3L49A

Crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SLEGKTIGITAIGTDHDWDLKAYQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQKPDAIIEQLGNLDVLNPWLQKINDAGIPLFTVDTATPHAINNTTSNNYSIGAELALQMVADLGGKGNVLVFNGFYSVPVCKIRYDQMKYVLEAFPDVKIIEPELRDVIPNTIQSAYSNVTDMLTKYPNEGDVGAIWACWDVPMIGATQALQAAGRTDIRTYGVDGSPEFVEMVADPESPAGAVAAQQPSEIGKLAVQNVARHLAGQEVKPFTFAPAVLITKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF ABC SUGAR TRANSPORTER FROM Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transport protein
molecule keywords ABC sugar (Ribose) transporter, periplasmic substrate-bindin
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A01
3I09A 4EVSA 4F3TA 2CD7A 4KQCA 4IMIB 3C3MA 4ETMA 2FVYA 2CHFA 4MQFA 1JF8A 2QXYA 3O1HB 1U0SY 3DGFC 4OBBA 4DN6A 1GUDA 2I6FA 3GRCA 5HSGA 1MAVA 4E7OA 1U8TA 2HPHA 3O21A 3MA0A 1QO0A 3NNDA 3EGCA 5IUJC 3RVPA 1RZRA 1RPJA 3HVRA 1L5ZA 3C3WA 3OQOA 3LUFA 3FFXA 3LUGA 3M9XA 3L49A 3FFTA 3O1JC 4YGXB 4JASB 4Z4GA 2QVCA 1RXEA 2FEPA 3LUJA 4RZSA 4EUKA 1SXGA 1JWLA 1USIA 2E4XA 2PAFA 2QW1A 2X7XA 4OATA 5FWYA 1USGA 1PNTA 3O75A 4RXUA 3CS3A 5JNWA 3CFYA 4F8JA 1JBEA 1DRJA 1QPZA 5EWLB 1JFTA 1EAYA 4MLDA 4KK3A 1EHCA 3C97A 4D6YA 2R48A 3KYJB 1E6LA 1H9CA 2LP4Y 1P2FA 2LUOA 5DCLA 1GUBA 2R47A 1LBIA 3LUCA 2FW0A 4IGAA 1M5UA 4PZ0A 5JS2A 4EYQA 2PE5A 4F11A 3H5VA 1ZH2A 3DBIA 1DRKA 5ED4A 2LPMA 3QLVC 4G0ZA 1CYEA 1JFVA 3LUKA 1KMIY 2JB9A 2QZJA 3EODA 4RY0A 5CNIA 3RVJA 2IOYA 3CLKA 3GYBA 3LOPA 4RKRA 1BDJA 5KWSA 4KK4A 5TPWA 3EDCA 1U2QA 2AYXA 3P9YA 1A2OA 3NHZA 2Q5CA 3H5TA 3O74A 4YV7A 4N76A 4KPYA 2PL9A 3MM4A 3SM9A 3QLVA 4UHKA 5JNTA 1BVHA 4OG2A 1T34A 1OXBB 6ABPA 1MB3A 5EWJB 1YMUA 3SNKA 5FBHA 1JL3A 4EVRA 4PEVA 1JYEA 2QSJA 1DBQA 3Q7TA 5FWXB 3H5OA 4KFCA 1YIOA 4XFKA 1ABEA 1USKA 3DZDA 1YS6A 4RY9A 4RXTA 3RVMA 3OQNA 4ETIA 5BQ3A 1QP4A 1U04A 5DGCA 3HJFA 2ID7A 3O2SB 4Z4IA 1PEYA 4YWHA 2PKXA 2GWRA 3OLWA 3RVKA 2MSKA 2F8SA 4RS3A 5KQLA 4MS1B 3F73A 3M9WA 1ZGZA 1QQBA 9ABPA 4Z9BA 5B3JA 5B3JC 2E4UA 4KQ9A 3ROTA 4JA2A 3GT7A 1C0EA 2ID9A 2RGYA 1NXOA 3H1GA 2JBAB 2MSLA 4RK4A 3KHTA 4TLMB 2L18A 3DLHA 4N41A 3KCNA 4G0XA 4OTZA 4XLTA 1VKRA 2NT4A 3OO0A 4MYRA 2JVKA 3KTOA 4MR9B 5I4CA 3BRQA 1QP7A 4HYEA 3RVSA 1LJUA 2E4YA 4RK1A 4Y9TA 1BDHA 2ZAYA 4ZJPA 5D2CA 3C3KA 2HQOA 5IUKC 4YLEA 5TPZD 4DADA 3CTPA 4WUTA 3RVNA 3DGEC 5CHYA 2FMHA 1QNLA 2IPAB 2F8TA 1Z15A 1AB5A 3A0RB 5KQMA 3Q7SA 1MIHA 4RU1A 3HDGA 3GL9A 3H1FA 5KQPA 1QO0D 1D1PA 5T3YA 2PUFA 3GBPA 4PICA 1E6KA 4TLLB 2WJWA 4TN5A 1D1QA 1JX6A 3FDFA 2DRIA 3ROFA 4QYWA 3TMYA 4YCSA 2IYNA 3KSMA 1DG9A 4Z0NA 2FN8A 5DKFA 4D6XA 4W5RA 1SXIA 2XDYA 4XAQA 3IPCA 3OO1A 2WJAA 3EULA 2NUBA 5JNVA 4YO7A 4LE0A 4LE1A 4IILA 1WETA 5TPZA 3H75A 1P6QA 1ZVVA 1DBPA 2WRZA 1NXWA 1I3CA 1DBWA 2M1ZA 2WB4A 4G0YA 1JFSA 3QEMB 2FSPA 2YHAA 2AYZA 4MS4B 1J56A 5JS1A 3BILA 3B2NA 4XARA 4N0QA 3FGZA 2VUIB 4IMJB 1Z18A 2FQWA 4JB2A 4G0QA 1DCFA 2HSGA 3RVLA 4WZZA 4ZPJA 3I45A 3OM1A 4MGEA 1TLFA 3LTEA 4D74A 1YK0A 2LIVA 1NXVA 3H1EA 3HZHA 1VRVA 1B00A 3IP6A 4KREA 4W5QA 3MYYA 2VYCA 4H60A 3UUGA 4WXMA 5HM6A 3IP5A 4M88A 4S05A 3IP9A 1PHRA 3EAFA 3OLYA 3HCWA 3A0UA 4ML3A 4L4UA 5KQGA 2FMFA 2JK1A 3C6QA 1FFGA 3H5LA 2CHEA 3CU5A 4LDAA 1RZRD 4GPAA 4H3KB 1DP4A 3F6CA 1ISRA 3OM0A 2P4UA 1VLZA 1BDIA 4NQRA 3ILHA 3JS5A 4RK0A 1ISSA 5EWLA 4L85A 2WWVD 4QICA 3HUUA 1APBA 2L2QA 2MYPA 3RVRA 4FE4A 1P8AA 1JYFA 1ZY2A 2MYUA 4G97A 4MS1A 5BRAA 1NXTA 1MB0A 4MQEA 1TMYA 2O20A 3O2JA 5EWMA 4EYGA 1TVMA 4JP1A 3S99A 1E6MA 4EVQA 5IUNC 1DCKA 1GCGA 1EWVA 4WXEA 2H0AA 3QLTA 1NATA 1DC7A 5BRJA 4OLBA 4YR7A 1XWWA 1HEYA 4RWEA 4MRMB 2GKGA 5IEJA 2OENG 1Z13A 8ABPA 1KRXA 3RVOA 4MAAA 3L6UA 5CNJA 4MR9A 4MS3B 3CRNA 2RJOA 4KZKA 2GI4A 1K68A 3N0RA 4G0OA 4RV5A 1ZITA 3CZCA 3BRSA 1JHZA 2VUHB 1FSPA 2QV0A 2JVJA 1YMVA 2ZWMA 2W42A 4TMYA 4UHJA 3CHYA 1FFWA 2L19A 1JH9A 4NICA 4PE5B 4RKQA 1Y1LA 1Z2EA 4F06A 4Z4EA 3Q9SA 1E2BA 2PLNA 5TQJA 1XHFA 3JTEA 4KRFA 2QVGA 3QX8A 3HV2A 3N8IA 3OLZA 4IRXA 3CG0A 1YVUA 5TQ0B 2FXIA 3R0JA 1L5YA 3HUTA 1Z12A 3DLBA 3LKVA 2PUEA 1SRRA 4HNQA 2A9PA 3OMWA 2IKSA 1NXPA 2PUDA 5DTEA 3GBVA 1ZGGA 3NBMA 2E4VA 1QKKA 1S8NA 3K9CA 1D4ZA 1YS7A 2FN9A 4LX8A 3LUAA 2JRLA 4Z4CA 4NCBA 5JNSA 4HNRA 4NCAA 4YS6A 3GWGA 2PMCA 3JVDA 3T38A 3BBLA 2HQBA 2L17A 4O1HA 2JBAA 3TX6A 3IPAA 1Z16A 2GX6A 4WWHA 3HS3A 1NXXA 5EWMB 2QU7A 4P98A 4KMRA 4Q6BA 3UKJA 3SQNA 5IX8A 1A04A 2QR3A 2PL1A 3OLXA 3H5IA 5KC9A 3KG2A 1BAPA 1W25A 3HDVA 1LK0A 4LZLA 2JCGA 4KV7A 1M2FA 1DZ3A 4E7PA 2TMYA 1TM2A 3LMKA 3E61A 5FBKA 1ABFA 3HK2A 1D5WA 1NY5A 1GCAA 1TJYA 3GV0A 4ZYLA 2FEKA 4MRMA 3F6PA 4Z9AA 3N6VA 4G0MA 4O5AA 1SXHA 1F51E 3UK0A 4W5TA 4MQFB 2HJ9A 2IPMA 4RK5A 2A9OA 5C5CA 4EYOA 4JB0A 7ABPA 5GQSA 5ABPA 2FMKA 2NT3A 3LFTA 2PUAA 1YK1A 4G0PA 1FQWA 1CHNA 4ETNA 5T7BA 2MSWA 1UDRA 1XHEA 3JY6A 4KNYA 1KRWA 1W9HA 1JDPA 3A3KA 5TPWB 5KC8A 3RH0A 1SD5A 4LDZA 1PEAA 2FLKA 2P9HA 3LUHA 2FMIA 4EY3A 3KLOA 3MF4A 4RSMA 3CKMA 3CNBA 2V0NA 1NXSA 2LBPA 2VK2A 3NHMA 3QEMA 4MQEB 3IP7A 2E4WA 4WT7A 1Z2DA 5TQ2B 3H6HA 1ZN2A 4GNRA 2E4ZA 3TD9A 1IIBA 2OQRA 3H5WA 4MS4A 3G1WA 1PNRA 3VNBA 3HO1A 4RK6A 4S04A 1KGSA 1K66A 1AB6A 4EYKA 3JPWA 4XASA 4N47A 3QX9A 1M2EA 3EJWA 4G86A 1ZAYA 3E3MA 3NNNA 2PJUA 3SAJA 2MYTA 1YTUA 4LRQA 5CNKA 5FWXA 3TO5A 5TQ2A 2JVIA 2NZVG 3MQ4A 4MR7A 5PNTA 3H6GA 4XXHA 4MR8A 2PUGA 3D02A 3MIZA 1P6UA 3VNAA 3G85A 3K4HA 3QLUA 3F7NA 4N03A 2IPLA 1Z25A 2RJNA 4W5NA 1VPWA 5HQJA 1Z17A 3N0WA 5F64A 4P1ZA 1Z26A 1ZHHA 4HNSA 4O1IA 3O2QB 3ILYA 4YP9A 3N75A 2MYNA 4MLCA 3HXMA 1NTRA 5EWJA 1A0OA 3N0XA 3SG0A 1QMPA 3Q15C 3SY8A 1C4WA 4Z4FA 3KJXA 1QQAA 4RK7A 4F12A 3QK7A 4FB4A 2B4AA 2M98A 1URPA 5FWYB 3M6MD 3CG4A 5TE9A 3HM9A 4EGSA 4Q7EA 3I42A 1R8JA 5CNMA 4MPTA 2FLWA 2RDMA 3Q41A 3RQIA 3HSYA 1D2AA 3OLVA 3N53A 1GLGA 2FQXA 3D8UA 2FEWB 3BREA 4RDCA 4CBVA 1FFSA 3HEBA 2FTKE 4NV3A 3O1IC 6CHYA 5JNUA 3T8YA 4Z99A 2FKAA 1LBHA 1JLKA 1CEYA 2WMYA 5GOTA 2H3HA 4RXMA 2A9QA 1M5TA 3W9SA 5C5EA 4PYRA 3LKBA 2KYRA 3QELA 3QEKA 5KI6A 5TQ0A 2B1JA 1LJLA 4N0PA 3JPYA 5JNRA 3TB6A 3LUDA 3A10A 2NZUG 2YHBA 5IC5A 4ZMSA 4W5OA 3RVQA 1ZDMA 4ZMRA 1RNLA 3CZ5A 4MR7B 1DC8A 1EWKA 1MVOA 4MR8B 3Q7RA 4QPJC 5BR1A 4Z4HA 3URMA 3IDOA 2PUBA 1RXIA 4Q6WA 3FFWA 1ZESA 4JOQA 5E3JA 1BA2A 3QELB 2A9RA 2J48A 2IDMA 5IEBA 5DLEA 4QYMA 3MMNA 1JDNA 2R25B 3FMVA 1ZH4A 4RY8A 5HKOA 4OLAA 2N9UA 4MS3A 1F4VA 3OMXA 1QP0A 1EWTA 5IBQA 3QLUC 3NNSA 2CWDA 3KS9A 5IULC 4LE2A 3I5AA 2IPNA 3KKEA 3T6KA 2HQRA 3GA5A 2GBPA 4JAVC 4B09A 4KVFA 4IF4A 4FE7A 1U2PA 2WY2D 3T95A 3EQZA 4YRZA 3KYIB 1PUXA 3EQ2A 3KLNA 1DJMA 4H3HB 1EFAA 2FQYA 2R4QA 3JVIA 1OXKB 2BGGA 4DQDA 3OQMA 2PUCA 1DCMA
chains in the Genus database with same CATH superfamily
4EVSA 2C5EA 5EXEA 5PGMA 1YC2A 3R75A 3X43A 2RK6A 2X3YA 2WSMA 4G0NA 1XI2A 3HEMA 5FTJA 4S2UA 4XGKA 1F0PA 1A7JA 1MV8A 3R4VA 4Q4HA 3C6ZA 1XU4A 4DN6A 4LS3A 1MAVA 3AF2A 1NI4B 1SVUA 4E7OA 2TMKA 4WGFA 1O77A 1F6BA 4X1KA 4YMIA 1G7SA 1FJHA 1FMLA 1K8RA 5DSTA 2ZRLA 1RLMA 2ZKIA 2UAGA 2P79A 3GLSA 3LKDA 4HEA1 4M8SA 1QMGA 1XKLA 1MAHA 4LXQA 2GFHA 1RZRA 4H7HA 1NDHA 2ZB8A 5CR9A 1Z36A 4ZVRA 3L49A 3A27A 3SBOA 1GAJA 4Z8YA 2ZE6A 1J0DA 1RI1A 2GZAA 3W78A 3HYNA 1PKEA 4JI6B 3ORFA 3X0DA 1E62A 3C7TA 1GA6A 2BFNA 3IKJA 1KNXA 1ZOIA 3MJVA 2I7VA 1ZW6A 4RZSA 4W82A 3TOCA 5B36A 5K9ZA 4YB8A 1F2VA 1MC8A 1HLPA 1QQ5A 1XCGB 2BHNA 2PRKA 2C5BA 2ZSIA 3QU9A 2AC4A 3DOCA 2X0DA 4FYIA 4REMA 3X1DA 1QH0A 3GB9A 4MV7A 1Q0ZA 1VE9A 2JAXA 5FBVB 2WHQA 1JBEA 1LPNA 3LX8A 3RV3A 2J0UB 3OOHA 1R0SA 3CVOA 1FY2A 1A27A 1MFPA 2Q07A 4PHTA 4FP9A 4EY7A 1JKXA 2SCUB 1J8FA 4A6PA 1M10A 1ZEJA 3BB3A 2AFRA 1X7ZA 2LGJA 3WIDA 6LDHA 5JCJD 1QLWA 2BY4A 2EKDA 2ODPA 4DA9A 1SVMA 2ZETA 4RELA 4LBYA 1WUTA 1ZM9A 4DJEC 1MENA 3F2IA 1HV8A 4ZT4A 3U13A 3P2MA 4F0JA 1Q3TA 4DV2B 2XHEA 4UATA 6Q21A 3N8DA 4JOBA 1LY1A 2V55B 3DL4A 4KV9A 1Z4NA 2AUMA 1NLMA 3K1AA 1KZ6A 2IYSA 5B1IA 1E9VA 2JI6A 2DPLA 2QD2A 1PT6A 3KVNA 4MUEA 5KVCA 1CIPA 1GILA 2RI1A 4JBWA 4K6OA 3ZVNA 1A2OA 2CKDA 3RBXA 2PT7A 4N76A 5ALMA 1A8UA 1BVHA 3SLKA 1BWSA 5L3SA 1XJCA 5LUBA 3TZCA 3FH0A 3VZPA 4NYIQ 3LAWA 1A9ZA 1CJBA 3UICA 1GNTA 1ZOSA 1KZYC 3SS9X 1O57A 3RASA 1H8HD 3C45A 3BL5A 2QX4A 4RHXA 4ANFA 4AX8A 3N39C 1G41A 1JYEA 1DBQA 3IAM6 2J3HA 5U9CA 1EESA 1DG1G 1ZD3A 3QU7A 5CA0F 1IK4A 4MV0A 4RBNA 5CH5A 1E2HA 5F1KA 3X2SA 4YJGA 2BMAA 4HLUA 4RXTA 4Q1EA 5E8RA 1QH1A 1YVEI 2ID7A 2IDZA 1OWMA 2JFXA 5EHZA 5IFLA 5KYYB 1DAIA 1L5WA 5ALPA 5F1OA 5DM70 2F8SA 3AR3A 1QGAA 1Z0SA 1NE7A 4EW1A 2QI9C 1T5OA 2GAFA 1PGQA 2FUCA 4V03A 5EIOA 3NTVA 3Q40A 3QKTA 4JOCA 2VAXA 2SKCA 2JLQA 1JHMA 4M86A 2XDQB 3ZQUA 1MO4A 2VH5R 2WVJA 3N8KA 3QSYA 3HKCA 1C0KA 2RMKA 4MGKR 1RMYA 4Z0TA 4CKCB 3A1CA 3SI7A 2WWYA 1NXOA 4I9GA 2PEYA 2XVAA 3H5RA 1KJZA 2OEPA 4GKAA 2C1XA 3V8RA 4YP7A 2ZJ4A 1Y3CE 1M1NB 2HWWA 4JJZA 4PQGA 4NBUA 4HLCA 1OXXK 2B83A 4XD7A 2XQKA 3TQOA 1IOZA 1P5ZB 2VJAA 1OI3A 2YMQA 3NT5A 4OKIA 4WZAB 4ALJA 5B6PA 4EG4A 2I29A 3EIOA 1Y8AA 2IF0A 4GOND 4MUIA 4LF8B 5DM1A 2C00A 3U7FB 4M2LA 1JKIA 1G8GA 1NJGA 3CTPA 3P9KA 3GOQA 4CTJA 4MHOA 1JA9A 1CYDA 1IC6A 3GLHE 3D0QA 1U3VA 4B4UA 4JMPA 2G1JA 2BEKA 4MZXA 5DEIA 3ZLVA 4AO7A 2F8TA 4KHPB 2O1EA 4HYQA 5A5DA 1N2ZA 4IO1A 1Q84A 3MERA 1B26A 1KOLA 3L79A 5CGQB 1GUYA 1P1CA 3UUFA 2V65A 3H1FA 1JAHA 4OGFA 3OU7A 4JT4A 5KQPA 1SIBE 1Y9ZA 4PW0A 3RSCA 3ZHYA 2XQIA 2OPHA 4W5JA 5IW8A 4X91A 3TMYA 1DAFA 3SZUA 4M0MA 3JD0A 4QOFA 2D7DA 1HC7A 1TUBA 3SSMA 3MAJA 4B7AA 1ZR4A 3P2EA 4XAQA 1JFFB 2IV3A 5ERGB 4EL5A 4NX2A 3W6NA 2P5YA 5I9BA 3UIEA 3UK1A 2B1RA 1LLUA 1WETA 1IVYA 1EFTA 5BSFA 4AF8A 1XEAA 4PG8A 1JSLA 3QNWA 3WHIA 3IAHA 4E2WA 3DT6A 1JP7A 3K1TA 4M7WA 1AHPA 3R0ZA 1KQOA 1NUPA 5FB3A 2Q4OA 5CHEA 1HE8B 2V6BA 3KZXA 1JI0A 3F7TA 2J3JA 1U90A 3OEHA 3P9PA 1FRQA 1WKBA 3DZKA 1CUZA 4OCZA 4OQXA 4YRGA 4PBSA 3IQGX 4KE7A 3FCYA 1I7QB 4ZPJA 2PFKA 3I45A 1BROA 1OZGA 3Q7EA 1L4HA 5HMLA 4H4EA 3PWSA 4TMWA 1NXVA 2UUPA 2VPWA 1MFZA 4UMVA 6NULA 2FDCA 2CWWA 5E95A 1AU9A 1Z5WA 4Q66C 3ONFA 5HM6A 4KC0A 1PZXA 4AZWA 1IY9A 1N2BA 3AHHA 3B1YA 2OO7A 4FHGA 4JUFA 3HYRA 3SEFA 3O4JA 3OTGA 3U56A 2H2IA 2IEZA 3HO8A 1RBMA 1N25A 4K9SA 4EARA 3QRWA 2JS7A 5IFKA 1JTVA 1CTQA 4NOJA 4U2KA 3KWMA 4EECA 1RZRD 2OHVA 2WIAA 1S2DA 3C6BA 1UUFA 3DEHA 4AUEA 4EHBA 1T5LA 2YWDA 3U60B 5IVIA 4NQRA 1IM5A 1SOWA 1ECCA 5E1MA 4EZEA 2B8NA 3HI6A 3RUPA 2Y1WA 1K0UA 1P8AA 1SWWA 4EFLA 1ZGAA 2A33A 4B6SA 2SKDA 2Y0BA 4AG5A 1EP2B 4R40A 3RDPA 3H3FA 5EPUA 2IHTA 3B89A 2ECQA 2D5LA 1RRFA 1ZKDA 5EIAA 2QF7A 5AHRA 2VDPB 4DV7B 2V54A 1NLUA 1E79D 4PGGA 5F9HA 4AIIA 3R09A 1DLJA 4FFDA 1OGJA 3JQ8A 4JVMA 2FP4B 2OENG 3IOEA 3WXMA 2HWUA 4OP2A 4H31A 4GGOA 5DXAA 3ZWPA 3T9CA 4EKNB 3GDFA 3DZ8A 5DCYA 1XALA 4MR9A 3JR3A 5GINE 2HH9A 4KZKA 4N7JA 3SNHA 1NM5A 2IOFK 1BVYF 3FPCA 1N5JA 4UNNA 3U39A 3OY7A 3TIFA 2C77A 1YRLA 3B9PA 3OLQA 4D8XA 4HAXA 4D5GA 1W94A 3HFSA 4QJBA 1KEWA 4B32A 2H4JA 1UKBA 1WY5A 2WINI 3JZAA 4E4TA 3EOBI 3SYMA 1ZIXA 2J33A 1Q92A 1Z6PA 3D5QA 3D4OA 3BFXA 4LFBB 1XHFA 3UJ3X 3ZDXB 3R9IA 3VR0A 2RGUA 5AOCA 5K05A 2OXEA 1Z2CA 5FTNA 1ZFNA 3CR7A 3NANA 4X8OA 1E5QA 4D9EA 2WIFA 2X13A 5DISB 4DIFA 2IEDA 5K8LA 5KX5A 3V42A 2OTCA 3A4YA 1YD7A 2B8TA 3ED1A 4WK4B 4D97A 3QU5A 3E7XA 4FGWA 5LJLA 4XB1A 1P80A 2BKLA 2PGIA 1KEPA 1LDNA 3ESAA 3IUEA 3OJEA 4KXXA 3PVCA 1Q7CA 4JBYA 1CNEA 5F7XA 4QGAA 4BB6A 5CLQA 4NCBA 3RFCA 3WIBA 3GVIA 3L4JA 3AIIA 2JGNA 1JG6A 1YBMA 2DH5A 3TB4A 1ITZA 5H81A 3AR4A 4TWJA 2JBAA 3DFIA 3WLFA 2X8JB 4BRUA 1X7YB 2Z4RA 3BBPA 3MUEA 5K4HA 2I33A 3QTTA 4UXHA 1I4EB 2QU7A 3PQ6A 3BJRA 4LTDA 3P9SA 3WYEA 4WBNF 1T3TA 3RHZA 2Z6AA 1QTRA 2CT8A 2J5XA 1UBKS 2BI8A 4ZEVA 3GF4A 2KMLA 2QY9A 2VC2B 2JGDB 1V25A 4FFRA 3VSBA 4Z7OB 2VNHA 3K8ZA 3QYPA 1V0JA 4ZAWA 3VSCA 1JU4A 2J0VA 4F5WA 2DFLA 1JBKA 3E61A 1L4LA 4BMVA 4YTEA 1P2GA 2AW3A 5L7WA 2E6KA 3K5HA 1NY5A 2XNKA 1ZRSA 2ORED 4R2IA 5U4XA 1DUIA 4WK0B 2WSYB 3DL0A 4DSZA 5CFNA 2NN3C 3FYUB 3DPIA 3DMFA 3QUBA 4XGRA 4G0WA 2OBMA 3OEYA 2Q29A 4F91B 1WPGA 1BMTA 2CXQA 2OK7A 1USVA 3V1UA 1CDEA 3QLEA 4XB6B 1OKKA 4URUR 3N2NA 4JELA 2RHDA 4RE6A 2Q99A 2NT3A 2A7XA 1BEZA 3UHOA 2YV5A 1CHNA 3D54D 3QTBA 4R3NA 4DY6A 1KP9A 3GIWA 1UK8A 1BXGA 2VRBA 4F2HA 4L9RA 3U1BA 4OAQA 4A0QA 2JFGA 3AXSA 4EKGA 2F3PA 1YQUA 3SX0A 2ZRBA 3L6BA 3K0CC 4MV1A 2GM5A 4P4UA 1QG0A 2GD2A 4PLCA 1HXHA 4RPIA 3I6QA 5H7XA 1Y8CA 1WZCA 1F4PA 2E4WA 4MPJA 3ESDA 3T7EA 1PFWA 3H1PA 4YRIA 6REQA 4QYXA 2V1XA 1HDEA 2Q3FA 4K26A 1ZH0A 4I99A 2D13A 2FV8A 4HDRB 4ZYXA 3G1WA 2Y1DA 3DO6A 2XZTA 3AHJA 4QUAA 1Z8HA 4M99A 4EYKA 4XASA 1EM8B 1KFEB 3NALA 2YMLA 2Q8PA 1FLDA 2CFOA 1UJ2A 1SCDA 1MABA 4R1SA 1TEZA 2H07A 3RRJA 4MITA 3K0KA 2DU8A 3OE7D 3MUOA 2EHJA 1AGXA 2H31A 1XJQA 1AIPA 3AOEC 3WQHA 2XADA 3BRWD 5BSTA 2ZQYA 1RJFA 1YR9A 2QXUA 2ZRGA 3W9BA 4ND4A 5D3QA 2DKOA 3H6GA 5BV8A 1VPEA 2ZYUX 3W2GA 4XJXA 3VNAA 3OSZA 3IEKA 3OFNA 5IABA 1SVIA 3EA4A 3KYBA 5BSMA 3PKJA 3AR6A 5BW4A 3U1TA 2YYZA 2JI4A 2WT8A 2YOHA 2HBYA 1AKTA 1T5DX 1QYVA 2EL7A 2J3QA 1CUWA 2X0NA 2XUZA 4IQGA 5EYPB 5A4DA 1IFXA 3OT4A 4P1ZA 4ND3A 2JBWA 4NCHA 4R31A 2P77A 3ILYA 1L8LA 3UG6A 2JAHA 1UM8A 3MQ2A 1WPRA 4PHFA 1RKXA 5EWJA 3TRJA 2ZYTX 4LV6A 3N0XA 1P2DA 4KU4A 4YUYA 5LZ2A 1QQAA 3CH4B 1ZJJA 1ENZA 3M83A 1F48A 5JCOC 4PWYA 4L5CA 3F5QA 3HU3A 3IHTA 1X1QA 1TW2A 3HP4A 3QI2A 5EHXA 2RHBA 4NH4A 1T1RA 4BNFA 2ZTVA 3FAZA 3KB8A 3G2KA 3KSBC 1OBFO 1W0JD 5A2GA 3ECCA 4YMLA 4U9UA 5DMXA 1D2AA 4LXXA 1NT2A 2ORWA 1K5PA 1SKUA 2FEWB 1T5SA 3HEBA 3PNSA 2AD5A 3V8VA 4A1OA 5JNUA 2VP0A 2OV6A 3VR4A 4AZ3A 2O5RA 3FSGD 3NBQA 1DO8A 3ESXA 3AHGA 3T5BA 2ZIEA 1RQXA 1YE8A 4EZIA 2ET6A 4HB2A 4N48A 1L5MA 1JLLA 3S1LA 4Y2QA 4NE7A 1KJ8A 2NSLA 3K72B 5A2QA 2PKQP 1Z2NX 3I4LA 3LVRE 4K7JA 2KYRA 4MDYA 4X5OA 3W9SA 5I7EA 3AM3A 1ZBQA 4GEGA 4GQAA 5DM4A 3RD5A 1VG0B 2AR7A 1W8DA 3HWX1 3A10A 3ABZA 2OBLA 5FV4A 5EIWA 3AQ4A 1ZDMA 2B25A 2YXPX 2Z3VA 3DCNA 5EMMA 5HM8A 2H4WA 3TSZA 5IJZA 1B74A 2YKGA 1PFKA 4GI1A 4LKRA 1ZA2A 3I4CA 3BMCB 3UAXA 2JI9A 1VJDA 2BZ0A 2IEYA 3A1EA 1FMJA 4IDFA 3AY7A 5AKEA 4H7JA 1SUAA 1PDVA 3AF3A 1UXOA 3TD6A 2PMFA 4DMFA 3ED5A 1V5IA 4QYMA 2CJYA 3RFFA 3DJYA 4BX9A 4UEWA 4KR2A 3ZV3A 2EU8A 2H7CA 3QPAA 2QA5A 3RQSA 1O95C 3WQBA 4B3IA 2ZT8A 1VJCA 5F12A 1FX0A 5CTAA 4W9NC 4RX1A 1SPBS 2WJ4A 4OIFA 2CWDA 2JJ1A 4X62B 4XYEA 3UH0A 1V4NA 1UBLS 1L7MA 5C8DA 2X9VA 2JFVA 2H4FA 4JXKA 2X23A 3D7LA 1A5SB 3B3QA 1P17A 1QYXA 2AEEA 2BEUA 3E5MA 3LF2A 4UEJA 2HSJA 3RTGA 4DCVA 4BNIA 4WVLA 1P4SA 3GFBA 4C0KA 3PEFA 3SBEA 2PLRA 4C88A 1L8AA 1TGYA 2VHYA 4E94A 5ERXA 1GZ7A 1G5IA 2GTPA 2Y2VA 4I5EA 2DTEA 1TT5B 3FOBA 5K6RA 2CHFA 1RTTA 3WKCA 5M34A 2VAWA 3NATA 4YMSA 2Q7OE 7AT1A 4OI2A 1G2OA 2ZSHA 5K0ZA 3JAWB 4OBBA 1DIOB 1KR2A 1UBFA 5KU1A 1FJGB 3WL7A 1OQAA 1GGMA 2G5PA 3G68A 1EBFA 1H6BA 1B43A 4L7QA 4LGVA 3TLZA 1JYSA 3FXAA 2I7XA 4JJ8A 1KPGA 3DCJA 4ME6A 4OU4A 4UTOA 3SS7X 5JIBA 3LV8A 3HVRA 1REQB 4DCOA 5HUJA 1QVWA 2C7QA 4N12A 2F1HA 5G53C 5BXYA 1I4TD 3PICA 2QVCA 4I5GA 2BUCA 1ARZA 1XD9A 2I4NA 2Y9MB 3ML1A 3HVIA 3WJ1A 3LT4A 4WNAB 2ZYVX 5EQDA 2P90A 3T35A 4BIMA 2XJ4A 1YNOA 5C1IA 1E1KA 1AURA 2QW1A 2OSBA 3PFNA 4B71A 5JE8A 1JQLB 2WKRA 1Z4IA 3O75A 1SC1A 4IHJF 4TVBA 3BB4A 4RD1A 1FQOA 4BVFA 3VHXB 3VTZA 3REQB 1DJNA 3DE6X 1QGED 5LOVB 3KWLA 4F38A 1V3TA 4Y98A 2Z2ZA 4B1FA 1OR8A 2J9FA 4L0DA 5KU7A 3C97A 3FTPA 2NOAA 4WXRA 4HUTA 1H9CA 2QRVB 3KKPA 4HAYA 2HA3A 3DAFA 3CH5A 2J9RA 1V5EA 3C8UA 3K0BA 3Q85A 2Z3WA 5AM5A 1ENPA 1LQTA 3OZTA 3TPCA 2ONKA 3ZV6A 4OGWA 3SSOA 3TE6A 2B78A 1TM1E 3K8QA 2IUSA 3AB3A 3U7JA 2DKFA 3S2UA 4O2BF 2GVNA 3RANA 3VU9A 1T5BA 4MGIR 4IJVA 4A8JC 5BPFA 3QKSA 3QKUA 4QJ5A 3IBSA 3CWZA 2GHRA 5HZMA 3WL4A 3ZN2A 4ENVA 1R88A 1Z6XA 1TW3A 1G8PA 3H83A 3MELA 1GM5A 1K3UB 4KK4A 1X7HA 5ALRA 1BDMA 4OAPA 2FNAA 5ELLA 3TS1A 2OVBA 3M3DA 1U1IA 4TMKA 4XVRA 3TW4A 2P35A 4UHKA 3TLEA 5JNTA 4US2R 3BCUA 2I7CA 2CLDX 5DMHA 3KQOA 1ZL0A 3V4VB 3FYHA 6ABPA 3HYCA 5ALQA 4ESEA 4ZU1X 1AQNA 1GSIA 5K45A 5H8WA 3WLHA 4QD3A 2G1PA 4UZSA 4JB8A 3TNYA 3VISA 5BY2A 4QBTA 4PNEA 2FCAA 4Y6SA 3R9KA 1G8KA 4DYHA 1BRTA 1RC0A 4RDHA 1CZOA 1XXHB 4JT2A 1LI4A 5H3HA 5JVDF 5CVCA 4B47A 3ND9A 3PYLA 5DNVA 2YCBA 1DAGA 2P9CA 1KYXA 1XYYA 2MWMA 3DP9A 3PLRA 3W8EA 4PQFA 4QHSA 4AN0A 4W1QA 2FPKA 1WE2A 2AGVA 3S2ZA 5FUWA 5JCJA 2X6QA 4OHCA 1K1EA 3NIFB 4AULA 4LWZA 1M66A 2V1UA 1XQXA 1Z2OX 4PCUA 1NVKA 2E4UA 1NI5A 1EZ4A 1O3YA 4GM4A 3CUWA 3ZE0B 5LMNB 1NE2A 2IYXA 2VSXA 3AR7A 4P7GA 2FCRA 3FCAA 4MKGA 4CVNA 4D9MA 4TLMB 2WE8A 1MLDA 2GBFA 4IDCA 1ZSYA 4B7CA 5A5GA 5BT8A 4V1CI 4EHAA 3IV6A 3U6BA 2J7KA 5LYYA 4F92B 5KX5F 2JVKA 2G8LA 1V5GA 3BX1A 4Q39A 3OY2A 2X6RA 2XTJA 2O05A 3BRQA 1C3OB 4QOEA 4DMUB 4DRXB 3FGPA 3H05A 1X1TA 1NA5A 2I1LA 2QJRA 4DG8A 4P7BA 1NBEA 1YBAA 1X39A 5ADVA 5AUPB 5JVDA 4FZJA 3JAWA 1N5KA 4ATNA 3E9NA 1CUCA 2D3TA 1FS4A 1GUZA 1I5EA 4X8LA 4UDNA 3JQFA 2BFFB 5A5EA 3NBAA 2QZ4A 1PR9A 4UHEA 2A7QA 4PSCA 1P2VA 4AW9A 4DB2A 1UJ4A 3FPFA 3QXGA 4PICA 4YRDA 4F3RA 4TN5A 1YE5A 3HU1A 3WFJA 4B7XA 5F5NA 1KA9H 2WIKA 3CUSA 2C03A 3GP5A 3R5HA 5LLTA 3FUXA 1DTSA 1RWOA 4DLWA 1N8KA 1JHXA 1J22A 3PFGA 1EUDB 2DUWA 1DKLA 1WW2A 4DQKA 2WJAA 3EULA 3PIIA 1GGEA 1X7WA 3NHAA 2H6EA 4JWKA 2WF9A 3WLSA 4YO7A 2B35A 4IUBS 1SOAA 4GF5A 4KRGA 5DTRA 2K7FA 4TYWA 4UCFA 1RT9A 1DBPA 2ONYA 3GNQA 1WULS 3GUYA 1OGIA 5AM4A 5KJCA 1DBWA 2M1ZA 3L43A 5L8VA 1XQVA 1K8ZB 5G3ZA 3PRYA 2FSPA 3KWFA 4EJ6A 2JAPA 3IBFA 1UZUA 4DIUA 4ZYZA 5BXQC 1CLUA 1I8TA 1MP0A 3K20A 3K53A 1ZNQO 3MT9A 2Z0MA 5JDCC 4BBJA 1LS1A 5AVTA 1P75A 3C1UA 4Y9UA 3E1SA 3HJAA 1R8QA 1E20A 3M3HA 3M1IA 2DFPA 2FWNA 2A4MA 4LXUA 4C4ZA 1UXIA 2ANBA 3DBOB 4MVJI 3CNOA 4TV8F 4Z2YA 4N5MA 3P0JA 5F21A 3WOVA 2XTNA 4DUYB 3T3MB 2JFOA 4B75A 2QUKA 2Z2IA 1UQTA 5DSXA 5L51A 2RKOA 2AMVA 2HMTA 2J3IA 2BFCB 5DGTA 3UV7A 4AZ3B 1I3NA 1WZ2A 3NV9A 3IQIX 3Q88A 5CVJA 5ALGA 1IQ0A 3G5UA 3GGPA 2XUDA 1ZOLA 1NVTA 2JKYA 3P1JA 2AI2A 4CM9D 5FI3A 4NZYA 5JD5A 3RHSA 1MOSA 2GF9A 1UJ5A 4WX2B 1G8YA 3ZQJA 3NO4A 2HU7A 5CA0B 4RPHA 1O9HA 1SD2A 3GA7A 3CO5A 3KQPA 4CL0A 5KYTA 3HBAA 2VQ6A 3R7AA 4OQMA 2IV2X 3W5SA 2IU6A 4J91A 3JYOA 3TMAA 3GJ3A 4YRBA 1NXTA 1WNFA 2O07A 4U7FA 5G1NA 3DD5A 1ULTA 2Z5LA 4R16A 1ODTC 4J16C 1V48A 1EGVB 2BHRA 1SCJA 2LKDA 1MG0A 2XSZA 3GJRA 4EVQA 1N0VC 1GCGA 3IO3A 2GCOA 4YJ3B 4WXEA 1CUHA 4RA6B 3OKCA 2D1FA 3T4XA 1HG0A 2V74B 1HEYA 1U1FA 1EVJA 1VI6A 4ARZA 1TA0A 3O83A 4I6JA 3DEAA 3SEZA 2J87A 1KRXA 3NEPX 3D81A 1VIMA 1Z0AA 3LC0A 4J0HA 4P0TA 3V00A 1I2AA 4A8TA 1C7QA 2OORA 1K68A 3N0RA 3OFVA 1KNQA 1NVDA 2QZSA 5KBYA 1ADFA 1QJCA 1YMVA 1S5PA 2CUNA 2DHQA 2ZWMA 3FETA 4Z0PA 5LA6A 3VM6A 5DNCA 5JPDA 1OTYA 4RVOA 1ZMOA 3I2HA 3CRMA 1RLJA 1WD5A 3IUJA 1IN8A 1OU4A 4Z4EA 2X4LA 3EGVA 3L41A 4ZDWA 1BMDA 4KRFA 4XSVA 3PKZA 2R11A 3HV2A 5J2TB 4HGQA 3MMZA 2EBWA 3M2PA 3DM9B 1G9XA 2I6QA 1E5TA 2VUTA 3GC6A 3HUTA 4TTVA 4XIJA 3AKZA 1Z7YA 4JNKA 5I4IA 2YJGA 4AKHA 1RBZA 1X1RA 4E5DA 3KVRA 2FEAA 3W3AA 3KKOA 2EGGA 2VIIA 3OMWA 1II8B 2RHWA 3ACDA 4OBWA 4BJ3A 4N18A 2WD7B 4XDYA 4QARA 3NWEA 4I9NA 1NW6A 4REQB 4JLDA 1E0AA 2XUJA 2J3DA 3GU3A 5DB4A 2P6OA 3QW4B 3VVLA 2DOKA 3PGXA 5AOBA 4G24A 1DBVO 5AI4A 1SXQA 3ELBA 3WNCA 1N2HA 3T34A 5HCIA 4MW9A 4ID9A 3IC5A 3ZU3A 4D4IA 1RQ2A 2PX3A 1B3BA 3HHPA 1N0IA 1UK7A 3VYUB 4MEBA 3GMIA 2JZNA 3U80A 2VHTA 1UF9A 1M1NA 1N1GA 3RRBA 2JJ2D 4FFLA 5JJBA 2X14A 2NQTA 1YJAA 2PDAA 3HDVA 3KG2A 2JCGA 1FVFA 4KV7A 4D3DA 9ATCA 3U7GA 4AQDA 3W5JA 2QVZX 2P2LA 2WNIA 3THSA 3ZWQA 4ACAA 4DR6B 4BCDA 3A9UA 4ZZ0A 3UOWA 1GN9A 2BE7A 1OAOA 3UWKA 1D5WA 3AUUA 3A6EA 3CPSA 5A9SA 4HYTA 1M2VB 3W5IA 3PUYA 1FRZA 1L7VC 2NVWA 2Y1EA 2ZT7A 1G55A 3B1WA 3EW7A 5A9RA 3F6PA 1U5CA 1VI5A 4R8VA 3UAOA 2NV2B 1BRMA 2EW2A 3HJTA 5KTMA 1Z6GA 2P9QA 1YZ3A 2PV0A 3Q0EA 1MJ5A 5SYMA 3K8OE 1L7DA 4IG9A 1MDFA 4BCBA 4EQ6B 4F2DA 3W4KA 3OZEA 4RK5A 4C7KA 2Q2OA 3T9FA 5HRAA 3BFKA 4PZPA 1LC3A 2ARKA 1R7RA 2ZCUA 5CURA 3PSHA 3WNBA 4R81A 4G63A 3EPRA 2QN9A 4INJA 5FD8A 3TW0A 1M0EA 4RKYA 5BR7A 1BH2A 1TO1E 1XHEA 4TV9F 4AMVA 4UNIA 2X0FA 1W8IA 1FYFA 1GZ3A 2OHGA 4QYSA 1Y7TA 2FH5B 2VJBA 4DUGD 4QTYA 3VNUA 3JYPA 4LDZA 1Q3KA 3U17A 3NIWA 3JQBC 4HL6A 3KLOA 1A4UA 3CKMA 1GOTA 2P11A 3HLTA 4MQEB 4DILA 4YCMA 2FPIA 3KZMA 3GCDA 1Z2DA 2VSFA 2R65A 1CUJA 3OCVA 4NARA 3ZJVA 3CSDA 3FCUB 3SC3A 4G89A 3S8EA 2IU0A 3CCBA 4GOLD 2ISCA 5IC4A 3HZRA 1HDOA 5G4KA 5LXTF 1SWVA 1SA0B 1FUUA 2FHSA 3LA6A 4JKYA 2FW9A 1K8YB 1OOEA 1VJ0A 1QVRA 5I8PA 2QX8A 3AL2A 4N47A 4KXQA 2R97A 4WY8A 4JLAA 4TQAA 4P5DA 1G3RA 1N3IA 2RGCA 3PC7A 1L2TA 2C5FA 5DCUA 2HUNA 5TQ2A 3UJ9A 5BVHB 4E1VA 2P2NA 3FDZB 3DBRB 3BGWA 3DTNA 4HAUA 4KYTA 3U3XA 3KL4A 3PU6A 1ZAKA 2DHCA 1PT7A 3OMLA 4OIMA 1UBNA 1S2MA 1SBTA 5MHTA 4K88A 2W8BB 2WHPA 5GONF 1PFYA 3T3EA 2YR0A 3CNLA 3ZEIA 1DQPA 3DNMA 2JIRA 2HO4A 3B52X 2AI1A 2RJNA 1NMZA 3FZYA 3KPYA 2ZB4A 4I1IA 2E82A 1YH3A 1UBMS 4AY6A 2PLAA 4NBVA 1J9GA 1P33A 2HDOA 3DWEX 4NCNA 1JDUA 4R69A 2VSNA 2X8AA 2PH1A 3BF7A 4TUYF 1N75A 5M3BA 1S3SA 1A0OA 1PK8A 2CXXA 4AUMA 4ZRDA 4OXYA 2BZGA 1WXWA 2VF7A 3VZSA 5LXTB 1NF2A 1OFHA 1W5SA 2L42A 5I4KA 2PSDA 1NUUA 5DHFA 4GO1A 1QQ7A 1XMSA 3H4IA 5LP6C 4J1SA 4LF6B 3FWHA 2CLHB 5DW0A 5ITVA 4Y67A 2XGSA 3DPSA 1UBUS 1XRLA 4EJSA 1JG1A 4Z3DA 2NZWA 2HB6A 3TF5A 2FTKE 1ZVMA 5FT9A 4XD7D 4XCXA 5JSFA 1HBJA 1IZ9A 3HB5X 2I8LA 2GRAA 3ETCA 4LECA 2BIFA 3R5TA 1NMEA 1X1EA 2FDXA 5T57A 1CS0B 1I13A 2FZWA 1K88A 1KOGA 2B8EA 1VTKA 2BBOA 2WKQA 4UBMA 1M5TA 1J1ZA 4YALA 1XN1A 5KI6A 4XDHA 3ZKWB 4NS1A 3JTMA 3NPMA 4DDKA 5TGZA 4ZT6A 3PA8A 5I7FA 1MTOA 2G04A 1KAOA 3SZ3A 1U7UA 4LI3X 5E3IA 3CLRC 3WYBA 4EITA 3U37A 2G70A 2RONA 3ZVLA 1BXZA 4GE0A 4JZKA 1NV8A 1JPUA 1US8B 3T9EA 3TI9A 5BR1A 2CMDA 3UKDA 4IH9A 3TQFA 3BWMA 3KFVA 4L28A 3MLAA 2PD3A 4ZYLA 1MAWA 4GE3A 2WEKA 2R7NA 1Z0UA 2XR1A 3LSTA 3AIOA 1U8FO 1J8YF 2DECA 2FPPB 1JR3D 2GK6A 4RZUA 1TCCA 5I01A 3FHOA 3L4BC 1KMHB 2KWIA 3LQ2A 4L8YA 4DMMA 4PVDA 2H11A 4ZAZA 2H1VA 2O0LA 2PKWA 4NDNE 4QVGA 3WA6A 4A16A 5HKOA 2Q0XA 1P7WA 2ATEA 5FOVA 2Q1YA 4WADA 3SVLA 2G1AA 4LE2A 4ZKDA 3K5IA 1HRDA 1A7AA 1MIOA 2ZBEA 4MTCA 3E2PA 3PDIA 4Q4DA 3CLTD 2QIPA 3VR5A 2XDQA 5DXJA 4D3SA 3RUEA 1IQPA 4RGBA 4YUXA 4YCLA 3HBFA 4QFCA 1R27A 2Q0SA 3NP7A 4GIBA 5JCXA 3T5GA 3U19A 1ND5A 1S2GA 4P0PB 1V1JA 2ERCA 1GTG1 1RJ9A 1YB4A 4LJ4A 3RARA 4N5HX 4BYGA 4JI3B 5LM3A 1TC2A 4Y7DA 4YV2A 3FYUA 3QWFA 1W36D 5FRDA 4WNAA 2FVYA 1PJLA 1TYEB 1JF8A 2FSGA 3HL0A 4QBKA 3TL6A 2FDRA 4G5YA 2G5TA 4G5OA 3RC2A 3VZBA 4HZIA 5LZ9A 2I6FA 3RIXA 2QRPA 5ALHA 3T7SA 3OESA 4BLOA 5DOZA 5IC6A 3A9SA 2C84A 3P9ZA 2W9XA 5DEOA 3QVKA 4PLGA 4PGHA 4Z4GA 3IEMA 4OL9A 1RXEA 3ASYA 2WHXA 4LOIA 4FGKA 4IHQA 1SXJC 1TEXA 1U3UA 1MC4A 4EK9A 3I6IA 2Q2VA 4EUKA 2XD4A 2UUCB 4U02A 1BE1A 2VDVE 2QT1A 3TIVA 1NVVR 4N0DA 2HEIA 4KQJA 1KK0A 4MIYA 4DW8A 3RYFB 2K4MA 4F8JA 4G5GA 4N7RA 3FCXA 1XDZA 2A9KA 4Q1FA 4UTRA 2WYWA 4R7TA 1JFTA 3N5CA 2C9OA 4KODA 5G0VA 4D6YA 1YZQA 4PTYA 1TKBA 1TKRA 3GN2A 1PZEA 3VU8A 4PC1A 2H1LA 4EX7A 3NKFA 3AR2A 2CK3D 4PZ0A 2PE5A 1KS2A 3GJ0A 3GZ4A 3RFXA 1G3MA 5D1NA 1HE4A 5COBA 4HAWA 4WE3A 3GAMA 3U4AA 1KMIY 3ZNQA 4DR3B 1A9PA 4I19A 2PY6A 4D81A 1XZNA 3WLAA 3I72A 2H63A 4EW6A 1VC2A 4PAOA 4QOHA 3RNOA 5BNTA 2BSAA 4L6IA 1S4MA 4P4SB 5HZHA 3UWSA 3BHJA 3H5TA 3PUHA 4IH1A 4MRPA 2HIMA 1FU4A 3FMGA 2D5CA 1TF5A 4JLWA 4R2XA 3T7AA 5KPDA 4DZTA 2R62A 1XRMA 4FQ5A 1ZKMA 3PTAA 1Y3FE 1PNQA 4ZQBA 1JXMA 1V3VA 3AUSA 2VI5A 5A4FS 8GPBA 4GGMX 4P86A 5EWJB 1RWPA 3EH1A 4OHMA 3ZGLA 4CCSA 4R0MA 2ZIGA 1DRVA 1J2YA 4MW4A 1F9AA 4NABA 1QIFA 1PVDA 3OZDA 2Q0HA 1H2XA 4KFCA 5CP8A 2PMEA 4C7VA 3DWIA 2IF2A 4FZVA 4HLUC 4DG9A 2J5QA 4GC9A 4M89A 4ERXA 1E1QD 3UG7A 3BIXA 5IZ4A 5IWCA 1YFKA 3F78A 3FWNA 2PKXA 1SU7A 1CJMA 5FPTA 2WVHA 1NR7A 2IYRA 3AHEA 4ZYYA 1WMAA 3F67A 2FWRA 3MD0A 5CH3A 4DYDA 1VXOA 2AB0A 2JGRA 3O03A 3QUQA 2NU7A 5HNKA 3D64A 1OIXA 2EDCA 3UTCA 2ONJA 3AM1A 3Q6NA 3PDIB 5I3ZA 4YCAA 1OXUA 3DV0A 4XQCA 2HWXA 3QWHA 4L5JA 2K2QB 3R5SA 4FMDB 3P9CA 4UUOA 2LCIA 2JLWA 4RTJA 2FSIA 4UD6A 2HRQA 3D9QX 4NZ9A 1NNUA 4G0XA 1GR0A 3L05A 3ZLBA 1DKNA 4DWOA 5KEIA 2I6UA 2NMVA 1M2OA 2AC2A 3MCTA 2H8GA 3AJAA 4MR9B 4GICA 4DHWA 5FADA 3GFOA 6PFKA 5AI5A 1BDHA 1VB3A 3CCCA 1KO1A 1HORA 2ZS7A 3K6RA 4F8YA 3RG8A 3K3PA 1R9GA 4FIZA 4AI6A 1SH7A 4OFXA 5IJAA 5KSZA 1E3EA 4MVJD 1KY4A 1U8YA 2GK4A 4XRGA 5LLDA 3W05A 1Z15A 1CUXA 2QAGC 2C61A 3FVTA 4HD8A 4UAVA 3I1YA 4ZT2A 1Y7IA 3M1YA 1W5FA 1JWBB 4BZZA 5INTA 3ISTA 1ZHFA 4RO0A 3PIDA 1E6KA 4XJTA 3K1ZA 5T8KA 5KNCH 4YRTA 1NPYA 4EFDA 4XLZA 1QKIA 3NASA 5BMVB 4P54A 4QYTA 4DJJA 1ZICA 2X9GA 3I37X 3OM8A 3SFVA 1EVZA 5TGTA 3RRFA 1NFQA 4BFLA 3PC4A 1NZJA 2VDMB 4OU5A 3T9BA 1UQUA 4YQYA 4Y7CA 3PNKA 3GRPA 7REQA 1R74A 2HSWA 5BOVA 1VPVA 2QSZA 3HGMA 5AWFC 1ECJA 1VKZA 2H2AA 1PJCA 3O2NA 3NHLA 3CUYA 2G1KA 4DOMA 4FR0A 1KU0A 3Q98A 4ZGGA 4IDDA 2Z58A 4UOZA 1ATZA 3WGKA 1E1MA 5BQOA 1X94A 1LRJA 3WIVA 2ACEA 3CEJA 3RWBA 4E5YA 4QA9A 1OI7A 1WO8A 1KI8A 3BHIA 4P3XA 5EEHA 2WM9B 1MABB 4O4IF 3HZHA 4PU0A 3ZCRA 2PWZA 1UJCA 4UULA 4PLZA 2AZ4A 2OV2A 5DLPA 1RPAA 1QHFA 3E3NA 1DE0A 1UEXC 3IP5A 4Q5IA 4U6SA 1U28A 3IAFA 4O29A 3H16A 1ZVJA 2V7VA 1M1UA 3DE5X 3K71B 2WM2A 3E15A 4V0OA 1P9OA 1UOOA 3SJZA 1T4GA 4DBLC 3VZRA 1WXFA 4XDGA 1QHHA 1I30A 3UQZA 1TADA 3GPLA 1HNXB 3RS4A 5LSAA 4UHHA 1QDLB 5HE9A 2C4VA 3IMCA 2BUBA 5CFOA 3DR3A 1Q22A 4ENRA 2UZ1A 2Q7XA 4ZPXA 3KPUA 4WNCA 3WDSA 3WLQA 2FZKA 3VZDA 2DXIA 5BSKA 1RWXA 4OV6B 3WYCA 4AZ0A 3DFZA 2RBGA 4IXDA 2AOTB 1NF3A 4P33A 4KAJA 3U7QA 1WD7A 1ONOA 1Q44A 2MDTA 2EHDA 2QE7A 1HK7A 4OBEA 1B1AA 2Q4BA 4GI7A 1QOPB 2PZLA 3QNUA 3OEWA 3K70B 2V6FA 4ZHQB 1DV1A 1LXCA 4Q9AA 2P91A 1NBAA 4XVHA 3W5BA 3H3XA 1DEXA 3KBOA 4OQPA 5FQOA 4ZV9A 1OX4B 4CCWA 4ZVSA 3W8DA 4EG1A 3DE7X 3RODA 2PH3A 5JXJA 4KQFA 4UVIA 1QAQA 1VHLA 1Y5IA 4MW7A 1L7AA 1DTWB 2XMSA 2ZREA 4Y1GA 2VK4A 5EE0A 2XYGA 3HA3A 3UHJA 4AJ1A 1MA3A 1GD1O 3GGSA 4TWBA 1ZJWA 2VUHB 4GLOA 2JHCA 1H3FA 4LZOA 2FUEA 5CU7A 3L8FA 3R9XA 5CB0A 4ENTA 4Q1AA 1DKQA 1TQ6A 3OZIA 3V8BA 3ZU6A 4GRDA 4PXSA 1UWVA 4X24A 1YI0A 1WA5A 2YN2A 2PO5A 4FGLA 5LKRA 1Q6ZA 4G8JA 1L5LA 2K6GA 1XC7A 4UARA 3TLXA 1OGYA 1RZUA 3V3TA 5DHSA 4TT3A 5KB3A 3IRVA 4EGJA 4BVHA 3PWTA 1A2QA 4EKIA 4DFDA 2GN8A 3KQYA 4LHEA 3R7NA 1NOKA 4EHKA 5JJ5A 1XLTC 2AG6A 1MRNA 2HIAA 1IM8A 3LKVA 4HNQA 4CFYA 4L0MA 1OW3B 4LSZA 1NXPA 4A5OA 2PUDA 2IELA 5HEKA 1RC1A 1AQUA 2YIDA 1W4CA 1T35A 3MTIA 4JUIA 4XQEA 4N9WA 1P0PA 3IDSA 1M1YA 4JQSA 1Z06A 2WA2A 4DSOA 2J30A 2PMCA 4C07A 1DX4A 1Z6YA 1X87A 3NAMA 1DG3A 2ZUSA 4FNGA 3D43A 3U4DA 1M2VA 1AKNA 4KO8A 3TX6A 1O5OA 5JQGB 3H4VA 4OK5A 1JVNA 4JL5A 3BWXA 4OQDA 1Q0LA 3B7GA 5CB4F 3KR2A 3N0VA 5E6UA 5H1YA 1LNSA 3FPSA 2V7PA 3FNQA 3SQNA 1M2KA 2NU9A 2QL6A 1H69A 3BF8A 2J08A 2WP8J 2ZR7A 3HWRA 2CXTA 4MV3A 4UCWA 1A8QA 1KJQA 1C3VA 3TYXA 1NF8A 4TWZA 2Z30A 3DNFA 4YJ2B 1G64A 1YZTA 2O6LA 3MRTA 1ZU4A 4JR2A 3PI6A 2O7QA 1U7ZA 3C48A 5LZ7A 2A35A 1MO2A 3IOMA 1KPHA 1U99A 2FK7A 1E3SA 3ZGOA 3WE7A 5JH7F 5K8CA 2HHHB 2HK6A 2QXTA 1NVVQ 1LTQA 2FEKA 2RGNA 2R1VA 3QFCA 1NKSA 3ISJA 3UHPA 3MWEA 4ZU6X 2FRDA 4FR2A 4MZDA 1SC9A 5EQTA 5FWAA 4YWJA 1JSZA 5KMGA 3E8MA 4BMXA 1JXAA 1QHYA 2FMKA 3H2JA 3MJCA 3IR7A 4QG7A 1V35A 4BEBA 5JBNA 3SYTA 3UBTA 5I9TA 3BRWA 4KNYA 4FBLA 3SF8B 4HEJA 4PPFA 2FJUA 1R5JA 3RHFA 4EP1A 5LMZA 2Y0DA 3AQIA 5HIJA 3QVLA 4OXRA 5B6IA 1NVWQ 1SFRA 4QHTA 3J7TA 4E33A 3THYA 3OFND 1NRIA 3DLIA 3IFSA 5JPIA 3R76A 2GAOA 5EXPA 5IP5A 5CDTA 4CIYA 2X3FA 3M70A 1M6NA 3B48A 5DDIP 1PD0A 1KE1A 4JLBA 5AW1A 3GA0A 4ALMA 3WGNA 1XZHA 421PA 3AETA 4DIKA 1HDIA 3O8NA 3IESA 4FFBB 4WZBB 3GRVA 3N7UA 5GTDA 4UEKA 3IJEB 5CEJA 5TR9A 1WDWB 4FLMA 4O2AA 4MWEA 4KRYA 2OM2A 4OYLA 1R8XA 1ZAYA 4TV9B 2W6ZA 4DANA 3UQYS 4EKDA 2RC6A 4HMPA 5JFOA 1CX9B 3BD6A 4WDRA 5FTKA 1AM4D 1AKYA 2GDJA 1CUDA 3I34X 3BMNA 1O0BA 1K0FA 4PANA 3VXKA 4M8IA 4NBLA 2WZQA 2EBHX 3TG8A 3SZOA 2XMPA 5EZYB 2NVUB 2AC7A 2F90A 3EEIA 3SMQA 2I2WA 5JRJA 3PPYA 4E14A 5ALNA 1ZMRA 1DFGA 2QN8A 1P1HA 2VTBB 3OT1B 1RHKA 2YWRA 3I2GA 1LLFA 1XNHA 2WWXA 3OWOA 2O7NA 1IJKA 5I8ZA 4AZTA 4ED9A 3BL8A 3WWOA 1T5IA 4DIOA 3N2LA 1IULA 3MBIA 5F52A 5LB4A 5LQDA 3Q5DA 2QN7A 3N0WA 3PC3A 2EEZA 2WJ3A 2J09A 2XXAB 3ANNA 5K6AC 3QSGA 4MJ3A 4KGVA 1NBHA 1M8KA 2ECKA 2MYNA 3SQWA 2I87A 3O90A 3ER6A 4QDZA 2XIJA 3OZAA 1C4WA 1WR8A 2F55A 4P22A 5DRTA 4YAWA 1Y9EA 2YRXA 1GYQA 1M3SA 1HNNA 1MRZA 3HY6A 2HU8A 3LXXA 4WFJA 3I73A 5FR1A 3AVOA 4TROA 4RH1A 3L7JA 2C96A 1RCUA 1W1IA 2NQ8A 1UEJA 4AO6A 3HM9A 4G26A 5LOVA 3PXCX 4EH1A 1LSSA 1ISGA 4FXPA 4IDNA 2ZJ6A 3UYLA 3HU5A 3BIJA 4UHCA 3ZR4B 4QXRA 4QM6A 1KAHA 5TX7A 2EIXA 4CCYA 1UMDA 4LISA 1FQJA 2GN6A 5E6SB 6ADHA 1QIDA 3KIPA 3GAFA 4KQMA 4P83A 1RYHA 1Q19A 3FJOA 1RYDA 1SKQA 4HV4A 3HNPA 3O94A 3NBUA 4ENUA 4OQFA 3E70C 1L4YA 1HF3A 4LQCA 5E7JA 2A9QA 2LCFA 3C1TA 2GRUA 5JYBA 2HMAA 4BE4A 4ASUD 1BG6A 4X20B 2PKCA 4BO9A 3CB2A 2ZE7A 4KDEA 1VBKA 4QSHA 5H59A 3VI3B 1WKCA 1GA4A 1LJLA 2F1KA 1TZCA 2P9ZA 4ZVMA 2VHEA 1HWYA 2Y76A 3LUDA 3GEHA 3QV1A 2VJDA 3WBBA 5KAMA 1SHLA 3FUVA 3FUWA 1B76A 1CF4A 2NNWB 3G5AA 2EZ8A 2OLJA 3ZDQA 4Y2RA 4DPKA 2PUBA 2PVPA 4QQRA 4B6RA 1E89A 2HBZA 2J4FA 5A62A 1HO3A 4F4FA 1IJBA 5CEEA 3WJAA 5EKXA 2EX0A 3KKMA 1BCSA 3IKVA 2W2MA 3PUVA 4I1SA 4K0RA 3V4RA 4ZYWA 1ZX1A 2NVBA 3UT6A 4BGVA 4KDCA 4KN9S 3ZWOA 4LCJA 2GZSA 2R25B 4CM1A 2UYGA 3QEBZ 4ER6A 3UK2A 1TU0A 1G1AA 1RTKA 1VSBA 3ETJA 3LDHA 5H02A 4F60A 1HT3A 1X7ZB 4ZDIA 2WU8A 1R5NA 2PGDA 1EWTA 4L9AA 1QH8B 3G6KA 3QLUC 3ZUGA 4BAGA 3WYAA 2OB2A 4KRXA 3PFIA 4EHFA 3F4BA 4QQFA 3KOYA 3A1NA 4BQOA 5IAAA 3CCFA 3H8VA 1AZLA 2GNPA 1IZ7A 5KJ6A 1I4LD 2Q5HA 2UZ4A 3EQ2A 3O9ZA 3PQFA 3H2BA 4AP9A 4PRZA 1OA1A 2Q4RA 3K9NA 1B1CA 3WRWA 4I4LA 1SHJA 1BXKA 3V4OA 2FG5A 4E88A 4F3TA 4KQCA 2QRZA 5KTKA 2QJOA 1B2RA 2PSSA 2R2AA 2PMBA 1RHJA 1BKYA 3R3HA 4P32A 5F7JA 5HKLA 4CKBB 1ADBA 2WM3A 1U0SY 4F96A 3G0DA 4I55A 4BNDA 5JADA 1AZTA 2QJFA 1JEYB 2E48A 4C3VA 3KHKA 4S1OA 1SBNE 2CNBA 3HCCA 4L3WA 2OORC 1S01A 5CK5A 1T1GA 5E6RB 4F5EA 1YRHA 4MVJH 3BMQA 1I32A 1JG2A 2GBIA 4COKA 1L5ZA 4MVJG 1O6ZA 3V5NA 4DC1A 4EFNA 3P2YA 1X8KA 3LUGA 1J7JA 3R44A 3IAAA 1UDCA 1VG8A 1UIRA 4XX1A 5AKHA 2ASVA 3K2QA 2O8DB 1P81A 1NN0A 3KSRA 5EI5A 3K5PA 4IIBA 2E55A 4R1PA 1DAOA 1KI6B 4HXGA 4IR7A 2EXXA 2WTXA 2ZJ7A 1ZK4A 4LK3A 4NV1A 4XVQA 5DPMA 2G4VA 3D0RA 3MYRA 4P8RA 1RYMA 1USGA 4H7DA 5D6OA 1DI0A 4C0HA 3KR0A 2QDXA 2C2BA 5FJJA 4D2IA 2I1VB 4F4CA 2XT9A 2P2CA 5FX2A 1Q50A 1H0SA 2LW7A 2ZIXB 4K9QA 5FBQB 4DIDA 2Y6VA 4ND1A 1R4NB 2GHTA 2IIBA 4DSUA 1K4KA 3P97A 1SG9A 2FPLA 1OFGA 4Z9YA 3AB7A 1NP7A 2BM9A 4IGAA 4IIJA 2EQ5A 2ZU0C 3M4YA 1KF0A 5DLYA 5JANA 1GPJA 1U9JA 1ZLYA 4R6WA 2ZAIA 5HDQA 3O8DA 1UODA 3N6RA 2W70A 3SHWA 1R0ZA 2W6JD 3IE2A 4TYMA 4FJ2A 1VMEA 3ME5A 1WNTA 3ZHBA 4PCAA 3G0IA 4XCVA 1Q20A 4A0FA 3A3NA 1X74A 4DBLE 3VO1A 1HYBA 1IY2A 1X2EA 2CXOA 3IDZA 1PR2A 3P0FA 4RKRA 4L3OA 2JI7A 3TBHA 3IDQA 5KWSA 1CDZA 2GKOA 2D4AA 2GRJA 7GPBA 2C07A 1VLHA 1ZCBA 3NHZA 2BRUA 4QTZA 3S68A 4YV7A 3OCXA 3TNFA 4H7KA 5JXHA 4LX0A 3OWXA 1BJTA 2V7EA 2DBZA 5EJ5A 1P3JA 3B70A 4NONA 1KSHA 2NAPA 4AYXA 2OFFA 4CTKA 1INLA 2VHWA 4H17A 1JL3A 2UZ3A 2C4HA 4IYJA 4PZUA 5KNLA 3PUIA 5FWXB 3Q7TA 1E3MA 1OFIA 1YIOA 4NAUA 3NBXX 4FS3A 5EIHA 4BO8A 1G3UA 3FSEA 1JEQB 2BSQA 3CEAA 4RY9A 3IBCA 4FVTA 4FSXA 4QXMA 2IS4A 1U04A 3SQLA 1VBMA 4JLNA 1ECBA 5IXSA 3DH0A 2Q27A 1M2OB 5CB8A 1GZSA 1Y4DE 4IVNA 1GQFA 4C22A 4MNTA 4NU6A 1OMOA 3M89A 3SYKA 3IEIA 4OP3A 5IZCC 1U7WA 2I4MA 3MBOA 2WF7A 3U3MA 1XHLA 1TVEA 2JJ2A 1JHAA 5EJ4A 1XUOA 4I14A 3AEYA 3JWHA 2C97A 3TQSA 1F6DA 3TSCA 1E3LA 3OZVA 1KZHA 1KMNA 1GAWA 2R6R1 1LVGA 3R2JA 2DT8A 3HA7A 2DZDA 3DLHA 4EGAA 2PGNA 3OO0A 4H15A 5DF1A 5KNCD 1K6MA 5EIBC 4EI7A 2AFHB 3D4NA 9GPBA 5I4CA 1WQ4A 1YFZA 2VF5X 3A2KA 1LFAA 2E4YA 4C0QC 1IDN1 1X7DA 4HRAA 1XA3A 5EHNA 4ZJPA 5BV0A 3WZ2A 3BDVA 1T9ZA 5ESDA 3IQWA 3NS7A 3OX1A 4EHIA 1PX2A 1UR5A 1GNQA 3RS8A 4CI0B 5KNBA 4XSGA 2EWMA 3AVPA 1N9GB 4I55B 5K3OA 2RGDA 2Q4DA 5E9QA 5LBIA 2HJVA 4W6ZA 4L15A 2ZJBA 3ENNA 5TY0A 2PXAA 1AN0A 4RPKA 3CX6A 3UAVA 1J23A 1L4NA 4Y2TA 3E9EA 2DQZA 3C87A 2ZUWA 3GEBA 3IXQA 3LLMA 2IY9A 3PD7A 3PGLA 4HGRA 4M37A 4RU1A 4U63A 5HX7A 3H2GA 4JR1A 4WCFB 3IOYA 3HB9A 5T4HA 1O87A 1JDSA 4FINA 3V1NA 4ENPA 1FP1D 2WJWA 3HN6A 4TPKA 3DF9A 4HQKA 3VKUA 4YCSA 3T0GA 1DPGA 2I8CA 3RADC 1U9ZA 2PWBA 3L07A 1NSYA 3A3YA 1JSXA 5DKFA 5CAEB 4CM6A 1C4OA 1E2GA 1JJAA 2XDYA 3DV2A 1WU8A 4MUXA 3AJRA 4N8DA 4C4SA 2OWEA 2RG7A 3RSSA 5J23A 1BE8A 3WFIA 3U4QB 1W7AA 4YJGB 3UV6A 2YOFA 5EMLA 4F9GA 5AVVA 2J0UA 1PVOA 5L6LB 5FR2A 4CLHA 3OKFA 2GEDA 1CZRA 3L1HA 1NKVA 2PA0A 3SJCA 3UTDA 1XLWA 3L4EA 4MS4B 5THKA 1Z62A 3HYLA 5BN3A 3FLBA 1T8UA 2VT7A 1R3DA 3FGZA 5LIPA 2P6RA 3RBVA 3NVKI 1TM7E 2ZXEA 5COAA 4V0RA 4GMFA 5JDCA 5EHIA 1SIUA 1SKAA 4KKVA 4AJPA 3QE9Y 1ZWLA 3EVFA 4AQ7A 3N9IA 2DR0A 3L8ZA 4EBFA 4Y1FA 2HK9A 1G4AE 2ECPA 1DC6A 3AUJB 1JHVA 1QGYA 4LHXA 1OWOA 4ZCLA 3U3DA 3DVAA 2GAJA 2QDKA 3C5EA 4QE3A 1E6CA 2HBRA 3RUIA 2JH3A 4DNPA 5JPCA 5JMWA 1OVMA 3S1SA 1QHXA 2PMDA 3FI9A 4HFNA 5TV2A 3ZDBA 3SHOA 4BEVA 3LZCA 3E4CA 3PZBA 4CMJA 4EQ6A 3JQ8B 1DKMA 1E3JA 1SZJG 2H2GA 2AEMA 3S2YA 1UBCA 3P32A 4DEXA 1C81A 3VV2A 4IMRA 4ZIRA 4QOIA 4TXHA 2G0TA 2QUHA 2F00A 2W4IA 4GPAA 4ZT5A 2XUGA 4EF5A 1ISPA 3FZNA 2LDXA 2P4UA 4BO2A 3AHCA 4RA9B 4PAWA 1QOQB 1LPOA 4QNRA 4P7KA 4RK0A 4HVTA 3FZGA 4Z3OA 3BC1A 5T6MA 2YFKA 1A8IA 1CZUA 4X41A 4MQEA 3RAJA 3C39A 3O2JA 5D3MB 5T4FA 3TH5A 3V48A 4WZ6A 4WFQA 2CMFA 2IBSA 2AXQA 4X90A 3ET5A 4X7RA 4GKBA 1A8PA 4LNUA 4W8GA 1XVUA 2XE4A 1OLXA 1T9HA 4G1FA 1X80A 2MOKA 1A9XB 2YDXA 1IK6A 4JGBA 5ALLA 3VOBA 1WB4A 1SU4A 3EXG1 1HDXA 4YAGA 1ZGCA 5BURA 2B0JA 3JD4A 1PL0A 1T9DA 3F9RA 4MS3B 5J5CA 2UUBB 1J90A 4WN9A 1B93A 1TRHA 2VHCA 1GU7A 2DWOA 4HS4A 1YONA 3HVHA 4QXOA 2QB5A 3ITDA 4MP3A 3GRKA 4LKOA 4YREA 2M2IA 1QF7A 2X2PA 1R64A 1I7SB 4GBJA 1NLFA 1RI3A 2J85A 1Y5NA 1Z56C 2GF0A 4C1BA 2GEVA 1QE0A 4JI0B 4FZRA 3H04A 4GWGA 1GKIA 4I1OA 2HDWA 2H2FA 5CVTA 2CV2A 2E9SA 2XZPA 3VNQA 4JS0A 1EFLA 3G7UA 2KX7A 2WC1A 3DLBA 2A14A 3W34A 2PUEA 4WY5A 5KSWB 2WD8A 3RFVA 3ZHUA 4QODA 1XXLA 2DEUA 4G8DA 5IJXA 2VDQB 2PS9A 1MZVA 2HJSA 2XYVA 4PC7A 2DULA 1Q11A 2ZAOA 4F4IA 4ZHSA 4X65B 1RM4A 1D2CA 1QKKA 1S8NA 3KYCA 4LCBA 3K9CA 3S70A 3UJ7A 3T1HB 3LUAA 1QHNA 1CUGA 1X8XA 2ATVA 3CF4A 4ZI7F 1ZVQA 5FFFA 3JVDA 4YT2A 3BBLA 2UUAB 1N4AA 5GPBA 5GWXA 5AO9A 2P40A 4QWWA 1Y5LA 2XWPA 3FF4A 2OCLA 1BHSA 4WWHA 5M04A 4UU7A 3H0KA 1JR4A 3HU2A 4JB3A 5MFPA 2YOGA 4UMFA 2OO3A 1TK2A 4R98A 2QR3A 1I0ZA 1T0IA 4DQ0A 1W0JA 3IYLW 1N6RA 2CV1A 2VFAA 3T1VA 3GGGA 2QE6A 1BWQA 2TYSB 5TIIA 4NNPA 2IVFA 3LCVB 2BMFA 5FULA 1ABFA 1KHTA 2DH6A 1GPYA 1N77A 2YS7A 3WGOA 4KLNA 1UPBA 1VJRA 1RKQA 2NTYC 5DLQC 4WRRA 1PN3A 1PGOA 3SFTA 5KTTA 1IQUA 2AJ8A 3KTFA 2PNFA 3B3FA 3MSXA 1UT8A 4QBIA 4R9RA 1FBTA 2BCGY 1UJNA 4IIDA 5EERA 2FSSA 3W3ZB 1ZXLA 1FDIA 4UNQA 4LZJA 4GPBA 3TZBA 1SXPA 2HJ9A 3KD3A 4HYYA 4EYOA 3CONA 1V1RB 2NM0A 1UPAA 1T0HB 1W5EA 3AJ8A 4ZXPA 2FPUA 4IEFB 4TM8A 3D8TA 1TA4A 2XWQA 3WLTA 4DUPA 1TDJA 3K05A 3LDFA 4KQGA 1ZUHA 1E0KA 4O3FA 4BQIA 2LR0A 1PQUA 2OG2A 4LRSB 1EPUA 1C7EA 3HGTA 1PEAA 3BTSA 3OTQA 2WZCA 4UCQA 4BFVA 1CFZA 5DYYA 4CM9A 3BULA 2E5FA 2JAWA 4UM7A 3ZV7A 2B34A 2EQAA 4LDJA 3TTVA 4DMGA 2A6PA 3DQQA 2HMYB 2Q6OA 1C9YA 1Z37A 3H99A 4U7TB 2E21A 2NO4A 4ONEA 1PR0A 3NR2A 3IJ5A 2NV0A 2EX4A 3D4PA 5CXSA 3D6AA 3MIIA 1SELA 1RWKA 2YWEA 2FRVA 2A88A 5CDYA 4S04A 2ZKLA 3JQDA 4MQLA 1TCUA 3HR8A 1Q3HA 2Q1SA 1Z38A 1M2EA 4MO9A 1XZIA 2ZJOA 1EXVA 1DNPA 3J81A 5EMKA 4IDHA 4EF6A 1G5QA 3QV2A 2II6A 1Q21A 2J3MA 4AQYB 2IEGA 4JLSA 1WXEA 4WBXC 1DQNA 1DQSA 5GJWC 1XT6A 4XVCA 1ZI8A 3AKCA 2JVIA 3QM1A 4OXXA 4EWLA 2JK0A 5AI6A 1U3DA 5KYUB 1AA6A 5CDGA 4Z4QA 1V47A 4XXHA 1BHQ1 3AUXA 4BKMA 2I65A 2A9FA 5FQNA 4MA0A 4U39A 4RQUA 2JIBA 4L08A 1RJEA 2X41A 3E2MA 3BMCA 1OBVA 2ZQZA 1NRWA 2AKAB 2GPJA 3HCRA 4PIPA 3F7NA 4J4TA 5TMBA 2O2DA 1RAHA 1A77A 2BN4A 2IPLA 2P3LA 2NWQA 2XCLA 1NJFA 1TA9A 2XAUA 3A70A 3C8MA 4TTAA 5FPPA 5C5DA 4PZDA 4KPFC 1MRSA 1AXGA 2RGEA 1D4AA 2IP1A 2VUSA 3LSYA 4KN6A 4O1IA 4C0SA 4BMNA 4IV8A 1GARA 2YIMA 5BQFA 1M33A 2BKVA 5B4TA 3J80A 1ZXBA 3RABA 1YDGA 2QY6A 3FYUC 1ZGBA 3GPBA 3LX6A 3KJXA 3SIPA 1XTUA 3OT5A 1XAHA 2HZBA 1IZZA 4PPNA 2GESA 3NIBA 4QUDA 2O2ZA 2ORIA 4YC7A 1AHIA 2ZWAA 1TX4B 1VJ5A 1JECA 1GA1A 5ELMA 2YY7A 4DY4A 2XCTB 1JKJB 5TE9A 1AH2A 4CM8A 1Z2PX 4M7PA 4Q7EA 1R8JA 2RCNA 4K9PA 3TM4A 1R0RE 2QX9A 2O8FB 3MAGA 4U1RA 1WMSA 4NBKA 4PF1A 1EIZA 1P4HA 3KWJA 4BAUA 4RDCA 4C7JA 4DGQA 4V1CA 2DUUA 3CSUA 4QPCA 2BFEB 1CULC 1PT5A 1WZUA 3G5TA 1KH1A 3GLGE 2QBYB 4KFRA 1Z6ZA 2X1VA 1RYEA 3NM4A 3OUUA 4CTNA 1G21E 2QENA 4DCSA 1LK7A 2HU2A 2QMQA 5G0WA 4F2WA 5FV7A 1AS0A 1WCWA 2BF4A 3IVAA 4DVJA 1QHIA 4OP1A 4TVKA 2NUTB 2TECE 3TFWA 3D6HA 3L9XA 4ZMSA 5IK2D 1NHGA 1BWRA 3C98A 3W1WA 3BWVA 4N1AA 3PQ5A 2OYSA 4FYMA 2VOEA 1XTKA 4PHCA 3CZ5A 4R8SA 3HSSA 4Q47A 1UL1X 2QTBA 4PG5A 3ZI7A 4XUGB 1N2OA 3W5UA 2Z9DA 4KUHA 4QKQA 2BGKA 4TKZA 3F8WA 4LYJA 2GZHA 2ZDQA 2JZCA 2R1UA 2XXJA 4PBRA 4C2TA 1O6FA 3T9DA 3RBZA 4POOA 3TKAA 3GJ5A 1TB4A 4EHDA 2J48A 2X9LA 4NXNB 1GADO 3LWZA 1NUQA 3NGLA 4MWZA 3QFSA 4LHVA 4HAOA 4P53A 4QECA 2UXDB 2YNMA 4YQEA 1NOIA 5FTLA 4D25A 4A03A 1T6XA 1V11A 2PQ2A 5I5EA 3BHMA 4HPWA 1VE3A 1XNJA 2DHRA 1JPVA 3A04A 5H3LA 1CUUA 3QW2A 1EGMB 3D6FA 4CGZA 3PX2A 2PANA 4WKCA 3I9V1 2WU3A 4KVFA 5JY1A 1ZCZA 1B6RA 2WMOB 1EDOA 5JWOA 5LQRA 3WBKA 2NU7B 4ARUA 1DX9A 4QGHA 3ST7A 4D02A 4RIFA 5CX4A 5ERYA 1LBTA 2R4QA 1HG1A 4ZTZB 3A9WA 3D6JA 1COZA 5DM0A 3DZFA 3ZWYA 4TLCA 3JYLA 4NBWA 4CEIA 1D8TA 3OTOB 1CQXA 3W2IA 5JZMA 3EQ8A 1IMOA 4NWIA 3F0TA 2BI7A 1JNXX 5EZYF 3H9CA 1THTA 9LDBA 4GLLA 1E2UA 2OHIA 3KUDA 3KDPA 3N2GB 3Q3GE 4BOYA 1Q0QA 3NTXA 5AK3A 3VMFA 1T0JB 1RWQA 2OV3A 2W5UA 2XVXA 4LCEA 1UC8A 4L78A 2YY6A 3EIFA 3PBKA 3C3BA 4J1QA 4NULA 3TUZC 2FMXA 5I48A 4JC4A 3X3HA 1JJ7A 3BERA 3L3BA 1HNWB 3IDAA 1LNQA 4G1EB 1RPJA 3FTCA 3Q3HA 2GJKA 5FP0A 5KDLA 1GZUA 4OAOA 2JGIA 2OGSA 3LHFA 2JLBA 4C5CA 4HUJA 5EL0A 3UAGA 5F23A 1YC5A 5F4BA 1VPDA 5MN6A 2QJTA 4ZA2A 1BXRB 1DWUA 3CTMA 3LPCA 3DEJA 4C0BA 2VHZA 4CUKA 1U7XA 3KQTA 4P84A 5ARBA 2IXGA 1JWLA 1USIA 2PAFA 2X7XA 1GFIA 3P0HA 1KGDA 1KMQA 3TQTA 5JW6A 5CIYA 5TT1A 2JIZD 1PFQA 4BPRA 3LGAA 4BE7B 5K0BA 4B82A 1YRWA 1T4CB 3NC4A 2AFHE 4C0AC 3V9PA 1XCJA 4U0JA 2VKQA 4B3HA 3MLBA 4Y9SA 4OREX 1N6KA 3WRXA 1NVEA 3LW7A 3ZHOA 4AFNA 4ITUA 5CMLA 1SXJE 1R5OA 5IYZF 2NSYA 1G6Q1 4G5HA 5C31A 2HF2A 2PGXA 1ULUA 3JVEA 4M1EA 1GUBA 2MTBA 1NVBA 3DFKA 3D31A 4EA7A 1J7KA 4O0MA 4W5HA 5DTQA 5C8VA 1AO3A 1MHPA 1N2GA 1NIJA 5HFAA 4CJXA 1IHUA 5E9JA 3RR2A 3D1LA 4GH5A 3PXDA 2LKCA 3LHSA 5BWLA 5BWCA 2QD4A 4KJXA 1KEUA 2Z2XA 4B84A 3W2TA 3T0IA 2F59A 4FJ1A 1HTTA 4D8WA 4G37A 4OM7A 5TPWA 4CEHA 1KORA 3WV5A 1E2FA 1LD3A 4DQVA 4X61A 2Y9PB 2X6TA 4RETA 4E5PA 3W06A 2V8OA 4YBRA 3MM4A 4YI5A 1V6AA 4I08A 4ZEOA 1BDIA 3VDNB 4JK3A 2C8KA 2VDJA 3EXIB 4CRWB 3PLNA 3R9XB 2R5NA 4GBMA 4HADA 3HR7A 5C7IO 4HMQA 1KIAA 3KE9A 3TW8B 3EISA 3QITA 5A4AA 2X86A 4ARAA 5AM2A 3E9RA 2B92A 5HR5A 1QIMA 3KM0A 3EY4A 2D2EA 4DB4A 5KDOA 1D0VA 1U0FA 4D9FA 1KDVA 4MGHA 5DBOA 4UMDA 3IAS6 3UY4A 5IJWA 4HH3C 2XMDA 1IBMB 3GLUA 2AOTA 3PPWA 4N8SA 3ZE8A 4W1SA 1JFLA 1GGHA 3E7PA 4JL8A 1UK6A 3UAYA 3KLPX 3AR9A 5B1DA 4D8TA 4YN3A 2UXBB 2WFZA 2JA1A 5LQUA 1K7YA 3ITEA 1U4OA 1LBSA 4FJ0A 4R71A 3H1GA 1VBNA 2WPDD 3GGOA 4OUDA 4ZOQI 1MJFA 5KDDA 4W7IA 3AKEA 4FSHA 5AUOB 2GLTA 1I7PA 5MGBA 1DQRA 1E1LA 4JQCA 4YH1A 3RKRA 2IYUA 4KFTA 2LXNA 4QU0A 2ZRDA 4MI6A 3PQEA 2MIIA 4Y9TA 2Q4TA 1RE1A 4D41A 3DAGA 2QTTA 1P44A 1YJ8A 5D2CA 3ZBUA 2ONZA 5IUKC 4NKRA 4YLEA 4RMHA 5D7BA 5AHXA 3JYNA 1VLLA 4X00A 1VGVA 4KXVA 2DBVO 1AV7A 3IIEA 5TNXA 5GZ3A 1E8DA 3L92A 1TUBB 4MAFA 3A32A 3R24A 2OG1A 3OCWA 2HMSA 2FPRA 4XH9B 3ZD6A 1CHDA 1JIJA 1OZ0A 5T64A 2UYOA 3COJA 4YRPA 3HY3A 4DLSA 1P5HA 3L6EA 2V7GA 1WUYA 1JALA 4BUZA 4EUHA 3Q3EA 3SOZA 3OVMA 4GVXA 3WL8A 1SY7A 5G4LA 1EUYA 3M9LA 4MDHA 4QYWA 5CLFA 2IYNA 3GX1A 2BZSA 3BS4A 1LBEA 2Y68A 2QZ9A 4BNZA 1N2JA 1SVKA 3R5XA 2NUBA 3WKBA 1O08A 1XXHA 3IODA 3LYUA 2VP6A 1QS0B 4CE6A 4G4SO 5ALTA 4HRYA 1ZVVA 1U7TA 2FUG6 4HRXA 3L93A 4QUGA 3NBKA 4EDHA 4PCVA 2VBIA 4ZV4A 2BDUA 3PNYA 2PK3A 2NTEA 4IJKA 4MI3A 1DXHA 1KERA 4ZREA 4CDNA 4REOA 5J5VA 3HB1A 5CJ2A 3HXQA 1GQQA 4IVPA 5FCDA 4OEHA 4U7HA 1JHUA 4MUNA 1MOQA 2PHZA 5FWDA 1R6UA 2AN3A 1Y3BE 2WICA 3A28A 1S1CA 4C2BA 2VYQA 2XI4A 3LTEA 2A1UB 4MKIA 3OKPA 4C4OA 1V5WA 1ZL2A 2RHOA 4XR4A 2SICE 4CM4B 4Q9NA 1EX6A 4XEUA 2Q2NA 1K2WA 1MJNA 5DIFA 4A8JA 4CQMB 4IV0A 4WXPA 2JGMA 2WWTA 2C31A 2JIMA 3OC0A 5T67A 4KIWA 3WMRA 3SYRA 2PMKA 3IMKA 3BQMB 1BMFA 2Q5JA 1L5HB 3DR5A 1XDSA 3NTRA 3QENA 4YAJA 2ISQA 1X8LA 3IMEA 5FNZA 1H4TA 5TVKA 2G4CA 4J0EA 4PXYA 5C7LO 2Z1MA 1VLZA 2BW0A 2C2KA 3NEJA 3ILHA 4EPTA 3NETA 4M87A 2MT9A 3RVRA 1M73E 2VTKA 4H6VA 5CVVA 4DCPA 1NVUQ 3R3VA 1SXJD 3WNZA 3NFYA 4TKLA 2GAIA 1W2WB 1JXOA 2C8LA 1QZZA 3HBJA 5DX8A 1TVMA 4JP1A 1O03A 4C4AA 4N40A 4MKFA 3X1WA 4LF7B 3Q6MA 1YB1A 4P5PA 1J8MF 3LK7A 4A6EA 4GRAA 3EEFA 2B8JA 2C3OA 1P9LA 2HSDA 3QLTA 1ZUNB 4AXBA 2RKWA 4BX3A 4C43A 3MCWA 1C2TA 4GMKA 4ES6A 4Y6OA 1WOYA 4KOAA 1RPNA 4YR7A 5ELXA 3EK2A 2AFIE 3KUUA 4MRMB 5FI1B 1J5PA 3DMDA 1FFAA 4G3XA 1MX3A 5CLHA 3HADA 1TMOA 2F3RA 4OXQA 1MU0A 2WTMA 4IJUA 1UP4A 4L57A 4YUVA 3RJZA 4B3MB 1DEOA 1K6EA 3V7YA 2B61A 4QPZA 1Y3DE 2BFAA 1II9A 3PE3A 4GPIB 4K9MA 4UHDA 1XDGA 5FAXA 5JSQA 2JVJA 4OLJA 2OESA 4J8PA 2FU5C 4Q4JB 2UDPA 3USZA 4BJHB 1TAGA 5I3CA 1MVNA 1JJIA 2XNCA 3FWYA 3G79A 5L53A 2FR1A 4CT5A 3HCFA 4J3JA 4M4SA 4G9BA 2F9LA 3SEAA 4F06A 5DT9A 1ZK0A 3WK7A 1MB2A 2PLNA 1SKYE 3Q72A 3DZHA 1JDBB 3I5YA 8AT1A 3DXXA 1FP6A 2C9CA 1FNBA 1YQ9A 3DEIA 1M2HA 1QQTA 1IU9A 3DMGA 3UPTA 2O57A 1C3JA 1PAUA 3UW1A 4JU9A 1QM5A 5KUTA 4O8CA 3RRNA 1P5RA 4BQNA 1BVUA 1DRUA 4YRLA 3THXA 2AJCA 4D4HA 1H85A 1JEJA 2CD9A 5IDXA 3V2IA 1UANA 1JAZA 3K9HA 1RXCA 1PFVA 1Y33E 2P2ZA 1WXXA 5JNSA 1F38A 3GWGA 4MARA 1XL0A