3L49A

Crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
b'SLEGKTIGITAIGTDHDWDLKAYQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQKPDAIIEQLGNLDVLNPWLQKINDAGIPLFTVDTATPHAINNTTSNNYSIGAELALQMVADLGGKGNVLVFNGFYSVPVCKIRYDQMKYVLEAFPDVKIIEPELRDVIPNTIQSAYSNVTDMLTKYPNEGDVGAIWACWDVPMIGATQALQAAGRTDIRTYGVDGSPEFVEMVADPESPAGAVAAQQPSEIGKLAVQNVARHLAGQEVKPFTFAPAVLITKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC sugar (Ribose) transporter, periplasmic substrate-bindin
publication title CRYSTAL STRUCTURE OF ABC SUGAR TRANSPORTER FROM Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transport protein
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A01
4TLLB 3H5IA 1JX6A 1XHEA 3DLBA 4RXMA 3OO1A 3QEKA 1P6UA 2VK2A 4PE5B 3EAFA 1APBA 1CYEA 3HXMA 3Q7TA 1ZGGA 3F6CA 1GCAA 1OXBB 5I4CA 1ABFA 1H9CA 2B4AA 3CHYA 4YO7A 2MYTA 1ZVVA 2A9PA 4LX8A 1QP4A 3CG0A 4N0QA 3Q15C 2WWVD 5TPZA 4YR7A 1ISRA 4Z4CA 4WUTA 3E61A 2AYXA 3IP7A 3HDGA 2FKAA 3QLVA 4D6XA 2IPAB 3Q7SA 5D2CA 4UHJA 2MSKA 4RU1A 4G0MA 4JB0A 3O1HB 5FWYA 5EWLB 3HJFA 2A9RA 4MQEA 3Q7RA 3MA0A 3L6UA 4YLEA 4TLMB 5JNTA 4DADA 2JK1A 3URMA 5TPWB 1LJUA 4PEVA 1GUBA 1PUXA 5FBKA 3HUUA 3UUGA 4IRXA 2PAFA 4F12A 4MR7B 3T38A 3UK0A 1YVUA 1W25A 2FLWA 3KLOA 4EVRA 2ZWMA 2I6FA 4Q6BA 1YMUA 2IKSA 4WXMA 4KQCA 3TO5A 3G1WA 1JDNA 2PMCA 4HNSA 1EWTA 3D8UA 4MYRA 2FW0A 3F73A 2FN8A 4G0XA 3CG4A 3N8IA 5CNIA 4L4UA 1M5UA 3SG0A 2YHAA 3SNKA 2X7XA 5BRJA 4RKQA 1Z18A 2NZVG 1ZESA 3MQ4A 1ZH4A 4QYMA 3T8YA 2HJ9A 4RK1A 4PZ0A 1AB6A 1MIHA 1YIOA 2WJWA 1MAVA 3BREA 4MS3B 4NV3A 4ML3A 3RH0A 4S05A 2WRZA 4ZMRA 1DG9A 1JWLA 2VYCA 3CZCA 1TJYA 2PUGA 1NXWA 4GNRA 1RZRD 3RVPA 4KZKA 1PHRA 3GA5A 2R25B 4G0ZA 3BILA 3BRSA 3F6PA 2QVGA 1LBHA 3KYJB 1U2PA 2JB9A 3JVIA 4MRMA 1D5WA 1BAPA 3KLNA 3RVMA 1DRJA 1F51E 1GUDA 1Z15A 5IBQA 4OTZA 1LJLA 2B1JA 3OLXA 3LUCA 3QK7A 2RJNA 1XWWA 4JA2A 2FVYA 3LFTA 5HQJA 3BRQA 4TMYA 4NICA 2FMHA 1D1QA 2MSLA 2NUBA 3KYIB 3JPWA 4MR8A 1QMPA 2JCGA 3N0RA 3DGEC 4IGAA 4JASB 4OG2A 4QICA 4Z0NA 4RXUA 5C5CA 1FFGA 4Z4HA 5CNJA 1VRVA 4YV7A 4MPTA 3KHTA 5EWJA 5KWSA 1S8NA 1Z26A 4RK5A 4PICA 4XARA 3KG2A 3L49A 3LOPA 5FWYB 2H3HA 1D2AA 4RY0A 3FDFA 5DGCA 2QW1A 3KTOA 3FFWA 3HK2A 1J56A 3JPYA 4RK6A 3EGCA 2GI4A 3SQNA 5JNVA 1JHZA 3A10A 3CRNA 4HNRA 4KMRA 2WB4A 3FFXA 1QO0D 4CBVA 2IPNA 4PYRA 2XDYA 5DLEA 1DBWA 2PUDA 1DBPA 1DRKA 2FMIA 3GT7A 4W5QA 3HV2A 3NBMA 2FN9A 1USGA 1M2EA 4OATA 3IDOA 1MB3A 3QLVC 4RK7A 1SRRA 1JFVA 3H5TA 3IP6A 3C3MA 3KJXA 3QX8A 4EVSA 3QX9A 1NXSA 4Z4EA 3NHZA 5JNWA 4Z99A 3RVNA 3I5AA 4N41A 1TVMA 5IEJA 1BA2A 5JNUA 1RPJA 2ZAYA 5TQ0A 3HUTA 4Z4IA 6ABPA 4W5NA 4MS4B 1JBEA 3CS3A 3W9SA 2JVIA 1JYFA 2FQWA 4RWEA 4RK4A 4RXTA 4OLAA 4OBBA 3O1IC 4H3HB 1JDPA 1A2OA 3H75A 2P4UA 4O5AA 4ETMA 2BGGA 2FSPA 4KK4A 4O1HA 3HO1A 4RKRA 5DCLA 5GQSA 1U0SY 1U2QA 2N9UA 2QXYA 2NT3A 3RVOA 4RK0A 5KQPA 1JH9A 4XASA 2FMKA 2YHBA 4O1IA 1NXOA 3GV0A 1ISSA 4IF4A 1URPA 1PEAA 5TE9A 4MRMB 4Z9AA 3C3WA 4JB2A 3JS5A 3RVSA 3EULA 3NHMA 1F4VA 3H1FA 1ZY2A 2VUIB 4WWHA 4XLTA 1M5TA 2J48A 2GKGA 3IPCA 3O21A 3I45A 4XFKA 2WY2D 4D74A 4EY3A 2PUEA 3RVRA 5CNMA 1NXVA 2LPMA 3CFYA 1OXKB 4MR8B 4Q6WA 4MLDA 2GWRA 5IX8A 1Y1LA 3S99A 3DZDA 3N0XA 5EWJB 2M1ZA 4G0OA 1E6LA 3O2QB 3SAJA 4EYQA 1ZGZA 5KC8A 2A9QA 3HSYA 3EJWA 3LKVA 2PLNA 2LUOA 2P9HA 4YS6A 2R47A 2R48A 1KMIY 1CHNA 5KC9A 3IP5A 2CD7A 4IMIB 1Z17A 3TD9A 1ZHHA 3ILYA 4RY8A 1USIA 4KV7A 3GBVA 2L19A 3OM0A 5F64A 1ZH2A 1DJMA 2RGYA 3H6GA 2H0AA 5BRAA 1VPWA 5FWXA 4FE4A 4KFCA 5DTEA 2IPMA 3QLTA 2MYPA 4H60A 1E6KA 1D1PA 1PEYA 1JL3A 2L17A 4MR9A 4Y9TA 2QU7A 3FFTA 4YCSA 4N76A 3CZ5A 1YK1A 1P2FA 5KQGA 5HM6A 3Q41A 2QZJA 2WMYA 5TQ0B 3BBLA 1U8TA 3OM1A 2VUHB 5IEBA 3OMWA 1DCKA 3IPAA 2PJUA 4WXEA 3C6QA 1FFWA 1YS6A 5BR1A 2IOYA 4EVQA 4W5RA 4F8JA 3OMXA 4F3TA 3FMVA 1YMVA 1BDJA 4N47A 1ZITA 3RVQA 3K4HA 3IP9A 1DC7A 3DGFC 9ABPA 3P9YA 1NATA 5JNSA 1NTRA 4WZZA 4RY9A 3SY8A 3M6MD 3LKBA 3VNBA 3O75A 2PL9A 2PE5A 3GL9A 3OQOA 4MQEB 3HCWA 1NY5A 3R0JA 1A04A 2M98A 5T7BA 1WETA 3H5WA 2AYZA 3LUFA 1L5YA 1TLFA 4TN5A 1KRXA 3M9WA 3NNDA 4KQ9A 3QLUA 5CHYA 1BVHA 4JAVC 4MR7A 3K9CA 2E4XA 5BQ3A 1EWVA 4LE2A 3CU5A 3H1GA 1Z2DA 3KS9A 2PUBA 4F11A 1JFTA 4Q7EA 5KI6A 2E4YA 1T34A 4JOQA 1L5ZA 3T6KA 3NNNA 3CNBA 5KQMA 2QSJA 1DCMA 1DP4A 3TX6A 8ABPA 4KK3A 1EFAA 3JTEA 2PUFA 2JVKA 2CHEA 1LBIA 2FQXA 1QKKA 2FLKA 1Z13A 3OQMA 1EAYA 1JFSA 4NCBA 5IULC 2PL1A 1HEYA 3GWGA 3N75A 1BDHA 4DQDA 3GBPA 4RZSA 4YRZA 1GLGA 5ABPA 1SD5A 2HPHA 1E6MA 7ABPA 1B00A 1MVOA 1VKRA 2GX6A 3LUDA 1Z2EA 2F8TA 4HYEA 4NCAA 3MF4A 3OQNA 3KSMA 2QR3A 6CHYA 4MS1A 3QELA 4MR9B 1K68A 1DC8A 3HDVA 4G97A 3LUKA 1Z25A 1I3CA 4LDZA 4G0PA 3GYBA 2FQYA 1ZDMA 4HNQA 2KYRA 1AB5A 4D6YA 2GBPA 2JBAA 3F7NA 1C4WA 2CWDA 4JP1A 5CNKA 2MYUA 1USKA 1SXHA 2HQBA 1VLZA 4B09A 3CKMA 1ZN2A 4W5TA 1KGSA 1PNTA 3MIZA 3LUGA 4YWHA 3QEMA 3H5VA 3RVLA 5B3JA 5HSGA 2IPLA 1SXGA 3ROFA 1NXXA 2ID9A 4KVFA 2RDMA 5T3YA 1FFSA 3C3KA 1Z16A 3O2JA 3RVKA 2FEKA 4EYOA 2NT4A 3EODA 4MGEA 4WT7A 4KNYA 3MMNA 3D02A 3MYYA 1ZAYA 5TQ2A 2IDMA 5HKOA 3HEBA 1P6QA 1QQBA 2FEWB 3OLYA 5IUKC 5ED4A 2OQRA 4IMJB 1RXIA 4N0PA 4ZPJA 5TPZD 1QP7A 2WJAA 4QPJC 1YK0A 2HQOA 3JY6A 3ROTA 1UDRA 4LE1A 3HZHA 3N53A 1NXPA 4NQRA 2QVCA 3FGZA 4YGXB 5C5EA 1RZRA 2E4UA 5TQJA 3C97A 3EDCA 3I09A 4H3KB 1JF8A 2QV0A 3SM9A 2CHFA 3VNAA 3RVJA 5EWMA 1E2BA 4RSMA 2A9OA 1U04A 4LZLA 5JS2A 1RNLA 3LUJA 2OENG 2L2QA 1A0OA 4RDCA 1QNLA 3HS3A 3CLKA 4MLCA 4Z4GA 4MQFA 2IYNA 2R4QA 1R8JA 4XAQA 4E7OA 2HSGA 3EQ2A 2HQRA 4QYWA 3LMKA 1YTUA 2FXIA 4DN6A 4XXHA 1W9HA 1XHFA 3LUAA 4MS4A 5KQLA 1BDIA 4ETNA 4Z9BA 1GCGA 2F8SA 3NNSA 1C0EA 2PUCA 4KPYA 1NXTA 4ETIA 5E3JA 4OLBA 1TMYA 3QLUC 4S04A 4KREA 3DLHA 1DZ3A 3A3KA 3EQZA 4M88A 5GOTA 4G86A 4EYGA 4LRQA 4RS3A 2MYNA 1SXIA 3KKEA 2DRIA 3TB6A 1DBQA 3QELB 4MS1B 4P1ZA 3H1EA 3O1JC 2ID7A 3H5OA 1Z12A 4Z4FA 5IC5A 5JS1A 1EWKA 3T95A 1QP0A 1QO0A 5DKFA 3JVDA 2MSWA 2E4VA 5FBHA 3LTEA 3GRCA 5IUNC 2LP4Y 2LIVA 5EWLA 2FMFA 2JBAB 4W5OA 1ABEA 3Q9SA 1QQAA 1K66A 3CTPA 4FE7A 2PKXA 4F06A 3O2SB 2NZUG 3OLZA 5TPWA 3TMYA 4EYKA 3UKJA 3A0UA 3QEMB 1M2FA 4G0QA 1LK0A 4G0YA 2FEPA 4EUKA 2LBPA 2O20A 4RV5A 2Q5CA 4UHKA 3O74A 3I42A 4E7PA 2TMYA 4MAAA 4N03A 2L18A 3OLVA 2E4ZA 1KRWA 4FB4A 1JLKA 1DCFA 5TQ2B 1RXEA 3HVRA 1PNRA 1EHCA 3MM4A 3M9XA 3DBIA 3OLWA 4LE0A 3RQIA 4LDAA 1FQWA 1YS7A 4ZMSA 1FSPA 1D4ZA 3H5LA 2RJOA 4IILA 4ZJPA 1P8AA 4EGSA 5B3JC 4ZYLA 2V0NA 1CEYA 4MS3A 3N6VA 4KRFA 5FWXB 2E4WA 3OO0A 3N0WA 2PUAA 5EWMB 2FTKE 3B2NA 3H6HA 3A0RB 3ILHA 5JNRA 4YP9A 3E3MA 5PNTA 3HM9A 2W42A 1TM2A 1QPZA 3G85A 4L85A 4MQFB 3KCNA 3LUHA 2JRLA 5IUJC 2JVJA 4P98A 1JYEA 1MB0A 1IIBA 4GPAA
chains in the Genus database with same CATH superfamily
5FJIA 1SU8A 4FT2A 5TMDA 4PQRA 1SQSA 2MSNA 1JX6A 2X8WA 1XNRB 2QMZA 4B6OA 3WK7A 4HN2A 2QM3A 1BU8A 3IMKA 4ZI7A 4YIHA 3LPAA 1IXZA 4H27A 1J8FA 3T41A 2ALJA 2VQ3A 2VBCA 1H93A 1TUGA 2V4UA 2B4AA 4AQYB 4QFCA 4YALA 3T35A 1Y3HA 1A9OA 2BGKA 2WSSA 2GJSA 4RCYA 2AB0A 4TWIA 1WY7A 2O2HA 3ZCQA 5G0WA 1GARA 2VL7A 2INGX 3W1WA 4K6MA 1IJFA 1U8XX 1GAWA 3TZLA 4BNYA 4X1KB 5DCWA 2RGRA 1BFUA 1EYZA 4IIJA 3LXMA 4TXLA 5EE9A 5JAUA 5H3HA 2BI7A 3R5KA 2C1EA 1MB9A 2PFSA 1E66A 4TV9B 2AR7A 2YKGA 2GEVA 2QK4A 3BAZA 3BJEA 3MA0A 5I4IA 3ZDQA 4WINA 4ZC1A 1FW8A 1VBMA 3SU8A 4UE3S 4BN5A 5A6VA 5JNTA 5KNBA 4OI0A 1G9SA 1TRHA 2CSUA 4NZZA 3IOMA 4IO1A 2PCJA 4GQIA 4RIEA 4B71A 1JEEA 2AQ8A 1N2CE 2QTTA 2EV9A 2X7HA 4LHWA 3C5HA 3JQBC 2QTBA 1VKJA 4P38A 2EBUA 2JS7A 1SKAA 4HOYA 2W4IA 3FPFA 3LL4A 4QIHA 5A4FS 1BC5A 5F9FA 1T26A 2XMSA 3A58B 3W5DA 2C59A 2GAOA 4MCAA 1EINA 1XTPA 5AK4A 4ZT4A 4Y8VA 3AR4A 3WLTA 1SOUA 5FFFA 1VE5A 3LT2A 2NZVG 2HNBA 3T8YA 2JCXA 2J45A 4RK1A 2AWNA 2DBZA 3AWIA 3ENKA 3EPRA 4TYPA 3PRHA 4S05A 4R71A 4RMIA 1UF9A 3NIDB 1V9SA 4YR9A 4OK5A 2ZE8A 3CY6A 4S1WA 2KWIA 4WXYB 1RKXA 3KJZA 1R3DA 1PHRA 3EWSA 2Q3BA 3ONVA 3GA5A 2OYRA 1MHTA 5EZYB 5JAIA 2YIDA 3KWMA 4DG5A 3ANLA 2BVNA 3P9XA 5FLXA 1CDZA 3ZI0A 3RVMA 3NANA 3QWIA 2O0HA 1X2EA 5IBQA 4E5PA 4F8EA 1FEZA 4GKVA 5F1PA 4BXOB 3SEZA 1KZGB 2Y0DA 3DAPA 2HC9A 2QYHA 1ZD3A 2I87A 3LH5A 3CQ9A 3RFXA 3BRQA 5KVAA 3N3AC 2F6RA 3C8UA 4BO1A 2VSYA 5JARA 2WHPA 4R2WA 4LHEA 2I4RA 4DHWA 1MX1A 3BE8A 2RHGB 3V3KA 2HRQA 1A8HA 4L6IA 1DWOA 4C0JA 3C87A 3DO5A 4O4LB 3TD6A 1AUXA 5L3VA 5EJ5A 2AOTA 3FTNA 1H85A 1NC1A 4JDPA 4XARA 5DLYA 3AY0A 5AP9A 3ZHVA 1E6CA 1QCDA 2BKLA 3I6MA 4G67A 3OCWA 3AUTA 4IM7A 4Z0PA 2D2VA 1SXJE 1JT2A 1VG1A 2R44A 2WG2A 1D03A 3HCNA 1Y5MA 2ZEJA 1YU9A 4WKPA 3Q3VA 5GGXA 2CLOB 4P0QB 5ALGA 3OECA 4QPZA 2JFXA 1R8YA 4DV3B 4N7RA 2A0YA 4LXUA 4YFVA 4XVCA 4B73A 1KJJA 3PUKA 2I3BA 3T34A 4BVGA 5CT6A 5IMBA 2XUPA 3KR1A 1PQYA 5ECGC 1JFVA 3A9VA 2I4MA 3C3MA 3GUCA 1GGVA 2Y77A 2GZHA 2IVZA 1D6SA 1PR3A 1U7PA 1YDMA 1Z37A 2DULA 1H3FA 4NMWA 3A4MA 4QC2A 4BV9A 4FZ3A 4HWTA 3IEVA 1VCIA 2BM8A 2CFTA 3DW3X 2W4QA 4MMXB 5TQ0A 1NQWA 2GOYA 3BJZA 3C7DB 1OLSB 1J0XO 3TRDA 4IIXA 3BL5A 4BC1A 4ZT2A 4NJMA 2H65A 5KCZA 3QXXA 1HSOA 3F3MA 5ALHA 3ZJVA 3BGSA 1J8VA 2JVIA 1F8FA 2V97A 1JYFA 3I4LA 1PG5A 5UKDA 2OC4A 3LOQA 3PFKA 4RWEA 1PKXA 1YMQA 3G7SA 1JJVA 3HWWA 4O5AA 3KPVA 3QU9A 2BJVA 2OHOA 4BPBA 1S2MA 2X41A 4KK4A 2WQ7A 1LBSA 1WSWA 3L8CA 5AW8A 3K0BA 3MGGA 2CEKA 2O2EA 5JSZB 2HF9A 5I4BA 4D4KA 1TUEA 5DWQA 2NT3A 3RT1A 4K1LA 1JDZA 1D0IA 4E3WA 3EYWA 4PQEA 1RLUA 4XM1A 3VMMA 4PYLA 4EW3A 1I51A 1XJ5A 3FYUC 3IESA 4FTWA 3ZWYA 4B6QA 1EESA 3LGAA 4IIGA 1WXXA 3C3WA 4K03A 3JS5A 4LGCA 2BP7B 3LRXA 4OHZA 3W8NA 3DTYA 5K9ZA 1D6JA 4CVNA 4US0R 2GVDC 4R83A 4C7KA 1AGNA 5ICSA 1AY0A 1FF9A 2R6DA 3L6DA 1IAVA 4F3YA 1IZYA 2VHZA 3DB1A 1Q15A 3NXSA 3OMLA 1NX6A 2NYRA 3DDOA 4UVEA 4DJTA 4LC1A 1JSXA 1UIMA 1JMVA 2IYWA 2LPMA 2VXYA 2G3YA 2ILTA 3C4VA 4HDMA 3UPDA 4BB6A 3I5XA 2A67A 2VF5X 4NOKA 4N40A 1OI4A 5DRYA 1M0SA 2J3LA 3D8HA 2NZWA 3HCEA 2IDJA 1E6LA 1MQ8B 4JC4A 2OTCA 4RNCA 3EFOB 5HX7A 2OHIA 3EPHA 2Q5JA 4FDAA 4LWQA 2A9QA 5BWBA 2CF6A 8MHTA 5GP1A 1IXSB 3FPCA 2POQX 1KMIY 2WJPA 4G0WA 4J49A 4NOJA 2E5FA 4KB5A 2JKYA 2GEKA 4KXYA 4R2HA 1F1BA 4Y2YA 1P2SA 4II2A 5DEIA 3THRA 2RGYA 1WXQA 2WJZB 1ZVJA 3IA2A 5FBZA 1VHJA 4A0QA 2JNWA 3TOVA 2PSDA 1YFJA 3DLAA 4OGLA 3ICQB 3SJAA 4YT2A 4XX0A 3I4CA 4BFCA 1I7SB 4N76A 2I6UA 3ZDRA 4IRUB 4DABA 2OZVA 1QIEA 3T9CA 5F52A 1ONPA 2IEIA 2W6JD 3EMDA 3ZBUA 3DYIA 3PNQA 5TS3A 4RDIA 1VJCA 2FA9A 2WVAA 3FROA 1WMEA 3FYTA 3KKLA 2WJJA 1WMSA 2A0UA 4N0DA 6PFKA 1WB5A 1XOIA 2AG1A 2FSFA 4UZSA 4I8XA 5BNFA 1FX0B 4F21A 1OROA 1QZZA 4MDYA 2QQEA 4M1TA 5ALFA 1SC3A 2FI1A 2LDBA 2XADA 3EXFB 3OM1A 5KHOC 4WY5A 4UNNA 2CGEA 4PSCA 4M53A 4JI5B 1O57A 1IK6A 1DCKA 1I5OA 1QHXA 1UODA 3G0BA 3OUZA 4IO0A 3V46A 4MGKR 3P0IA 4WXEA 3FNBA 1CP2A 1QKIA 3ZWXA 2EU8A 4JT9A 3FXAA 4RVSA 4RYLA 4GG1A 5DNDA 3KJFA 4ZEXA 5JJKA 4RZUA 2VQSA 4LJRA 2LV8A 4TS3A 4YRJA 1K8XB 3UK1A 5JZVA 1KY4A 4EPVA 3SBOA 1GPNA 3FR7A 1YHNA 4DDTA 1E2EA 3U80A 2ZAGA 3K4HA 1RYMA 4Z8YA 2HWUA 3TYXA 1I36A 4WCVA 5KVVA 1XQVA 6ADHA 3DONA 4JI0B 2WAAA 5ARDA 4HPJB 3H7IA 2J7PA 3MRXA 1YS2X 1VLJA 4DSAA 1F8YA 1H94A 2REQA 1N5MA 2YYSA 3S5UA 3H04A 2RGWA 3OTWA 1V8OA 4ZEWA 1W5BA 2VYFA 1BX3A 4EHAA 1TC2A 4C22A 2LCFA 2H59A 3E18A 3UTCA 1EDEA 3FHJA 4MITA 4NABA 1EDOA 3AR3A 1IMOA 1LLFA 1NKTA 1ZD2P 5HF9A 3SS7X 5A9TA 4BMVA 4N5DA 2XZLA 1LRLA 1S9HA 4CQNA 5DM4A 3BSWA 3VGJA 4FGJA 4YPVA 3NHBA 1GEGA 1IBRA 2J09A 3F8SA 5B6IA 2Z2ZA 3FMFA 5H7XA 4HWGA 3BIFA 3C8MA 1NVTA 2EW2A 4PNPA 2ZULA 2CMDA 4MA5A 1T9HA 3OT4A 2QSJA 4B3RB 4L9SA 3VNUA 3TUZC 1Y5RA 3BFKA 3BHMA 1I3NA 2FR8C 2VYNA 3IV9A 1HNNA 1WB6A 5K0ZA 5CBPB 1XFDA 3BIXA 5A0FA 3CBQA 1BN7A 4ALKA 1RMTA 3WB1A 3BMOA 3KKOA 4HYYA 2RB5A 1P2BA 2ACKA 1SD5A 2V7QD 3AH8A 3PQ8A 4XWKA 2GX6A 3AUJB 3DCJA 2VTKA 5GTDA 2IW3A 1C3EA 2WWXA 5LQMA 1NLFA 4ZO7A 2CLHB 4F0JA 1C8VB 4MWBA 4BX8A 5HYVA 5JDCA 2V96A 2I29A 2OBYA 2HA2A 3DVAB 3ZKWA 1ZL0A 4L95C 1B8UA 1DDOA 1WQ4A 2C92A 3EA4A 3I52A 3P0JA 1TDJA 2QX8A 2I6QA 3C4JA 3BJMA 2B69A 3SI7A 5FQOA 3COPA 4NDZA 3GRZA 4I4TB 3W5IA 2ONYA 1QVAA 1Z8HA 1NYLA 3ZHSA 4WFIA 4PHTA 3FMOB 4IFBA 2RGNA 4BVBA 5K0EA 3NMUF 3QIAA 5FLKA 2C9OA 1Y33E 2QA5A 1UWKA 2FWNA 4RDXA 3VV3A 3ZV7A 1U9IA 4BFWA 1KVQA 2PLWA 4XB2A 5K2MA 1KGSA 1SB9A 2HN9A 2F43A 3EZFA 4ZEVA 3ADCA 4CCWA 4DCTA 1YL6A 1O5IA 3PEWA 4KI0A 1NXXA 5J40A 3SC4A 4NEHB 1YI0A 3G9UA 3AFMA 4RF4A 5H80A 5T3YA 3ROZA 4YXWD 2QP3A 3LU1A 3NS7A 4A2CA 1J21A 3PF9A 4CIYA 2HNKA 4HZUA 4D3YA 3SHWA 1DT5A 5JTUA 3AU8A 4G09A 1G2QA 4LCBA 3C1OA 4OQZA 2BHLA 3C41J 4XI9A 1QZXA 1LS1A 4EG6A 4MARA 3GMTA 1KU0A 1FDOA 2E0IA 4KQKA 4ZPJA 5EUBA 4GDFA 3D43A 2FW7A 3ROTA 1ADYA 3E8SA 1NXPA 1GFIA 1VHQA 3Q12A 4TQUS 3R44A 3G8DA 1RWOA 1R00A 4PM4A 4WH0A 1COWA 4PYMA 1H65A 3EMKA 1JF8A 2ZIGA 2Y8EA 2B6HA 3GLIB 1MJFA 4JZYA 1ZKDA 4QHYA 5KYGA 5LQRA 2H8KA 1U04A 3H11B 1FDSA 4BJ6A 5JS2A 5KYNA 1FBNA 1ODCA 3WFJA 4OQEA 3HKBA 3BAFA 4E5YA 4CIVA 3PHCA 5JFOA 4AZSA 3E70C 4JEUA 4D79A 5J5VA 1G1MA 3IHLA 1V3TA 4MPPA 5JCZA 4IG9A 5EIXA 3EW9A 1IUKA 2ZYSA 5IFLA 2GBGA 3GEHA 1YOVA 2WZQA 3FNIA 1Z6ZA 2AN1A 3ORYA 1CY2A 4R9NA 4UPEA 1M66A 2W0SA 1TA9A 1L8QA 2GAAA 3ZIDA 2G9NA 4UTVA 1H9BA 1M6VB 3KL4A 3RBXA 1Q1AA 4LC9A 4DMFA 2FFQA 4HQLA 4PRLA 4K9DA 1PLLA 1SXIA 1JJBA 2ECKA 2YJNA 3AI7A 2AJDA 3JQAA 4PAOA 1ODKA 2VLIA 4M8IA 3VDXA 3EUEA 3B3JA 3H1EA 5FEMA 4B48A 5C7YA 5CA1A 1E5XA 1YI8A 4HB4A 3S44A 3ORRA 3QU2A 3FSEA 4M0DA 2JGDA 3H2JA 1TK3A 1QQTA 4JITA 3T95A 3NI2A 4NFSA 4D56A 2HMSA 1SPBS 1ZGHA 4G81A 4PAWA 1PWHA 3DE6X 2GKOA 4G63A 4JX9A 4US1R 1X1BA 5HCNA 2LIVA 2OAEA 2XCUA 4AJJA 3KJHA 1JEQA 3QITA 3VYSB 4BCBA 1U7ZA 1K6XA 1OC4A 2C4NA 4YRSA 2RBEA 1GGJA 1W19A 4GSLA 2WSMA 4ZEOA 2NZUG 3GJ8A 4X6LA 5BNWA 3CVVA 2NSYA 1XTJA 1ZD5A 3VGPA 1R0SA 2D0OB 1SOVA 2D13A 4EUKA 3ERCA 3BZBA 3FA2A 4X94A 2WTMA 4F72A 2B4YA 1YA6A 1FXWA 1P77A 2QUHA 2DJIA 3WBKA 1Z4LA 4KEAA 2AXNA 4P5DA 1JIIA 2P35A 1DHTA 3PNPA 3QYAA 5EKUA 3T3PB 3BIJA 4F1JA 3AU9A 4MJXA 1CDOA 2QN1A 3AFHA 4DLWA 5K01A 2YWJA 3IQHX 1Y3BE 3V1YA 1U98A 4QGHA 4QUGA 2W2PA 4JELA 5H82A 1GXSB 2ZXUA 3OIVA 2VNJA 2A4MA 3U44A 4BZPA 1XXHB 4QTYA 5AVYA 1HYBA 4EG0A 3E0XA 1C4OA 1Z33A 3WIUA 1Y1SA 2GEDA 2QDXA 2JJ1D 3CJQA 4F5YA 4LDRA 3VR2A 4UMEA 5EIWA 4BQRA 4C20A 3IILA 3CVXA 1U2GA 2FQQA 3H0KA 4ZCPA 3FHTA 2CC2A 1Z2CA 2BKEA 1L8XA 4KWTA 4QASA 4TXMA 3IKMB 4WNAA 2VDVE 4NU8X 2ORVA 4D9NA 1JG7A 3H9BA 2XUAA 3OSZA 1MO5A 4GQBA 3FNHA 2GPBA 3SLKA 1RYDA 3LQ2A 5HF5A 2H48A 4KXNA 3UGKA 5ENVA 1V3UA 1SOMA 4AX8A 4IOMA 1QJ4A 3AOEC 4WASA 1XDGA 3G85A 1N75A 4CT0A 2VRCA 4EX6A 3ANTA 1AA9A 5I8WA 2JRLA 4NG4A 3V80A 5JD6A 1RPZA 3P2EA 1NI5A 2ZB4A 4FFNA 4EPRA 4KRYA 1VPTA 2H16A 1FYVA 1M6YA 4QBHA 1P5HA 2ZTUA 3NVDA 4FLMA 4LEIA 4UDYX 1QIGA 3U2QA 5LWQA 1NZJA 1XZ8A 3AW9A 4TL9A 1SB8A 3JQ8A 1MAAA 2W0MA 1EH5A 2P0AA 1B0AA 1EE9A 3DTNA 1YVRA 1F8GA 2JDID 2QZSA 4YO7A 4RZXA 2JLAA 3ROMA 2MYTA 4CDRA 3DWGA 4E1BA 2XUIA 5G3ZA 3VNSA 1YNOA 5HTOA 2AG0A 2FFAA 5B55A 3H6KA 4MI9A 3SHTA 1V1JA 4Z4CA 5KOHB 4MWDA 2QAJA 2BH9A 4FKBA 2OCBA 4C7OB 3TQFA 3LHKA 5JZMA 1X7ZA 1VIVA 3B6ZA 1W85B 4B6PA 4C03A 1P74A 3RB8A 2Q0SA 2XB6A 4NBWA 4CDMA 4YUVA 2VC2B 2F1RA 1WSAA 5IAJA 1U1CA 4H4EA 2QJRA 4CGYA 4Y7DA 4M8NE 3DZCA 4YP5A 1IH8A 3PT5A 2J3HA 3T5CA 1P4RA 5B1YA 1XQ1A 1TZ2A 1SWVA 2E5WA 3DHNA 4W7HA 5T4HA 3OZDA 1KYQA 3WYBA 2V5AA 3HYSA 4JI4B 4C4YA 1RLTA 2PL5A 3OJEA 2GEBA 1KSJA 4QBGB 1EUYA 2JG3A 1Z39A 3HCOA 5LUAA 5TY0A 2IITA 1M8PA 2F3PA 1RIIA 2JD0A 2OZLA 2WYWA 3LXRA 3FUWA 4KX5A 4OMDA 2XZDA 4F2PA 1U7XA 2WNHA 1LD3A 1MORA 3UAVA 4HNSA 4H3SA 4QVGA 3UCFA 3COWA 3ZCVA 1SIUA 1X8LA 3D8UA 3T1HB 3EOZA 1RZVA 3HFJA 3MXTA 2J3KA 3FBWA 3DDCA 1N25A 3RRXA 1VGRA 2BR5A 4EELA 1ISGA 5G1PA 3F7OA 5D87A 1ZRSA 3EUAA 2YWXA 3C4QA 3F1LA 2B61A 1O77A 4B9EA 4UEQA 3TL6A 1KPGA 1UM8A 4G5RA 4FMPA 4ML3A 3TOCA 3A1DA 2O8BB 1KXZA 1EA5A 2FMTA 2PN1A 4I55B 3K6SA 1RZRD 2OCXA 5EA2A 2GPYA 3P97A 3VC1A 2DE0X 3K2QA 2BISA 1M83A 3GFBA 4OQFA 5LA6F 4N3AA 4B7AA 3HGMA 2QVGA 1LBHA 1OU4A 1YCDA 1X1TA 3KU1A 1CUSA 1L7VC 3L8YA 2XWBF 2RGCA 3QPCA 3RRBA 4A6XA 1BAPA 4LY9A 2K7FA 1PLKA 1U9CA 1J2UA 1FQOA 5ESDA 2PMEA 1HH4A 5AVXA 1K97A 1T2FA 4UPVA 2B34A 1XVLA 3LUCA 2O8CB 3F97A 1D4FA 3AT1A 4B4VA 1YB4A 5LU8A 2G09A 1H22A 4YT4A 4N8EA 4HH3C 1LY1A 5CX4A 2GCOA 2IS6A 3DXYA 2B8NA 1GAEO 2IP4A 4PGHA 4OHUA 3WJ7A 4MUHA 3PLNA 2PEYA 4LOJA 4UTOA 3W3AD 4BNMA 1I1HA 3K92A 1Z2NX 3VQTA 4AKHA 1A7AA 1E18A 3KHTA 2ZYVX 5HBRA 2X0RA 2AA3A 2IYSA 3SMQA 3DKRA 4EGFA 1PT8A 2J3QA 2XA1A 2W9XA 1CUWA 4MQLA 3CLUD 1PL6A 2WUGA 1Z7WA 1IVYA 1XKLA 3HE3A 4RFVA 1E4EB 4B4DA 5AO9A 4AKGA 1EX7A 1FNSA 4CLRA 2IIQA 2ZANA 3WYFA 1OXTA 4BX0A 2GUGA 2PRIA 3FFXA 5K8IA 3C3CA 1P4AA 1H2XA 1M5RA 2K7ZA 1SXJC 5I7VA 1Q95A 1ENZA 4Q9KA 5JCOA 3GQVA 2OVFA 1J00A 4Q37A 1GR1A 3TOZA 3NGMA 4YQYA 4JI2B 5LQJA 3Q72A 4ILEA 2KBEA 3TLEA 3ZGYA 2GZ3A 1E3IA 3WLIA 1IY9A 2P4EA 5BW5A 1OGJA 3A06A 4KPUA 1BDBA 2I2WA 3FUCA 3ZGNA 5J2TF 2MSEB 1FMTA 2VHJA 4UC0A 4ZDKA 5IEJA 5TC4A 2P9EA 4U6QA 2G77B 3OAAD 3TQOA 1BOOA 3KFLA 1NNUA 2QHXA 3P2YA 1RBZA 4B3FX 1TYZA 1JFFA 2YC2C 3HBNA 5IW8A 1YGYA 1ZMRA 2IYVA 1JLLB 2QL9A 3JWPA 4JQSA 4PCAA 1US8B 4R81A 4C0WA 1OH8A 1V8DA 2C4KA 4XM0A 5CDFA 1A2OA 5PGMA 4BZZA 3FX2A 1TVEA 1ZMTA 4PR3A 2ZZMA 3UJ7A 1ZJYA 4DIDA 2OLJA 5HUQA 1QGED 3R5TA 4V1CB 2VQ6A 4LDQA 2WPDD 3LP6A 2XVMA 1KJIA 4RHEA 5CURA 2C2HA 3M83A 1HQCA 1IY1A 2P41A 4JWTA 1ISSA 1O96B 4Q9AA 4LKRA 2XZPA 1E60A 1URPA 5EZ5A 1EVEA 1V8BA 1XRNA 1BWRA 1JSLA 2AG8A 4G9GA 3X0DA 3BUSA 4CIWA 1KHTA 1Z4KA 3TRFA 2VXCA 1QORA 4KXLA 5A5EA 2A7XA 1ZY2A 1NULA 5BYBA 1CVLA 1UDWA 3UB3A 2G5GX 2VP2A 2ZIAA 4LOLA 2J48A 3LQKA 2VJKA 5IXSA 2AZDA 3I83A 5DFAA 3W5AA 5JRJA 1ATIA 3NLLA 1UK9A 4H1UA 3ZCTA 3KT8A 1V5IA 1FQJA 1HDEA 4IY1A 4RKYA 3WA6A 1JN0A 4YUWA 1U6IA 3SAJA 2CCGA 5A3SA 1EIWA 2R1VB 2Z43A 1HE3A 1ZM9A 1PJBA 1IOWA 3KZXA 2NVUB 5C4MA 2FY8A 3N05A 4X92A 3SXJA 4ZA2A 3ROEA 4DTCA 4EHHA 1E9DA 1P60A 1N8TA 4B3IA 5D7NA 3IIMA 3TD9A 4XVUA 4AG3A 3CB2A 1P8JA 4WI1A 1GG9A 1M2VB 3OM0A 4IHJF 4RKWA 4EJ2A 3H65A 1L4NA 4LI3X 4M38A 2OXCA 5HK8A 5IDXA 4L50A 1AK1A 1HR0B 4M46A 2C3UA 2RHOA 2WB2A 4BGDA 1GG5A 1DHRA 4N3BA 4PNZA 1ZOSA 5KDDA 2UZIR 4GDMA 3I2IA 4IIEA 2C4MA 4RA9A 1NVBA 1QHEA 4TS1A 5AHKA 1SIOA 2QVLA 3CRZA 3PT9A 3AG5A 3G1UA 3L2OB 4FFBB 4CM8A 4YCSA 2EFJA 2J6BA 4ZKEA 3D7SA 4CDNA 1NMSA 2Q5QA 2WUEA 2HF8A 4IHKA 2GETA 1J2RA 5C5DA 2O2DA 1P61B 2H92A 2AC4A 4OQLA 5T6MA 3I6BA 4LVCA 2B82A 5I7FA 3QXHA 3FVVA 1UC5B 1RWBA 3H8JA 4K1XA 3NB0A 1T4DA 2IV2X 3PRYA 3W6NA 3G59A 2Y1GA 3G2PA 5A04A 3DFMA 1F06A 4PBTA 2EL9A 2ODEA 3DBHA 1NF9A 4ZVOA 1IN4A 1LPOA 2JGFA 4V02A 3E53A 2QQ5A 1Y81A 1YCFA 2W90A 4HLDA 5TGZA 4C89A 4FK8A 5CLHA 4CHTA 5BSUA 2WZDA 1JHYA 1C7IA 1WXEA 1I5EA 5KAMA 1QLJA 5KNBH 1XZQA 4OL0A 1OJ7A 4AD8A 5CM9C 2WQ6A 2Y0PA 4PYKA 3PUZA 3ZCXA 1JBKA 3T61A 3W2HA 4YRPA 1PGJA 3S27A 2H1VA 4EBFA 3NIWA 4UAGA 4B44A 2IIBA 2ARKA 1W96A 3AERA 1CUDA 1S4MA 2PZJA 3HO6A 4NFYA 1E1CB 3IODA 1E0SA 1R5BA 2AJLI 4MQEB 4FDLA 1DAGA 1ORRA 2UVPB 4GXQA 4P84A 3WIVA 3HB9A 1QIJA 1W0CA 3AWDA 3U4QB 3KKMA 4D0LB 5DW0A 1V0JA 4LW8A 4B17A 1JR3A 3HACA 2QLLA 2QTRA 5EE3A 2EKDA 3SICE 1DJPA 3CU5A 2OEPA 3K1AB 2IUFA 2VJAA 5LC1A 1RXSA 3S7TA 3NHKA 2VHYA 3VZRA 4D98A 2PUHA 5CK5A 1IBLB 1E4YA 3IBCA 3U37A 5ALQA 3VSDA 5AICA 3DE4X 3H2IA 3LXXA 1VGVA 3C6YA 3CNLA 4FHZA 5EGNA 3V97A 2R7MA 4EA9A 2IH4A 2P9CA 1X1QA 1OFHA 3FYUB 1BCRA 1LBIA 3M4NA 5DLDA 1QYRA 3L40A 3NTVA 3VI3B 3QVWA 2X6RA 4U7PB 1SIWA 1BGWA 1TMKA 3DG9A 5A3VA 3TE7A 1DLJA 5EXXA 5LOVF 1XGKA 1FUYB 1GLGA 4BFZA 5AVSA 5KNDH 2A94A 2VBIA 3TR5A 4PX5A 3DBRA 4WA8A 1ZH8A 4PLYA 4QARA 1RT9A 5EMJA 2BKUA 2QTHA 4QEZA 2D1TA 5ENZA 3V1LA 3ZLTA 3L8DA 3X1WA 3ZDEA 4JBXA 1MOPA 4UXHA 3CO5A 4Q7QA 2NXJA 1FA9A 4MR9B 4MS1A 2DPLA 5C34B 4C7BA 4U39A 5KNLA 1GFZA 2C9MA 2FF5A 4QGAA 1GADO 4F3NA 4JMPA 4CCYA 3OQHA 3E7FA 1TT5A 3GLTA 4DM3A 1X7YA 4X1OA 2ZBRA 1K6EA 4MVJP 4HJXA 2LCIA 4U2DA 5M5BA 4BNJA 2WKRA 2ZG6A 1S5PA 2YN2A 1AB5A 1T0HB 3IUBA 4Z51A 5CX1B 1O97D 5CNKA 5E1DA 2CNBA 1KFJB 2QGNA 4JUBA 4XPZA 2CE7A 3NV7A 2JEYA 3P9KA 4TLBA 4WOCA 1ZFNA 5B3JA 3GDOA 3SD7A 1ZC3A 3A70A 3QVKA 4K0KB 1ZJ5A 2BEUB 2VWQA 2EP8A 1FLAA 2QRVB 2IS4A 1VKNA 2X9LA 3H4TA 4IDDA 4LRSB 1T36A 3QPVA 1D3AA 3QE0A 3DULA 3EODA 4JLPA 4ASUD 4BQFA 4KNYA 3TFWA 5IKOA 5TQ2A 1VB5A 2DWCA 3HEBA 5B6JA 3O8QB 3ACBA 2YV5A 1YS4A 2JIQA 2PLAA 2P2ZA 4IS3A 4JT8A 1Q1BA 4MUIA 2GNAA 4XYMA 4X71A 2ISCA 4EY5A 3FKSD 1ZR4A 2V7WA 3OKPA 1I94B 2AV6A 3JQ9C 2OD7A 4XB6B 1G5HA 4AN0A 4BAZA 3R3VA 4C6TA 2H2WA 2A35A 3T7TA 1HQKA 4DBLE 5E6SB 5C81A 2C5AA 3DP7A 3LQ1A 4W4TA 4WV3A 4B7ZA 4LSWA 1QR2A 3D1LA 3VNAA 1KEUA 1W6UA 2RHDA 3WGJA 3ZE8A 1FFHA 3FR8A 4DILA 6YASA 2PD3A 2A9OA 3IKVA 4RSMA 3UJNA 4KN5A 2JD1A 4UU1A 1J0BA 1JI0A 1WG8A 4KN6A 4ZCSA 4TXHA 1JKXA 2FN4A 1OX4A 3WLNA 5C51B 4B6EA 2OQ2A 1P4HA 3MLBA 1ENYA 1U8YA 1L4FA 2CVOA 2EZ4A 1XN4A 4JJKA 4ZYYA 2F64A 3PU6A 2GXSA 3GUHA 3HCDA 4YAEA 2D1YA 4Z9BA 5DULA 4NBRA 4R0MA 4BMYA 1DKNA 1T6ZA 2E48A 1UK6A 4JU8A 4MW5A 4OLBA 1KOGA 3VU9B 2BW0A 3WQRA 3C2QA 4ARAA 3PXCX 4JIMA 2DZDA 3EQZA 5DK6A 3U31A 3S55A 3BFPA 1G5QA 4K3VA 1PK9A 3KAPA 3M6UA 4M0CA 4YJHB 5GV8A 5JAMA 1V95A 4Y2HA 5FOVA 2QTWB 3TKYA 2DRIA 5AW5A 2YDYA 1U0HC 3GVIA 2IU6A 3KM0A 3QVVA 1BXRA 1DQYA 3MELA 4KVAA 2IV7A 4NJEB 4FWTA 3E9YA 1UJ4A 2X9VA 4H17A 4AICA 4QU0A 3VH3A 3VO2A 4JHXA 1TPZA 3K0KA 1NF3A 4JT2A 3WDMA 1ULUA 4WERA 4AO8A 5GJBA 1CE8B 1RPAA 1X1CA 2SICE 4ISBA 1WHSB 1YE5A 2JHAA 3KEQA 3CRW1 5BR4A 6REQA 2X8LA 3AEKA 3A6HA 4G26A 4Y6LA 1V9LA 1JT9A 1M2GA 2Q1YA 1EK0A 1ZSNA 5B7QA 3MRTA 3O84A 3P2IA 4XTCS 3B1VA 3HPRA 4HGOA 3KDSE 4LDJA 3E5HA 2G6BA 3D3KA 3U4GA 5K3AA 3R3ZA 4RVOA 2R1ZA 1LLDA 4BB9A 5L7WA 2JAOA 1IHYA 1GFWA 3O74A 3GXBA 2OHGA 2BPOA 2PKQP 1E3QA 1M6HA 3HZZA 4QYTA 1Z47A 4E7PA 4ZK6A 2CV0A 3WWCA 3O8DA 1WZIA 1Z8FA 3EDQA 3UPTA 1TM5E 1G64A 4KHPB 2Z8YA 1W88B 1PNRA 1KQ3A 1KY2A 1W5AA 1N1GA 3B1FA 4QHSA 1KQFA 4PPGA 5GIPE 1RYBA 3GQBB 1QFMA 1KORA 3LQ4A 4E5UA 1ATZA 3O7WA 1XO1A 4TXJA 3B53X 3R9IA 3DMFA 3EF3A 2V6IA 5AK3A 3ZK9A 3D6NB 1XX6A 1U3WA 3O83A 2FMUA 1TQ6A 3OCJA 4F7WA 3NP7A 3AVUA 4Q7JB 1OKKD 2XGOA 1KFBB 5ALWA 1RRPA 3OF3A 4JP8A 2ZJYA 3CMMA 4L73A 4CKBA 4W5HA 1Z34A 3NM4A 1AHNA 3VC2A 3E7WA 5J4YA 3MWDB 2FKNA 4PHFA 4UD2A 3M6AA 1ZC4A 3V2GA 4PNEA 4OYRA 4MQFB 1GTVA 3UMSA 5KTKA 2H4YA 1PGQA 2E7ZA 3KCNA 3UYLA 3N2KB 3TLZA 2FSUA 3RO7A 5ALOA 1IIBA 3NKVA 2Z5LA 1EFTA 4R3NA 2G0AA 2O3QA 4TM7A 4IIVA 1N2GA 5F7XA 1ECCA 4O4HF 5FI0B 3W5SA 3FNQA 4FE3A 3QA9A 4OREX 1JEJA 4RJLA 5HIKA 5I6DA 5INTA 2ID4A 2V8BA 1JG3A 3U17A 1CB0A 3VM6A 1P81A 1THMA 2P0YA 2YY5A 3L18A 4Q3AA 5KX5B 3IPXA 2Q4BA 1F2TA 2HWYA 1PI3A 2JA1A 2EKBA 3KKNA 3SXUB 4JJEA 4LX8A 4HNUA 3T15A 3EGIA 1YCGA 4I9HA 1XAHA 2XUFA 5D1HA 3GWZA 2WU0A 3OZIA 4HTFA 5FO1A 4UJ5A 5CFNA 2WA2A 3R7SA 2DAPA 3LKZA 4IV8A 2O8NA 3TX2A 5CRIA 4D2IA 1IWOA 1MAUA 2JGEA 1G19A 3QKUA 5IAEA 2XLCA 5DXFA 5A5GA 1LWNA 3FPHA 3FTEA 1UDCA 1DKLA 2HYDA 4YLEA 4O4IF 2Q45A 1N9ZA 4I1VA 3KUUA 1XKQA 4XYGA 1USVA 3OJOA 4NHOA 1LJUA 1T5IA 4Q02A 3KBBA 2AZ4A 4A1OA 5JTTA 1E1MA 1J0CA 1KYXA 1TZCA 4G1UC 4I1OA 1X7DA 2W6JA 4K8OA 1Q0SA 5B1EA 3B3GA 3PGKA 5FUVA 4NPHA 4MR7B 4AYXA 1Y1QA 3UK0A 3UHOA 3R6GA 1DV2A 1IATA 2ES4A 3STXA 3K1YA 1VJ5A 5JC8A 4UQPA 1U02A 2OESA 4JS0A 4F5ZA 5HS6A 2IS2A 1BHQ1 4QQRA 4QDKA 3TO5A 5LOVB 1JDNA 2GPWA 4GOLD 2VK4A 2DP4E 3THSA 2FW0A 4E08A 2BDUA 3E27A 4GQAA 1Z0ZA 3HN6A 1E3EA 2I9PA 3VU0A 7REQA 2QTVB 1H4VB 4GLBA 1U5CA 1FXUA 2IUSA 4XJSA 2ASVA 4LFCB 1KE2A 4U3JA 4ESEA 1M9NA 2D2XA 1NQXA 4PXAA 4V24A 2BLLA 4V0NA 4ZMRA 3C6ZA 2YIVX 1FS5A 1N92A 3FSJX 3PPYA 1U8UA 1YDEA 2B2XA 3CZCA 5FAXA 3WV4A 3K1ZA 3U7GA 3HTXA 4LTMA 4I2NA 2YBDA 1YKSA 3RU3A 4EPXA 4NESA 5EZ6B 1M34A 3HFSA 4YRMA 4RLFA 3TW8B 5J1SB 2YV3A 5F5LA 1E6EA 1FDVA 3RS2A 2RC6A 3JVIA 4FHDA 2WM8A 1Z73A 1NMYA 2A1TR 4QYIB 4YI3A 4B2PA 5JEDA 3L4KA 3U9SA 1FTWA 2P8SA 4CE6A 5E6UB 1ZICA 4CQMD 4ZU6X 2BWJA 1TYCA 3QOWA 1GSIA 3M89A 5JQWA 1WF3A 2P5YA 4Y2PA 1VSQA 2M6RA 3DKKA 4E30A 2IXDA 3ZHBA 2NO9A 1DX6A 3EQ9A 5JWHA 3DDHA 3S28A 4RLSA 1Z5VA 3JQRA 3T3IA 4AS1A 1BE1A 3SKYA 1GT6A 2DFLA 2H6EA 1N8NA 3AXSA 4A27A 4DLBA 3LVRE 4CKEA 5DP2A 3T99A 1VCMA 3ZNOA 4AJKA 1X7WB 2C5BA 2HWXA 1N5LA 2Y1CA 5IFKA 4MPTA 3ZD7A 2XUHA 5CDFE 3REQB 2ZRPA 2OFXA 2R79A 1A9XA 2Q0XA 1EFUA 4ZARA 2V7QA 4QSMA 3GF4A 4E5NA 3E6AA 4ZHSA 2MSCB 3A28A 3FDFA 1T0PA 3AX6A 1Y7IA 2ZRDA 2IBSA 4B80A 2JHPA 5A9SA 1OJLA 3GVCA 1SKYE 2YHUA 2EX1A 3LA6A 3C1TA 4GBMA 4GZLA 3SQNA 4ZOQI 4YUAA 4FJ2A 4C2UA 2P9FA 5C32A 1OI7A 3KJNA 2AOVA 3N7AA 5E4TA 2PH1A 4KXFB 2FMIA 2P5TB 4UNRA 5C7IO 5J2UF 4V2UA 4J43A 4DJAA 4EDFA 1YZUA 1POWA 1M33A 2JFZA 2OBBA 4HB0A 1W87A 3QBDA 4EMUA 1DKRA 1OFTA 4D4MA 5I7SA 3KJXA 3W7AA 5C8ZA 1OA1A 3SLGA 3HKEB 3U6KA 4Z99A 5EVCA 5C8YA 2PQ6A 3TZEA 5IWCA 2HF2A 3I5AA 2BRUC 4NECA 4Q3BA 4CKCA 3QPAA 4LXTA 1PVDA 4M1QA 2JCVA 4RWZA 4UUQA 4YDQA 4BNVA 4EZIA 4O4JF 5KSZA 4P5EA 3D0OA 3ITDA 5AOVA 2HV9A 2QL6A 2VJMA 4YXWA 1QH0A 2OCIA 3KSZO 3U7EB 4I81A 2WMOB 4RK4A 1ZYUA 1RDFA 2RHTA 3HADA 1JHOA 1QZUA 4HVAA 3GPCA 1C8KA 3TSOA 1EGMB 1VHTA 3ILXA 3WG9A 1QLHA 4DSUA 1U2QA 1E64A 2VLBA 4MMYB 1R88A 2IDKA 2E37A 3B85A 3QVJA 3RVOA 4WKNA 1T8TA 1JH9A 1C3OA 1OA0A 3H97A 1MC1A 1I0LA 3P4XA 5HW0A 1HXHA 2FPWA 2XMRA 4WECA 4GEKA 1AUVA 2R2AA 4K87A 4CV1A 2QW0X 3L1UA 1NR5A 3AVTA 1TIPA 3HWSA 2C2WA 2HLDD 3KUCA 5THKA 4F71A 5T6BA 4PQFA 4KYVA 3EEBA 1ND5A 3SQWA 4HWKA 4N5MA 4L28A 2VCEA 3PHLA 3R23A 4P4UA 4Q00A 5FOWA 3UAYA 5LDDC 1B4DA 3GRAA 2PAAA 4J07A 1MQ9A 2QRJA 3K15A 1FUKA 3JQCA 4DF3A 1IWBB 4MJ3A 5FRDA 1GV1A 4PZPA 4HMQA 4U7DA 3N0XA 4P7BA 3VTFA 5KC8A 3U9LA 2Z09A 1KJ9A 3V4ZA 4RD4A 4X45A 1EJ6A 3SR3A 3FTPA 3EJWA 3A3OA 3E82A 3U6BA 2QRKA 4Z8XA 5EMKA 5A6SA 1GRRA 1NFFA 3SHOA 2ZI6A 2QW8A 3LE8A 3A3YA 3IP5A 4A26A 4DCSA 5BV1A 5AVRA 1MNAA 2YZKA 2H1LA 3BTVA 4A10A 5AW1A 1BMTA 3KIPA 1B6SA 3WGOA 1C29B 4RGBA 2PZAA 2BEVA 3DMTA 3L8GA 5BRAA 1VBNA 3BULA 2EARA 4A7PA 2BDTA 4LJSA 2PZGA 4BLVA 3MINB 3MTQA 5CJJA 5LJIA 3R6DA 2GAFA 4WLEA 2JGNA 1H2HA 3QMVA 3RV4A 1JAXA 4NMHA 1YQWA 3ZDBA 1QSGA 4EB6A 5ULLA 3WLPA 3PE6A 2O3SA 1GHTA 4JP2A 3KQMA 1E58A 3C43A 4M6WB 2ZVPX 4BP9A 1LQ2A 3RJTA 3SM3A 2O2XA 2WOOA 4AC9A 1VE3A 1JR3E 3ND7A 4NE7A 4JBIA 5LZ5A 2OA0A 1N33B 1F9EA 2QNRA 3ZWNA 1QXSA 2KBFA 1U8TA 2ON6A 4YAIA 3R7WB 2FG7C 4CM4B 5KIAA 2ETXA 1KJ8A 5CA0B 2UYHA 3BWCA 2QD5A 4M1KA 4PC2A 4S1TA 1RXCA 2CZGA 2X2EA 2DM6A 1AHIA 3GLQA 3QXSA 4OSEA 1LVGA 4R7TA 2QE6A 1M6WA 2KS6A 5HDBB 1G1AA 2X5XA 2HX1A 3E5NA 1GUYA 2IBMA 3ECSA 4HGYA 5LIPA 3JATB 3M70A 3UT5B 3ETCA 3L7MA 4AZ0B 1SXJB 5JPCA 5FF9A 4ARBA 3Q8LA 5K20A 1JAHA 2ONCA 3LJKA 4QM6A 2JJ1A 4OP2A 5CW1A 4Z2AA 4QUHA 3N2ZB 1RZUA 1G5RA 3BS4A 3NORA 1Y7LA 3PD0A 1GSHA 2XSZD 3VOBA 3B9RA 4F56A 4CMJA 3EZXA 3VISA 3LBFA 1M2JA 1N6KA 3IX7A 3ELUA 3NU1A 2XHEA 4S35A 3GHHA 3HJCA 1E5VA 3TQTA 3HBFA 1MQAA 2FZEA 3HXKA 4H0CA 1LV7A 2XVYA 4H7HA 5DBGA 3TUIC 4QD3A 3DCNA 3H1BA 2CCKA 2Z56A 1K8YB 2FN7A 3ZW8A 4CCSA 3EW7A 4F6RB 4EHFA 4R16A 2VH5R 1FU7A 1UINA 3TIGA 1MP0A 4ADSG 3R0ZA 5FNVA 1JFRA 1KOJA 5AM0A 3ZS8A 2P90A 1UMBB 3NNNA 3L43A 2DQYA 4BBAA 3TX6A 2XWJI 4B2IA 1W44A 1E0KA 2RGNC 2DB3A 1QU2A 2ZSKA 2JDIA 2G1KA 5AT1A 3ZBPA 1U9IC 4AS2A 2CYBA 2OXRA 4YRZA 3R9KA 4PO8A 4DIMA 1WJGA 2DBQA 3ORSA 4X6YA 7AT1A 2ZPTX 4EMTA 1OE0A 2Z98A 3OZRA 3T3EA 1Q74A 3N28A 4CNQA 5B12A 4L9RA 3NXKA 2H8GA 3B78A 2X8BA 4RVCA 6CHYA 2B8WA 4DDMA 2P4QA 3LFUA 2PSHA 2AE1A 4X6UA 2LD4A 3GY0A 1QOPB 4GVLA 3PJRA 3FMIA 1BOFA 1WBDA 4DIUA 2P2CA 3K0AA 2JLSA 4BGUA 4BNFA 3OE7D 2GXQA 1GDHA 1UK7A 3GYBA 4KN8A 3UJ8A 3EFHA 4HDKA 4HNQA 3H8SA 5DEOA 3COJA 4XDHA 3U3DA 3U7HB 5C8DA 4G5QA 1ZVMA 1S1MA 2OBNA 1UXOA 4GECA 5ER6A 3SIRA 1ULHA 4L6AA 4RAQA 2E1RA 3EBPA 3HDJA 2HMVA 1W4LA 1X15A 1XP8A 3E2PA 3KHKA 4FZVA 2BF4A 1CV2A 1ZIDA 1TA0A 2ZJ5A 1ZZEA 2O7SA 1WCIA 3D4LA 3PB3A 4C7JA 5JCPA 5JVDF 3UV3A 1KO7A 3VO1A 4QSHA 2XD4A 5E1MA 3FPGA 2ZSBA 3TTSA 5KMGB 5F2EA 2GDJA 3ZGOA 2BM1A 2EZ8A 2CBZA 2GCGA 4MGEA 4L3OA 4BVHA 3R09A 4BAGA 4D9FA 3WMFA 5HKOA 2BAGA 4TSFA 2TECE 4MZDA 4BMNA 3OLYA 4TYYA 2V7GA 4R8VA 4F2DA 1A50B 2OQRA 1V1MA 1J8MF 4BLSA 2WTAA 5K3BA 2GZMA 2I4LA 1TCAA 2HQOA 1G0NA 3IB3A 4LE1A 3BH7A 3FGZA 1RZRA 1JEYB 1H2RS 1FC0A 4URWR 3WP1B 4IFTA 4PIVA 2AUMA 4ZQBA 3UENA 5DASA 4WBNF 3LPCA 4EVIA 2MT9A 1Z5PA 3H4VA 4C3VA 1FSSA 1UT8A 1GQYA 1G3QA 4Q4LA 3SS9X 1ZNZA 2L2QA 4TZTA 4BU1A 4DBLC 1LX6A 4RDCA 4ND8A 4EAAA 5ICGA 3HCBA 1UAYA 5EG5A 2W2KA 1C1DB 2BFBB 3CLHA 4GPTA 2JFOA 3VDQA 1O0CA 4LF4B 2OGWA 2DBRA 1HDRA 1OI2A 2ET6A 4GZMA 3AZQA 3F6EX 2FXIA 4MS4A 1P2TA 3LUAA 5KQLA 4CEHA 2B9EA 2F8SA 3MUNA 3TAXA 5K6RA 1WL8A 4CM1A 1HKUA 2FK7A 5TDHA 1HQDA 1XZBA 2A9FA 3DLHA 1QF7A 3SFZA 1N9GA 3I76A 2CLCX 2ZB2A 4IWYA 4R51A 5D51S 3A9CA 1GO2A 4ZYZA 4RS3A 1UIRA 1B16A 2HPZA 3OCZA 4FN4A 3E1GA 1XRQA 4M9XA 1N3LA 1T2AA 2AGVA 4YMWA 3W2GA 2R97A 3EIFA 4P1ZA 2BFAA 5JSYA 3IAXA 4YP0A 2LIPA 3RGWS 3ROQA 4EZBA 5B7GA 2QQGA 4RV4A 1QC5B 2C31A 1ANKA 1QPBA 5AFSA 3GIWA 5DKFA 4BJ5A 4QAQA 4ZJUA 1B1AA 5IUNC 1BTOA 3HU2A 2A5LA 4W5OA 3BA6A 3HKCA 2OZPA 4I50F 4DNQA 5FH9A 2C20A 3GAZA 4GLFA 5ADWA 2REBA 2WD8A 1LFDB 1RS0A 3ZIAD 3JALA 1EVLA 2VRWA 3R9WA 3KJGA 1FUIA 1GQSA 3SZLA 2FWJA 1R4NB 2QAGC 4NBTA 3WAJA 1VHDA 1XTZA 1M2FA 2H4HA 2C2KA 2G67A 3AXTA 3ET4A 2BGIA 2G07A 4G0YA 5D8DA 3WGTA 5IM4A 2O2GA 4RV5A 3OQIA 1OWOA 1Y6GA 4TZ0A 4ZV7A 3KKZA 2GD0A 4IINA 1ZJ6A 2WUVA 3OAAA 1PWYE 3QXJA 1AQNA 4BNWA 1U0BB 1EP9A 4BIIA 2C9DA 2E2WA 3OE5A 4Q3KA 3TG8A 1JQEA 3O03A 3GMSA 1VBFA 4XVQA 3FPAA 3MM4A 1PFUA 3M9XA 1S8FA 3WDKA 4F3CA 1HORA 2ZJOA 2R751 4YCNA 3OLWA 3LTNC 2EKLA 2IXFA 4E5MA 1UFKA 2HCFA 1VL0A 2OV2A 3CGGA 1A5BB 1ZOLA 4FZ5A 2XQVA 4YMUA 4ZJPA 2ZE5A 2WPDA 2JLRA 2XECA 1C9MA 3EZNA 4IIYA 2RK6A 3KD2A 1N5DA 4H31A 3WLOA 3RHSA 4D9GA 5IC4A 1KQOA 1MB2A 3I2YX 3NGLA 1C1XB 4U5QA 1E2NA 3O94A 3TSCA 5C9ZA 5ER9A 2W42A 3CZMA 5IKPA 3G2LA 4D9CA 4EF4A 4HRVA 4C0HA 2CXOA 5LU9A 4P98A 4OQ4A 2XCSB 1MB0A 1NTOA 1YR6A 2HA7A 4JQYA 2Q4RA 1Y1KE 3W7BA 4BPRA 1WSDA 2PBRA 3ZE2B 4Y6OA 5HK9A 3RM3A 5HG0A 1UWVA 2HSDA 2WHRA 5KYXB 5FPKA 3CE9A 1VC2A 2GPSA 3KJQA 1ZGGA 4ZAGA 2XXAA 1GCAA 1KSFX 5GJCA 1T4MA 1N57A 1OXBB 2J5KA 2ZXFA 2AK2A 2EHDA 3L6BA 4L4RA 3TUJC 3F4KA 2A9PA 4C7MA 1ZN8A 1FP4A 2IYAA 2UYQA 3QG5A 4N0QA 3GJ3A 1NRWA 5I51A 1SELA 1ZD1A 1F0YA 3NTUA 2C82A 4BO4A 1V6CA 3ETNA 5COBA 4KR9A 3ZK8A 4EKNB 5E7IA 5LWHA 4CIDA 4L0CA 3OHPA 1KAMA 2AMLA 3Q7SA 2D4HA 2HBRA 4JB0A 1H1DA 4AZWA 3O1HB 3ZOZA 5FWYA 3T1YB 3IT2A 1MDBA 3M34A 2X2PA 1E3SA 4MV9A 1M34E 1X87A 3IBGA 1D8TA 3NEJA 3A9UA 3QE2A 4G5SA 4ENWA 3GZNA 1WKCA 2A6PA 4N6NA 1MUUA 1ACLA 3WGZA 4BMCA 5J9FA 1E8MA 4A16A 3EIQA 4TSRA 5IKMA 3PC3A 3UUGA 3RUAA 2PAFA 2RH9B 5AKXA 4EKIA 5CTAA 5EMMA 2AN3A 4NX2A 1W25A 1GPMA 3I9V6 3PGA1 2A5DA 1FUEA 3I9FA 1ZUHA 2H4XA 1UR5A 2PPLA 3PFHA 5DISB 3FD8A 1DXYA 3VKFA 4YECA 3TZ6A 1A98A 2ACEA 4UFNA 3VA7A 4LCJA 2BKAA 3CEPB 4FDVA 2SCUA 4IQ8A 4ER3A 1XQYA 5L3SB 2GN9A 1A4RA 2QRQA 2QQFA 2YS6A 4E2WA 1XTBA 3ECCA 4MV3A 1ELOA 2NYAA 1M5UA 4L4UA 4W9NA 5HIJA 5BVGB 4BVEA 1P3DA 3PGXA 4I5FA 3DP9A 2J7KA 2Z1MA 1G98A 4JJAA 2ZTLA 1ZCAA 1ZESA 4XFJA 4WTOA 4F2HA 3K70C 5D86A 3U3KA 3NVKI 2R1TB 3HJBA 1B14A 4ZZ1A 3FBTA 4G3XA 1WZCA 1XSEA 3CZ9A 5TMBA 1AV7A 4KTTE 2CY0A 3RSLA 2QMUA 4AJNA 2IXTA 2I66A 2WRZA 3VVBA 3F8TA 1N77A 3CXUA 3IJ5A 1QWOA 2I62A 4AP6A 3U7QA 3CYFA 4JLNA 1L3BA 4LGMA 1Y7HA 1W0JD 2RFLA 3PFWO 2P0EA 4QQ8A 4UAVA 1YZQA 1VP9A 2R25B 3CSUA 4F92B 3S8EA 4L3WA 1YC5A 3LPDA 5F7OA 2A1UB 1XRJA 1R6XA 1Z4IA 1P0PA 3FVQA 4OB6A 4C9BA 3CLRC 1DWPA 5ENDA 4OM8A 1Z7YA 3RYHA 3WHLA 4C6SA 1DU4A 5JVDB 2KX7A 3PF8A 4DGQA 1DGQA 3HFGA 1O3YA 4D92A 2FVYA 2ONKA 4OOFA 3LFTA 4ZI7B 5DXAA 5JCOC 4WK4B 2B4QA 2G5TA 4UEJA 2O2IA 3SZGA 2J9GA 4DXDA 3I6QA 3L8EA 4NIMA 5LYYA 1E4VA 2Z4TA 4YYZA 1PFYA 1Z6TA 3ZZNA 2YQ4A 2AVDA 2G4LA 4G25A 4QICA 5H02A 2C7QA 1X86B 2CVPA 1VRVA 1USUA 5DNVA 1O2DA 3GPIA 4WKGA 3INYA 2RBGA 4AECA 1CRZA 4RPIA 1PG0A 2FSGA 2R8XA 1ZZGA 3B89A 3ML1A 4IIJB 4EECA 2AFHA 3BT7A 2PUWA 3EIEA 4EJSA 2PMDA 4L75A 5H68A 1UDAA 3KTAA 3ORHA 3JPYA 1PW5A 3QUAA 4Q1AA 2ZRKA 2R86A 3NDPA 3CRNA 2NU7A 5U4XA 4KMRA 2WIBA 3K31A 1KK1A 1A27A 3G5LA 4LUCA 3L77A 1UPXA 1DRKA 1J49A 2VJLA 3FN4A 1TZKA 1XT6A 4CTOA 5BNTA 1IBCA 1S2GA 2P9BA 4AMZA 1QG2A 1KTVA 4MV8A 3Q0EA 3D0KA 3FFAA 1U81A 2CJYA 3ZCSA 5J1TB 4GYKA 3T3NA 5JNWA 1GTG1 1SD1A 3S1AA 4Z4EA 1M2OA 2IRWA 2WPNA 4KJZA 4N41A 4QDZA 4LFAB 3PI6A 4YRKA 3G2QA 3G9XA 2PNJA 1JJFA 5HR5A 1E0AA 1QK3A 4H7FA 4GUAA 2I4TA 3HLTA 1XMJA 1VG0B 4U00A 1BYUA 4Y30A 3PFIA 1ZU5A 4ZD6A 2A9KA 2DHDA 2HA3A 3F4BA 3WYAA 4CODB 3AV3A 3N0VA 3SQOA 2J31A 1UH5A 4YJGB 2HI0A 4UMVA 4OI4A 4ASUA 4GBED 3PWSA 2XNSA 3PNKA 1ONBA 2JFBA 4GZ6A 4BDSA 4RF2A 2P2YA 4P35A 4LMAA 3OICA 4JOBA 3FKSA 4RK0A 1SG0A 4ND2A 5FB3A 1QR6A 2I6GA 4CIXA 5LYJF 4QO8A 4O1IA 4I3GA 5JPIA 3ZH2A 3THWA 2GJ4A 2C1ZA 3DKIA 4MKIA 3AR6A 1DO0A 1G5FA 3RFCA 3H3JA 4M4SA 2WD9A 5IG2A 1ESDA 4EI2A 4B3BA 1Z63A 2I2XB 2QKYA 1RLMA 4JQCA 1CUZA 2Z3WA 1ESEA 4UD6A 4KNWA 2DR0A 3CISA 1CS0A 3KZVA 4Y3UA 1E0DA 2WHPB 5FTKA 1NOJA 3N2GB 3CFYA 1Y8RA 3J81A 4IJQA 3G0GA 4XUDA 3D5EA 5JXIA 3FPJA 3M1AA 3DZDA 2WBLC 4DW8A 2X0IA 1XEXA 2G06A 3AY3A 2AOTB 3QFRA 2ERXA 3ENNA 2CJXA 3MJTA 1WNTA 3A36A 1K86A 3P32A 4O0MA 2JATA 3PUVA 5K45A 2V7EA 2OO5C 4IG4A 3IUSA 4Z2YA 4ZEMA 1E92A 2VPWA 1G5TA 1ID1A 3T5PA 1KDPA 4IJVA 5AYVA 3ILYA 2XMDA 4P4SA 3OPYI 1HT0A 1FSFA 1T1EA 2EQ5A 4FGZA 4RIHA 2ZGVA 2QJOA 4BFTA 5FV4A 1VPDA 3SIPA 2X14A 2VZ0A 4UTPA 3QLTA 4P83A 1X38A 4UVIA 3ZWAA 2B5OA 3VVLA 5IAKA 2WF6A 3P45A 1J33A 1NVEA 3AO0B 4LJKA 4O2RA 4PXYA 5EIBD 4GOKA 1KZ7B 1DSSG 1C3JA 1OFIA 3QKIA 1Y9ZA 3KPJA 2P4SA 5FOUA 1XG5A 2A9VA 3M49A 3WWPA 5BYJA 4BZWA 5L95A 3NT5A 3RDPA 2FPLA 1EK1A 4BNZA 4COOA 2E4AA 1GNVA 4HFJA 2CE2X 5TQ0B 2I8AA 1TW3A 4OU5A 5GAJA 4LDNA 3MS2A 3TAUA 4NJMB 1WVIA 3UK7A 2AQHA 3U4HA 1HT3A 4ZJZA 3GUUA 5CLFA 5AUQA 4B34A 4MRSA 2CNKA 1SEPA 3F98A 2WABA 1R0RE 1Z0KA 2FZ5A 2P2DA 4UUMA 2BL4A 4PTYA 3CKLA 4WNCA 1SKMA 4J4HA 4MUGA 2ZBQA 3HSSA 4DL9A 2ZRQA 2GGSA 1CQJA 4DRXA 4KE7A 4JUFA 2BIFA 3KXIA 3F5SA 3OMXA 3GVXA 4LWOA 2HK8A 4R0NA 4JXXA 1W8IA 1YWGO 4HZGA 2F55A 3DNMA 2PD6A 1Z06A 4BJHB 4N47A 3H2BA 4ESHA 1VMKA 2NO1A 5AOAA 5DNYB 1A9YA 2WHQA 4QFBA 4HUQA 3O8RA 2VHCA 3SYLA 1DO8A 1NATA 2Q6OA 4ENUA 1J23A 1E7SA 3PXUA 1BGXT 1DL5A 1FRQA 1OKKA 4R2LA 2DH6A 4TKLA 1U0TA 2NXCA 1GVHA 3C5WP 2CEAA 2M98A 5T7BA 1TKCA 1K89A 1T2VA 3LS2A 4ZGWA 5EIAA 1T5HX 4KUGA 3TGPA 4YP7A 1H23A 2QVBA 3VVCA 3VXKA 1IZ0A 4BTEA 1N5KA 2IY8A 1RD4A 1EWVA 4H77A 1QFXA 3R2JA 1Z2DA 1OVGA 1SUWA 4DWOA 1ZUNB 4N12A 1AKQA 4XIJA 2PUBA 3M9LA 4LA4A 1OYWA 1QCYA 3DAHA 3CX4A 4P4LA 4EUSA 4F93B 4D99A 1Q1GA 4MV0A 1L5ZA 5F33A 2O1SA 3W0LB 4QBIA 1E5DA 2GN1A 4URFA 1XI2A 4RQBA 3SDBA 4E11A 5G40A 2PUFA 1AS0A 2CHEA 4U9IS 1RI3A 4E4YA 1E2JA 1GKKA 1DDGA 1A2BA 1WCV1 4PR0A 3SDZA 1Q92A 1VPVA 3GROA 4YAGA 4JLAA 1F20A 3FAZA 4Q3CA 1UKBA 2AK3A 1CUHA 3KQYA 2HPHA 4R2XA 1GSAA 1MVOA 1RI5A 3JD0A 2HGSA 2PDAA 3QVOA 3GIDA 3R77A 4XZ3A 4CR6A 5BWOA 3GA7A 3LECA 3HHPA 2Q99A 4HJRA 3RRFA 3SP1A 4BB0A 4Y2JA 4UULA 1P9OA 4XX0B 1JE0A 3HNOA 3L7IA 2V8OA 3PRJA 4P82A 4QTZA 3WICA 4F38A 4RH0A 2HPAA 2QUKA 1FFCA 1BEUB 4IQFA 4C0XA 1BEZA 3RAEC 3U9TA 1O0BA 4BVAA 1I3CA 1E63A 4I9NA 4O0LA 1LV8A 3AUUA 1ZGBA 3IHWA 4QDOA 3CEMA 5DHRA 3WE7A 1AIPA 5ECYA 2MYUA 3RUDA 1SXHA 4HLUC 2NUTA 3ES9A 4B09A 2UUBB 2AYYA 1QHHA 1ZS9A 2Q9UA 4S1OA 4TRNA 4Y1RB 2GMWA 3URKA 2O07A 1H5QA 4M0UA 5F78A 3UJHA 2FSIA 1PQPA 3KU4A 4IUYA 2Z2YA 3E81A 5EPOA 2PIAA 3IVAA 4C30A 1X6VA 5BOSA 1MXFA 2H1WA 4BEJA 2IS1A 4H59A 1M1UA 1JU9A 2I0FA 3BMXA 3DFZA 3N6RA 4DMUB 4J9VA 4WT7A 1QH1B 3R0XA 1QCCA 1DARA 3K7EA 2IDMA 2A5YB 2VEDA 5EHNA 1JG2A 4IQ0A 4X1IA 3KAQA 1GKYA 4TQ9A 4ZVNA 2REQB 4C0BA 5IXJA 2Q9AA 2HJGA 4FIDA 3MT0A 1O03A 3A6GA 1RC8A 3EIWA 1GNRA 3LLSA 3BA1A 5HQ3A 2R8RA 3OURA 4L7QA 3LX6A 3AEXA 2CHFA 4TV8A 4ZRMA 1HDGO 1QRRA 3VR0A 2X5OA 3QMWA 4PSDA 4CQMA 5K4GA 1BHJA 1GPYA 3DT9A 1Z7BA 1PJQA 1HDCA 1YQEA 4N3NA 4PYJA 1C4KA 1EXMA 3BIOA 3PI7A 5BPHA 3DMHA 3MN1A 3Q1LA 2OBLA 1J20A 1L1QA 4OPMA 4XIYA 1W76A 2N75A 3RF7A 3UV6A 3TRKA 5HXAA 5C8XA 5HOEA 5LJLA 3KDPA 1N7IA 2XPCA 4XXHA 4ZHQA 4TMVA 4WSOA 3AB7A 2Z4RA 4ZAVA 1SBZA 3OESA 3P9PA 4ETIA 4E1AA 1OX5A 3F3SA 3HR4A 3DZHA 1AM4D 1WD5A 3BMOB 2ZBEA 1Z07A 3EHDA 3AHIA 3IAM1 1BKSB 3R0IA 4PWYA 1DZ3A 4GR4A 4M88A 3G5MA 4I4LA 3ZYZA 4D3DA 5HEKA 1F1JA 5LYJB 3STWA 4YREA 5MN5A 1RLIA 4B0OA 4LRQA 5CT5A 4QG3A 4PLCA 5HPYB 1SVMA 2CDCA 1EM8A 2FZCA 2QYOA 1UEIA 4HH1A 4N7JA 4XWAA 5CYGA 4WEQA 5BNIA 3WL4A 4YCLA 2Z6AA 1UK8A 5IF3A 3ZKWB 1RHUA 2ZT5A 1PSWA 1NI4B 3C7KA 4FGWA 4ECEA 2ZETA 1D0VA 3NV9A 4IX9A 1R5OA 3IUNA 4MH0R 4NS4A 4P6VF 4P92A 2OPHA 1FJ2A 5TGTA 4UDXX 5B3LA 4G5GA 2EG9A 5ETJA 1QGOA 3K16A 4FEGA 1EIZA 1QQAA 4AG6A 4TMWA 3P9CA 4F06A 3K94A 4G2TA 4HGZA 3K0EA 1WW3A 5JANA 5LR6A 4CW7A 3A0UA 4M0FA 5HHTA 1ZEMA 1DNPA 1JUDA 1P3JA 4QL3A 5FR2A 4X60A 4IXMA 3ZNNA 2JARA 3ISVA 4X7BA 2MJLA 2P3OA 4YN3A 3VX3A 5F23A 1R10A 4KV9A 2O1WA 4GWGA 5FIUA 1X0VA 2GILA 2GK7A 2PZMA 4HZUB 5EP1A 3UC5A 1RRVA 3QHQA 4BAUA 1L7NA 2GK3A 1R9JA 3K9QO 1ZGAA 2H3EA 3PBKA 4XGIA 4DXAA 1PV1A 5JD3A 3O92A 2WF7A 2WLTA 4FFLA 3RQIA 3WSTA 4DC0A 1NVVR 3F9RA 4B75A 2HRZA 4IILA 3MD0A 1Y3AA 4OU4A 4X9XA 3ZE7A 5K8JB 1D2NA 2XTZA 1JXOA 5B5SA 4R3WA 3R75A 1G6OA 4CF5A 5GIOE 3ZDXB 4BE4A 4JY7A 2D1QA 3ER9A 1TYDE 4MULA 4PIMA 2A4KA 4DEYA 3IT3A 3HKBB 1XZLA 5FKJA 4I6JA 4KYUA 5KKNB 2Q6LA 3GFPA 3PDHA 5DTMA 1EZ1A 3S2ZA 2HLDA 3USZA 2VDJA 1O4WA 3NAZA 1Z38A 1JMKC 4WXMA 1AC5A 5LIRA 1FX0A 4DRZA 5IKEA 1YOVB 3H5IA 4QBTA 1V4BA 5GZ6A 2OM2A 4E12A 4MYHA 4FX5A 4YDSA 2O5EA 5H8WA 1Y3IA 3QJYA 1YB5A 5U4QA 3Q7TA 3KKKA 4K5QA 4YJFB 2ZI5A 4Q1FA 5CDGA 3KQUA 1ABFA 2CL6X 2Z8YM 3U3RA 5KYTA 4PBSA 1C7FA 4RV9A 4ZRDA 3W2FA 2VJPA 3JQAB 2J46A 3UO8B 1PZFA 1V6AA 3RC7A 5EJ4A 1B6TA 4L7VA 5CA1B 3LCUA 4F4HA 5D00A 2AHRA 1PK7A 2JGDB 2YHIA 1H9AA 2P7IA 1I0IA 3Q7QA 4LXXA 4QUIA 2QZZA 5DYWA 2HHJA 3BXFA 5H3LA 5LP1A 3U4MA 3O4RA 1J24A 2PGXA 3CXRA 5JRDS 5JCJD 1JEQB 3C6KA 1PP4A 3R9XA 1G9XA 2QX7A 4YP6A 1NRIA 3V6LA 4KWHA 4NV1A 3IAUA 2X3FA 3ZDZB 2HR1A 3LQQA 4OMUA 1PUXA 3AEUA 3FJOA 2B3DA 1AURA 2B8JA 5EFOA 4MQBA 5AHWA 3OZUA 3A1CA 3EXG2 4TTIA 4MJLA 4KIUA 2DEUA 2I4IA 2J3IA 3VPFA 1C7JA 1JVSA 3KLOA 4EVRA 2W00A 3IHTA 4XLZA 1GZ7A 1F5NA 3AL0C 1OPXA 1UMDA 2EFHB 3BMQA 2GS9A 5BXQC 2JFYA 2PWPA 5T41A 3RTBA 1QYXA 1RKQA 4IH1A 1W30A 2NSLA 3MQFA 2GA9A 3QIVA 4NK4A 1ZGJA 4QGFA 4UM5A 3JWGA 1XP5A 3V7YA 2GYUA 5F3RA 3WGKA 5LMCA 2OT3B 2X5NA 3P9IA 2WZCA 3WR5A 1JPVA 4KAXA 1VPEA 1DELA 2BELA 4PZ0A 2VJYA 5CLGA 4EB0A 5CP8A 5BNZA 4J2OA 2AFHE 1FJGB 1XVVA 4LTDA 4YRIA 4O5OA 1K5GA 4WNAB 3W77A 1CY8A 3G02A 3PP8A 4DQUA 1U31A 2OAGA 3RC3A 2QAGB 4ZVUA 1YB2A 2PUGA 1B7GO 1IOLA 3NDBB 4QGGA 4XX1A 2XSZA 3U5ZB 2CLKB 4KZKA 3BMNA 3PZBA 5A9RA 3QPWA 3IV7A 4MEBA 2JJ8A 3F6PA 1BJKA 2WJ6A 1XA4A 2P2NA 2CZQA 1JLMA 3CUEF 2Y0EA 3KYJB 4MRMA 4RESA 4DR1B 1AZSC 3G9QA 3RADC 2QBYB 2X1HA 1UZNA 2Y4OA 3OLXA 5LCXA 2V7VA 3NHLA 1YDWA 4MW2A 2ODNA 2J0SA 4XWTA 4MAMA 1R66A 4Q93A 4GMXA 2XXJA 4WNYA 1KAGA 1ZP6A 1Z36A 4NPCA 4XCVA 5H83A 1KPIA 4KBYA 2FUG1 4YDHB 2MSLA 1E98A 1EK5A 2ATCA 2YV4A 4QLAA 1CULC 1F6DA 1HEUA 1VYVA 2XT0A 5BN3A 3B3FA 2CVZA 1SUEA 2GLXA 2PRKA 5AJYA 2FPIA 2UXDB 1HDZA 2YWDA 1HL3A 1REQA 1V45E 1X7ZB 3ESBA 2Q1WA 2O3TA 3F8WA 3P2KA 1OIXA 4K9PA 4AZ3B 4ZDWA 3FKQA 2JJYA 4RHXA 2XWPA 4HXYA 5DGCA 3WNVA 1TIBA 1Y4SA 2QJTA 5CFQA 3RNOA 1Y63A 1YZVA 1KAEA 1Z74A 2XRYA 4CM6A 3V32A 5HJ2A 1UWLA 1A82A 2EFYA 3G3EA 4EDHA 3AETA 2EJVA 3EYAA 3HYNA 3NBYC 3CVUA 3N9IA 4WKOA 3OE7A 4EA6A 4MHSA 3GDGA 3H11A 4Q01A 4TKVA 3PTAA 1MB3A 1VLVA 2HK7A 5D01A 4HNTA 1BSVA 2WM9B 2GSWA 2OZLB 2R6JA 2QN7A 3ZU6A 4EEKA 3A6FA 3A7EA 3DDNA 3W3AH 1EDZA 4PLHA 3ELBA 1NZDA 2I1LA 1RYEA 4R9RA 4L5BA 4OQPA 3ZJYA 2PCLA 1G18A 1BA2A 3I2FA 1RPJA 4MLPA 3VYWA 2G0NA 1J7JA 2QG9A 1IOZA 2PQ2A 1UT6A 4OQQA 1S2OA 1SZCA 2WDZA 4OFZA 3U1TA 1LCIA 1FFXA 1KK0A 2GDZA 3UJCA 4JUCA 4I1SA 4RH3A 4J0HA 1K6MA 1M6VA 1CY4A 2VTEA 4X90A 3TIIA 3A26A 4OBBA 4C4ZA 3P9RA 1L3IA 1R6BX 2HJHA 5FTJA 3HO1A 1FIUA 1JIXA 1I4WA 1U0SY 2J07A 2NSJA 3VR4D 1NOIA 3D6HA 3WC4A 3K6SB 2YJZA 2J6IA 4YCBA 1TFUA 4KXQA 5IF9A 1M0EA 2UUCB 5HIAA 1Q2UA 5EXPA 1J1IA 1CIJA 3EBLA 4J7CA 6LDHA 1YZ3A 1PEAA 2QZ4A 2YVQA 1L4GA 2H1HA 7MHTA 3L1HA 3QKSA 4JB2A 4S0XA 1TD1A 2Y1LA 3AY7A 1NWCA 2XA9A 3AFGA 2IWRA 1YVDA 4DARA 1TAGA 4Q1VA 3DMTC 5SICE 2VG8A 2F59A 3MTJA 4PINA 4C4XA 1NW8A 2X4LA 2LDXA 2UDPA 2I2FA 4F3RA 4EEXA 5DLQC 1N2XA 2ODWA 3IPCA 1EUDA 2GCOB 2QG4A 2YJTD 3O21A 2YTZA 3QYFA 5L3QA 3HDQA 2Y6VA 3ND9A 1W6RA 1NXVA 3TPZA 5F4ZA 3KSUA 4L22A 1QO7A 3P52A 4A8TA 1NF2A 1SBNE 2RJ3A 3SVZA 1X8XA 4EYQA 1USWA 1CSEE 2DPGA 4XR9A 1M3SA 3CR8A 4H3VA 4N39A 3KT3A 2JFPA 1AO0A 2LUOA 1ZD4A 2JI4A 2JLZA 3U81A 1RBYA 4IMIB 1XYYA 1FFEA 4KDFA 1EFCA 5TF4A 3KNZA 1DKMA 2L19A 4IXDA 2R6GA 3B70A 3MQ2A 4FFSA 4MAFA 4QO7A 3ZE0B 3VR4A 3HBJA 4GC5A 1NQUA 1RW4A 1XEWX 4BO5A 4MGYR 1RAIA 4URVR 4D44A 1UAGA 3JXEA 3ON5A 4H60A 1QDLB 4M2LA 3A05A 1VIYA 5H70A 4RMNA 4YAFA 4BKOA 5C1PA 2AEEA 1J39A 2NX2A 3LDGA 5JQGF 4JFRA 4UZFA 4Q66C 2YVUA 3LIPA 4FKZA 1BZYA 1FTGA 5HKKD 3TJRA 5D5HA 1B3BA 1NUHA 2ZSJA 3G0IA 4AUEA 3AM5A 2UZAA 4UEWA 3ZIAA 3H05A 1NL3A 1SU4A 2XY4A 3WZMA 2GCEA 3QBTA 4CT5A 4JOCA 4LJLA 4WN9A 1UBUS 2PT7A 2QRUA 4BO8A 1UZAA 4J0DA 3ZHQA 1U3GA 4BQOA 3U7IA 2G83A 4AY3A 4H1VA 1Y6FA 1JFFB 1GQFA 3OMWA 3C7AA 3PYLA 1SO8A 3BK2A 4DWVA 1IN6A 3UT6A 3ESQA 1BXKA 2Q5FA 2NU8A 2DU8A 521PA 4XWYA 1XZEA 2N3ZA 4EVQA 4BRWA 3RNLA 4E70A 2BMVA 1J2TA 4DLXA 1CUCA 3NUZA 2FMXA 2VF4X 5EMNA 2PZFA 5CXUA 2GJ9A 2QENA 4DEXA 5K8TA 3V4FA 1YMVA 3MJVA 1RIFA 1SKYB 1JHPA 3DQQA 4BO7A 3UA4A 4Z3OA 1NBMD 1EWQA 1W85A 5KTOA 5NULA 3LBHA 5JSUA 1N4AA 4C2AA 3P9SA 3U62A 2O8FA 3PHBE 3AM3A 1IUOA 1SEVA 4L8LA 2BSXA 5T64A 5IAAA 3NX4A 2G71A 3D6MA 2HF7A 5FUBA 1BWPA 1G20A 2YS7A 1OVMA 3FHOA</