEFA 1VTKA 5FI1B 3OJCA 3KD3A 1R16A 1RXWA 2VP3A 3FPLA 4CEHA 5JU6A 3Q40A 2VK1A 1G5PA 3JSXA 1CRWG 1ZH8A 4RNCA 4P3KA 4C3UA 1HDIA 2R7MA 2VJOA 2YOHA 1QP7A 1CSEE 2QM7A 1JHOA 2P90A 4QT4A 3AKZA 2X6QA 2XMPA 1DG9A 1V7ZA 2LP4Y 2JW5A 3AFIA 1UM9A 1PT6A 1VPLA 3NTRA 4FQ5A 3D81A 3SSNA 1SXJC 2IPNA 3BIXA 9ATCA 4FYKA 2BH2A 1KYXA 5HYVA 1YZFA 4HEA1 3PA8A 1E0DA 4JWKA 1ZLYA 2HQRA 3QBTA 4YWHA 4PZUA 3L01A 4WK4B 3P19A 3DFMA 4JQCA 4YLEA 4LSZA 2AHRA 1AZWA 4NESA 1HE5A 1BU5A 1WXEA 3ZHUA 4BNLA 4F6RA 4P38A 3PQ8A 4C4TA 2RHGB 4ZOBA 1WZNA 4HATA 2IYPA 2VLBA 4LC9A 4A8PA 2CNOA 4LBYA 3LUBA 3RYCA 4C4XA 1KDZA 2D1YA 1G3RA 1PR3A 1JT9A 1WSDA 8ABPA 3G2OA 2ZS7A 1X1TA 4HWRA 1CJUC 1RFLA 4DKXA 1DOHA 3BB1A 3QU7A 1YIOA 2BR5A 4ZWNA 1Y34E 1Z75A 4MH0R 2VTVA 1I4DD 1NF8A 3X1JA 2JFNA 1K0FA 1SK8A 1X1CA 4J16C 1XZIA 3EW7A 4JUCA 4WJLA 4IHJB 1JG2A 3FWHA 3MJFA 3PLRA 1EI9A 1A95A 2YXNA 3AJAA 4M1WA 3ZLJA 1XZKA 1XR3A 5JSHA 2GN2A 1JSZA 2PZKA 2XLBA 1RZ3A 2MSDB 2V6GA 3ABIA 4ZVQA 4DM3A 2AOTB 3ERCA 4D3XA 4YCNA 1JX6A 2RHOA 4QRDA 2IIQA 4H1WA 3BA1A 1YE3A 4ABTA 3FCAA 3MCAA 3VR5A 4BMSA 4PIPA 1EQAA 4LWQA 5BSUA 2F1JA 3K9LA 2E4YA 4I5EA 3T1YB 4TV9A 2HEGA 2RJ3A 3DCNA 4RHEA 1V4BA 3HBFA 3LHFA 1A4UA 4MV0A 2JHGA 1LFDB 1I4WA 1Z4NA 2GN4A 1P7VA 3H6KA 1LJ8A 1B0AA 3EQZA 1AKRA 1EDZA 3R76A 4D8TA 3L02A 4FQ7A 4NAUA 3SG0A 3WAGA 1W46A 1MXFA 1WSWA 3I8SA 4ZVRA 3RR2A 3WB2A 2JHFA 1GUFA 1QF7A 3K94A 3PDIA 2PT7A 4PYOA 4I8DA 4QU9A 4BJ5A 4LF8B 3O03A 3W2TA 1T8SA 2GSDA 2VAWA 1EQUA 3BC1A 5EWMB 4F3NA 1SU6A 2YR0A 2P67A 3U17A 4DCTA 4OLHA 4YPVA 4CF7A 4R51A 4BXOB 13PKA 2EWVA 3A8TA 2PYDA 3OIVA 4NECA 4GE0A 1VHLA 4WJKB 5LCXA 1KP3A 2HCFA 1U28C 3EXFB 3TD2A 4BVGA 4EJSC 1CXZA 1H8HA 1CQJA 1E3WB 1FTNA 2KI5A 3G9XA 1BRMA 2BELA 3R3HA 2HU5A 3DC2A 4M1QA 4PHTA 4U7JA 1ZSVA 1OGIA 4FC6A 2IZOA 2P4HX 3TLYA 3ZDRA 4DCNA 2ZJ0A 2GKGA 2C83A 1H8HD 3GLHE 2XDWA 3AUKA 4CF6A 1ULAA 2X3UA 2ZIWB 3MQ2A 3FOWA 3OE7A 3QPWA 5K3DA 2IHBA 5JCOC 1NKVA 2IIPA 2RGGA 2NP7A 3GROA 2GLXA 2EERA 1QO0A 3QV2A 3IUQA 5JY1A 1ZMRA 3T4EA 2Z3ZA 1IXRC 4HGZA 2Z3WA 4E5UA 1WCIA 4QTXA 2LGJA 2O2GA 3W05A 1DKPA 3O38A 5F12A 3DFZA 4BZXA 3AVXA 1YFKA 1BEEA 2NSHA 1NX6A 3FHJA 3T5AA 4P54A 4RPCA 4ESHA 1UBSB 3NTOA 4LYDA 1EP9A 1WETA 4KZPA 1U1DA 2CFRA 5CT9A 4MGEA 1CYDA 3AEUA 3JQFA 2ECQA 2LCQA 3R1IA 3RGGA 4YCMA 4X60A 3OT4A 5GM1A 3Q98A 4L8GA 5HZHA 4WZAE 3GJTA 2TYSB 2VBIA 4LVUA 1NLMA 3WRXC 1K97A 2ZUFA 1EBBA 2HYIC 3BA6A 1C4KA 2OZLB 4DIKA 2DETA 3I5AA 5HP4A 3F8TA 2NXNA 4UBIA 4UU1A 2BE7A 4F0JA 2ZVPX 5JBIA 4DRZA 5JYBA 1CDDA 1RAHA 4YAJA 1NGSA 5ICEA 2O6LA 1R64A 3CZ9A 3S55A 4EBBA 5IBCA 2EEZA 2IS6A 5ALRA 2D1RA 3VO1A 3WA6A 4O4HF 3W5IA 5IPFA 1OH8A 1BW9A 2VA9A 1E96A 2WYWA 3CEMA 4K9KA 3LC0A 3LYHA 4QJ4A 1ZONA 4N0DA 2KHZA 4FFLA 1WL8A 1B93A 2F59A 3PGA1 5DEIA 1VKZA 4AJ1A 4H9GA 3K0KA 3WLTA 2ZM5A 1L7AA 1FXWA 2NZ8A 4P7FA 1AJEA 2BGMA 4X3PA 2HJSA 1XJ5A 4X6YA 5HKKA 2P1DA 3GDHA 1JDTA 2GD0A 4CCYA 4YRBA 1DPFA 1Y89A 1N32B 4XVQA 2WHQA 3L7KA 5CCDA 3RDPA 3RU3A 4O4HA 2BFCB 4PW0A 2OBMA 1U1IA 4HQLA 1N25A 2D06A 3I3SR 3MS4A 4DPLA 4FIDA 2JK0A 2DHDA 1BRTA 3FJ1A 1FE8A 4DYDA 1UP7A 3TDMA 2UXBB 3OPYA 1K27A 3FCYA 3WNCA 4LF7B 2VHVA 3N7TA 3LLMA 2INGX 4HP8A 5ICGA 2V6FA 1I4OA 1OILA 1QHIA 3GLHB 5EA2A 3ZOZA 3U4DA 5K3SA 4YV1A 1A7AA 4K6MA 2E5LB 1ZY2A 1OIVA 3NNNA 4DMHA 1OBHA 3M33A 2ZSJA 3QWIA 4A73A 5DLDA 4A0GA 1XFAA 4FX2A 4HYEA 4RDCA 1GAQA 4NCIA 4A6EA 1R8SA 1JHDA 1UFKA 1Z4IA 2JH3A 3ESYA 4PZPA 2ZPTX 3F47A 1RYFA 1EVYA 2QD3A 3NIWA 2G9VA 1FA9A 1Z47A 4HWSA 3UT6A 4HNTA 4MEBA 1JQBA 1FMJA 1NV8A 3G2LA 3EAFA 2ZJYA 2C4NA 4QUKA 3UPUA 2FDCA 3QVWA 2NLOA 2EQAA 3D2BA 4WFJA 4DCCA 1FXUA 3A4YA 4M0KA 4ZT4A 2V8BA 2EWMA 2VWPA 3KXPA 2MSWA 4YA6A 4CIDA 4AO7A 3WHPA 5BORA 4NOMA 2BUBA 4YALA 3RCBA 1GY8A 2CHQA 3V7NA 3IE0A 1ZH6A 4PZZA 3IEUA 2AR7A 5LB2A 1VG8A 2MSLA 5B1IA 1L2TA 3PKJA 5DM0A 3U48A 2QNRA 3H1BA 2G77B 1PWHA 3OHPA 1XLUA 1VG9B 1QR6A 1JIJA 4Z1MA 2OZLA 5B3JC 4NYMQ 2REQA 5IDYA 1TIBA 4EO4A 2YQ5A 3DBHB 5FP0A 1CQXA 2ID9A 1IJBA 4G1MB 2QTFA 4LPSA 3KTAA 4G1UC 4ZOLF 1ENPA 1KZ1A 1XTJA 3ENNA 3KX2A 3FVQA 1SUDA 4PGHA 3LBNA 1E58A 2FEOA 3CLRD 4RY9A 2W8BA 3HKBA 4TQGA 1TYCA 3KVYA 2X0EA 3W2HA 2XKKA 3GAFA 3ZHCA 4K6FA 1A9SA 2C94A 3OIUA 1T5OA 3R6TA 5I4IA 1BAPA 1YNOA 3U37A 2F43B 5KCMA 4EGSA 3AOEC 2KWIA 5F2OA 1FTSA 3MIZA 4TLBA 5LUBA 3S4YA 1Y3CE 5D3QA 4LOIA 4W8HA 1QE3A 2GCIA 3PKZA 5DM2A 1AQLA 1YZLA 4ITUA 3AUSA 1Z15A 3BZWA 2J07A 3O74A 3NNDA 2XA2A 1Z7WA 1ZJ5A 1Z37A 4AKTA 5GJBA 3ULKA 1BFKA 1RYYA 4EM6A 4FU0A 1KBQA 4U7GA 1EVLA 4OQNA 3MOGA 1K1EA 1Q7EA 3P9IA 3ZV7A 1B15A 1JWAB 2XNJA 3G5AA 3SS9X 1U11A 2QJTA 4HJXA 3CXRA 1M6YA 2HFJA 4J6EA 5KNBD 5BW5A 4NABA 2BFDA 2XVMA 5L4LA 4AY2A 3H3XA 3OEHD 3VYTB 1QR2A 1ZEMA 1TMYA 3FNIA 4FONA 1TM3E 4I4TF 1LVUA 4A6PA 3ZGOA 3E5MA 2AVNA 2P6NA 5GGYA 3RREA 2DFNA 4HSEA 1NVFA 3HZRA 3OBIA 4Y1RB 1OYVA 1NE7A 4L5IA 5AW1A 3AL2A 4HL6A 1YHYA 3BUSA 3H11B 3OG9A 4FS8A 3SZRA 3WFJA 3UWKA 1MFPA 5AESA 3DEYX 3G1TA 4C6SA 3TQIA 1NASA 1G42A 1TM2A 2JJQA 2BHRA 5DNEA 1Z34A 3QXHA 4GP9A 4I36A 4TXHA 4BGEA 2PX6A 4M9UA 3ILHA 4PZCA 2VJNA 4MR8B 3ZGLA 1Z5WA 2BHLA 3WGUA 3PHBE 3A1FA 3AERA 1JFFB 2CDNA 2G9ZA 2IF0A 3EMBA 4O0LA 1DUIA 5CDTA 1OB2A 2CD7A 3VKGA 5L6LB 4Q39A 1O8CA 3OQPA 5FRDA 1Q1NA 4R6XA 4IRXA 3U4HA 4NNOA 2FP3A 2FHPA 3KHSA 1SRRA 2A4MA 4TKVB 1WX1A 2DAPA 2B21A 2CMFA 3OC0A 4L2IA 1RQGA 1WZ2A 1QFMA 1O9HA 4WCFB 2I2AA 1GZ3A 1QJCA 3PT9A 4MP6A 2V7XA 3R5FA 4LZZA 4RANA 4DIFA 2A9QA 2W2LA 2V7BA 1Z0FA 1EEXB 3L0CA 4J43A 2HZ7A 5FBHA 3CZ4A 3OLWA 3QSGA 5IMSA 3LKDA 5JXJA 1KSFX 3E9DA 4MV8A 4UAGA 1X3SA 1EG2A 3MJCA 4AN0A 4Z9FA 1IBLB 3HLKA 1M1YE 1ZCZA 4BGVA 4DKJA 4E32A 2VP4A 2P78A 2ZJBA 4OJTA 3ZU2A 4BS9A 2VPIA 4GBMA 5AHWA 3COPA 2OO5C 4WCDA 4AJ4A 1JBQA 2RKBA 1XPRA 2O2SA 2BKXA 3HKEB 3ESAA 3TYXA 2RAFA 3V8EA 4PSCA 5JAHA 3CN9A 3Q2OA 5FYQA 4G67A 3TOXA 3IMEA 1DKUA 3REGA 1SEPA 4GQBA 1N2XA 4CMIA 5JTUA 1N33B 2CN1A 1GTZA 2ENWA 2ODNA 2OLEA 1GLVA 2IS2A 1K4MA 5I7WA 2BCJQ 2XDYA 3C8ZA 3IQDB 4Q4HA 2BIFA 4QFCA 4RVHA 3BXOA 1UT8A 1N1DA 2WFLB 5FKJA 4CI0B 5EEHA 1U8XX 1ZRSA 3DB1A 1CNFA 4OXRA 1SCNE 1XRQA 2H7XA 1AGNA 1T1GA 3EDQA 5FUYA 1VP9A 5TRTA 3RRNA 2OQ2A 3KEQA 4ENTA 4ZEVA 3LJKA 1UEXC 4HWKA 4DJ5X 1U3CA 2FPOA 4EPVA 3BJZA 3AUAA 1SXJE 1WVMA 4C05A 8LDHA 5LL6P 3T1QA 2Z3VA 3DE7X 2PUHA 3W4KA 2CLFB 3DT6A 3OBBA 4IQ8A 3RSSA 3VFDA 2VYVD 3BJIC 3ZGVA 4DA8A 4DXHA 2APJA 3U44A 3OFJA 1WXXA 1YA8A 1NOKA 1VDZA 2R4TA 3S2ZA 1ML4A 3KLBA 3L0SA 4MQLA 5SZKB 5B4TA 4JLAA 1NLUA 3NUGA 4OA5A 2CL7X 5BR7A 2DHCA 2P6OA 5LA6A 5CT8A 1JKFA 4IZIA 1RYDA 1MABB 3WLHA 4RVDA 4JR2A 2PY6A 3BS4A 3KLMX 1XQ6A 2H85A 2J67A 4PBRA 3RC2A 4Z7JA 5JYDA 3K8ZA 2RK4A 2Y2VA 2FH5B 3GN1A 3N5KA 2B7CA 2RFLA 4A4DA 4AUEA 2BMAA 4QGHA 4J1SA 1CEQA 3GGCA 3GJQA 3TNDA 1ESZA 3W9YA 4XUCA 3AF2A 1D8AA 1YO6A 3OETA 3LW8A 1A82A 3DLBA 3UHOA 2ZJ1A 8ADHA 2PWAA 3U4QA 1PS9A 4B3JA 2JLQA 4EPTA 1PL7A 4D4HA 5BMVB 1TEXA 3S7TA 4L57A 5CR9A 2XSZD 4JX8A 4NCXA 4PFQA 1ISRA 5KWEA 2PEZA 5FO0A 4KFRA 2F8TA 3DG9A 3D6NB 1EFUA 1D7AA 1RHKA 1OMOA 1C9KA 3P9XA 5TV2A 3P2IA 2DFTA 2ISSD 3OF5A 2QI9F 1VL0A 1W8IA 1J5PA 5ER6A 1BMFA 3K9BA 2BGNA 4MS4A 2HMVA 1L8QA 4DARA 2IY9A 2KJQA 1QHSA 1PR6A 4M60A 3S1AA 3PVZA 2PKCA 2BY4A 3S81A 3WLSA 1CB0A 4KK3A 5CM2Z 1WUYA 1DC4A 2O59A 3A6EA 1K3TA 1LZLA 1VLHA 4KGVA 3PK0A 1XGKA 1Z0IA 1AN0A 4MYDA 2VF2A 1QLJA 4QFDA 1ENYA 3U7EB 1J2JA 3H6GA 4K6GA 2M6LA 4PC1A 2F3RA 1DT5A 5HM6A 2HPVA 3VPXA 5A0TA 4PYKA 4BJ1A 3QXCA 4YGXB 4OJNA 4IINA 2XCUA 4FS3A 4I66A 4QC2A 3KSAC 4ZV9A 1I33A 2BZGA 4NMXB 4Z9AA 2C8JA 4ZRNA 5REQB 3SHOA 1SZJG 1SKAA 4HWTA 1BIFA 4XOIA 1WB5A 2LVBA 1CQPA 3E82A 3IP1A 4IIFA 1GPLA 4L9AA 4RY8A 4TQAA 3DXZA 1PUJA 4PONA 1YZKA 1K4YA 2NUAA 3EBLA 3L7NA 4L7VA 4C7BA 3IBCA 4ZHQB 1Z6PA 3DR5A 2EP5A 1S7GA 3GU3A 5DB4A 4FD3A 5FUMA 2QZJA 3HEBA 1OE0A 2XUAA 2CE2X 2H1HA 1R66A 3J81k 3U4AA 1S8OA 2P2CA 2GA8A 1BKDR 2UUOA 1UJBA 1QOZA 3RV3A 1BG6A 3W5CA 3C8HA 4RIEA 2CZCA 5I48A 2ZE8A 1KEKA 3VKVA 5CFRA 1RJFA 1Q3KA 1IZ7A 1EE1A 2GPBA 2Q8NA 4LSMA 5F98A 1EESA 4NARA 4F9EA 2YL2A 1K68A 4HNSA 3R7NA 3GMDA 4JL6A 4QDUA 1H2AS 1NVVQ 2Y9MB 4DLNA 1R8JA 1UMCA 3B3AA 3TD9A 1WY7A 2HQBA 5FR1A 1H22A 2V45A 3JATB 1PW7A 1UXIA 1HMPA 4PC2A 3UK6A 3E7XA 1KMMA 4JXKA 1DUSA 2QK4A 1SJ9A 4Y2YA 1MORA 1CUXA 2PR7A 2G3YA 1QIEA 2GOYA 5BQFA 4GPAA 3KJQA 2VBCA 4ND5A 3TZKA 3I04A 4BO9A 2EAUA 1EK2A 2Q6LA 3OKCA 3U40A 1PZHA 3INTA 3BIFA 3JXEA 4F2GA 4B74A 3TG2A 3GP8A 2QLBA 4GPBA 2QUJA 3NHBA 1NM5A 3SBDA 1CZLA 4P7GA 1B8VA 1FSSA 1H8EA 2A5DA 2AOUA 1UWKA 2JGAA 3OFND 5FBKA 3ZW8A 4F4DA 5EJ5A 4Q9LA 3AM5A 4DLVA 4F92B 5JSUA 1IJKA 2J0UA 3VVMA 2WT9A 5J63A 1UBEA 3VGPA 1JA9A 2FW6A 4KWHA 5CDUA 4CF3A 2HX1A 1F9EA 1ZITA 4PANA 3HN7A 3OM9A 3PC7A 1L6IA 3JTEA 4CGYA 2AG8A 4JXZA 2BI4A 2MR6A 2B7BA 5ECYA 5JZOA 4GVXA 3V48A 1KMIY 1VECA 2D1FA 1ANKA 4R1LA 4MI9A 3WSTA 1EZZA 2P5TB 4TVSA 1ONBA 4LN1A 5KTMA 4JT8A 1ZD8A 5AUOB 4NMHA 4D6YA 4H1VA 2PL5A 3TBKA 2QKYA 1KP2A 3HBMA 4NFSA 4X1YB 3FUWA 2ILTA 1F48A 4RS4A 2ZUUA 3EYAA 3CR3C 2VYQA 3PNSA 1NZDA 2F1HA 3ITKA 3ENWA 4RU1A 4NCHA 5DSTA 5LYYA 2D54A 3E22B 4P84A 4AIRA 4DDHA 3T9CA 5BUCA 4ND4A 1TIKA 1N3LA 5ER9A 2HKIA 5DI3A 3X1XA 3PGXA 3L43A 2K2QB 3TQOA 2WTMA 5JATA 4EUNA 4F2PA 3EA0A 4RK6A 4K87A 2ZRNA 4GOOD 1A7KA 5LNK6 1VJDA 1NURA 4ZYTA 2N75A 1P31A 1QONA 5BR8B 1PK8A 1R4MB 5A4AA 2IUYA 4OX9Y 1F2UA 4JT4A 5EVJA 5I9BA 3R7WA 2YC4C 4E3ZA 10MHA 1VKNA 1R0LA 4ARBA 5EP3A 1JSRA 4EHJA 3G6WA 5KS2A 4X61A 2QAIA 1M1UA 4CCWA 2YJ5A 1ZZEA 4G5OA 1CS0B 3QIVA 2F67A 1EFPA 1OA0A 1X7HA 1U28A 1XP5A 2W0MA 5H5JA 4BBAA 3MWGA 2XBMA 4JI6B 4INPA 1K3FA 5CMLA 3CLUD 1MB9A 3AVUA 1JH9A 2HC9A 4XFJA 1WUTA 3T1OA 1TW3A 1UKEA 3TB6A 2W48A 2FEXA 1JEDA 1VBNA 2VJLA 5CLFA 3AR7A 1TKRA 3HUTA 3MAJA 5ENZA 5AJXA 3QVUA 2VT7A 3OPMA 4KIFA 3RM3A 1LH0A 3BN3A 4JBNA 2Z5FA 5FF9A 2JNWA 1XMOB 3EZLA 1NMSA 4FLEA 3BILA 2IYVA 3FKSA 5A03A 2KBFA 4O29A 2OP1A 3LK6A 4M89A 721PA 4G26A 2R5WA 3H9JA 2I3DA 1F3LA 1R4AA 1Y3DE 3KRTA 3AR2A 3DE6X 4HF7A 4P9NA 4FFWA 2PZAA 3H2JA 4BMOB 2XA1A 4FW9A 5CDFE 3IDFA 4OOFA 4IOLA 4M0EA 1R3DA 4KDCA 1U81A 4JZYA 3HM9A 2BMWA 2B5OA 1E79D 4XASA 3UJ6A 3K6RA 3TINA 2NTVA 4EB6A 3OJEA 4OP1A 1U2EA 3H1TA 3AETB 2H4ZA 3H2KA 3LU1A 4YLGA 3UB2A 4JP8A 4DDMA 3WXMA 4ZI7F 1R0SA 4P34A 1EGMB 4RTNA 1XLTC 2FJPA 3FFWA 4JB8A 4J94A 2O4UX 3C3BA 3HCRA 1SB9A 3COZA 1NONA 4FYVA 1BDBA 3BXXA 3O93A 3UAOA 5M04A 2O2CA 1XCBA 2HLPA 3RIHA 2QN7A 4WLVA 3L2OB 4O4JF 4OKNA 4GSKA 4WNAB 4X7MA 5C0OE 3HG7A 5AW8A 5ETJA 2XYGA 5IZCC 3FIJA 4MS1A 2CXNA 4DN6A 1UXOA 1ZM4A 3SQNA 3NBMA 3A58B 3A6ZA 3WGJA 5IN4A 3STTA 4A16A 4ID9A 5CX1B 1RXIA 1P4GA 1T2AA 4XIGS 1GSAA 3N2IA 3DWFA 3ZG6A 4A10A 1PR0A 5LFAA 4RTJA 1A8QA 3UT0A 3F4LA 2PEYA 2PXHA 3C3XA 4OD0A 4QG3A 3RS2A 3UPTA 1B43A 1E3MA 1BFUA 3I64A 4U7TB 3E9RA 3BSWA 3N6RA 4YEDA 4RZHA 1SHUX 2Y6UA 2QZ9A 4XGKA 1P74A 2QLFA 3VYVA 5IDQA 5KQRA 1C7ZA 1YTUA 2DUMA 1T9CA 2HF9A 2P9FA 4MW1A 4ZCQA 1DUVG 1KZ4A 4JMPA 3I52A 3SF0A 4OYLA 4I14A 1QGUA 1UP4A 5EUCA 3WKCA 3T5GA 7YASA 1UKZA 2F8MA 5EZYF 4EA6A 2BFNA 4OCZA 4Z49A 5JXIA 4GX1A 1GXSA 1R12A 1TJ4A 2YUIA 4H27A 3GA5A 4MYRA 1WW8A 1GRNA 1PW5A 3WNZA 1DAEA 2GDJA 4DCSA 4BN0A 4XRRA 5E9QA 5T3UA 1XI2A 3T7SA 5IT9A 1Q15A 1PP4A 4TTPA 2FWBA 4J03A 2DERA 1ZIOA 1TO2E 1P6QA 3FE2A 1RXCA 4UBOA 4RA6B 4UFNA 4REQA 2ONZA 3I0ZA 3OH8A 4K9LA 3ZHTA 4EG7A 1ISFA 2QS9A 3OJWA 4G5FA 4PHFA 1JU3A 1R1DA 3A1SA 3JAKB 3E1GA 5DTRA 2WF5A 4I1SA 1JR3A 3U3KA 3DV0B 3QLUA 5B4UA 3FTFA 2J41A 4MCJA 4N18A 2FF7A 5KHOC 2TS1A 2NPIA 1LLCA 3FNQA 3KEMA 1QVZA 4PNHA 4BJHB 4ENRA 2YJGA 1RRPA 3GPBA 3FN4A 4FD2A 4DT1A 3C7TA 1D6SA 1V1MB 1B8PA 3L6RA 4GT1A 4WEQA 3RS3A 4WZBA 3UHPA 5DXFA 4R16A 3QKSA 2HV9A 3ZDFA 4AC9A 2ZDGA 1RI5A 1JA0A 3CZAA 4GLBA 1P77A 4L2IB 3V3KA 2Q6VA 3KUXA 3JZAA 4GVPA 5IP5A 1JDSA 2JZNA 2VXOA 3LT1A 1W1UA 3HN2A 3VH3A 1IHPA 1YQGA 2J6BA 4WXRA 2A0KA 4LZAA 4KPEC 1L4UA 3IAEA 1XVUA 3OFSA 4PQYA 1ZD5A 2QR3A 3CVOA 5AJZA 3Q15C 1AX9A 1FFBA 4XYMA 2FWAA 3IAM1 4JLOA 3GAMA 2ECKA 3HCFA 4MUKA 4XYGA 4PYJA 1U98A 2YS7A 2Q9AA 2ODAA 1SK9A 2QX6A 3CEJA 4TWJA 2J5XA 2W6ZA 2ET6A 3SSMA 3K4QA 1AQ6A 5BN5B 3CLTC 3RSLA 5LQJA 1JYSA 1G21E 1J9ZA 3FMPB 4N7JA 4RF5A 2IYZA 2SNIE 1TK3A 3CBGA 1CTQA 3BREA 3DHWC 3P52A 4IG4A 5DTMA 5JR3A 4MMZB 1RQXA 2UUPA 1Z9BA 3I01M 4TRNA 5CX1A 4BFUA 3VSAA 2XXJA 1ZCFA 3ADDA 3L7CA 3Q41A 2BSQA 1X14A 3LKBA 4FNAA 4XR9A 1T5HX 4D56A 3L05A 4ARCA 4RD2A 3TIIA 5JSZA 1G55A 3IIJA 3T3GA 2HPHA 3FOEC 5D51S 5M3BA 3ZDBA 1Y8RA 1RJDA 3ROMA 3B2QA 4EGCB 1YS7A 2O7SA 4R8RA 2A4KA 1E6CA 1LUAA 3C1AA 1WOMA 4Z4GA 2I22A 3DBIA 3K53A 3OLVA 1JIQA 1VCIA 4Z0TA 1SBZA 4UTXA 3WK4A 4JEUA 5FT9A 2QNIA 3N2GA 1MX5A 3QBDA 4BQNA 5LMNB 2IW1A 1IH8A 3B8EA 3HJCA 4MAFA 4TMKA 2I33A 2CC2A 4E5KA 4NZYA 1NW5A 3M2TA 4K46A 4LJ9A 5I3CA 2RHCA 3IUEA 4WY8A 5KOHA 2JGFA 2Q2OA 4H3HB 5I7HA 3N76A 3FIUA 1T13A 1XTBA 4NZPA 4XTRA 3QMWA 3T9EA 4JC8A 2ZRDA 3ACBA 4R1UA 4OHVA 2J7PD 4HYTA 1CJVC 3O3NB 4LJ5A 2RGXA 1DJNA 1YBFA 2PO7A 4Y2TA 1DAMA 1KL7A 1FCJA 4JLNA 2WKPA 4URHA 5KKAA 3DFIA 3T5CA 3V8MA 1T4CA 2O8EB 4M9ZA 1CVLA 5IULC 5ENVA 3AHJA 4J0FA 2EZ4A 2PFSA 3QZUA 4CHTA 3OQHA 2R25B 2AFIE 2VDUE 2V7GA 1P3JA 3ZHSA 1P2DA 4RZSA 1TD9A 3KQKA 3PNYA 4HRXA 1UIRA 2GZHA 2ID8A 2Z98A 3DTYA 4MARA 4OGWA 4RE6A 1Q3TA 3L8ZA 2IEDA 1WCYA 4B5KA 4YCSA 5KQPA 4X00A 1TEHA 4DAEA 1ZRHA 4ZJUA 2X9QA 4U2BA 4NRDA 3T06B 1OT5A 5MN6A 4MV4A 1TVEA 3OWHA 3W2IA 1VP3A 4X6LA 4BV3A 5LU8A 2A1IA 4M21A 2O0MA 4LISA 4MYTA 3PA6A 2C5HA 4QG7A 3ZS8A 2IY7A 5GIPE 4PLHA 2CCGA 2F1OA 3VDMA 1Q0PA 3P20A 3FDFA 3N2LA 3CB2A 1TC1A 5J4VA 2WTBA 4TZTA 4H08A 1PGNA 5DLQC 4CHGA 1TM4E 4CW7A 3EEQA 4PX9A 3WOVA 2PPVA 3VSCA 3OQNA 3A1UA 2C8VA 2NO5A 2YBDA 4DM4A 3R4CA 2IEZA 1J8FA 1VFPA 5B4VA 5L7WA 2QTVA 2NP6A 1WD5A 1RWMA 2C5AA 3OPXA 1NA5A 4L4UA 1EFHA 2YW2A 3OM8A 1AURA 1P4SA 2D2VA 5KNBH 1J42A 2JGLA 2IEGA 2RHTA 3ZE1B 2J3MA 4G36A 1XKQA 3JPWA 4MJ3A 3EPJA 3AM1A 3FOBA 2JKYA 1NT4A 3AM4A 1KETA 3V80A 5TARA 5AK0A 1E6EA 2ZJOA 3ED1A 2DWCA 1VOTA 4R0NA 3ESXA 5EHNA 1YQUA 1OLXB 2JFGA 2O8DB 2QUKA 1Z2AA 3TVDA 1LDNA 3B48A 5FV7A 4ZVUA 4I1UA 4C7KA 4WXYB 1BWPA 5D3ZA 1N6IA 5IG2A 4GG1A 4ZHQA 1JLLA 1Z4MA 2NXWA 2C2BA 2XMQA 2WMOB 3BGDA 4YMGA 2ARKA 1K08A 1T36A 2F90A 4G25A 3WYAA 4DA0A 5BP7A 2HFKA 3OHMA 5K0CA 2GZSA 1U1EA 1YZYA 3F5MA 3FLBA 3EGXB 4JSYA 4OAPA 3UXYA 5JG7A 3W6UA 3K0SA 3TOZA 1PJ8A 5KCZA 5CDSA 1HE2A 5DFAA 3M5CA 4ZPJA 3A6LA 3FCOA 2EATA 1ESMA 3FETA 1E7QA 4KB5A 3QK7A 4QYMA 1WXQA 1GZ5A 1CUIA 5BQXA 2BGWA 3TCNA 3AMVA 3NPMA 2JGDA 3EVCA 4O25A 4RVSA 1QQAA 2W42A 2D2FA 3K6SA 4Q93A 1BH2A 3PUKA 1ZD4A 3B1XA 3M3DA 3NTXA 3Q7PA 1X6VA 2B36A 4LV6A 4Z54A 3PQFA 4XQGA 4C4PA 4HAXA 5BVGA 3UAYA 5FTLA 1GZ7A 1RHMA 4WGFA 4ENUA 4XWGA 1JR4A 2Q5OA 3HSSA 1FFYA 3F7NA 3E58A 1RSZA 2JLCA 3FWYA 3PJFA 4R1QA 5GJCA 1MD9A 4HAVA 3SBEA 4HJRA 3THXA 1KMCA 2V9PA 3F7OA 1XMQB 3FSGD 4ZYUA 4LXTA 2H3HA 4KKVA 2DFLA 3GUVA 4RGBA 1I2BA 3IUSA 3PFNA 3EW9A 2WDZA 3V1KA 4OK5A 2WJYA 1GARA 3A05A 4D81A 2CT8A 4N41A 5K8TA 1FFXA 1C9MA 1E2PA 4KACA 1XDWA 2Z4TA 4NVRA 5K0EA 5JS6A 2ZB7A 3LQ2A 5AVZA 3QBJA 3VPDA 3FROA 4AP9A 4BRZA 1SPXA 3WWPA 1P72A 2Y0CA 5KYXB 1YDWA 2FSFA 5IANA 2WKSA 3KO8A 4NU0A 3ENQA 1O8BA 2UYQA 3VHQA 2FEWB 4RMNA 2RHBA 4AUKA 4BZZA 1MAWA 1Z28A 1KPIA 4OI4A 2C2HA 2IYWA 2BGJA 5EOVA 4WEOA 3TNLA 1V37A 3E3OA 4EMBA 2WM9B 1T9DA 2B2XA 2PV0A 1SGWA 3VC3A 2AIRA 2CNLA 2AX4A 1I2DA 1YDEA 1T3HA 3L40A 1M75A 1QQTA 3COYA 4MLZA 4NU6A 4QFMA 4DMUB 1XKLA 2B0JA 1YV9A 1V41E 1PWXA 2JATA 3F98A 2GAIA 3GGSA 4MUBA 2WU1A 5IMBA 1KVTA 1SEVA 1B26A 4V1CB 2DKOA 2BCGY 3VR2A 1PJ4A 2QP3A 1KO7A 1I7NA 1UJ5A 2VATA 4N7BA 2JFZA 3EY9A 1UBCA 2A9JA 3TR5A 1RJ9B 1XXHA 2I99A 4UDNA 4BO8A 2IOFA 1P2GA 4KFTA 4HFMA 3DD5A 1W1IA 1IM5A 2I66A 4FHCA 4L4XA 3KHTA 1MQSA 1M34E 2F4NA 4KO4S 2IA5A 2VC2B 4F8JA 1GZ6A 4E2WA 1K5HA 4UOZA 3V34A 4G0ZA 2AR0A 3OSUA 2EX1A 5ECGC 2ZRQA 2PMDA 2O2YA 2E4ZA 3CY6A 1PYDA 3WTBA 1I0ZA 4RPKA 1H3EA 4F12A 2WF6A 1QYCA 2OV1A 2P5SA 2VNSA 3GGJA 2X1MA 4EYGA 1F12A 1Y3IA 5COQA 4BNYA 1NL3A 3THYB 3EXG1 1NDUA 1M1NA 4CE6A 2HCBA 4WK0B 5I9NA 1BEZA 1UP6A 1EKXA 3QPVA 1AVTA 2I54A 2ZULA 2WYIA 3CEHA 3GLUA 4RETA 4RM3A 1JDBC 2ZRKA 4JLSA 5CU7A 5U1PA 4XSHA 4DRYA 4DV5B 1OWNA 5B6PA 4H4EA 2IZ6A 2HH9A 1PL8A 3OLQA 1PZGA 4RULA 4LVCA 2DFDA 2O20A 5T4EA 4J9VA 1N0HA 2YV3A 3ANXA 1NYRA 2VKQA 1QPGA 3HDGA 3MZ0A 3OZRA 5GWXA 2W98A 3ZD9A 5K8CA 1PJZA 1QNFA 1XZBA 3I9V1 4TT3A 4OREX 3RUPA 4BO5A 3CUSA 4M86A 3PDIB 4S1VA 1UOOA 1H94A 3GGPA 4G5YA 3WNBA 3KV3O 1F8UA 4DWWA 2P65A 2QX7A 3CT6A 3OAAA 4UBLA 5IKEA 5GINE 2Y9PB 3V4ZA 2FGJA 3SU8A 1YQTA 2YN0A 3CKKA 4IXMA 3VZBA 3QVMA 4CIAA 3FSEA 3WO1A 4NJMB 1C9JA 4ZVTA 4DVGA 4F6LA 4O4LB 1G6HA 3E0QA 1CUZA 1BDMA 1R6UA 2I78A 3FFBA 2KX7A 1KBZA 2D62A 2XOEA 4KW7A 1F8XA 4LJ6A 5IEBA 1FJXA 2G71A 4HGOA 5ICSA 1PLJA 3SX4A 4CDRA 2P5YA 1DKQA 1CQJB 1E3WA 1M10A 2IITA 1ZH0A 2V74B 2EFHB 2ZJ3A 4NL4H 3PEYA 1RAFA 1I5OA 4Q19A 1U80A 2XUZA 3HWX1 4GX5A 5CGZA 4V3BA 5G53C 3H2ZA 1G3MA 1AV6A 4PTLA 3OZXA 5CEFA 3WNDA 4LIPD 3GFSA 2QY9A 4R3NA 1DMRA 2RHHA 2OESA 3F6SA 2HDNB 1NXTA 1FLAA 1G16A 1W0JA 3GWZA 3LFHA 2QD1A 4GECA 3V33A 3O92A 3ZWPA 3I58A 3FSJX 4I1PA 3A6PC 3BQMB 2IIBA 4HZUB 5FAKA 4YCBA 3TPFA 2JRCA 4C3OB 3TUZC 3SBOA 2QN3A 4IKOA 1L8AA 2FYTA 3ANSA 3N2KA 4RFVA 1J0EA 2Q7OE 1E1YA 3V8VA 1SURA 2BT4A 5K3AA 1CF4A 3VNAA 5T64A 3TL6A 1N5DA 2W6MA 3HYRA 1X7YA 3O9ZA 2LDXA 4UNIA 5CNJA 3I37X 1RWPA 5KYWA 2IC5A 3A3YA 1I6WA 1GA6A 1M34B 3UW3A 1YOBA 3CH4B 4ARAA 2LPMA 1QJ4A 3I5UA 4ZZ0A 4FDMA 2HU7A 2F4VB 4C7JA 4JVOA 3CW2A 4JUDX 3L41A 3OZVA 2Y0BA 5KOYA 1DCFA 1C1YA 2AOVA 5CVJA 5F7JA 1T1RA 4WV3A 4M8KA 2BFAA 2NVUB 2H2DA 1USIA 1T9GS 2QL9A 4RY2A 3ABOB 1T9AA 1E6WA 3EEBA 2P62A 3V2HA 3C3DA 5A9SA 5BVHB 5AVSA 4FJ0A 4RSHA 1U2ZA 3E9CA 2HRBA 3AKCA 4PHHA 3H0KA 3ORQA 4LBWA 4Y2RA 1E2MA 3BIWA 4MW4A 2JCGA 2X0DA 1P2FA 4V0RA 3GLGB 4YHBA 3PFIA 3RYFB 1K7YA 4X6XA 3D7LA 4N40A 5B5SA 4IUYA 2VZ9A 3TEJA 1BEUB 1V1RB 3T95A 1MG5A 2DQKA 2DUUA 2X8JB 4M7PA 4WI1A 3BHMA 3WBFA 5ERXA 1B4DA 2BKEA 2Q2VA 3SXPA 1Z2OX 3KZOA 5JH7F 3GELA 2JIBA 2IYLD 4G2TA 1MMFB 4DUGA 2XOKD 1QG2A 3CO5A 3R6WA 3QHPA 3X2SA 4HLNA 3QU2A 4R8SA 4U7HA 2HPZA 1WUJS 4NBTA 2WHYA 1NTOA 6ABPA 4BDTA 2MWMA 2E9SA 2OHFA 2DQ4A 4RWEA 2G82A 2WJGA 3OECA 1EXWA 1CRZA 5D3KA 2A0UA 1QHHA 2H0QA 3H9CA 2Q1TA 2QAGA 4I3GA 4KIUA 5AT1A 1Q44A 4KVAA 3DFKA 2ZBPA 5FCDA 4PQFA 3SKXA 1SKBA 2YIMA 4EPXA 3AESB 4JB2A 2ZI9A 3IEMA 1X8LA 1MOSA 1NQAO 5AHRA 4BB5A 3ZYZA 1DKMA 2W6IA 5YASA 4D25A 2PT6A 3BXEA 5IFKA 1SZCA 1D4AA 4D2IA 1JI3A 3TLJA 3R0IA 2X6RA 3VHXB 2IL1A 1ADJA 2R1TA 4RELA 2IEAA 1H1TA 3CVXA 4LDNA 1RKBA 1XMPA 3PCTA 1M7GA 1XF1A 1H2RS 1NJSA 3M6IA 2GA9A 3K0FB 2R79A 3KPYA 2BAGA 3P4XA 3HLTA 1I3NA 1IHOA 1M2JA 2VBFA 3C5HA 3Q1LA 4JROA 5F64A 3SC6A 4X85A 3EMVA 3P0EA 4UHKA 2N46A 3LWZA 5AKZA 3PDCA 3QG5A 4RKQA 3JWEA 1ILWA 1LSOA 2XADA 1UT6A 2L69A 2QVYX 3QW2A 1SVUA 4HEHA 4YAIA 1C2TA 3UWMA 2QTLA 4HEA6 1UBTS 3LDAA 2IU4A 4EY8A 2NV0A 3EFBA 1H2HA 3EGEA 5K3FB 2Y1OA 1CUVA 3JPYA 4GX0A 1VIAA 1Y48E 1YZUA 3TTXA 5AOBA 2LV8A 3UMCA 1P3Y1 2C7PA 3UA4A 2FKAA 1W2WB 4N48A 2BV3A 2J8ZA 1AKVA 3YASA 3TIVA 1RADA 3DVSX 2D7CA 4H3KB 3WA7A 1LNZA 2F62A 2CL5A 2JJYA 4N54A 5EIFA 5IVIA 4F38A 5CBKA 4OBBA 5FUXA 1QANA 1FSFA 5DGXA 2C7RA 1GCIA 2AYXA 3UMYA 2ZWAA 4WZZA 1X3LA 2M98A 1A27A 5BQ5A 3ZXIA 4DCMA 1RAGA 3NVDA 3JQFC 2FQ1A 3AQIA 3LUAA 5E7QA 4W9MC 5KWVA 4H6VA 2ERXA 2HZBA 2C4KA 4YTEA 4LJRA 3W1VA 5K0ZA 3Q12A 4JBYA 4KHZA 4I9GA 5JBQA 2F9LA 3HKBB 2Z04A 4E12A 4F93B 5GIOE 3BFJA 2PLAA 4RABA 2Y76A 1H1LA 3K9WA 2M1XA 3OCZA 1U4NA 2DLNA 5DU2A 1TXGA 2Y92A 3QPBA 2ZZMA 1F0NA 1RVDA 4BNHA 2BTQB 2DWPA 4IIJF 5I8ZA 3V7YA 2BFEB 3FOZA 2J0SA 2H1CA 5DH9A 2XE7A 5AHKA 1T4MA 1YBHA 5A3JA 2W4QA 2DM6A 5EL0A 1OASA 3KTFA 5A4DA 5B64A 3WK8A 4EL5A 4JT9A 4YPOA 4HNRA 4B44A 1L5SA 3UC9A 1A98A 1B1CA 1DADA 5HR5A 1U9ZA 3MGKA 4CMBA 1D0VA 4V0ME 3NGMA 3TAUA 3ESRA 2WJ4A 3IUNA 3VDNB 3VR4D 1DX6A 4HQFA 3ZK9A 4BTVA 4E7OA 2VQSA 4ZXPA 4OY3A 2J3DA 1PJRA 4DLYA 4YMHA 1PJTA 1E8NA 1UK8A 4X7PA 3RBZA 2HL6A 4IW3B 2A9OA 2V97A 1EXNA 1E64A 1H9AA 2G0AA 4I99A 4EUSA 4NAVA 1RC8A 1DCKA 1PJBA 5AICA 3GUYA 4TYQA 5TVGA 5BUSA 1GHTA 4J2HA 4QOFA 5LD2C 2UXCB 1ZI9A 3C2QA 3L4BA 4QPJC 1YVRA 1Z0AA 3O2SB 1KOGA 1XU7A 1IHUA 1OX4B 1Q91A 4LWPA 1L4FA 3AFNA 4G23A 4YAGA 4YRMA 1QYXA 4ZTBA 3G49A 4IDFA 4IDEA 4U6SA 5GONF 1KEZA 2VK4A 1P1JA 4EHNA 4R2LA 3SQXA 1TPYA 1U8YA 5DNUA 1SKYE 4RF3A 4B3RB 2FPUA 1TUBA 1NBWB 1QSGA 2QRVB 2HMWA 2XX3A 2PIDA 3IUPA 1NLFA 1J2EA 1JKXA 1KY5A 2GXAA 5CW2A 5H8WA 4QDXA 1M2EA 4RGVA 5EWLB 1QCZA 1OLXA 3NS7A 4K0RA 3QNUA 1CUGA 4ML3A 1K5DA 5H3LA 4AN4A 3ER8A 3GQVA 2XNCA 1KI1A 2GUGA 4GUAA 1YS1X 1FW8A 2ZT6A 1I9GA 2RKWA 1WQ3A 4RFLA 4YRQA 1NXWA 5DNCA 5HBRA 3V55A 5SZIA 4DQXA 2BDEA 2JHAA 3ETLA 4DE5A 2OCXA 3UXHA 1BGXT 3TW8B 4WA8A 4H7PA 1NBIA 1Z88A 4QSHA 4EBFA 3NHPA 5A4IS 1NW4A 2C61A 4L4YA 4LHYA 1MB0A 1UXHA 2H0AA 1TGYA 1QH0A 1QZZA 1U8AA 1P9NA 4YONB 2F9MA 2VP0A 2VP5A 2WU8A 4E4TA 2QGNA 3D4BA 4P22A 3MAAC 2FPWA 2X8AA 5JMPA 5KPJA 1NY6A 4NDZA 4E6PA 3O8CA 5C7OO 3CVVA 3B60A 1W75A 3TNJA 4B6RA 4DLKA 2GZAA 4C29A 1GUZA 4NKRA 4D0LB 5K6AA 1UK9A 5E3HA 3LVQE 3QI7A 3TWOA 4I6JA 2QRZA 1M5UA 3AEUB 4I81A 1D1SA 1AF7A 2ERYA 3OUUA 3L7LA 4AW9A 4DTIA 5B2EA 1MIOB 3BTUA 4X91A 2ZBEA 1CDZA 2Y27A 1S2NA 5CT5A 4W82A 4C9BA 4RLSA 3D6MA 2CMKA 2FMHA 5LZ7A 2FAXA 1TDJA 1ULSA 2D5IA 2ONYA 2DEUA 4KJZA 4O5OA 4OU5A 2VHUA 2ZANA 4J7CA 2WM8A 3OO0A 2HO4A 2WP8J 4JELA 3F9CA 5DRYA 4KC0A 2PQ6A 1LC0A 4FT2A 1DEHA 1K6IA 1NULA 3VDQA 2ACWA 2GTPA 1OXKB 3EFOB 3MT0A 3WJ2A 2CF6A 1VHDA 4F5YA 3H4VA 1KMHB 4KXWA 1T5IA 1MQ8B 1USUA 2OGZA 3FYCA 1T2UA 2A1UB 1BW9B 1GNLA 1P0IA 2Z08A 4WASA 1X2BA 5FPSA 1G17A 2DT8A 1Y4AE 4ZVSA 2RE8A 5T5QA 4G0WA 3GFTA 4OSEA 5DBHX 3RAGA 3O8LA 1SH7A 4LQCA 5T7BA 1OH7A 1DC8A 3V1LA 4QXMA 4A8JC 2R85A 1LCIA 5KTSA 3ITDA 4FKBA 4MGZR 3O8QB 1FL9A 4UVGA 1M8JA 2Q4OA 3EMKA 5CVVA 5BRNA 4AZTA 1CVIA 3KNZA 4Q4JB 4YP0A 3SYNA 1R8YA 3VHLB 1SOAA 2GNPA 4JLUA 2JGNA 3KSMA 3Q72A 3SM9A 3VR3D 4CIWA 5JDCC 3UGKA 1AGYA 1FX1A 4ACAA 4BJ6A 1WY5A 2ZR9A 4F2WA 1WHTB 2DHRA 5CPBA 4RKEA 3BE8A 5C5CA 2UZ4A 1XN4A 3D0KA 4FDVA 4NS1A 1YB5A 2CHVA 1IHDA 5FJJA 3D59A 1GZVA 3FLMA 3BT7A 2A86A 1Z6ZA 2NU6B 2QX9A 2PZBA 3DLCA 3ON5A 4OI2A 3LUHA 3WLEA 4B85A 2I9KA 1D2RA 2CUKA 2Z1DA 3ANYB 4HPWA 2DU8A 4FZVA 1CW2B 5I7AA 3IAXA 4MR8A 1C80A 1VBMA 2HNBA 1EFKA 1SQ6A 2YYSA 4I46A 1NNSA 3LHIA 5BMVF 2XVYA 3QM1A 3SK0A 2PX5A 1QH9A 5HIIA 3PF9A 4X5OA 5BOSB 2YY5A 2QQEA 4ZALA 5I4KA 1P80A 5TEVA 4PC6A 1QHFA 2JANA 3EASA 1BVHA 2IDZA 3TUJC 2E7ZA 3KOYA 5C81A 1O57A 2CJYA 4ID3A 4AQDA 1WBDA 1XEWX 2ZOSA 1M2VB 2I03A 4BQSA 1G98A 1Z7YA 2R96A 1ZISA 4IFIA 1LBSA 1T0IA 3G1WA 4OLBA 5IBPA 1NJ8A 3M2PA 5KAPA 2IEBA 2JASA 3V1TC 4YMTA 3GH3A 3VO9A 4XOUA 2Q27A 4B5LA 1QGZA 1TTQB 3UJAA 4CQNA 3AKYA 5DTEA 1AKWA 4HYQA 5COBA 4MPDA 3TI9A 3GJXC 3WKDA 4DA6A 3JQGA 4CM8A 2VAMA 4KZKA 1PNTA 3BWXA 4PX5A 5FOQA 4R68A 2NQ8A 2PNJA 2Y2UA 1QIIA 3ZDEA 4DC9A 2WP0A 3DVQX 3ROKA 1X1SA 2F48A 2NUAB 4NJMA 3F96A 3RWOA 2PU5A 4OQXA 2R97A 1ISGA 4IUCS 2QUAA 2WWIA 4LVOA 2YYZA 2W2XA 5A5GA 4M1EA 1HKHA 2IXFA 3D31A 1YIDA 1NW8A 3FKJA 4P5DA 3SYTA 4E51A 4P36A 4B4DA 2GJSA 2Y8EA 4FX5A 5BV7A 5LVAA 3QU4A 3BULA 2OCIA 3T3HA 3WX0A 3NEPX 3ZWXA 2Z6UA 2FMKA 3MJTA 3LUKA 3ZD8A 3RSQA 2XBUA 2XUFA 3I5MA 1ACLA 4FGLA 2WWTA 5BSMA 2I0FA 4JIGA 5DI3B 5K8VA 1THTA 1NBEA 3L6CA 1WZEA 4G0NA 2WMNB 4N3AA 2X14A 4ZT3A 1PE0A 2WOOA 1G41A 2VPXA 4Q9NA 3WGGA 2QL6A 3UKOA 2VWQA 1UXKA 3S2SA 3C3PA 1PTJC 4NK5A 4WLUA 4D0SA 1UPFA 1IDOA 2XOKA 3I2JA 3JZDA 5CA1F 1W85A 2OEPA 4EQ6B 5HE9A 5BNZA 3DDCA 3PR3A 1IN8A 1JJAA 2C42A 4RJIA 1ZGBA 3GJ3A 2DQYA 1RXYA 3LZ6A 3D64A 4B3BA 2H3EA 1EFPB 4FXOA 4JLJA 4W9NA 4Z4FA 4EFLA 1DKRA 3KBOA 3VU8A 1Z33A 4EKEA 3GNLA 1VPEA 1AXEA 2VZ0A 2DR2A 5A5DA 5DYWA 4CXMA 1SIWA 2FFRA 5E9JA 4U0JA 5EE5B 2WTEA 3JAWB 5B7PA 1JEYB 2XUPA 3P7MA 4IOKA 5IBRA 5LIPA 2B1QA 1EZ1A 2X19A 3ADBA 3T7TA 4N0QA 2B4QA 1YZQA 3C3JA 1DRUA 3SR3A 1CUFA 1TMKA 2SKDA 5I7VA 1CQIA 5E1OA 3USZA 3N2NA 2QHXA 3LAWA 2NZJA 3BXHA 1CDOA 2IHVA 3N2YA 4KG7A 2GEUA 4ND2A 3T3IA 2O8BA 3MHPA 3LNCA 4LRUA 4F4FA 4GQAA 4TVKA 4RFSB 5J9FA 2V9CA 2VRCD 4C2AA 3A1CA 1DINA 4QXAA 4G2NA 2RH5A 1HNXB 4O4IF 2C5LA 4AMVA 3O3OB 2C84A 2X23A 4L8VA 4MOWA 3PIRA 1TUEA 3T8YA 5BWNA 1NBMD 1YFLA 1UXJA 3CH5A 4BCDA 3CW9A 3O73A 1QZUA 1SULA 1XCMA 1ZX1A 2D1SA 1G9TA 2VS1A 2X9GA 4MSUA 5FBQB 3X3HA 2XNHA 4C14A 4HVLA 1PX0A 4HDQB 1ZVKA 3DPSA 4E08A 1ST3A 1BD4A 2DKNA 3AONB 4PO3X 4YROA 3WKBA 2O7QA 5C7LO 5IAOA 2B1IA 2OM2A 2XHEA 5IU6A 1EX1A 1YIAA 1S9HA 3BWDD 3S8EA 1PDWA 1XEAA 5CXXA 3ZBPA 1H5QA 3AW9A 1TVMA 2CMGA 3LIPA 5FLKA 4BX9A 4M55A 4R6WA 1TCAA 1F1BA 2JJ1D 2FX2A 2J46A 3G8YA 1VCMA 3L84A 2BI7A 3P9ZA 3IPCA 4K3VA 1DV1A 3A4NA 4MVJA 4FYHA 2VDNB 4QUIA 4UVHA 2ZUSA 4HQOA 4LWZA 4OI0A 1PJCA 3A10A 3HJHA 5I4CA 4S0ZA 3GLIB 1KSJA 2WHXA 5CDGA 3LMKA 3BK1A 1VPTA 4B9AA 2A5YB 2A35A 1BX1A 2WYOA 4KN8A 3OEHA 4G8BA 1AQUA 2AZ4A 1DXOA 2R4QA 4WOPA 4FMCB 1JDUA 3D0OA 2DUJA 2YHSA 4B6PA 1CR0A 1IBRA 2XUHA 1DDOA 3VU3A 1JR3E 4A8JB 4ONEA 4JI3B 3GPLA 4Q9IA 1N7HA 4LZOA 3LSYA 1P9WA 4RLFA 3S68A 1ZCBA 3FMOB 4DDVA 5BWBA 1J1ZA 3TPZA 1AH2A 3E8XA 1AZSC 1FDRA 3EH1A 1QZXA 1TCVA 5EC8A 4WUTA 2AQKA 2H06A 2QIOA 1S5PA 1GAWA 3IVCA 4DLXA 1Z36A 2XNSA 2FP4A 4X3OA 4JHXA 3RT7A 4ARZA 3EY4A 5G1OA 5C4IA 5CXSA 5F73A 3ZE9A 2QSZA 3A9UA 2AGVA 2NO9A 3NZEA 3HFJA 2FV8A 4PQRA 4YJ2F 2RH9B 5DCWA 4ZC1A 4EO9A 2D1QA 2Q50A 4XPZA 5CAEA 1JPNA 3FF1A 1BQEA 3GCXA 4QQRA 4JI5B 2R7AA 3G0BA 3R7DA 2W2OA 3HKDB 3RBVA 4ITVA 4BPRA 4R71A 1D1QA 3EB9A 4ZI7B 3AL3A 4R9VA 4U63A 3GRZA 2XSZA 2X9LA 2FEAA 1CQIB 1EYZA 1T3GA 4LOAA 4P2BA 3DEJA 3G13A 1XZGA 2ZE5A 3V9PA 4FXPA 3ZH2A 1JHXA 2QP9X 4KXVA 3DOFA 1OXTA 2C57A 3PYMA 5TE9A 5M34A 1SWVA 1IQPA 3V97A 2C04A 4FN5A 3VTKA 5CFNA 4NE9A 1M6WA 2AXQA 3SKVA 2RGDA 1VA5A 4GYYA 3HZHA 3A26A 5BV8A 1Y7TA 2NVBA 2BFOA 1RXEA 2FPMA 4Y9DA 4JD5A 2ZDHA 3NTUA 2QE6A 1F0KA 5FWXA 1O87A 1WHSB 1ZR4A 5G0VA 2EP7A 1H3FA 3WC4A 1BZYA 3MMSA 2GZ1A 3GRCA 5EKUA 4X44A 1JYEA 2C9YA 1D4OA 1UZLA 4IICA 2DC1A 3CPSA 5KJEA 1I2CA 2IUUA 1QFZA 1DV2A 4FFOA 2Q28A 3B9PA 4DXDA 3GLGE 1R5JA 1NQXA 2QAGC 4YMVA 1F5SA 1EJ0A 1NT2A 3RARA 3BL5A 4Z5XA 3LKZA 1KI6B 2WICA 1R4MA 1P91A 3DP7A 4K03A 1YDGA 1MO4A 3QLVA 1XJQA 3LLSA 1EUQA 1U4SA 2X1VA 3UJDA 4HS9A 1YFJA 1JNYA 4Q03A 2WIJA 4XUEA 3A4VA 3BGIA 4XM1A 1AT1A 1JV2B 4YRSA 5G3ZA 3MPUA 1E1QD 4GC5A 1D2GA 2NAPA 1UBRS 2VSYA 5LZ9A 2R6CA 1NU8A 1PBTA 1KEWA 1CULC 1GUBA 1Z6TA 4LMPA 4O2BB 1SBNE 3I53A 1TA4A 3K1ZA 4KL8S 2GCOB 1OU0A 3CFYA 2I80A 3A32A 1Z4PX 4KAJA 2F3QA 4QEZA 1HDCA 5FNVF 3RT1A 4YP9A 2GN1A 1ONOA 2OUKA 5JADA 1MHTA 1ZN2A 1YMUA 3IB6A 4N4AA 1DQNA 5TLSA 4L1KA 4BTEA 2EL7A 2BFFA 1CUDA 1Y80A 3AV3A 2BGIA 2WIKA 3NVMB 3LIIA 2NUTA 3ZKWB 3WRVA 1GD1O 4J16A 4U2EA 3ZGXA 4O63O 2XB6A 4TWBA 4N3CA 2VJMB 3UG7A 4MV9A 1CU1A 4O2RA 1ZL0A 2PZ8A 1C0LA 3GLRA 1UH5A 2WAAA 4I55B 4FJ1A 4BQRA 4CYMA 2VTDA 5EHXA 5AVTA 1TM1E 4HDSB 3A6FA 3TRHA 4KYUA 3ROTA 3B3QA 4Q7JB 3HHPA 4LJSA 4WQMA 1IY1A 3LX4A 4AJ2A 4OHRA 3AG5A 3I39X 5E4JA 2IS4A 1GCAA 1SCUB 1KC3A 1XJCA 4U4AA 3TG8A 4UOQA 1JDVA 3AETA 5CA1B 4H16A 4MGKR 3ZY6A 2RSLA 5IC5A 3GZNB 1JQ3A 5ITZB 3M4NA 3L0OA 4FYIA 5DIFA 2FUG6 3LCUA 1YMQA 2O3SA 1EWVA 1E7MA 5FL3A 4IV5A 3E84A 2I1QA 3GVHA 4FFVA 3RVSA 1MT3A 4TWAA 5FEUA 1O77A 3D5QA 1EX7A 3WB0A 1Z4LA 3KAJA 4W99A 2B6NA 3UAWA 4DNPA 4IIBA 1UDXA 4NU5A 4EJ2A 4WWHA 1B1AA 1A9PA 4XB6B 3KB8A 4D7AA 2Z5LA 3CG4A 4KGDA 3PNOA 2X77A 3SHWA 1M2OB 1G8HA 3J80A 3K4HA 1FW6A 1KJJA 4P7JA 1PFQA 3B53X 3JQ7A 1C7EA 2ZJ2A 5IVKA 2OCGA 1R88A 1GAJA 2H2AA 2R11A 3QEMB 3C24A 3ZCRA 2AV6A 3B5EA 5B2ZA 5MHTA 3UJNA 1PV4A 3K8QA 2C29D 4RQAA 5EJIA 2HW8A 3K32A 4QNNA 2ZR7A 3Q3EA 5EQJB 1P9OA 1AZLA 2WWGA 5SZHB 3V8RA 4QO7A 2X0FA 1T4DA 2WD9A 3P2OA 3CSDA 2PGLA 2Z57A 4GXTA 3GCGA 2JLWA 1ZBDA 4TT3D 4U2DA 1GG5A 4Y1EA 5J1TB 1NP7A 3W8FA 4DCJA 1KMHA 3CLTD 4IIEA 2QT0A 1LS1A 3S2YA 3HJRA 1E8MA 1GQYA 2J48A 3F71A 3QTLA 2VF8A 3KYJB 3QXXA 5CIWA 3H0CA 1WMEA 3H7AA 4BFYA 3BRSA 5CUQA 3ZX4A 1VMAA 1SQGA 1UINA 2I29A 1JZTA 1Z2PX 2D5AA 1EVIA 1JTFA 2AE2A 1JPUA 2C2MA 4P2GA 4BAUA 1NPYA 3AIIA 1IQ0A 3BJMA 5GJVC 4CIYA 3A70A 3O8QA 2LBPA 5H7XA 4F3YA 3H2HA 1HFJA 1DB3A 5JJLA 4KQMA 5AKXA 4PINA 4RPJA 4IOMA 5FADA 4E3WA 1FX0B 3UJ3X 3P97A 4IJVA 4CM7A 1HORA 3ASUA 5EJMA 1L0BA 1B6TA 3UJ9A 2D5LA 3L0IB 3P9CA 4ER7A 5LXTA 3QA9A 2NYVA 2QUZA 2A1TS 2HBRA 2CFOA 3M6WA 3S6JA 1EM8A 5AVYA 1BWQA 4WW0A 4R7GA 2IYRA 2IH2A 3HGMA 4CUZA 3CEAA 2WW8A 3E15A 5A2GA 3TR0A 5ULLA 4K86A 4YJ3F 3U7QA 2WAYA 5IWCA 2P91A 2ZYHA 2V96A 3VDRA 1ZL2A 3HVUA 4GP6A 1FQKA 1L6RA 3AVTA 2JJ8A 1IVYA 2J32A 4X63A 1OAOA 1YRBA 2D4AA 1YL5A 5HFNA 1PNQA 3IQHX 1EUDA 3ICOA 2LUOA 4FNMA 4R2JA 1HBJA 3D4LA 1PZXA 3VU1A 3PEVA 5M29A 1NBMA 1SD1A 5DOZA 1JU9A 2G1KA 3E70C 2DBRA 3BFXA 1Q0ZA 1M54A 4ROTA 4UULA 2OGSA 1VLVA 4ZEMA 3LPLA 5J2TB 2BBTA 1Y0BA 4V0QA 2EGUA 4KR2A 5IUKC 5KNCH 4ZT6A 5KSWB 4JY7A 4FB5A 3SYMA 2OILA 3GJ4A 1QRSA 2A5FA 4D41A 2HU2A 2V0GA 3LWNA 5KWSA 4W8OA 5KNCD 4HGQA 1A5TA 3ZE8A 4LBZA 3TW0A 5JEEA 1OAAA 4HNQA 4XPIB 2GNAA 3N07A 3C39A 5LZ2A 1JDPA 4HT3B 5K6AC 5CA0F 1EHIA 2EF1A 2ADFA 2FFBA 3P0IA 3EQ9A 3VBEA 4HMQA 4HB2A 4COOA 3UFXA 1DQSA 4C0HA 4GPD1 4WLEA 4MRNA 1TO6A 4KR3A 1JFLA 2DR3A 1D07A 4MRMB 4GAEA 4DB2A 1K7SN 3UK1A 2ZSIA 3AP1A 3WWDA 2G4CA 4DF3A 1XZPA 1XZLA 4S0XA 1OWOA 5CVUA 1D1PA 3OY7A 1QLWA 3PICA 4RKRA 3IB3A 3LF1A 3CB4A 2Q45A 1VYHA 4R9RA 5BNFA 1JVBA 3RYTC 1IUNA 4BAZA 4PGFA 4U6NA 4BVLA 3T0IA 1W47A 2PPLA 1VGVA 2JHCA 2JD0A 3KKLA 3DBLB 5IKPA 1M5RA 1IG0A 1WXWA 2Z56A 3LC7O 3WGNA 1UM9B 2H29A 1LV7A 1U9IA 5L51A 3IE2A 1Z38A 2IUSA 1Y4SA 1OXSC 4OYRA 3UATA 3OP1A 1PEKE 1R5NA 5BYAA 3IHLA 4D98A 3TECE 3AHIA 2J5BA 3B38A 3AK4A 4GQIA 5DXAA 3SZLA 3I3OA 2R6JA 1X7DA 1KHTA 4GLJA 2ZXUA 3I2HA 5KKCA 2QGZA 4HRYA 1QGUB 1R6VA 5P21A 4EW2A 1EM8B 5JDCA 1ZGHA 3AGQA 5CHYA 2PRZA 3ETJA 3KQMA 4II3A 5IAEA 5PGMA 4LF4B 4D4GA 1DRKA 2ZWPA 3PQCA 1SC6A 3C4QA 3EG9A 4GWKA 4NONA 3GB9A 4WNCA 5FHQA 5DO9A 1QAQA 1E7RA 2B4AA 2F64A 1H1DA 3KIPA 4P81A 4WY5A 3RU2A 4B84A 1E8DA 1RLMA 5ADHA 4J0DA 4FSXA 2WZDA 1ZOIA 2CJPA 1I4TD 4FE7A 3SAJA 5EWJA 1YJAA 2G70A 3HCBA 1EAYA 2GZRA 3OU6A 4LZNA 4OMDA 4PRLA 5JH7B 1QFYA 5L3RA 4DQLA 4J1TC 2VDPB 3ZXSA 2VEDA 5EIHA 4G8DA 2C0PA 5JRJA 2GHQA 1Q6YA 3VJRA 2JAWA 2FWJA 3HNOA 4WNIA 1SQ0A 1N2IA 3CUVA 2A5LA 2FZEA 3IR6A 3SC2A 4C0LA 4CG3A 1SHLA 5LYJB 1R9GA 4AQYB 3ZJVA 1RIFA 4EHKA 3WDLA 2ATIA 3N7AA 4DJEC 2QL7A 3KLPX 1M1YB 2LKDA 3IR7A 2ZTLA 5HIJA 3CU5A 1ZAKA 2Z4SA 2IZZA 4WZBB 1BD3A 2JLYA 1THGA 3I6BA 2DB3A 2P9JA