3L49A

Crystal structure of abc sugar transporter subunit from rhodobacter sphaeroides 2.4.1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
282
structure length
282
Chain Sequence
SLEGKTIGITAIGTDHDWDLKAYQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQKPDAIIEQLGNLDVLNPWLQKINDAGIPLFTVDTATPHAINNTTSNNYSIGAELALQMVADLGGKGNVLVFNGFYSVPVCKIRYDQMKYVLEAFPDVKIIEPELRDVIPNTIQSAYSNVTDMLTKYPNEGDVGAIWACWDVPMIGATQALQAAGRTDIRTYGVDGSPEFVEMVADPESPAGAVAAQQPSEIGKLAVQNVARHLAGQEVKPFTFAPAVLITKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC sugar (Ribose) transporter, periplasmic substrate-bindin
publication title CRYSTAL STRUCTURE OF ABC SUGAR TRANSPORTER FROM Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Transport protein
total genus 106
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l49A01
4IGAA 4RK1A 1YMVA 3LUDA 5FBKA 3F73A 1ZGGA 2E4WA 1DP4A 1A04A 2FMIA 1W25A 4OTZA 4Z9BA 3HM9A 2O20A 2JB9A 2F8SA 3MF4A 3DBIA 3KKEA 1LJLA 3KCNA 3KSMA 3RVKA 1YIOA 5IX8A 1L5ZA 1QKKA 4RV5A 4D6YA 3CKMA 2IDMA 3GWGA 2N9UA 3A3KA 3QX9A 3O1HB 3T8YA 4QICA 1RZRA 2JVJA 3IDOA 5TPZD 1PEAA 3CZ5A 3FFXA 5TPZA 1JDNA 5CNJA 1DBQA 3R0JA 1NXSA 1PHRA 4G0XA 3TO5A 3JTEA 4G86A 4UHJA 1QNLA 5B3JC 3QLUA 5TPWA 2MYTA 4XFKA 3RVSA 2A9QA 1NXWA 3G85A 4NICA 1DBWA 1JHZA 2GKGA 3EAFA 1ZESA 4RKQA 4Q6WA 4EVRA 1P8AA 4JAVC 5TQ0B 1ISSA 2X7XA 3I45A 3JY6A 3C3KA 4KQ9A 3G1WA 2E4YA 2QZJA 3EJWA 2PL1A 3HSYA 4PICA 1MB0A 1ZGZA 2J48A 2P9HA 2CWDA 1PEYA 1TM2A 3Q9SA 1E2BA 3OQOA 3QLTA 4MQEB 2PUFA 1E6MA 1Z2EA 2FSPA 4LE0A 2FMHA 5JS2A 5JNTA 3N0RA 5EWJB 1KRXA 3SG0A 3TX6A 2HPHA 5EWLA 1ZAYA 2WJWA 5EWMB 1EWKA 2RGYA 4KK4A 5JNSA 1EHCA 4EYOA 4W5NA 1EWTA 4MS4B 2KYRA 4YCSA 2FEKA 1OXBB 5IBQA 4HYEA 5JNUA 5GQSA 2GBPA 3EODA 4RDCA 4MS3B 5IULC 4L85A 3EQZA 1DC7A 3K4HA 2VK2A 3OO1A 2LBPA 1F51E 3QK7A 4H3HB 4GNRA 3OO0A 3BILA 2YHBA 3N75A 6ABPA 1DG9A 3H5IA 4QPJC 3LUJA 3BRSA 1HEYA 2NUBA 3NBMA 1P6QA 3LUFA 3DGFC 5CNKA 5DTEA 2H0AA 4FE4A 3RQIA 1FFWA 3IP5A 1K68A 5DKFA 4D6XA 1IIBA 1DRKA 4N03A 1Z2DA 1RXIA 2IPAB 1JFTA 4KNYA 3H5TA 1BDIA 1JBEA 1WETA 3O2SB 3LUCA 3CHYA 3O21A 2FTKE 4WZZA 4YV7A 3KG2A 4G0QA 2LUOA 1M5UA 3H1GA 4MYRA 2PMCA 4KPYA 2ZAYA 1KGSA 4EVQA 1QQAA 2LPMA 4IRXA 5FWXB 1Z16A 1QQBA 3UKJA 4EY3A 3SM9A 3FGZA 2L19A 1JFVA 3GA5A 1BDJA 3TB6A 4OLBA 3H1EA 5TQ0A 1BA2A 3W9SA 4OBBA 2FN9A 3RVRA 4XARA 3RVOA 1T34A 3O2JA 3VNAA 4N41A 3MA0A 3CG4A 1FFSA 4TN5A 1QPZA 2PJUA 2OENG 4MQEA 4MR7B 2VYCA 5KWSA 1D1QA 2CHEA 5EWJA 3B2NA 1FFGA 4O1HA 4MS1B 2NT4A 5C5CA 4NCBA 5JNRA 3FDFA 1SD5A 5EWMA 3UUGA 1YTUA 3F6CA 1OXKB 1D1PA 3QLUC 4G0YA 2FVYA 4WXEA 4EVSA 4MS4A 4RS3A 4GPAA 3SQNA 5JNWA 3OQMA 2HSGA 2FQWA 2HQBA 5TQJA 3JVIA 5GOTA 4YRZA 2F8TA 1DRJA 2MSKA 5IUKC 3ROFA 3DLHA 3GL9A 3D8UA 4MS3A 5E3JA 1Z17A 3CZCA 3LUGA 3N6VA 3OMXA 4G0MA 4KMRA 1NTRA 4O1IA 3F6PA 3H5LA 4KRFA 3RVNA 4W5QA 3ILYA 3CU5A 3IP6A 1BVHA 1D2AA 1JYEA 1MB3A 1ZVVA 3CFYA 4FE7A 2FW0A 3MMNA 1Z26A 4KVFA 4EYGA 4E7PA 4EUKA 4Q7EA 1RNLA 3HV2A 1Z13A 3GBPA 3HZHA 3HS3A 2MYUA 3SNKA 4JA2A 1Y1LA 4Z4FA 1W9HA 6CHYA 3LKVA 3O74A 3FMVA 1ZDMA 4N0PA 5TE9A 3EULA 2AYXA 3GYBA 4KQCA 4F11A 4WWHA 3M9WA 1ABFA 5IC5A 3KJXA 3D02A 4M88A 3Q7SA 1CEYA 4YO7A 4RXMA 5FWXA 2NT3A 4W5TA 2R48A 2IOYA 3F7NA 3OQNA 3O1JC 3H5VA 4Z0NA 3A10A 4JB0A 3E3MA 4TMYA 5CNIA 4TLLB 2R4QA 2QW1A 4W5OA 1PNTA 5T3YA 4KFCA 5DLEA 1DCMA 5FBHA 2W42A 1XHFA 2E4XA 4H60A 1ZH2A 4MR7A 2FLKA 4ETMA 5TQ2B 1CHNA 3LUHA 1U2QA 4ZYLA 4Z4GA 4MS1A 3MQ4A 4UHKA 3EGCA 1NATA 3KHTA 3HDGA 1JX6A 4RU1A 2PUAA 4NQRA 1QP0A 3NHMA 4Z4IA 2WWVD 4EYKA 3FFTA 1Z25A 1QO0D 3JS5A 1B00A 2IPNA 4LZLA 3URMA 2PAFA 1YK0A 4RK6A 3LKBA 4MLCA 1YMUA 3OLXA 4JB2A 5I4CA 1VRVA 4Z4HA 3P9YA 3HDVA 3JPWA 5IEJA 3K9CA 3LOPA 2XDYA 5BR1A 2CD7A 1DCFA 1U2PA 2QVGA 1XWWA 1JYFA 2E4UA 2E4ZA 2MSLA 4G0OA 4P98A 1RPJA 1DZ3A 4MLDA 3MM4A 4HNRA 2I6FA 1LJUA 2JVIA 1USIA 4PEVA 5D2CA 1I3CA 3RVQA 1SRRA 3L49A 1VLZA 2GX6A 3C97A 3KLOA 1MIHA 3N0WA 1JF8A 5FWYB 1NXVA 3A0UA 1APBA 4OATA 3HUTA 4LX8A 1K66A 2L2QA 4RK7A 4EYQA 3UK0A 4ML3A 2PE5A 1M5TA 2PLNA 3CTPA 4D74A 5BRJA 1FSPA 1DCKA 4DADA 1SXHA 4L4UA 4H3KB 1E6LA 4ZJPA 4OLAA 1SXGA 2L18A 2RDMA 2QXYA 1L5YA 2L17A 2R47A 2VUIB 9ABPA 3ROTA 2ID7A 2M98A 1UDRA 1DJMA 4MQFB 4RK0A 2PUCA 1YK1A 1J56A 2PUDA 4WUTA 1NXXA 5ED4A 2YHAA 1CYEA 3H5WA 3NHZA 2B1JA 2ID9A 4N47A 4RKRA 4WXMA 4S05A 3T38A 4Z99A 3CLKA 1Z15A 2AYZA 2QSJA 4TLMB 4F3TA 1KMIY 1C4WA 2IYNA 3O1IC 1MVOA 4G97A 1GCAA 3EQ2A 3IP7A 3QEMB 5TQ2A 4CBVA 5KC8A 5KQMA 3HVRA 1VKRA 2FMFA 1P2FA 1TMYA 4N76A 1M2FA 3E61A 4YR7A 1TLFA 2PKXA 1D5WA 3M6MD 8ABPA 1S8NA 4IILA 5KQPA 4Y9TA 3H6HA 4ETNA 3KYJB 2JRLA 4DN6A 3NNDA 1EWVA 2FMKA 2JK1A 5IUJC 2M1ZA 1F4VA 5KQGA 2CHFA 3KYIB 1NXTA 4RY9A 7ABPA 4RWEA 2JBAB 3LUAA 4RY8A 5KQLA 1AB6A 4YP9A 3BBLA 3TD9A 1H9CA 3LMKA 1MAVA 3OLVA 3HUUA 4HNSA 3QLVA 3CG0A 1USKA 3H6GA 3SY8A 4ZPJA 4LE2A 4F8JA 3DGEC 5HQJA 5DGCA 4MRMB 3GBVA 3S99A 5FWYA 1C0EA 3Q7TA 3GRCA 3RVJA 2RJOA 3NNNA 4YLEA 4Z9AA 3DZDA 4MAAA 4QYMA 2FEWB 1SXIA 2FQXA 1Z12A 2MYPA 3H75A 2TMYA 3OLWA 4XLTA 3SAJA 1ZN2A 3LUKA 1JH9A 2A9OA 4P1ZA 3MYYA 4MR8B 3Q41A 4RXTA 3N53A 2H3HA 4MQFA 4RK5A 1RZRD 4PZ0A 2PUEA 3JVDA 2FEPA 1FQWA 3QX8A 4ETIA 4HNQA 4IF4A 1TVMA 4MR9B 1JDPA 3HXMA 3LTEA 5CNMA 4PE5B 4F12A 1A2OA 4LRQA 1D4ZA 3BREA 2ZWMA 2FKAA 3IPCA 3HK2A 5C5EA 4YGXB 3QEMA 3NNSA 3QELB 3I5AA 2WY2D 1ZITA 3M9XA 4OG2A 2VUHB 5KI6A 2LP4Y 3EDCA 1JL3A 2B4AA 3T95A 1QO0A 2FQYA 4F06A 4ZMSA 1RXEA 2V0NA 4KK3A 4RK4A 5JNVA 2QU7A 5CHYA 1A0OA 1QP4A 1U0SY 1GCGA 2HJ9A 1YVUA 2JCGA 3H1FA 4O5AA 3TMYA 3H5OA 5BRAA 1VPWA 4LE1A 1M2EA 3VNBA 2NZUG 4QYWA 4Z4EA 2LIVA 1USGA 3IPAA 5F64A 1LK0A 1YS7A 5HSGA 5JS1A 2QVCA 4RZSA 1AB5A 2JBAA 1KRWA 1EFAA 3OLYA 1LBIA 2FXIA 3HEBA 4G0ZA 3C6QA 2R25B 3GT7A 2FN8A 4FB4A 2HQOA 1TJYA 1JLKA 1QMPA 3C3MA 4NV3A 5B3JA 4DQDA 4KREA 3ILHA 3KLNA 5BQ3A 1P6UA 4MRMA 1R8JA 3RH0A 4Z4CA 1NXOA 2IPLA 1JFSA 3I09A 3N8IA 3HCWA 4E7OA 4RY0A 1JWLA 4IMJB 2GI4A 1YS6A 2E4VA 3O2QB 3QEKA 4NCAA 4RXUA 1BAPA 4EGSA 3T6KA 3FFWA 2BGGA 4JOQA 1DBPA 4N0QA 2WB4A 1EAYA 3KS9A 4MR8A 1Z18A 3I42A 1DC8A 4MPTA 2OQRA 4S04A 4Q6BA 4JASB 5PNTA 4W5RA 3GV0A 4KV7A 1BDHA 2GWRA 3QLVC 3HO1A 3IP9A 1GUDA 4MR9A 4LDZA 3A0RB 4IMIB 4XXHA 1ZY2A 4LDAA 2MSWA 5TPWB 3BRQA 3OLZA 2FLWA 5DCLA 3HJFA 1GUBA 2WMYA 4YS6A 1ABEA 2WJAA 3O75A 3KTOA 1ISRA 1PNRA 2PUGA 5HKOA 2IKSA 2HQRA 1XHEA 2WRZA 3C3WA 3QELA 2IPMA 3N0XA 1QP7A 2NZVG 1GLGA 3OM0A 2RJNA 3Q7RA 4XAQA 5IEBA 1ZHHA 3DLBA 1ZH4A 4MGEA 2P4UA 1PUXA 1U04A 4PYRA 2DRIA 4KZKA 3RVLA 4RSMA 2PUBA 2Q5CA 1NXPA 2JVKA 4G0PA 3RVPA 3RVMA 4B09A 5KC9A 2PL9A 3MIZA 5IUNC 3L6UA 5EWLB 4ZMRA 3Q15C 4YWHA 3CNBA 2A9RA 2A9PA 5ABPA 5HM6A 1URPA 4WT7A 2QR3A 3CRNA 2QV0A 3OM1A 3LFTA 3CS3A 1U8TA 1NY5A 5T7BA 3OMWA 1LBHA 4JP1A 2MYNA 3JPYA 4XASA 1E6KA
chains in the Genus database with same CATH superfamily
1QS0A 2ORIA 1LK5A 1B74A 5FO0A 1OB5A 2QM3A 2Z5VA 1QG2A 1CUIA 1SQ6A 4AMYA 3O90A 5DGTA 3PX7A 3P9RA 4UOEA 4CIXA 3HCCA 2Z2YA 3DBIA 5COQA 5U1PA 3U60B 1JPJA 4CQLB 3AM1A 1YZTA 1TAUA 1ZVJA 2IHNA 3A37A 1GRCA 1Q0ZA 3C5HA 3OX3A 2EOAA 1XTRA 2VQFB 1KK0A 2VK4A 3L2OB 3ZOKA 4JX8A 3NBUA 1PGOA 4ZOEA 4P83A 2VJBA 2R1UA 1WABA 1RQ2A 4MO2A 4QICA 2IZOA 3IDOA 2NXCA 2AEFA 4XRGA 1EA5A 2C9ZA 1LBTA 1RYEA 3T06B 4CQMD 2AK2A 4UDXX 1OXVA 1EFLA 4K6OA 3SJCA 4AUNA 3KV3O 2FG7C 2WU8A 1JIKA 2OR3A 4EJSC 5FULA 4Z9YA 1NXWA 4QUGA 3WL8A 4LRTB 2VJMA 1ECPA 1JHZA 1K89A 3KVVA 3CF0A 4GI1A 4RW0A 2C1ZA 4F4IA 1F17A 1CR0A 3RROA 1UH5A 1GG9A 1WLYA 3JAWB 1LRKA 2CNKA 1EFDN 1SD2A 3ADKA 1YUMA 3Q87B 1QHSA 4PICA 5DT2A 3SBEA 1YSCA 2EEPA 4L07A 4NZNA 3A1SA 4TKUA 1GRQA 4EPYA 1VLHA 1YFZA 1JIVA 1SG0A 1FMJA 1P6XA 1WCWA 1ZUHA 4MP3A 4MVJE 3KPWA 1TW3A 2RHTA 3B3QA 2XIJA 4LE0A 4A5SA 2IHBA 4YAIA 3OFVA 3N0RA 5JRJA 2DF8A 1ZP6A 3E03A 2HZ7A 3LD9A 1NOIA 3P9KA 5C5CA 2A33A 3GMSA 1IPEA 1GG5A 4KXLA 4U0KA 2B20A 1F6WA 2FWIA 4XFJA 1XMPA 2UV8A 5HNKA 1F8XA 4HX9A 3VR4H 2GJ4A 4JEIA 4MS4B 2V8OA 3JYQA 1XMOB 1L2TA 2XI4A 5E6UA 1KR2A 4RNDB 3WWCA 4AIIA 2JAWA 2NU7B 4I8XA 2CE7A 5FUBA 5U4QA 5JC8A 1W4BA 1YQXA 1WZNA 1DUIA 3G2OA 3KPJA 1F2UA 5EAIA 4YRBA 3ZOZA 4C2TA 1E98A 4TWZA 3F6RA 3MLEA 4H3HB 5EUBA 4POOA 3BILA 3H8WA 1Q1EA 4WVLA 4Q4CA 3S2EA 3IL2A 5KYGA 3WE7A 3VPHA 3D6NB 4XDGA 2BMVA 5IJWA 3MT0A 2YN4A 1ODKA 1MMFB 1RWNA 3IFSA 4PQYA 5CNKA 4CIBA 2C3MA 2O7RA 4TTQA 5HHTA 5DLPA 5HE8A 3KPUA 4C4PA 5JLJA 3F7TA 4IHJB 4HUTA 4CIWA 1E60A 2YFQA 1O8CA 4LTMA 4DJEC 3I53A 3EIHA 5CTAA 1JHDA 2JFUA 2VP5A 5F76A 3VVCA 1KNQA 4FEGA 4DKXA 3U7FB 5CDYA 5A04A 4QA9A 4RCZA 1L5LA 4LOAA 4CQMB 2G06A 5HKAA 2YUTA 4ZJUA 4UVHA 3Q12A 2CVOA 2XB6A 3WNQA 3GLGB 4KXUA 1E2KA 3KU1A 2NO1A 4IFTA 3THOA 4BO9A 4E12A 4ZYWA 5EJFA 2WFLA 1GKYA 2P8JA 2AUMA 1N5KA 3P0FA 4KPGA 4O4JA 3O4RA 3SOZA 2XF8A 4N5LA 4HC4A 2HPVA 3M1YA 2AOUB 4GGPA 3ZVLA 4OBBA 5BR4A 3L79A 2O05A 1JB9A 4N41A 3O2JA 1K8QA 4RLFA 4Y0VA 1BX3A 3DL0A 1FFSA 1JQDA 5AKIA 5A1TA 4GYJA 3REFA 2FGKA 3MB8A 5CFRA 1JQ3A 5C53B 2EJCA 2P9JA 1H1LA 1UMDB 4OAQA 1QPZA 1DKLA 3W79A 4B7ZA 1GLVA 4L6IA 3N8GA 4N49A 4OB6A 4L2IB 4TLCA 4O1HA 4K8RB 5IWAB 3O1LA 2RHWA 5BNTA 3IMGA 1NW8A 5E1BA 3SMVA 4EB8A 3LUBA 3F6CA 3IIIA 1JJIA 3E3OA 3ZDFA 5AVVA 4TQAA 3WRWA 3ZU6A 4GE0A 4BX0A 3QPBA 3ROFA 4P86A 4YAOA 4LMPA 2G9UA 1Q6ZA 2O8NA 3C3PA 3X1JA 2CSXA 3L06A 1NPDA 4V2UA 3U7QB 1NR7A 2ZJYA 3WGYA 2YINC 3OMXA 4KMRA 5EHQA 1KOFA 4AKIA 1WWKA 3QUBA 3LG2A 2I4LA 3L7MA 5T4BA 4BFLA 3K6JA 4X54A 3L4JA 2WM3A 1U2SA 1TPZA 1W76A 3TFQA 4K46A 5AJYA 4Z51A 5LD2C 3LL4A 3T1HB 2XGJA 1NMEA 1QV7A 4O4LB 4B71A 2IH4A 4UAUA 5KSOA 1CETA 3QPWA 1JRLA 621PA 5AHWA 2QMQA 4G5QA 3OJEA 1BCRB 4HUQA 3USES 4A0SA 1CUUA 3FCYA 5GY7A 4AF8A 3DOJA 2X22A 2RIPA 1A8PA 1G5QA 2J5KA 3V2GA 1JI0A 4ZVPA 1ZXBA 4AJ4A 1KO7A 5HQ3A 2YMMA 4D6PA 4JXJA 1SCBA 5BPFA 5L3SB 1A88A 3IDFA 4FCVA 4N7JA 3FMVA 3DAFA 1TGVA 2WSYB 4UOZA 2YWXA 2FDXA 4HLUA 3ETHA 1NSFA 4HFJA 5TXGA 4QAQA 1LB1B 4HEHA 3WSWA 4YO7A 4ZKDA 3G82C 1RLTA 5IMSA 3EA5A 1O5OA 1JKJA 1TT5B 3QEOA 4EYEA 1TCBA 2ZE6A 3H5VA 5IN4A 3I83A 5AIBA 3UB3A 5DRYA 4GGOA 4TVKA 4UUPA 3R0QA 3UFXB 5HMMA 4I3HA 1FMFA 4Z7NB 4Z3KA 1LPAB 3S2SA 1IONA 2KLBA 5AKHA 5CB4A 4MI1A 2WQZA 1KDVA 3Q0TA 1AQIA 4MWEA 3H19A 5AESA 4S1PA 1T8TA 2R8EA 5EE9A 3GLGE 2HCBA 1NATA 2QN3A 4ZZ1A 3CPJB 3CPHA 5LB2A 3JQ7A 4JC4A 5JFOA 3WMXA 3ASVA 5KINB 3ZHCA 3WGZA 3A4VA 2ORED 2FZLA 1MXHA 1GQYA 3LQKA 3EXEB 3GAMA 3G9QA 2GYUA 3V48A 2JJ8A 2B92A 1J0AA 3ND6A 1T35A 2JFNA 3O3MB 4UM5A 3TM4A 3WQSB 4D8YA 4A6EA 2EC5A 4EL5A 4XZ3A 1JEYB 4OQLA 2FSIA 1VI5A 1BZYA 1PTJC 2BONA 5LXTB 1EUQA 5BR1A 2OZLA 5BRJA 1WCIB 3CLSC 1XQ6A 4IDHA 4FBMA 4ZRNA 4DXDA 1Q0PA 2FR0A 3SYMA 4JUDX 3KFXA 1C4KA 1GVHA 3MT8A 3A1FA 1RPJA 2B36A 1YQTA 3GC6A 4FNOA 4X95A 2YYZA 4QREA 2PIDA 1IUNA 4KLRA 5HCUA 1IY8A 2IVFA 3UV3A 1DEAA 1JGTA 5G41A 1DTWA 1ZIPA 5EQJB 2OGWA 2NO5A 4MVJI 5HIIA 3WB0A 4EX6A 3ANSA 3N0WA 2ORWA 3D3WB 4FXPA 5KDOA 1GT6A 4KVAA 4F5ZA 1P17A 1PT6A 3Q3CA 2O7QA 3FPLA 4TV8F 2IBSA 5HIKA 1ATIA 1EXMA 1KBZA 3MINA 5CYOA 5BQ5A 3RIXA 3A4YA 3BMOA 1RQPA 4YRNA 4RCYA 1H8EA 3VYVA 2QLNA 4RF2A 5IFKA 3LC2O 4OLAA 1SXGA 3ZWWA 2ZRHA 4EL0A 3QPAA 3IMCA 5JPIA 4QDZA 4HGRA 5DI3A 1GZUA 1YVEI 3W3AH 4JMPA 1OWMA 4OI4A 1VYUA 3QBDA 4ZAYA 2PUDA 1LQ2A 4R3UC 1WUJS 2OCLA 1TZKA 2G1JA 3IA7A 4FJ0A 4RORA 4BJ6A 4DQUA 2GZAA 2N1MA 2O5VA 2VDMB 3KELA 2QNBA 4E22A 1BVUA 2PLRA 4U7JA 2JGAA 1K6XA 1VL1A 4PIVA 1XP5A 1T6ZA 1WXFA 2PGAA 1MVOA 2CXTA 2RHGB 1E3JA 1PWXA 2BEVA 2PUHA 4PFKA 4PG5A 3WYCA 4CMAA 3KC2A 4N76A 5K1ZA 1HOTA 2ZRPA 3PQ3A 4L73A 2Q9UA 2TECE 4N3BA 4YR7A 1QK4A 2HWUA 3CPSA 5EMNA 2V7WA 3T1TA 1S8NA 4IDCA 3KWFA 4U2KA 2X0EA 1SBIA 1WHTA 1X7HA 4B4WA 1T29A 1MAUA 1QZUA 3P9NA 1XSEA 1Z5VA 4IOKA 3EFHA 3K32A 2M1ZA 3VZBA 3UWKA 3GBSA 4JHLA 1YQEA 2QTRA 2ZU0C 2Q6LA 2JLZA 7ABPA 1W1IA 4L5IA 3PFFA 4RL6A 3GLFB 5IBCA 4TTAA 2C82A 3QM1A 4I1YA 3D3NA 3AJ8A 4EUHA 4DLVA 1J8MF 3M6FA 2NU8A 1U8AA 5GM2A 2EFYA 3FPBA 1TA0A 3AUYA 1G7RA 2Y1XA 3OJWA 5AKGA 1R0BA 1B8VA 2QTMA 4HI0E 5HQJA 1REQB 3OCCA 4B4UA 1GCOA 1N7JA 1RWXA 3MELA 4I4TA 4QBGB 4LXIA 4NU0A 1YDEA 2XHEA 5TF4A 2VBCA 4LC9A 1KWKA 2YQZA 3GRCA 4XR4A 2IH2A 1NZJA 3EA4A 2Z56A 2HPAA 4O4HA 3WYGA 1BHSA 2TMYA 1VKHA 5SZHB 2QUIA 2DBRA 4QLAA 1JH9A 4G63A 3MWLA 1VZ2A 4F3KA 3L92A 4OP3A 1N5DA 2ZAOA 2ST1A 1WF3A 4M83A 1JHOA 1QB7A 3ACCA 5EJEA 3U4DA 3U61B 2LR0A 1OA1A 3DW3X 5DASA 5FHQA 3TRDA 5J47A 3L7AA 3RRXA 1L7OA 3S40A 3NHFA 4XVRA 2AE1A 3PIDA 3ZD9A 2ZJ0A 3SLGA 1V1RB 3VR4A 4PNEA 3CSSA 3Q2IA 1C80A 4BKOA 1CS4C 4I8DA 4QE3A 2A5DA 4XIJA 2V5UA 4ZO7A 2TYSB 2ZWMA 4PIPA 3HK2A 2HBYA 3OZEA 3HB0A 3RC3A 1HLGA 2FWAA 2YY5A 3BMNB 3M5WA 1KDRA 1FDRA 1FFEA 5CA0F 4WNYA 5JROA 3L6EA 1E6UA 4AK9A 3BBPA 1N92A 3NTVA 2A2ZA 2VUHB 1K3UB 1E92A 4H16A 3DD1A 4YJ3A 1GEEA 1P45A 2Q2NA 1PQ4A 1M5RA 1Z63A 2V0NA 2IC5A 1RPZA 4ZQIA 1DRVA 1NW4A 4R51A 5LZ8A 4EPRA 1U0SY 2JAXA 4HDKB 2GZ3A 4YCMA 4GKKB 2G63A 1IAVA 2HJ9A 3I2YX 3EVAA 4URHA 5AUPB 5KVVA 4OY3A 4DIUA 3HXQA 3WGKA 1RU3A 2ZSKA 1M0WA 5FUYA 4QYSA 3VNBA 721PA 1RRVA 3UMSA 4M53A 3T3IA 5A4MS 4FNAA 3ZCQA 1TVEA 5D7BA 4OH7A 1AB5A 4ZO4A 1Q17A 4AX4A 1UBOS 4QC2A 5BSWA 3T7RA 4YJFB 3TJZA 1V7QA 2PUJA 5ALNA 1A69A 1HDGO 1M2KA 2ZAMA 2W0MA 4L5YA 1H3FA 2JPDA 2DSTA 4QHSA 1GR1A 3DUWA 5JLAA 3CW2A 4LBVA 2VDQB 3L01A 4L0DA 1ZI6A 4B6FA 3IDQA 3C39A 4BASA 3IDSA 4M2LA 4S0ZA 2X9GA 4YRSA 5IJ0A 3CR3C 3K0HA 5K0LA 1SRQA 3RH0A 5AKJA 1YBFA 4ES6A 1K7FB 3WNDA 3PD0A 2FUG6 3LK6A 1QFZA 2GI4A 1MABA 1ZD3A 5LP6F 1JAHA 1ZL0A 3TBHA 3W2GA 5L9AA 1N1DA 2J45A 3JSXA 1NAHA 4CL8A 1DBPA 4X3PA 4MO9A 4YPVA 1NGSA 1L5KA 3SSOA 5AW1A 3I6MA 1RKBA 3CEHA 4FMCB 4MWZA 1J1ZA 2A3RA 3ROEA 3V4LA 1OGIA 1IN5A 1ODJA 2XNKA 4ND4A 1VCMA 3S2UA 2YWGA 3TQIA 3UAGA 4UE2A 4WXEA 1WL8A 3S2IA 3VHXA 3OQIA 1Y98A 3BTSA 3EFOB 1G4HA 2ZBRA 4M9SA 2IU0A 1CF9A 4HCJA 5A3VA 3QX7A 4BTVA 2J9FA 2JJMA 1Q77A 4BO7A 4GMXA 4DYDA 4K7JA 3A0RB 2Q6KA 4JT8A 4B79A 1R18A 3OE7A 5H82A 4EGFA 5B6IA 1TM7E 3HKBB 3KFVA 1X1QA 4MIKA 5TPWB 2FLWA 5FPYA 4DJ5X 4DSZA 1IBSA 4E2FA 1M6EX 2WE8A 5LVAA 1P9NA 1PR4A 1Y8QB 2F17A 4C4SA 2GWHA 3BRWD 2O9JA 2HQRA 3C3WA 4CM1A 3A25A 1ZONA 3OM0A 1Y1QA 2CLKB 2EARA 4UQLA 4GR9A 1X7GA 3AHGA 1OJ7A 1G7CA 2QRJA 2W8BB 3G8CA 3UHAA 3GNLA 3T7DA 2QEQA 1H65A 4BFUA 2RGAA 3FA2A 2H59A 4CIAA 1JW9B 1HE1C 1E3DA 2Z8XA 2XW6A 4QDJA 1L7DA 1Y6GA 1PT8A 2Q3CA 2W70A 5EWLB 3K8QA 2HWYA 2JGLA 1N2CA 2LVBA 4ND3A 4NK4A 4CMEA 1ZH6A 4R7GA 2QV0A 3N6XA 2PLFA 1EFKA 5ALZA 1OUMA 4RIFA 2VP6A 1XIVA 4R2IA 1FQJA 1B93A 3CISA 5CW2A 3ZIAA 3OMWA 3IEMA 2Q6OA 3QVTA 4WTOA 5E1OA 3QWAA 3ZV7A 3IUSA 3TLGB 4AP5A 5JDIA 1Y4DE 1U9IC 1XRMA 2PUVA 4UHHA 1RAHA 3LUDA 2BMWA 5AVQA 3PJEA 1AUPA 5A9TA 3VR2A 4P84A 1RRPA 4U6NA 1ORWA 2B61A 2MHCA 5K5EA 1IOVA 1D6MA 1SU8A 3CR8A 5G0TA 1GAQA 4JZYA 4XWYA 1X1RA 1EESA 3IV6A 2F3RA 4EHDA 4C0AC 2V8BA 2HNBA 4XUEA 1JNYA 4NS4A 3RIGA 3EZYA 1OLUA 3BYZA 1ZGCA 5TS2A 2Z04A 2N9UA 2WB2A 4BATA 5IAKA 1RZRA 4CNQA 3UWDA 1CERA 1KH2A 1O96A 4FSHA 4CTMA 1I2MA 4LA4A 4F91B 4TM7A 5T6BA 3V1KA 4H1WA 4Q02A 3HTXA 4I1UA 1KP3A 2GSWA 3L82B 1UP7A 1QH0A 2EKPA 1JFFB 1XROA 3WZLA 2VUUA 2GOYA 2BEUA 1AGNA 3CH7A 4DTIA 3BSWA 2VDPB 2YVAA 2C42A 5AHRA 5D3KA 5FXMA 1UBMS 1M2OB 1XL1A 2GJKA 1I4LD 1IUOA 1PS8A 2I87A 3ZW7A 5CG2A 1L8AA 4P22A 4XWKA 3RC1A 5TQ0B 4H4EA 1ONOA 3HLTA 3L4BC 5C37A 4YFVA 2B34A 4GQBA 4HGYA 4NHOA 2IYFA 4TMTA 4BFXA 5BN3B 8AT1A 2UYYA 3ELBA 2XCQA 2P4HX 3KUXA 5JRZA 5EA2A 5GJWC 3UOWA 3NKVA 3L9WA 4LDPA 4IRMA 4P9NA 1PGQA 3FUVA 3ANYB 3R9XB 1YDGA 3WV5A 4S0XA 4G4GA 3E18A 2VJDA 5JNTA 3LJKA 2A9KA 4R1SA 3IDAA 4H7FA 1BS9A 2B4YA 1JA0A 3L6DA 1EFRD 4WUVA 2XRYA 1FOEB 3A6ZA 5BVHB 1TAHA 3ZHYA 1C9MA 3ITEA 3L8FA 3TH5A 1QPBA 4ZOQI 1T6BY 2AKEA 3IELA 1LLDA 2CUZA 4V0OA 4ZEOA 3MCTA 2ZQYA 3N2KB 2OA0A 1P33A 2LW7A 3OWXA 4K8OA 4ZV9A 3RFFA 4BKQA 1G6OA 1BGWA 2BJVA 3LECA 5C1DA 1NBOA 3OE1A 3LP5A 2FPOA 4MVJF 2NSLA 3GMTA 1IL0A 1Y5MA 3OO1A 4PC1A 2VAXA 4R83A 1G3UA 3W3AA 1JLRA 1P0PA 1U0FA 4QPJC 4DREA 3KUDA 2X9VA 3BIFA 3RC8A 1VYTA 2F9FA 3I01A 3I9V1 5IAEA 1P1CA 4B3HA 2E4AA 4X8MA 3ILSA 1RYHA 5DWDA 3PHJA 4GVLA 3FCUB 1G3IA 1V6CA 1IIBA 2WSSA 3QYJA 1DX4A 3GJ0A 3SHWA 4XYMA 3T9AA 4DLLA 2P7IA 5A7HA 3E3LA 4P7GA 1IQ0A 4UPVA 5CT4A 2H4HA 2CF6A 2W6QA 1XCOA 4EY6A 1QLHA 4JLKA 5E9JA 4CM8B 5E7JA 5TIIA 4LOKA 1RDFA 2PWAA 5B7GA 1K06A 1P60A 2WIGA 2GCIA 3H3JA 4IEFB 4MUFA 4KVGA 4Q39A 2JI7A 5EZYF 5HA5A 4BJ1A 2R6FA 5KJEA 3E9NA 1NDQA 3ELWA 2LPMA 1UADA 2IUFA 2XB4A 4IJKA 4F4UA 1E7RA 2XJ9A 1M1ZA 2WKRA 4FYHA 1TM3E 3H1EA 5C7LO 1XZEA 3FKSA 3H1PA 4FEAA 1NQ5A 1YI8A 2GUWA 1VLLA 1ZU4A 5ADWA 3J7AC 3FY4A 5CAEA 2P79A 2W2MA 1EQAA 1AS2A 3ONWA 3P9IA 4HUJA 4OGKA 4TN1A 4AQ7A 4J3JA 4TN5A 5F3DA 3VJKA 4AP6A 3AVXA 2WF8A 1ZGBA 2Y71A 3PLNA 3MRTA 2B8NA 1X7YA 4FFWA 5JQWA 1QGED 2AFHB 1CY1A 5CVUA 2CVZA 1UPUA 3S6JA 1DEKA 2RH8A 3GQVA 2WYIA 4NCBA 2CDNA 1CF2O 1M0TA 3T7IA 3BQMB 3X1DA 2C98A 2O3QA 1VHWA 4DUZB 4AZ0A 2GLTA 2DWOA 4ZU3A 5T67A 3DQQA 5JWRA 5FUVA 1F2VA 3P96A 3UMMA 2AN3A 2VCEA 4WSOA 4F5DA 5BWOA 1PQUA 4MS3A 3AM3A 5FTKA 4KQKA 1PKXA 4IDPA 1M1YA 2MSEB 4NBRA 4O1IA 2FETA 5LKAA 4HL6A 1D2NA 2P9EA 2JA2A 2OTCA 2ZYTX 3HR4A 2QVXX 1STOA 3L0ZA 3L93A 3QP9A 1T1JA 4P38A 3WYBA 4CT5A 4RQTA 1L7AA 1PVVA 1ZD8A 2DH6A 2XWPA 3D4OA 1GSIA 1MC8A 4BWFB 2ZRFA 1XE3A 3BMXA 4D9JA 1VB3A 5EJ9A 3SR4A 2O48X 1XCGB 3MWEA 1JIXA 5KU7A 1FW8A 4DMUB 4XWOA 1S4MA 1Z13A 1DC4A 2G1PA 3LQ2A 3MC1A 2FFQA 4CN8A 1XLVA 2YVQA 3P19A 3ZWQA 2YMQA 3KQQA 3GI1A 4FKZA 1R50A 1L3BA 3IAM6 4O0MA 3GEHA 3ZHRA 4N0PA 3IE1A 2X5JO 2AYXA 2B2XA 2VNJA 3K9FC 1GZ4A 3LC0A 3MCWA 5D87A 2NV0A 5DHPA 3B89A 3OM9A 1PK8A 2XT0A 3AG6A 5IJ9A 4MRRA 1IHDA 3TSAA 1P0QA 3THXA 1GTVA 3ZN2A 3COJA 3QXGA 1CY4A 1QHIA 5BUSA 4NARA 1L7QA 3CT6A 5E6SB 1RM3A 3OQNA 1JEDA 3RYHB 1F8UA 3T5PA 3OOEA 2OE2A 2FFBA 4KRYA 3F4LA 4W6ZA 5FX2A 1EX1A 4M1WA 4W4TA 2OQVA 1RI4A 1JHMA 4H77A 3V34A 1P61B 3M1IA 2DOKA 2R4QA 2FA9A 3PIRA 4CM3A 5DLYA 3PGA1 2C5HA 2CXSA 4X6LA 1VXOA 4MJ7A 3H4MA 4RSGA 4UXIA 4ACBA 4DSTA 5ALJA 3KD2A 4DZTA 3I6YA 3NYQA 4E2YA 3WLSA 5HJ7A 1GG2A 3SBXA 1B0ZA 5B55A 2V0CA 1YCDA 1XI2A 3GDFA 1E0DA 3BN3A 3EC7A 4MW9A 4B3CA 4LOJA 3LT4A 2HU5A 1DFGA 2IPNA 4HWOA 4IHJF 3W04A 1G16A 5KTOA 2UVDA 2JEZA 2ATCA 5IYZF 2H85A 1NC3A 4WQMA 1JHYA 4J16A 4DQ0A 1ILWA 1CZUA 1YMUA 2ZTUA 4HK4A 1XWIA 4PWYA 3D0QA 5CG1A 3QVLA 3RS7A 5H81A 1R0CA 3OOJA 3P9YA 3SQOA 4B4VA 1R5JA 1E3WA 1EE2A 3SZ3A 5BSHA 4EH1A 4POAA 1EP9A 3VMMA 4DV4B 4B48A 4MI3A 2AFHE 4HVAA 2BGWA 2KMLA 1GPWB 4ZQEA 4ZQCB 2H0QA 3TL3A 5EUQB 2W11A 2FX2A 2EVWX 4D8VA 3HWWA 1QRTA 1KI1A 3LHSA 3KDAA 4MICA 2JFOA 2JIBA 5CUQA 3FSGD 3IOMA 4PG4A 2WWFA 3STXA 3WB9A 4A10A 1UXGA 3BWXA 2UXCB 1G5TA 2OM6A 3ECAA 2JZOA 3K1TA 5B1EA 3U19A 3WQBA 3AEYA 2NPOA 3FZGA 3QENA 4PG7A 5FF9A 2ODNA 4S1TA 2XYQA 2AOVA 3UQZA 1D8TA 1JLLA 1I4WA 4P92A 4BRWA 3NP9A 4F04A 1P8JA 4NULA 4D74A 1FSPA 1D2GA 3A4IA 3HFSA 4HXFB 2JGDA 4JLDA 4C0LA 4JUAA 2ADFA 2Y0BA 3NS7A 4H3KB 3MCZA 4FKMA 2Q4RA 3GAFA 5DK6A 1Z83A 2QV7A 2RARA 1BU8A 3NKFA 2ZU6A 1XXHA 1DJMA 5DRTA 1GD1O 2BSXA 1Y4ZA 2JBHA 4YMWA 1VYVA 3RO7A 5IVKA 2FQQA 3FYUB 4H7EA 5FQOA 2P1ZA 4ZVUA 3TSWA 2Y99A 2PFGA 3T9EA 2BGMA 2ZWOA 4M9UA 1F2TB 2ID9A 2VDJA 4L57A 3X44A 4GWLA 4LZAA 1EI9A 3MJVA 1DE0A 3MWJA 3CLKA 1GP2A 1J9GA 1SVNA 1ZX1A 2DPGA 4KRGA 4LJAA 4MMZB 4QHTA 1W0JD 3AYXB 3I3SR 4CNBA 1NMYA 3Q3VA 2IZ1A 1MPTA 4MRVA 5C8DA 2WWYA 1TDJA 4KE8A 1Z2AA 4O4LF 3RRYA 4BP9A 4CKBB 5A3JA 4KYTA 3LVBA 3M6MD 3TTYA 3QG5A 4WCFA 4EI2A 2WR8A 1CULC 3LSTA 5JOQA 3FETA 2WIKA 2XF2A 4OI1A 4NU6A 4DMKA 1QIHA 4NAUA 2GSDA 4WCDA 1EWVA 1N8NA 1Y7LA 3VVMA 5JBQA 5MFPA 4ZAFA 2PH5A 4IIJA 2R8PA 4O0LA 3D3KA 3KK0A 1YL6A 1XA4A 3GJXC 4D8XA 1YS2X 4C5CA 2YV4A 5HCNA 3TQCA 5IS2A 4JROA 2VP2A 4DLZA 3D43A 1FSGA 1QIKA 1X19A 1QHFA 1MAVA 1PO7A 3INNA 3IP3A 4IJ6A 3HUUA 3SK0A 4HNSA 2IF0A 3CG0A 4RENA 3SXUB 3BL8A 4YT8A 1U8CB 5ALTA 1B41A 1Y80A 1C7FA 1MUUA 2Q8PA 3F5FA 2MU1A 2D1SA 2OG2A 3ORFA 2OFFA 4BV8A 3FRJA 4BX9A 5HFJA 4G84A 4B6JA 2ZJBA 1V71A 2VTEA 1W19A 4LJSA 1CQZA 1PJ3A 2RJOA 2ZYHA 1GTMA 3DZDA 2OCIA 1TZJA 3QWBA 4DA6A 4EB6A 4EJMA 1OROA 3OP1A 2Z2XA 3I4CA 3LUKA 2RGXA 2WDZA 3UAVA 4G36A 3L7NA 4F3NA 2QBYB 2HHJA 4RXTA 5JG7A 1LC3A 1XMIA 1YB1A 3PPXA 2PM8A 1ZNWA 2XUQA 4P33A 5CPBA 5KNLA 1Z68A 4WPGA 2QTAA 4MIYA 1KARA 3SLKA 5FOTA 2DUNA 4UTVA 2YRWA 1BHO1 4N4AA 2W2OA 4TUYB 4HF7A 1Q12A 2COEA 5BXYA 1MOSA 3HXMA 3LTEA 1R15A 3KEGA 2VK1A 4FFSA 3GVPA 3QX3A 4X44A 4QTZA 1OZHA 3PQ5A 1CSEE 1IK6A 2EAUA 1GZ6A 3O8QA 3OEYA 5I51A 5IXJA 4LSMA 3DWGA 4QUHA 5EPOA 2ZPUA 4CMIB 3PF8A 3DJYA 4G1CA 5FLKA 5BMVB 3D6UA 4MUBA 1GGHA 1ZA2A 2PXCA 2HRCA 4OHZA 1T4MA 2P0YA 2ZYSA 3P0RA 3ZDAA 3IBSA 2VTDA 4QXPA 1Y6QA 4JKIA 4XDZA 1LKZA 4W9NC 2PUTA 2AZXA 3RVBA 1LDMA 1QP4A 2ZAGA 2OFXA 2OO5C 1QV9A 4B6OA 2O5EA 1QF6A 2IXDA 2K4MA 4ZDIA 2WQ6A 2AD5A 1SXQA 1MKYA 1OJLA 2FZ4A 2XRMA 1S8AA 4WXYB 5AW7A 3QUCA 3HWSA 2YHIA 3W3ZB 1XX6A 2MMCA 3EXAA 5BRNA 3WC4A 1DTSA 4H6VA 1U63A 2P0EA 5SZIA 1ESMA 1T9HA 1U5CA 3L77A 2G88A 1U1EA 2BHNA 3U3ZA 3W6ZA 2ECOA 2RCYA 3AP1A 4JJFA 4NCJA 4C0WA 1WU8A 4Q1CA 1WVIA 5K4AA 5HPYB 1SPBS 3L8DA 4DQDA 3KLNA 1XJQA 1BVYF 4S1WA 2DHDA 2FW6A 2V3WA 4MRMA 4D99A 3AETA 2FUCA 2IPLA 3P0HA 3E2IA 4G4SP 2WMDA 3EF3A 3OKCA 4I55B 4R84A 1E64A 2VDVE 5BO5A 4M8NE 3AVOA 2ZTLA 4DNXA 1XZBA 2X1HA 4X97A 3PTZA 3UXHA 3G5TA 4N0QA 3U81A 4GM4A 5J9FA 4LNAA 4ZPXA 4HTFB 3TDMA 4K6MA 2EFHB 2IBTA 1VIDA 1PJ4A 4J1TA 1FFCA 3IKJA 2HDHA 3G7NA 1ST3A 4D81A 1YVDA 3IT3A 3ZDBA 4XTCS 4LV5B 3HO1A 1QZZA 4DHEA 1KS2A 5JCJA 4WASA 5LNK1 4D7AA 1ZCAA 5KMGB 4CM6A 1NMXA 2WMYA 4QOEA 5JY6A 4H1TA 2H4ZA 3KSUA 3AL0C 3RU3A 2JZCA 3IQZA 1N9KA 1OYOA 3DDWA 1TVCA 3O95A 4HNAB 1HNWB 3CCBA 1JG7A 4KNVA 1TJ5A 4PLWA 4GR4A 4OFWA 1YKFA 3AIIA 2OZKA 3NIGB 4HAZA 4MGEA 2SKEA 3O93A 4V0LA 3TMKA 3BT7A 2C9CA 2ZR9A 2Q21A 2EYUA 4FFBA 1UBUS 1JHPA 3L9XA 1L4GA 1HYGA 2XKBA 4GEKA 4NF2A 5ALOA 3ND8A 1QONA 2MIIA 4B09A 1EJ2A 3T9BA 1JA1A 3RI3A 2QSZA 2V55B 2BMEA 3DL2A 2JF0A 3CWQA 4HPXB 1N3YA 3ENZA 5GVRA 3WOVA 3EWNA 3CH4B 1E2EA 3E1KA 2PSFA 3IODA 3JCZA 4FIZA 4IV0A 2ADMA 5H4GA 3K70C 2AMFA 2B1QA 2KJQA 4IXNA 3I9FA 3DQPA 3UBMA 1D7AA 3LFUA 2XBUA 2QN6A 3NB0A 4AZ3A 2PSJA 3QVKA 4QGBA 3ZWMA 4BN0A 2HDOA 2WTBA 4YXWA 1U7XA 1ZHOA 3O9VA 3OQHA 2GCPA 4I6EA 4MVYA 3IIMA 1H5QA 1B6RA 4KX5A 4LKRA 4MUYA 4Q48A 5EGNA 1QTQA 4JMLA 1DKOA 2VR1A 3KYCA 1PFUA 1R0WA 2CZGA 3CRVA 2QD3A 1TKAA 2JB9A 1E4YA 2HK7A 1H0HA 3L5KA 2ODBA 1R9MA 5KWIA 4XIFA 4CQJA 5G2OA 1HTBA 2QTVA 1FJGB 4JZKA 4EMUA 1CQPA 1E89A 1U8UA 4XYEA 6LDHA 4REOA 1E9DA 3NLLA 3T8YA 4U2EA 4KQFA 5DSZA 2IXAA 3DXYA 3DE7X 2WAMA 1H23A 1UPXA 2ZRKA 3DVLA 2G6BA 4Q5IA 3E7PA 5JDCC 1JDNA 5DSTA 2GJ9A 3W2EA 1JAZA 1HE2A 1JDJA 2BHTA 1NYQA 4HB2A 4HDQB 3JD3A 3TGPA 4UHJA 1HX7A 1RYZA 4AG3A 3H16A 1E79A 2HT1A 1M1YE 3SIPA 4TYWA 2Z9BA 4R01A 4OQDA 3KSDO 3N7UA 5FORA 4DJTA 2PT6A 2OXFA 2RGWA 3FHTA 3TRIA 2BI8A 3L0CA 1DLIA 1H2XA 1QGOA 2GBIA 1J0EA 4NLLA 2WD9A 5EHGA 1I6LA 3IHTA 3T3EA 1X8LA 2VPZA 4M1TA 3RC9A 3VU0A 3ZKWA 1O95A 1RPTA 3AUFA 3EJWA 2GETA 4P80A 2DUJA 1RXWA 2BHSA 1MB0A 3K53A 1PBNA 1HDYA 1Z0ZA 3CNLA 2CWDA 1TM2A 4IVPA 1W47A 4TOIA 1UDBA 5AVYA 3NT4A 5K3BA 4GBMA 4K87A 3OTHA 3BMCB 1AY0A 1W29A 4XB6B 4AICA 1E2UA 3OEWA 1NJ5A 2W6ZA 1Q0UA 1YXMA 2AXEA 2J4DA 1U8YA 3U39A 2RGYA 4KK4A 2YW9A 2XZPA 3HXKA 3Q98A 4Q1EA 3JATA 5F2NA 3OFND 3PA6A 1JZTA 1NW6A 1J2YA 2G1KA 1G21B 1OXBB 2F2TA 5BN5A 3ASYA 5JNUA 3FYTA 2HIMA 2Q1WA 1MJFA 5ALPA 4RF3A 3V1UA 4FMCF 5JAZA 2VHZA 4R40A 3ZWXA 4B6EA 5J4HA 4GZ3A 1JLMA 4YUYA 5A3QA 4M98A 1THZA 5HVNA 3H87A 4G01B 1MG5A 1NR5A 1W88A 3HI6A 3N75A 2CBZA 4HLQB 2XYPA 4OI2A 2WWWA 3LBYA 2J3LA 3WLAA 2GCNA 3UA4A 1UMBB 2I76A 1SZJG 3IKMB 4EJFA 4Q1BA 4MB2A 3OECA 3BRSA 1L9XA 2CB0A 1LRLA 5DN6A 4V1CB 4UTZA 2Z8YM 3RQIA 1XZPA 3OKPA 1DIGA 4KODA 3AILA 4L50A 1RZVA 2R00C 5ALUA 2JCVA 1NSTA 4N5IX 4UEKA 1IWOA 1T43A 4ZWNA 3WL7A 2I2BA 2KB0A 3ZH9B 2NIPA 1XZQA 2RKWA 3VOBA 2OGSA 5K6RA 1SG6A 5B4VA 3ADCA 4KNYA 1T4CA 4HWTA 4UHFA 1KQNA 4G4IA 3ZWNA 4C6RA 1OH8A 3WJ1A 4INZA 5GMOA 2NUPA 3G7SA 5C5DA 2I3ZA 4E5YA 1GZSA 2YJ5A 1HNZB 2WWHA 2OHFA 2J0EA 1CJSA 3BB3A 1MAWA 3RWMB 1YR1A 1TYDE 2YOHA 5AI5A 3GAZA 3I2JA 3I0NA 1DIOB 1FUEA 4QUBA 3KZKA 1G3RA 2J8ZA 3QUSA 2XODA 5EXSA 3CH5A 4R81A 1NTOA 2VT6A 2IYXA 3K30A 4GRAA 4UEWA 1X14A 2GZRA 1MLDA 1TGYA 3HPQA 4HZUA 4NMMA 4CCYA 2G5CA 3LT5A 2OXCA 3VBEA 1Y6FA 2PIAA 3G8YA 3V7NA 1RAEA 3F1LA 2GCGA 4WZAA 3INTA 2QPTA 3P9CA 4ARCA 3W8NA 1TZ2A 5HKBA 4N01A 2Y1GA 4RABA 1KYVA 1WPRA 2W48A 1V7ZA 4BNFA 2L0XA 2ZSFA 1F1BA 2GT1A 4DAOA 5LQRA 1OVMA 4XVUA 5EWMA 2QAGB 5A0TA 1B2LA 1CBUA 2J7KA 3KEMA 3NANA 4U02A 1OXKB 3TX2A 5JNWA 2PFKA 1JMVA 1WCV1 4EYSA 2GZSA 1VJ1A 2ARKA 3JVIA 4ALMA 3G0CA 3DT6A 1TIBA 2WE7A 3H2GA 3BSFA 4ZC1A 1SKAA 1YIDA 2DTXA 1SXJC 3S27A 3TUZC 1P1JA 4UVIA 2L82A 3U4QA 1EUZA 4XPZA 1KPGA 2C7VA 3CLVA 3SFZA 2MR6A 3HKCA 7REQB 1NTRA 1C4OA 2J9XB 4E70A 3TQRA 2PT9A 1HDOA 1TUIA 2VSOA 5HR5A 1T2VA 1U3GA 4C78A 4E13A 1IHPA 3B70A 3COSA 3LO8A 1W4CA 1ZGJA 2KM1A 2CT8A 1KZ4A 4CIDA 3VPBA 1QE0A 4GP9A 1ZMBA 3EX7C 4B5KA 3EWAA 1J49A 4CKZA 1G21E 2ZR7A 3HS3A 4NESA 4TMWA 4WZBA 1O5IA 5F7JA 5JS6A 4BXOB 4UAJA 2I7VA 4IXWA 3AGPA 2G82A 3DWFA 4TYQA 1WUYA 2DFNA 4N65A 3LLUA 1ENYA 4YT5A 4QGFA 2YV1A 4OSEA 1VPLA 4PYLA 1B16A 1BJKA 4BBPA 3HGTA 2WYHA 2PZBA 4UC0A 1N2HA 4XI9A 5M2QA 5B7PA 4IQFA 4HO1X 2LCIA 3RNOA 4W5TA 1S8OA 1UQRA 2PBLA 4BDTA 2E49A 2OC4A 2F90A 1KXJA 4FLFA 3TN7A 4IHAA 4JCCA 3EDOA 1M2VB 4QG7A 3VR0A 2YUIA 4BB5A 1I14A 5JD5A 3RJ5A 3FZEA 5EERA 1Z6QA 1IE3A 2Q1YA 2WIJA 3HCRA 4DCSA 2I91A 3SX2A 1DO0A 2PX3A 2B78A 1M72A 1TPYA 3I04M 2V1XA 1CY7A 3B8EA 1NQUA 1PJAA 4R0NA 3UMBA 3HMKA 4IJQA 4BYMA 4EKEA 1MA3A 1Y81A 1T0BA 1F0YA 2HMYB 1Y5NA 1L5WA 5G0SA 2FPKA 2PXXA 5EN4A 5BSGA 3TZBA 3D2LA 4AO6A 2Z5FA 3E1SA 4ZYLA 2RGDA 5CDGA 2PT7A 3JASB 2K5UA 1HURA 5KSWB 4RAOA 5L6MB 5HK8A 1GQFA 1PS9A 1W5TA 2PK3A 2Q9BA 4MWBA 4NQRA 3VH1A 2VRCD 4GP6A 4H0FA 3WP0A 5KYXB 1C3VA 5CR9A 3URMA 4RH3A 4RD0A 2R8RA 3T5AA 4OXIA 1OIXA 5KNBD 4CKCB 4EDFA 3DZCA 2AZTA 1XYVA 5DGHA 3HZZA 1EYZA 4I1IA 4LXXA 1QOQB 3IKLA 4KYUA 3HDVA 4X8LA 1AZWA 5HFNA 4RZHA 1F5NA 1JE0A 2XDYA 2IIVA 2WKWA 3D6VA 4UM8B 3M6XA 2BW0A 1QPGA 3DMTA 3PUKA 3TR5A 3AEUB 2VQDA 3E27A 1UOEA 3D4BA 5L3QA 4UASA 3KHSA 4HVCA 1IBRA 4G0OA 4D25A 4FGZA 1HYBA 4MLDA 4NX2A 4JLJA 4JCOA 2H9AA 1NDUA 2I6FA 3RT1A 2GYWA 1QIGA 4PO9A 1USIA 2PWBA 5FA6A 5TVGA 3H4IA 2FPIA 5DNYB 4HATA 3GHYA 4KR0A 3SNHA 2P68A 4UTOA 1A71A 3U1BA 1GL9B 2WV9A 3EF0A 2HMTA 3EN0A 1T8YA 3A0UA 5D1NA 1VDZA 3L3BA 1JU4A 2AKYA 2C9DA 4PQGA 5MN6A 4YRCA 2WICA 1P3Y1 4YRTA 1NU8A 3AFIA 1TLTA 2DR3A 3I1JA 2XCRB 4ZJPA 5EQDA 2QXYA 2B6HA 1EA7A 3UEOA 1USVA 2CYBA 2C5LA 2YX1A 3QG1A 2IL1A 4ZT2A 1JLSA 1NKTA 5SV2A 2P90A 3H3XA 5REQA 1UMCA 2XIQA 1M8FA 1NWCA 2YZGA 2FRDA 2FZVA 4NFLA 4EW2A 1X39A 2C29D 1QYXA 3JWIA 2PNJA 2BFNA 3O8OB 3TMAA 4RKRA 2I2WA 4WXMA 3S7TA 3OM8A 3H0KA 3TQTA 3D59A 3UANA 2AYZA 2L42A 3HXTA 1U2TA 3P0EA 3ZDYB 5F3WB 3PSAA 1YJQA 5AOVA 1QB8A 2RGNC 2D1TA 3NTOA 2DVMA 3RT7A 1U1FA 3VX4A 5JXWA 2NUAA 1C9YA 3THWB 2W5UA 3MWGA 2AHRA 4M8LA 2IEDA 4R1PA 1LZLA 1L5SA 1FDWA 4P8RA 4GOJA 1GTZA 1MO4A 1TYCA 2VKQA 3C45A 1GRRA 3EAQA 3S29A 2H54A 5I9LA 1IYZA 4W1RA 4RLSA 5B5SA 4YMTA 3VNSA 2JK1A 3NWBA 4M9CA 4XQ0A 5EIEA 5JYBA 5TMDA 3TE6A 5B2FA 3G6KA 1KZ7B 1NDHA 2EX0A 3KB8A 3PQCA 4U63A 2X40A 3W2HA 5CXUA 1LDYA 1N2EA 4BS9A 4REQB 1L3CA 1H9AA 3VZSA 3LUAA 5DIZA 2WYUA 2F8MA 2Q5LA 1JHXA 1NUPA 3DULA 2OYCA 1I4TD 3VSAA 2WFZA 3HY3A 3KRTA 3NEYA 4QQKA 3UNXA 3EAGA 3HKEA 5JJIA 3DHNA 3JQ9A 3VOTA 4M1QA 4YMLA 4HH4A 4KLCA 4HB0A 4ZPJA 4L5BA 3RHZA 1JSRA 4EJSB 3PCRB 4A92A 4XWWA 2W43A 5TGZA 5GGYA 1LA2A 3P27A 1YOVB 3G59A 2R7LA 4JXZA 1KDYA 3ZYZA 2AXNA 4RF4A 5A3RA 2C4HA 3WWDA 1XK6A 1DIAA 2HRZA 3GGGA 3GRAA 3MOIA 4XIGS 1GITA 1KAEA 4BO4A 4Q37A 2FQXA 4DJJA 2BY4A 2ONKA 1HQCA 1DO8A 2Q49A 2QRVB 5CU7A 4R3WA 1MFZA 1AMOA 1WBJB 4X7MA 1DCTA 1MTOA 3IMKA 1C0KA 3JAKA 2YYYA 5DGXA 3VC2A 2IYAA 5FBWB 3MMSA 4PG8A 4N12A 1GFZA 1RAGA 2R1VB 4LXGA 2V74B 4DUYB 1Q0TA 2GAOA 4IQ4A 1V26A 2FWMX 2EQ5A 4TKVB 4BV2A 4OMDA 3SF8A 1BKDR 4AL4A 2V7PA 5JASA 2HUNA 1GFWA 1KI8A 2Q9CA 3CVJA 4F12A 8OHMA 1OFTA 5GZ6A 3T7KA 5B3LA 5JCPA 4BLSA 3JALB 3R75A 5E1DA 3N76A 5IXSA 4DFDA 2OVBA 2VWQA 4RFVA 5HTKA 2IRWA 2P0AA 3DBRA 4U7HA 1WZIA 2YOGA 4DM4A 5D5PA 1NW9B 3ABQB 4X1YB 5E7IA 4JI3B 4H7PA 1CQXA 1IC6A 1YRAA 2F1IA 2CJYA 4OYYA 1Q57A 3VDXA 3WISA 4IYJA 3R7WB 3WKEA 2B4AA 1I7SB 5J3JA 3E1GA 2XXAB 3FYDA 1ORHA 5L4SA 1VYHA 1ZBDA 1HT2E 2ZBEA 3B7GA 3RRFA 1QUFA 4MPDA 4R1MA 2GNAA 3HXOA 1VZ3A 4KWEA 1OLXA 2CZCA 5CFZA 1U8XX 4TQGA 5IZ4A 2H5EA 3R6GA 2YQ4A 1UFRA 4C14A 5T5QA 1QRSA 3LDHA 2YZNA 4KWHA 4FGLA 2C4VA 1MO3A 1ANKA 2JAQA 2OORA 4J07A 4WI1A 4B4KA 4CI9A 3VC3A 4MKRA 3RFVA 3OU6A 5FOVA 3R74A 2Q1TA 3DTVD 4ME6A 5EJ7A 2E5WA 4V1CI 3PDHA 2YIJA 4Q0MA 3H11A 4QELA 3GOQA 2NSHA 4N8SA 3SC2A 3WJ2A 3RSSA 3KZ1E 4EGAA 2PT5A 1KJJA 1QMPA 4KWTA 4EHBA 4EZBA 5IWCA 1AZLA 3C8MA 1I2ZA 3IO5A 3QITA 4J6EA 5LUBA 3WYAA 2NYAA 1P6UA 2HX1A 4Z4CA 2J6HA 1I0IA 4HPJB 4GYKA 2IYSA 4ERXA 3RU9A 3N8IA 2GLXA 3TRJA 4Y2QA 1N7HA 4AW9A 1CUEA 3O2NA 5F21A 1BQEA 2HYIC 1QJ4A 2P2CA 4Y6GB 3VFDA 2B6NA 5CFLA 4LYEA 1IZ8A 4ETWA 4ZV7A 1YL7A 2YDYA 1B6TA 1PLKA 2ZBUA 4H0NA 3AI3A 4Q3AA 1SHZA 1TKCA 4YJ2B 4AN4A 4EFMA 2H0RA 1A50B 1BO6A 3MJDA 1Z5GA 3HDHA 4IZOA 1I30A 2DLDA 4YUXA 3HCOA 3QLVC 4TTVA 4XEUA 2V6MA 4PANA 1G2OA 3SQMA 4XXHA 1ABBA 1XKTA 3FX2A 2J9GA 2BELA 1Z0DA 4OF4A 1E1CB 1GUBA 5B1HA 1UXOA 1ABEA 1R6DA 3GAAA 1QKJA 4YS6A 4H1VA 4C4TA 4E5UA 4Z9XA 2XVYA 1FFXA 5FNZA 1NAIA 2HWKA 1XHEA 3ZHQA 4YRAA 1BJTA 4LSZA 3SXJA 3L40A 3THYB 5JECA 1P2DA 3DOFA 4NKRA 2RHLA 2X77A 2IU3A 5AVXA 4IDBA 1PUXA 2Z6AA 4YAEA 2WWXA 3EMDA 4KW7A 2FMXA 4GL2A 3IT1A 3N2GB 3CLSD 3CRMA 2HXSA 1HI9A 2W6IA 5AOAA 3RS0A 3TK1A 5LD2B 2PUBA 2NVUA 2ZIXB 3L8YA 3CRZA 3O47A 4JYCA 4RE6A 4R68A 1H2BA 2ANCA 3PNVA 3RAFC 2ZROA 4G9BA 5DJ5A 1CHDA 2C3UA 2A9RA 3VYUB 5AI9A 4P4SA 4X8HA 4U39A 5HM6A 1J99A 1XN1A 1M66A 3GFVA 1VIYA 3F2IA 3DTVB 1H6BA 4A15A 4C3UA 4FNMA 3TZQA 3LFTA 3V2HA 1YUBA 4Y2YA 3I30X 4E4TA 1GXSA 2PMFA 3PXUA 4JDPA 1FJXA 2N3ZA 2FEAA 3DYBA 1BDBA 3QU4A 4PHFA 3EBPA 4KO8A 3U3DA 1J2UA 2MMGA 1NW3A 2QL7A 3KPYA 4TWAA 1ZEJA 4TUYF 5EIFA 1PS0A 1A04A 3V8RA 1AKTA 1WDWB 4GM1A 2BGTA 4P3PA 3HM9A 3PJFA 4WZAE 4MV4A 3FOBA 4KO2S 4OVKA 2GF0A 4UW9A 2C97A 3WDSA 1QRAA 1PWEA 2C0CA 5IX8A 4DGSA 2GA9A 4CM7A 3K1ZA 2IDJA 4FYWA 5ENDA 4ZEMA 4D6YA 3UICA 3V8QA 4ABYA 2X8JA 3AB7A 4PC2A 5BMVF 1J2EA 3A3KA 3MGGA 4NZPA 1HL3A 3T3OA 3AONB 3I0MA 2ZOSA 3EVNA 5ALRA 3ICEA 2CKDA 1JH8A 4C0BA 4YK7A 1WMEA 3BQNB 1UKAA 3E5MA 3SWWA 1RLJA 1A9QA 1N0VC 1ZK0A 3LT0A 4K40A 5EKSA 3PBKA 3TLXA 3UJHA 1HZZA 1OLSB 4FTWA 4A26A 2OG1A 4KUEA 4TZKA 2H65A 3FZNA 4JR1A 4QDTA 4M9RA 1GU0A 3KVNA 4YCCA 1XZLA 2GKGA 2JGMA 4AF7A 2JJYA 2MINA 3BKXA 4RL4A 1OU0A 2OBXA 1IN8A 1Z7BA 1T8RA 2FEMA 1ZI9A 2H00A 4GMFA 4IOMA 1UKVY 2FUEA 2HKIA 4Q6WA 4J2HA 1ISSA 4B0OA 4O8CA 2ETVA 2C2WA 1U90A 2VH5R 2I4OA 3HSYA 1UFVA 4K3UA 5H7XA 3SDBA 2CFIA 2WTNA 3LRTA 2RH9B 3PNKA 4P4GA 1K6EA 3Q9SA 5BURA 1E2BA 4UMFA 3SD7A 2HRRA 3QNWA 1FDTA 4EO9A 3HJRA 4MQ4A 5JS2A 5M34A 2W2QA 4RPJA 2R66A 3HYTA 1O6GA 3W5UA 2G9RA 1VIVA 2QLJA 4L5JA 3AI2A 3CZRA 1NVTA 3EZLA 1LTQA 1TX4B 3E9RA 2XUPA 3P9PA 4F3YA 2YCLA 5JCZA 1AT1A 1WD5A 3Q6IA 5KOHB 1EWTA 3PENA 3TNFA 3UMFA 2FEKA 3OFJA 3ZX5A 5G1NA 4BE9A 4N9QA 3ZLBA 1U0RA 3EODA 1MC1A 1MPXA 3OF3A 4BMDA 4OXKA 2EZTA 5EYPA 1RADA 2ZRNA 3RIEA 4EARA 3NT2A 1ZD9A 1A9TA 1O7JA 2VH1A 3SKYA 2FZEA 1JKXA 4EZIA 4XIYA 5BNFA 1SN7A 4COOA 5K03A 3ZK9A 1W46A 2ET6A 2YWJA 5AW4A 3GLRA 2ZCUA 3LUJA 4B75A 2X7HA 3JYPA 4ZHQB 2IH5A 2COUA 3DEZA 1UK6A 1HMPA 1RLIA 1V37A 1M6WA 4Q3CA 4BKMA 1K5DA 3AGQA 2ERYA 4BMSA 4KX3A 1USWA 4HVLA 1B23P 2QD4A 1K4YA 1K63A 3D64A 3SE7A 4D6XA 3DKKA 2ZJ6A 3UUWA 1SHKA 3EH2A 1E7WA 1U31A 3ZZTA 5FWNA 5JCOC 1LDBA 3DWEX 5AKZA 3RRNA 3CN9A 2M1XA 3AJ9A 3FMFA 3LUCA 3CHYA 3TWOA 1QTIA 4B3XA 4LZZA 2FTKE 1RABA 2R8OA 3ABZA 4FYIA 3VDQA 1W9MA 4Q4HB 2XOXA 1GUAA 3CLHA 1JG2A 4K28A 1M5UA 2P6RA 3D54D 4LUCA 1FYWA 2NUTB 1CV2A 2Q50A 5AIAA 2FNAA 4FYJA 3UVEA 3VO8A 4EABA 4EP1A 5KYNA 2ZSUA 3SKXA 1B1AA 2JAUA 2GPTA 4H59A 4IRXA 2IYZA 5L3ZA 3WLJA 4DDVA 4IS2A 4OIFA 3B9RA 1I7DA 3FGZA 1QF9A 2R96A 1UZLA 1ZOOA 2VNIA 1DQPA 3W77A 4Q1DA 3WDKA 4DY4A 5CDSA 2DKFA 5DTIA 1D5CA 1DJQA 1E5QA 2FN9A 1RYYA 2H63A 3CE6A 2PMWB 1GYQA 2FSFA 2I2AA 5KYVA 5ELXA 2ZTHA 1Y3DE 3NHJA 4RVNA 2PRYA 4Y0AA 4B45A 5LQNA 4HHEA 3IJRA 1GCUA 2HHLA 3U7EB 4BVKA 3BCRA 1NBIA 3NHUA 1M76A 5IAGA 2ETXA 1CZHA 4KN9S 4F5YA 1MHTA 4M86A 3BHIA 4YA6A 1A9OA 1K4MA 2XTMA 4WKNA 2PPLA 2WI8A 4C7KA 2Z2IA 1SBTA 1RBQA 3T34A 3QVUA 1JQEA 2HCJB 4N1AA 4G0YA 1YTUA 3ZY4A 3ZQ4A 3H9JA 2WJPA 3OJ0A 2QUKA 4K1LA 3T5CA 2HIHA 2JIDA 4KWIA 3NC0C 2E37A 3FNFA 3GMIA 4JVSB 3EXHC 3L7LA 3IHKA 4TT3D 3G9TA 4UHEA 4AMVA 2DHRA 4Y0NA 1MX9A 3BFVA 2RH4A 1ZD2P 2X15A 1BMTA 1YZVA 3I76A 1RXYA 4HSEA 3U17A 1E94E 1XZKA 3LDAA 3ZTTA 3BPSA 4J1SA 1Z6YA 5IZCC 2C4KA 3LUGA 4G0MA 1A27A 4DQVA 4CL2A 2FPWA 4JLNA 3PR2B 3R5JA 1D8AA 3PGVA 4EF4A 2F1KA 3LYLA 3A9TA 3PRJA 2CYCA 3MAAC 2CEKA 4WKOA 3L0OA 2E1PA 2XVZA 2GD1O 4DRYA 3CU5A 2XDQA 3DE3X 1YUNA 2AI2A 5A2QA 3DFMA 3IS3A 1HQYE 3K8OE 4RPHA 3VH3A 1PL8A 3ECCA 4JFAA 2O2GA 2NU6A 2YZ2A 2AG6A 1P29A 4EUKA 3JQAA 5JDIC 4NCKA 3ZLJA 4UMDA 2VYFA 3WLMA 1Z0AA 2AOTA 3VZRA 2F3PA 3VR6D 3PE6A 4YT4A 1GTSA 4UZSA 2R3SA 3JD1A 2HT6A 4HYTA 3RSZA 3ZYCA 4JI6B 3UAXA 2D5LA 2J9YB 2FFHA 3A4TA 1PZXA 2HA3A 3NDBB 3QVGB 1II8A 1ZQ9A 1INLA 4LPSA 3QBJA 5AJTA 1EEHA 1U5BA 2BZ1A 3GJYA 3H3FA 1GV0A 1O08A 3Q8WA 5DCWA 4I6JA 3PRHA 3BORA 1V48A 3KJXA 4NE9A 3DUFA 3R9WA 3Q7SA 3CA8A 4RXMA 2FFRA 2G9QA 1DWUA 2R48A 4B3DA 5F7OA 3L84A 1XYGA 2OZEA 3ABIA 4N6GA 4ZOAA 5HZKA 2FB9A 1VLJA 2GN6A 1NLMA 3HU5A 4E03A 4OHKA 2A7XA 2A57A 4F85A 1XTVA 2B5WA 2PWPA 3LQ4A 4TMYA 4ARSA 1U7TA 3UFBA 4Q4LA 2GM5A 4ARAA 4W7HA 1Q3TA 5KYUA 4D26A 1W85B 2Z1DA 3I9V6 3BEDA 1Y7IA 4NRDA 1DCMA 3D4IA 1JDVA 4DV6B 4KFUA 4UJ5A 1XHFA 4X71A 1DEXA 1Q7GA 2FLKA 2OP1A 4KI7A 2XEDA 1AO3A 1V4VA 2VP3A 3Q9LA 5CIQA 2CNDA 5DTRA 3W2FA 2B7CA 2Q6TA 4P2BA 1G42A 2HDNB 3C85A 3GUYA 3KDPA 4WINA 4BGVA 2UU9B 4Z4IA 2I78A 3U49A 2WM8A 1U2ZA 3D4NA 2H4JA 5IU6A 4CYMA 1M6YA 2XMDA 4IJWA 4MYCA 2CKMA 3IOEA 1YK0A 2V58A 3EMBA 3QU9A 4WDRA 1U2EA 1CNFA 2OUIA 1PGPA 3OLQA 4FILA 2JI4A 4ZGBA 4ALKA 4MZXA 4YCBA 2PGIA 3GZJA 3M82A 3HCAA 2C3OA 4XGRA 2AFIA 2OWEA 3OICA 3CIOA 2HJVA 4JUIA 1CUXA 4KHZA 4OK5A 4X84A 3ZY6A 1TJNA 4ANFA 4H1UA 3WG9A 4EG5A 5JW6A 3AHDA 3WNZA 3RAPR 4WJKB 4ZAVA 3DBLA 1JAIA 2OK7A 1V96A 1SQFA 3TDKA 3W0LB 2GN0A 1N6LA 2YH2A 4BNXA 4UVDA 4M36A 4C87A 1M10A 1TAGA 2Q7DA 3N2NA 2JVIA 3FPCA 4UXHA 4ITUA 4EHKA 1DJLA 3PTLA 3W8FA 2C96A 4CCAA 1I0ZA 1XQ9A 2BR4A 2QOEA 3UZUA 4DILA 1MIHA 3ADPA 4OQ4A 5FWYB 5A03A 3LTNC 1NJ8A 2H08A 4BNTA 4DTCA 1KZGB 1FP4B 1VRWA 1BHJA 2I4TA 2V03A 3E6AA 5ECDA 3B20A 2O0HA 2YJZA 1F7VA 3WK4A 1P2UA 4DEVA 3EBOA 4L4UA 1CY0A 3GN1A 5TF0A 4Q3LA 3GQBA 9ABPA 2BUCA 2M6RA 3ISVA 5P8WA 4KR7A 4OHVA 1SC3A 2JLAA 2M98A 1DBIA 5E95A 4L95C 3I9JA 1J56A 1ETUA 3WBKA 1OWOA 4PS0A 4BQRA 3H2BA 2R6R1 5I9BA 3MTDA 4LAFA 2RC6A 1VPTA 2VF8A 4WBSA 3B13B 3RC7A 5EHNA 1VSVA 4JKYA 1A9RA 4S05A 3ZUPA 3CZMA 3MGBA 4BJ3A 1VP9A 5EFOA 3R3XA 1H2FA 3W6UA 4EY8A 4D9CA 3ICOA 2QMHA 3HB5X 3K0FA 2V7VA 4BL5A 3PHCA 3WWZA 1T1SA 1SUWA 3BE4A 3IP1A 4DA0A 3LPCA 1PV1A 3C7DB 3G89A 4HEQA 5SZJA 5JXHA 4C7BA 4D3DA 3SZOA 1NXQA 4F2PA 4CKWB 5IM4A 4M0EA 3E61A 5AKEA 3KQNA 1T3ZA 1US8A 3C2QA 4NMWA 1L5FA 4AVYA 1Z74A 4LOHA 4TL7A 4B6PA 4RGQA 3GCGA 3AR9A 4URUR 1FNMA 2QT9A 2YJ3A 3G2JA 5JUWA 4PAWA 4NXMB 1SVSA 4DWVA 1HLDA 1VIAA 3K1AB 1LQTA 2UUOA 1LBEA 3LCVB 4BECA 3QJ5A 3I5UA 4RVDA 3TW8A 1X92A 4JU9A 3C1TA 4D44A 1E1YA 3DZKA 4DRXA 2FN3A 3PNMA 5BOSA 5LIPA 1KAOA 3SP1A 5BSFA 1QZTA 3QVVA 2VJLA 3EGDB 4BVFA 4DA9A 5MN4A 3OQ6A 2DR0A 1IEVA 3BWEA 3HL0A 3K0AA 5DYNA 4AMZA 5FEMA 3T5DA 2I9PA 4BO2A 1K5PA 1B0PA 4EKYA 1N34B 2XXBA 2FPPA 2R6JA 3LBIA 2R79A 5M3BA 2CBXA 1USKA 2P78A 3QKWA 4M6WB 1J1UA 1TYBE 4JVLA 4B47A 3S8YA 4TX1A 1U7UA 3K16A 4MWSA 3U3OA 2F62A 4EFNA 2EG9A 2R6HA 3VOSA 2C3YA 3SYNA 4A0HA 1OMOA 4HLNA 3RVJA 1TK3A 1E32A 4YASA 1HMYA 4QYMA 1S8FA 3BH7A 3I6IA 4XM0A 4BNWA 1RAAA 1Z12A 1D2HA 2ZT5A 3LZDA 1NY6A 2X9NA 4LJ7A 3VPAA 121PA 1RQ7A 1S6YA 1ISFA 2CCJA 4YHBA 2A0WA 2BKUA 3Q41A 1CE8A 1GG8A 5EKXA 4BZPA 4C21A 4WY8A 2ACKA 2IYYA 1KFCB 3L6RA 2O14A 2HDWA 4RK5A 4B1FA 3D3EA 1UODA 1YI0A 2BRUA 2I7TA 5DI9A 3QFRA 1R64A 4ETIA 2IE0A 3KM0A 4CCWA 5AK0A 5J2TB 3A32A 5EMHA 2F1OA 4J0QA 4LCBA 3CUTA 2G17A 4CLRB 3S5UA 3IHLA 1CVIA 1MOPA 4RD4A 5EJ6A 2UVQA 4CL3A 3LW8A 2AWNA 5EJ8A 2DQKA 4EFKA 2Y67A 4X1IB 4QZVA 3MCAA 2YDXA 1C3XA 3MIIA 5BSVA 5KOYA 2IX3A 1LW7A 4LXHA 4PTYA 3SC6A 2C8LA 4QYTA 3S0JA 5J4VA 1WMDA 4YRFA 3SZMA 1XNGA 5LJLA 1GM5A 1JIUA 1CW2B 1KH1A 3OPYA 4ZT7A 5KI6A 3TOCA 3DL4A 3T95A 3O7WA 1JJBA 3C43A 4AKTA 1U0TA 1UWVA 1ZSNA 1L5HA 3WIOA 3F0TA 5DNCA 2ZE5A 4PC7A 3TTVA 3G2HA 3A28A 3H5OA 4LX0A 3FLBA 2WV7A 1FYFA 4RQAA 4A91A 2QIPA 5KOJB 3F71A 1YNSA 1J97A 3GGCA 3BIWA 4Q4JB 1E8NA 3GPLA 3GGJA 2I03A 2A9JA 3OZDA 1LK0A 2DQ4A 2P5TB 1USUA 1KJ8A 4LDRA 1N6OA 1U3DA 1T13A 2QVCA 1XZNA 2WUWE 3AR4A 1OPRA 4KOAA 4CMKA 4IDGA 1LLFA 2XUDA 4BNIA 5FBVB 4L15A 3DEAA 3JQFC 4IXMA 4XSGA 4K6KA 4URZR 2FN8A 2XMZA 3OAAA 5BV1A 2WM2A 2E5FA 2V45A 3NJRA 2PKQO 3E3NA 3SBDA 3BXOA 4QUDA 1E5LA 1OBHA 5U4XA 2Y4NA 3FF4A 4JR0A 1GGEA 3I8OA 4YNBA 5JZMA 4FZJA 3LX4A 3V42A 3V3TA 1MC4A 1NJFA 3L8ZA 4PYJA 2IYTA 2P9CA 2JLVA 1YIAA 2PH1A 4FEEA 2B8TA 2XTJA 1KYYA 2GQ0A 3DE0X 1FP1D 3RFCA 4JOQA 2NO9A 2R751 4M0KA 3VKWA 2D4AA 2Q5IA 4JLVA 1HSZA 1E5TA 2CD9A 3TLYA 1CVLA 2J6IA 2FWBA 2JFHA 2X5OA 4UTXA 4ASUA 1WEHA 1Q16A 2JIQA 1G1MA 4MRAA 1J33A 2MSCB 5T57A 2JHPA 5KU1A 5KAPA 5B3AA 3DHVA 3I39X 1BDHA 4N48A 2Q4DA 5EZQA 3E7WA 4CG1A 1GYPA 2IY9A 3NM6B 2QTWB 1EBUA 2P7HA 4M1EA 1GOTA 4Q7KA 4E21A 5ICMA 3USZA 4PBTA 3FM9A 2JGKA 4JA0A 4LDAA 1S3IA 3M2TA 1M0EA 2GM9A 2ZYIA 1M7BA 5EI5A 1GO2A 4U6SA 3DAGA 9LDBA 2HSZA 1TL7C 4OMUA 1COWD 3KZOA 4XUDA 2WYOA 4HBZA 4MULA 1A9PA 1WG8A 4Y2HA 1DDIA 2ZVJA 3PEVA 3PC8A 3VPSA 6GPBA 4I1VA 3TLZA 4IXTA 4LSGA 1FNNA 2ONJA 3MWDA 2AQKA 4UU7A 2HBQA 5MN5A 1QO7A 4BNHA 1NVBA 2F67A 3C0KA 4PXSA 5TEVA 2VSYA 3NYRA 4KXXA 5KC9A 4RC9A 3RHFA 4Q82A 1A5AB 4NFSA 3R9KA 2YRFA 2RI1A 5K8IA 4ZMRA 2XV1A 4MSUA 3U5ZB 1L5OA 1WW2A 2PQ2A 3JQ8B 4MJXA 2Q5FA 1TTHA 2HQSA 1OI7A 5I6DA 2OLKA 2YXEA 1P72A 1E1KA 4NWIA 3D6JA 4YQFA 3WWOA 5T7BA 1Y9DA 3DSRA 1YE3A 3PQ8A 4WJZA 5J40A 5KBYA 4H2DA 1V9LA 1QNFA 2C8KA 4G07A 5ITZA 2Q07A 5FYDA 2NZ2A 4FOPA 3GNQA 1O0CA 1XQYA 3CVWA 1R5BA 3LLCA 1MEOA 1V1MB 4BP3A 1ONNA 3GDWA 4WKCA 3NOOA 5BN1A 3TPCA 4B9EA 2ZM6B 2QAJA 1FX0B 1LF0A 1L8XA 3N2IA 3P94A 1H8HA 4KTVE 1QH1B 1VCIA 2FP3A 2CVQA 1Q92A 2WOJA 3V8VA 5JR3A 4F60A 5K01A 1DU4A 3G2IA 1P1KA 1YCGA 5GJCA 3F90A 1RWVA 3PFNA 3GWGA 2QT1A 4G0NA 2LRHA 3F7OA 4NVRA 4B34A 2PR2A 3W34A 2CK3D 3GU3A 3IV9A 5LWHA 4MI6A 1FIUA 1C30A 5HE9A 4B40A 8ADHA 3DBHA 1XGKA 2ZVPX 3JTEA 4P7BA 4K05A 2EP7A 3NWEA 5KNDH 4CEJA 2VAWA 4JQOA 1H94A 2MYTA 3RVSA 4DMGA 4IEEA 3PYLA 4QBKA 4CDNA 4BFWA 3VJRA 4DKJA 2WIFA 4DNFA 3LBAA 3CEAA 2VLIA 4NR0A 3QEBZ 1DIBA 4LTNA 1FMLA 1HM5A 1W5EA 3JQEA 4L4XA 4I14A 4P3OA 5EOVA 5T64A 3WRYA 4FGUA 3T4XA 3D4LA 1KMNA 1M6HA 4EITA 4ER7A 4H0CA 4NU8X 4KSCA 1R3UA 3WHPA 1IIRA 3GLIB 3TIVA 2IIBA 3HBMA 1QE5A 3CNQS 1E6MA 1H1DA 4JXXA 4J7AA 1DEHA 2GK4A 4KIFA 1UOQA 3A4MA 4HDCA 1OF1A 1SULA 5DTQA 3SMQA 2MJLA 1CP2A 1O9GA 2ADOA 3O0TA 3QUTA 4KMOA 3H86A 4OKSA 2JFFA 1ZIOA 3QHPA 2C1EA 1G9SA 2XDWA 4XD2A 1P2VA 1N8KA 4ALNA 4OHWA 1CJVC 2CLHB 4Q01A 4BU1A 3IVMA 3FPAA 1OIWA 3GFOA 4TMVA 5LNK6 1IWBB 4CHTA 1MQ8B 3CXUA 1ZZGA 2QP9X 1GR0A 3HHPA 3QVXA 4L85A 4W9RA 2WJIA 2DWPA 3L7CA 4YBRA 4PCUA 3UAWA 4BO3A 2BTQA 2ZZNA 4ZTBA 1UIMA 1BE1A 1O03A 5FA5A 3AVQA 4K9SA 2YHBA 1VJ0A 1PJCA 4L08A 3H5IA 3AHFA 4IOLA 4BC1A 1KI6B 4A0FA 2EZ8A 1QHXA 1U6KA 1H2AS 3LUFA 4H9GA 3RLFA 4HADA 4YRLA 4IJ5A 1KEZA 3HJBA 4QOGA 3S8MA 3UOAB 4AMUA 2A78A 1LI7A 1GV1A 5H80A 1YC2A 1K68A 2B8JA 3FCCA 3KJQA 3KVOA 4F3CA 1NVXQ 4G1FA 2EFDB 2AJLI 1PJQA 3VKVA 1GNLA 1ORIA 3NJ4A 4C43A 2XZTA 2FJPA 2GRAA 1YT5A 3PE4A 2I1VB 3JYNA 1WETA 3EPJA 1KYWA 2ZYVX 1XRJA 4PYOA 1GNVA 1QYRA 1ZM7A 1QVVA 1GA4A 2OGUA 3G13A 4E5SA 2FRVA 3KG2A 1Z6PA 3GEGA 1O4WA 5J59A 3E23A 4OB7A 1KYZA 1S2OA 2K87A 2AFIE 2QYOA 2Q3EA 4JEUA 4M7OA 1QQAA 4P4NA 1QQ7A 2A0KA 3MCUA 4KVZA 4Z1MA 3G02A 3GA5A 3HRHA 4OLBA 5JPCA 2ZYWX 1BWPA 1G4AE 2A5LA 1CRLA 3BFJA 1KAQA 3U48A 5A6SA 5CA1B 2CXQA 3W8DA 5KYWA 2CLOB 2EDAA 3F6EX 4OHFA 5JBNA 3Q0IA 5C4IA 4JBXA 3IB3A 2ZP1A 1QDEA 4MQEA 4MR7B 1WBBA 1NI3A 2CHEA 2C8VA 1I3KA 1SHUX 3BWVA 3OD5A 4HRAA 2X3YA 3OZCA 1LQUA 1A2KC 5JNRA 1WXIA 4ZANA 1SD5A 5I9TA 5K0BA 3NBXX 1N7IA 1U28C 3AO0B 3HJNA 3HP7A 3OA0A 4FSXA 5BV8A 1Z06A 4X62B 4Z53A 1WXWA 1KZYC 2AA3A 1D1SA 2OZPA 2ZSEA 1NJGA 1RR6A 1TJ3A 3AESB 4FQ7A 4G5RA 2J0UB 3HBFA 4N5MA 4AY5A 4AQYB 1ZVQA 3ZCUA 1GQRA 3AUKA 1RWWA 4PX9A 2QA5A 2YXNA 1H2ZA 3NXKA 3PUVA 4CV3A 5E3JA 4AKGA 4D3XA 3WVNA 2ZKIA 3EG5A 4BTLA 1UPAA 1VFPA 3STYA 1RRGA 1SK9A 1PW7A 5J4KA 2EKDA 2J67A 3EYAA 3GLIE 3OZFA 4YMGA 2JFBA 3BG5A 3VNVA 4EMSA 1SD1A 3IP6A 3OIFA 3OIVA 4OJMX 5CK4A 4AWBA 4RHCA 3QMVA 3NBYC 2FW0A 3MMNA 4LKOA 3WSTA 5LP1A 3IQWA 2GXSA 3QYAA 3HV2A 3N2LA 1JZSA 5DXJA 2L69A 2MYUA 2UAGA 2YIVX 3C6BA 1JPVA 4I66A 4INPA 4XYGA 3IBGA 1B76A 4LZPA 3P71T 2AVNA 3HRIA 1ZMXA 2SCUB 1Y6JA 4KL8S 1PJRA 4OMCA 5CLIA 2XOKD 3COYA 3PXGA 3PHLA 4CM9D 2GAAA 2Z08A 2VBGA 3THSA 5FOQA 4B85A 2RK6A 3DO8A 3MMZA 4PZAA 3Q3IA 2XDAA 3HHEA 1JIJA 3KTAA 5AM0A 5FWXA 3VC7A 4AJ1A 2Z09A 4EF5A 4F84A 4BZWA 2IOYA 2C4UA 2XYRA 4O2BB 4X3CA 2XH8A 3VU3A 2V59A 1O58A 4ZREA 1GIAA 3I8SA 4JBWA 2E18A 4XRRA 4P6VF 5BUCA 3UYLA 3A6JA 1SU4A 4R98A 3V55A 5FO1A 3MCVA 2X0KA 5T3YA 3DE1X 5DK4A 2HSEA 2W42A 2P2DA 4B81A 1ULTA 2E4XA 4YUAA 5IKXA 2RB4A 3KEFA 3OF2A 5TQ2B 4F9TA 2DHEA 5KX5B 1OHHA 3IJEB 3K9NA 4PZUA 3MQ4A