3L4BC

Crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
216
Chain Sequence
MKVIIIGGETTAYYLARSMLSRKYGVVIINKDRELCEEFAKKLKATIIHGDGSHKEILRDAEVSKNDVVVILTPRDEVNLFIAQLVMKDFGVKRVVSLVNDPGNMEIFKKMGITTVLNLTTLITNTVEALIFPDEFSSIIPLEQGIEFLSVNVEEDSPVVGKKLKDLPLPRDSIIAAIVRGGVLVVPRGDTEILSGDKLYVIVSAEAKETVEETLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Octomeric Two-Subunit TrkA K+ Channel Ring Gating Assembly, TM1088A:TM1088B, from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords TrkA K+ Channel protien TM1088A
total genus 56
structure length 216
sequence length 216
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2009-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02080 TrkA_C TrkA-C domain
C PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 3l4bC02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3l4bC01
4OYRA 1B2LA 2DBRA 2ZJ0A 3FTNA 3QLJA 1HETA 1CEQA 2Y66A 3INGA 4DC1A 3JD0A 9LDTA 4EJ0A 2IXAA 1PR3A 1EVIA 4J4BA 5A9TA 5A4DA 1IZ0A 4TZKA 2YZ7A 4J0FA 2Y0CA 3K5PA 3U09A 2JHGA 3PGXA 3SEFA 1DEHA 3LF1A 2AQKA 2B37A 1TVEA 3WFJA 4BO3A 1HSOA 4E21A 1IE3A 4CM9A 2Y1DA 4AJHA 4Z0TA 3VZQA 1I3NA 2VYVA 1BRMA 4XB1A 3DBHB 4L4RA 1MFZA 4PLGA 3RD5A 3B6ZA 4OQYA 4BO1A 5DOZA 4RF3A 4RF5A 4F6CA 4BL5A 1EMDA 3TZCA 1RKXA 1GUYA 2GRAA 3TL2A 5KJ6A 1LC3A 3OEWA 4TWRA 1ADFA 1E6EA 1M67A 2E82A 3LT0A 3WYEA 2Q2WA 2QW8A 2H1SA 1FXSA 4HY3A 3DTYA 3G0OA 4ALLA 1DAPA 3PHGA 4PG4A 4BNXA 4R3WA 4W7IA 4XR4A 4OAQA 1LBEA 2H6EA 4I08A 2D1YA 1SEPA 1HL3A 4R1UA 1HTBA 4CM8A 5B4VA 4Y98A 1R4NA 2Q4EA 4G81A 3KUXA 4BNKA 2Y1OA 3GDFA 5JS6A 4CMHA 2BRUA 3UGKA 3L9WA 5MGBA 1JVBA 1P1HA 5JCJD 3HDQA 1I3KA 2ZB3A 4ID9A 4TRNA 3ZNOA 4HNGA 1HDGO 3HDYA 5DCYA 1GV0A 3DWFA 4JCOA 4RL6A 4BNWA 2FWMX 1K5HA 1XHLA 2HSDA 4II2A 4OIMA 3Q6IA 1UXKA 3WNQA 4UVDA 2GPTA 4CLOB 3KBOA 4JIGA 1ISFA 1NASA 4GX5A 4XQCA 2EW2A 2NU6A 4GKBA 4XEHA 1E3JA 1JA9A 4YAGA 3E9QA 4MVJA 5CDUA 3BIOA 4TROA 1E1MA 4ALMA 1P31A 2EWMA 5TF4A 5CDTA 3KYBA 1E7SA 4DQXA 5JYDA 3KLPX 4NPCA 5L45A 1YXMA 1T4BA 3NKLA 3E5RA 1JKIA 4HFJA 3ZWYA 5L7YA 2X58A 1PJTA 1ZK3A 4OSOA 3CKYA 4BQRA 2A92A 4PLWA 1PQWA 2P2SA 1HEUA 3QJ5A 1JDJA 1NM5A 4PZEA 5JY1A 1K89A 1NHGA 2HMUA 2HMTA 3WS7A 1N9GB 4DPKA 3TZHA 4AL4A 4E0BA 4ZQBA 4BNVA 3UW3A 4XIYA 1HYHA 2EP7A 3ABIA 4BMNA 1SC6A 1DC6A 1SCUA 2X9VA 1H0KA 2X0RA 3CUKA 1N2SA 3WIEA 3JQAD 3GDOA 1E7QA 3MJVA 4TMFA 3F3SA 1NQ5A 4IIVA 4MP6A 1M2WA 3WMWA 4B4WA 4MVJI 1JQBA 1NWCA 1DFIA 5DNAA 3AM3A 3K96A 4YR9A 4TZTA 4DUPA 3B20A 3VDQA 1XWFA 1H2HA 1YBAA 2YFQA 1LA2A 4PZDA 3WGZA 2VWPA 4D3SA 5IDQA 2PTGA 2VYND 3NDRA 4L76A 2WMDA 3H5AA 1M75A 5JPIA 3TZQA 1NTOA 3GDGA 3QWBA 3I4FA 3OF2A 2C29D 4XQ9A 3JQGB 3H3JA 4IY1A 2X0NA 2JAHA 1ADBA 3ZNNA 2GUGA 1QXSA 3SC6A 1NFRA 3FI9A 2FR8A 1ZH8A 5I9NA 1E1KA 4NR0A 2B36A 4ZQEA 5IZ4A 3FBGA 2AG5A 1YB5A 3MCVA 3DB2A 3DMTA 1V8BA 3ITDA 5JDIA 3WFIA 4A5OA 3OJ0A 3GUCA 4WNCA 5TQVA 1VM6A 3AY7A 1RM5A 1KY5A 4NIMA 4OSPA 1C0KA 4GX0A 1HDOA 4JROA 4Z9FA 3VTZA 1AE1A 5DBGA 1U8FO 1KERA 3RKRA 2PK3A 1Y81A 3T7CA 2CDCA 3EMKA 4BMVA 1JLLA 1DHTA 3QWIA 4YACA 1BSVA 3VH4A 1E3WB 4MDHA 4EUEA 1UDCA 5ITVA 4Z9XA 5THKA 2DPGA 3KEQA 3PJEA 4Q9NA 3VVCA 3KYDB 2DTXA 3BTVA 1WLYA 4EBFA 4FB5A 4M8SA 1PS9A 4R3NA 3ZW9A 5H81A 3RUEA 1A9YA 2FPGA 4R68A 1VJTA 3E82A 1QRRA 2GGSA 4GGOA 4MVJP 4KMSA 1NNUA 1Y8RA 5A05A 3ZDFA 1U3VA 5KJFA 2C2XA 4NBTA 2G5CA 1LDBA 5KIAA 2VWGA 1KC1A 1KYQA 1TEHA 3LZ6A 5DULA 3F1KA 4BIIA 1XKQA 3QW2A 2BKAA 4KTTE 3EW7A 4DREA 4P22A 1HDZA 3G49A 1A7KA 5ICSA 4YS2A 1HYEA 1EBUA 1XQ6A 1VKOA 2PA3A 3JQFA 2D4AA 2I3AA 1Q7GA 2ET6A 4DIBA 3WGIA 3JYNA 4J91A 4OJNA 1CERA 3F5QA 4P4NA 2Y99A 4Z9YA 3ZNPA 2O23A 1U3UA 5A04A 5BNIA 1ZEMA 4BGIA 4A26A 3LVFO 1B3RA 1GY8A 1EK5A 4RVGA 3I9OA 1I33A 1SB8A 1O95A 3GH3A 3WBBA 2P9GA 3RJ9A 3PP8A 4TRRA 3C85A 3BXXA 2FY8A 3N7UA 4MVJG 3K30A 1EUZA 1Q1NA 3WSWA 2BF7A 1GQ2A 3CPSA 3H6KA 4YRDA 2CF6A 4JLWA 4PZCA 3F46A 1LJ8A 3EZYA 2Y1EA 4H16A 4CM4A 1FMCA 2X5JO 1ZCJA 4WOJA 3I6IA 4IDCA 1GUFA 5I8ZA 1DIAA 4GX2A 5KVCA 1CIVA 3PJFA 1XA0A 4Z3DA 3VZPA 5HBRA 1RM0A 1K0UA 3ST7A 1EFLA 3ETGA 1KS9A 1LSJA 1P44A 1R12A 2RBEA 4IDAA 5K6AC 5KNLA 4B8WA 4J9VA 1SB9A 1U5AA 1ENZA 3KM0A 1O9BA 4E6PA 2GO1A 4NK4A 4PVDA 4KOAA 1K6JA 5L3ZA 2GCGA 3DQPA 1PJBA 4MP8A 1I30A 2C82A 4WLVA 8ADHA 3EUWA 5H82A 2W2KB 2WM3A 3PXXA 2BI8A 3PIIA 5TIIA 4UVIA 2W4QA 4DLBA 1EUCA 5ADHA 1UP4A 3MEQA 2VNSA 2JJYA 4J49A 2I9PA 5L95A 3ZWNA 3JQAB 4NBRA 4EDFA 3GEMA 3NT2A 4CMKA 2VZ9A 4DVJA 1A4IA 4RPHA 3TRIA 3I23A 2AQHA 3ZWWA 1H9BA 1QR6A 4IXWA 4Q3DA 4RZIA 4X54A 5EPOA 3FSRA 3UICA 2HUNA 1YQDA 4RLSA 1IHXA 1MP0A 4P4LA 4ZQFA 2FR0A 1C1XA 1HE5A 3SBOA 3EY4A 3JQ7A 5H83A 3BMNA 3ZWVA 2CVZA 4WCFC 3R1IA 1PGJA 1E5QA 1ZBQA 5TNXA 5A1TA 2JL1A 3MOIA 1DOHA 2GR9A 4JP3A 5CFZA 2EKLA 4G2NA 1X0XA 4ZGWA 5DN9A 3DBLA 4M87A 1DXYA 4YEDA 4WE3A 2DAPA 2R2GA 5G4LA 1YB1A 5I7FA 4L73A 1Q7CA 1MXFA 4FFRA 4LSWA 4LGVA 2H63A 4HX5A 4OXYA 5T64A 4UEOA 3V1TC 5DP1A 3ROQA 4DLAA 1R16A 4W4TA 4J0EA 3MJSA 4UAGA 3C1TA 4ITUA 4M55A 4I5GA 3GG9A 4RCVA 3GPIA 3GLQA 7ADHA 5T5QA 1PZFA 1C1DA 3HNPA 3S2FA 4XRRA 3ULKA 2DT5A 3AOEC 2VT2A 2P4QA 1KC3A 2OUIA 3MJCA 4YT8A 1I3LA 2DKNA 2EEZA 1PU2A 3BMOB 3IOYA 1H6BA 3GAZA 3PWKA 1DFHA 3SVTA 4DRYA 4JXKA 3C24A 1LSSA 3QV1A 4OKNA 1UXGA 1D1TA 4R51A 1X7DA 5F3RA 5L53A 4KWIA 3IIEA 2QRLA 2YV2A 3O03A 3FRJA 1IY8A 3AUSA 1T2AA 4D79A 4U0JA 4TKMA 5B1YA 5KJCA 1CRWG 3WTBA 3I9NA 5COQA 1ZSNA 3BMNB 1IHYA 4OOEA 4D3DA 3QP9A 4R9SA 4BNTA 1ZKMA 4TQGA 3I1JA 4H7PA 2PR2A 1O8CA 2PGDA 4BKOA 4EGFA 5T8KA 3ONEA 1HKUA 3SX2A 3NJ4A 1KEVA 1WWKA 2IXBA 2J3KA 2YY7A 2YHUA 1X0VA 1GZ6A 4JQCA 2X5KO 1VL8A 1MA0A 2X6TA 1BDBA 4R41A 4H15A 2JHFA 3LT1A 1Y5RA 3ZU5A 3H3FA 2P9EA 1X7HA 4JNKA 4YJFB 1PZHA 1V9LA 3QVOA 2C07A 1CWUA 4ALJA 4ZU3A 2NLOA 2W2KA 1DIHA 1ZSVA 1JWBB 1L1FA 4BNNA 4U6QA 3AI3A 2ZB4A 1T1RA 1BGVA 2WD8A 4BVAA 4UUNA 4HV4A 4XRGA 4ESOA 1C0PA 4NBUA 3ZWBA 3JQ7B 5EN4A 4AJ4A 5TLSA 4CQMD 3WXBA 4ZJUA 2X4GA 5JCJA 4BO8A 5GZ3A 1CF2O 3F4BA 3PWZA 4TVBA 1RJWA 2CFCA 1BW9A 1V3TA 3MTJA 4R1NA 3GGGA 2UDPA 3JD3A 4YJHA 5TT1A 2B4RO 3W4KA 1OI7A 1PGPA 3WGTA 4E2WA 1MC4A 4YVFA 5L9AA 4XYBA 3AM5A 5GY7A 5F1KA 2POQX 3RUIA 4A10A 1DAOA 3AU9A 4BB6A 5KJEA 3WGYA 1LRLA 4WUVA 1OC4A 4IZIA 4Y6SA 4JX8A 3DBLB 4IGFA 1E92A 4CLEA 5HS4A 1ZMTA 2R00A 3GC6A 3AJRA 5A3JA 4XB2A 3DZKA 3I52A 5I8WA 2DC1A 4CODB 3HDHA 5AXCA 3GFGA 2FR1A 3L0DA 3WOHA 1A71A 5ICMA 4OL9A 1U2GA 1G1AA 4DC0A 3VKUA 2FPIA 4I5FA 2NQTA 1MX3A 4A27A 4YB8A 1QMGA 4CQLB 3ASUA 1VPDA 5EMHA 1LDYA 3ENNA 1GPJA 3WGOA 4ZRNA 5IN5A 3WSVA 2VT3A 2ZCUA 3KOUA 2X23A 1E7WA 3PK0A 1OZAA 4FFLA 1JTVA 4EZBA 5IG2A 5LDHA 3UAGA 1QYVA 3GGOA 1NHWA 1B3BA 1DRUA 3DC2A 3PEFA 3QVXA 5AXDA 4BNYA 5IZCC 2DFDA 1B15A 4KQWA 2BMAA 4WOKA 2CDAA 3FBTA 1PS0A 4R69A 1EK6A 5DZSA 1NAHA 2JAPA 2HQ1A 3RFVA 4HFRA 2ZIZA 3KXDA 2XXBA 1YOVA 2NWQA 3DMYA 1FK8A 1KOLA 5L4NA 3OQBA 2Q3EA 1I3MA 1R6DA 2ZTVA 3VTFA 3W6ZA 2FZEA 2QHXA 2Q1SA 3KO8A 4QECA 2PZKA 3JD1A 3VH1A 1B7GO 1ULUA 4CMGA 1JAXA 2RAFA 3OECA 3NDIA 3TPCA 4FGSA 3KETA 2PH3A 1UP6A 1ENYA 4RZHA 1IPEA 4GLOA 5F1PA 5EL0A 4B7UA 2D8AA 4Q3BA 4R1TA 2PH5A 1U3WA 5IZCA 3PQDA 4HFMA 2E6UX 1PTJA 4J4HA 4NJOA 2A4KA 3R6DA 1P9LA 2DVMA 5JBIA 3E9MA 3KSDO 2VHXA 1NVTA 4PFJA 1H94A 2AEFA 4PRKA 3H7AA 4YAIA 4YT5A 3ON5A 2IDZA 2IYOA 2OOSA 5T67A 1P1KA 1CJCA 3QVTA 4IJUA 4R16A 1I01A 1KVRA 4ZQGA 2G76A 2BLLA 2EGGA 5F1OA 4YJFA 1P0FA 3PVZA 1GCOA 2OFPA 3JQ8B 3TZKA 1E6UA 3Q11A 4OGWA 3VZRA 1UAGA 4MO2A 3F4LA 4URFA 3JD4A 3TZ6A 4CMIB 4F46A 4XQEA 1M66A 2GF2A 4J1QA 4DLLA 2B35A 2P5YA 4S3MA 1P1FA 3DBVO 1PJQA 5L40A 3F5SA 3RKUA 3HG7A 4ZD6A 2HU2A 2WE7A 4LMRA 4Q3EA 3KYDA 4PLVA 1VJ0A 3VDRA 4EYEA 3V1YA 2DUWA 4INAA 3BYZA 1JKFA 2EV9A 4YAEA 4B3JA 3H9UA 3Q1LA 4GSLA 4L4SA 5IDXA 4BV8A 5C7OO 3G3EA 3HJAA 2V65A 1VI2A 3EC7A 3H65A 3RUFA 3VPHA 3WGHA 1W0CA 5IXYA 4NNJA 4TSKA 2C7GA 5A06A 3U4IA 2XF8A 2W90A 5C7LO 4XWYA 1U4OA 3QY9A 1QV6A 2AE1A 1H2BA 3LC7O 3H9GA 1D8AA 4HP8A 4BO0A 5KOIA 6ADHA 1U28A 3JV7A 3O8QB 2FN7A 5JMPA 3PZBA 2CSUA 4XZ3A 3ZWOA 4MKXA 3ANLA 4UEJA 4EITA 5A03A 3NJ8A 1SAYA 2HK7A 1ZK1A 3VPSA 4J3FA 2W98A 3DONA 3DZHA 3V1UA 5BQFA 3U49A 4O5OA 4L9RA 2PD3A 2ZYDA 3WWYA 3MWDB 3PFFA 2BKPA 2OZPA 3PDJA 4PLFA 2Y05A 4D46A 1HT0A 5A9RA 4NMHA 1Y6JA 1WP4A 3FCOA 4AJLA 4WASA 4UULA 5JLAA 1NQTA 2UVDA 4LVUA 5JCXA 4KQXA 4K6CA 3FTPA 1U7HA 4MVJH 1ZK0A 1X1EA 5ES3A 2VUUA 2P91A 4EJMA 2YQ4A 4PG5A 1YDWA 5EESA 5MDHA 1SEVA 1LC0A 4DWVA 2LDBA 1EQ2A 5KVSA 1YL5A 1Y8QA 2TMDA 3PTZA 1PL6A 5EINA 3PLNA 1T2DA 4MIOA 5IF3A 2YHIB 4O63O 1E0DA 4IGEA 3AU8A 1HRDA 2X7HA 4WKGA 2O50A 1DBVO 2G17A 3B1KA 4ZQHA 3DEYX 1E1NA 4BQPA 1FF9A 2A35A 3RBVA 4J7CA 2IE0A 5EERA 3AK4A 4MIYA 3TOXA 4M86A 1E1LA 5AOVA 5K9ZA 3I9JA 2BGKA 1U5CA 3E03A 2O3SA 1ADCA 4I5DA 2JFFA 3R3SA 1K3TA 5DT9A 5HS6A 4B4UA 4IDEA 1YS4A 4J7UA 4UVHA 3DAGA 1NWHA 5IJZA 1J5PA 5I7EA 4CLOA 2Y1GA 3GPDG 3RC9A 3SJ7A 3TWOA 3WYBA 4CMAA 3S1LA 1EE9A 4FDAA 3G1UA 2Y67A 5JAMA 1T1SA 4E2XA 5C5IA 1WMAA 2VTEA 2BHLA 2X5OA 3OA0A 4Z0PA 5JXWA 1VLLA 2PD6A 1H5QA 3D4NA 1LRJA 1Z7BA 3Q3CA 4L8VA 5G0VA 2EXXA 3RI3A 5A9SB 2HLPA 1IULA 3NRCA 1IZ9A 1WZEA 3HHPA 4M89A 3A28A 5HWSA 4RVUA 3V2GA 3AFNA 3HB5X 3ZHXA 3DTTA 2OP0A 4K9DA 5IDWA 4LSMA 1OBFO 5GMOA 5KCZA 1ADGA 1R4MA 1YJQA 4WECA 4A03A 3OICA 1M76A 3EAGA 1ONPA 2PD4A 1U8XX 3ROPA 3I5MA 4RF2A 3C1AA 2W2LA 3Q2KA 1TT7A 2H5LA 2PZJA 4Y9DA 3E6AA 3EK2A 1NP3A 2YV1A 3QVWA 3KYCA 2A94A 1HF3A 2NVUA 3UN1A 4CM5A 5A5FA 1J4AA 5L7TA 2VYVD 5LC1A 3HB4X 1EEHA 3ONDA 4PVCA 3Q9NA 2OBYA 3RUCA 1LQUA 1UAYA 4ND2A 3GZ4A 4PG8A 3WMXA 4E12A 3OM9A 2WTBA 4ZHSA 4MVJE 4TKLA 4XD2A 1M6HA 1WDKA 1E3LA 3QVSA 4MOWA 1BWSA 3WX0A 1DPGA 1H6CA 2RCYA 3D1LA 3HZZA 1GL3A 5B4UA 7MDHA 3HN2A 2PZMA 1I2BA 2I66A 4XCVA 1Q7BA 4XDYA 4PN3A 1XCBA 2YQ5A 3KZVA 1NVMB 2CNBA 1MC5A 1D4FA 1SOWA 3ZW8A 3UCFA 1AUPA 5F5LA 3ROKA 4E4YA 5JW6A 1KIFA 2V6MA 4XGKA 1LX6A 1P77A 1DC5A 1I0ZA 2B83A 3OQ1A 2WYVA 4WCFA 5B4TA 4BNMA 3D3WA 2FRDA 4PCVA 4TVOA 4CM7A 3CE6A 2VRBA 3KHUA 4U5QA 1YQGA 4KWHA 1ISGA 4BKPA 1IB6A 4OH1A 4NK5A 4PRLA 1CYDA 1YOVB 3L6EA 1I10A 1YB4A 4NU6A 5TRTA 3ANNA 3JCZA 3I4CA 3AI2A 2GERA 2D5AA 4RJTA 3OJEA 4EI2A 3QA9A 1FJHA 4FC6A 4IBOA 4WK6A 3GK3A 4NJMB 3W4IA 4B3IA 1TLTA 4IS3A 2ILTA 5JAZA 3DZGA 4CV2A 1HYGA 2OO5A 2JFHA 3K73O 2C5AA 3GZNB 2DTDA 4G65A 2DBQA 3DZBA 3BHIA 2E37A 4NDNE 2Q45A 2VQ3A 2LDXA 4CR8A 2B4QA 4XR9A 2UYYA 2Y1CA 3JQDA 1GEEA 4IMRA 2I76A 4Q3NA 4YJHB 1MB4A 2FZWA 4RO0A 4RQUA 4W99A 4R1SA 3IUPA 1Q0LA 5DDIP 3O38A 2EG9A 4FS3A 3Q9UA 2OORA 3K6JA 4NI5A 1H6DA 5IAAA 1QKIA 3ICCA 2C2YA 5CEEA 1LQTA 3GMSA 4B79A 5CDSA 1Y5MA 2X0IA 4RORA 3WJAA 3G17A 4RLHA 3K2EA 5IN4A 1GQYA 1YBMA 1MLDA 4HNHA 1GQQA 2X0JA 3IJPA 4GSKA 1ZIDA 3JXOA 1HWYA 3O4RA 4E5PA 3UHAA 5CAEA 3ZZNA 3CINA 1A9ZA 4LCJA 1PJ4A 4M49A 4UVGA 1O0SA 2WD7B 1HZZA 1B0AA 2QYTA 4W9NA 2HJSA 3IQDB 4RPJA 1C3VA 2BKOA 1XR3A 1YKFA 4BKRA 5DP2A 1U9JA 2GASA 5JAQA 3U62A 1YWGO 4J1SA 3INRA 1M6WA 2XXJA 2WDZA 2VOJA 1PZGA 4W6ZA 5CG2A 1AGNA 4CLRA 4E31A 5FF9A 3M1LA 3ZU3A 3QWAA 4E3ZA 3C7DB 4B4OA 1Z45A 2ZYGA 4PLTA 1KY4A 2AEMA 1LDNA 3N74A 3P19A 4IDDA 3WDSA 3WQSB 2A9FA 2I5PO 3C1OA 3PHJA 4B8ZA 5KKCA 3SC4A 4RF4A 2DPHA 5U1PA 3ZHBA 4XYGA 4F3YA 4ND1A 4MINA 4D44A 1Z82A 3GNSA 2BFPA 4GMGA 3G79A 4XKJA 1FDWA 5F5NA 5BT9A 5A02A 1PGOA 4GI2A 4IUYA 3DXFA 4NJMA 3ZV4A 2YUTA 1NAIA 5TX7A 4ZN6A 2C59A 1QYDA 5C7IO 1P1IA 3IJRA 5ER6A 3NTRA 3KLMX 4JJGA 4LW8A 3ZWAA 1DB3A 4K1LA 3OA2A 5I7SA 3I83A 5BSEA 1FDSA 4IJWA 1BW9B 3GRPA 4YPOA 2ZKLA 4BNLA 3D5QA 4Y67A 3WQQA 2GYYA 3MJ4A 4N5NA 4E2ZA 1CETA 2NVUB 1IUKA 1O5IA 4E5MA 4PLPA 4IXTA 3EGOA 3FF4A 1ZZEA 4J1NA 5COBA 5GZ6A 2EJVA 4CPDA 2JCYA 1H93A 1SPXA 5DBIA 2WE8A 1SBYA 3Q0EA 3MZ0A 4DTIA 1EFKA 1AN9A 3ZU4A 4DXHA 1SOVA 4W7HA 1Y9AA 3KRTA 1ONNA 1ZFNA 3ZV3A 1GYPA 5CG1A 3ZI0A 1PZEA 2W8ZA 4YAKA 3NTQA 1EDZA 4NH4A 3VKVA 5L4LA 4L4XA 3IS3A 2PFGA 1B8UA 2QZZA 4L75A 4ND4A 5CDGA 3GVXA 1HLDA 5AXBA 1YONA 5JE8A 3S55A 3NGXA 5U4QA 3IP3A 3JQBC 4R54A 3I9KA 2WWRA 5HA5A 2DFVA 2FSVA 1MXHA 2NSDA 4BO7A 3GA0A 5LDGA 1I2ZA 2ZCVA 4Q39A 2ZATA 2NVWA 1KETA 3A06A 1T2FA 4NBWA 4E2YA 2AHRA 1R0SA 1O6ZA 1XYGA 4PGFA 2Y0EA 3S8MA 4AJ2A 4BUCA 4YCAA 1SMKA 3GFBA 4FR5A 4J7XA 3ETEA 2UUOA 3JQBA 3CH6A 4ALNA 2X1HA 2BGLA 1NR7A 1C14A 1F17A 3ADPA 3W4JA 1YO6A 3H2ZA 1DDOA 1N9GA 1HE4A 1I24A 2NVBA 3JQGA 3P5SA 4LK3A 1B8PA 1GR0A 1NFFA 3GUYA 4N5LA 4JGBA 3WGQA 1Z75A 1Z73A 3ZH2A 1ZNQO 1C0LA 2ZQZA 1CDOA 3W8DA 4B3HA 2EW8A 2J5KA 4PIVA 4AJEA 2J3IA 5EIOA 3P2YA 3RCBA 3BAZA 1HDXA 1Z74A 3FPLA 1LDEA 4E32A 4R9RA 2EHDA 1JW9B 2DUUA 2OXIA 4ILKA 1B8VA 3ZN2A 4FJ2A 4WLNA 1LDMA 5TS3A 3IP1A 1Q0HA 3WLEA 1P33A 1E7YA 1Z6ZA 4ZA2A 3UH1A 3M2PA 3RC2A 2F00A 4NZ9A 1J6UA 2BD0A 3LF2A 4IJVA 2XPCA 4N54A 2GN4A 2XAAA 3F1LA 3WBFA 2P4HX 5J23A 1HDRA 2HCTA 3FPCA 1JAYA 4CM3A 2VN8A 4FSHA 1QYWA 3BHMA 2IRWA 3BMCA 2GD1O 4QFDA 2I99A 1BVUA 3JQEA 1K2WA 3GAFA 3CTMA 1J0XO 1GEGA 1WXDA 3TQHA 2NU8A 2OMEA 5T6BA 1KEUA 4O0LA 1Y8QB 5BNFA 3IL2A 4HWKA 3ZNQA 4NG5A 2VZ8A 3H2SA 2QRJA 1X1TA 4XJSA 5T57A 4E5YA 3TL3A 2O2SA 4YDRA 2QX7A 2YFHA 3KYCB 3MJEA 4XJTA 3L4BA 3BHJA 1C1DB 4CMEC 1WVGA 1X14A 3D4OA 4Y6PA 3HADA 3A4VA 3KB6A 1YBVA 1PIWA 4GQAA 1BHSA 2Q99A 4CLXA 1ISIA 3GOHA 3GF4A 4FBGA 3BA1A 5JFOA 4MKZA 3NEPX 4AG3A 3A9WA 1TT5B 1PL7A 3E9NA 5T8KC 2J3HA 1UR5A 2JD0A 1K6XA 3IKVA 3OJLA 1YJ8A 1PSDA 3KEOA 3OMLA 1AXEA 3M1AA 3UCXA 2IEBA 1LEHA 2HMSA 2O7QA 4CQMB 1NX6A 4EW6A 1U3TA 3EYWA 3DDNA 2X9GA 3QHAA 4MJLA 4OHUA 5TJHA 4FW8A 3C8MA 2TMGA 1U4SA 2AXQA 1UZNA 4J9UE 2IODA 3GZNA 4DMMA 3PJGA 1XELA 5FI5A 5TC4A 1OOEA 3CEAA 4DPMA 4BGUA 3A1NA 2B5WA 2NTNA 2PNFA 3AOEA 3FWNA 2EGHA 1GUZA 4ZICA 1NQAO 4FJ1A 1VSUA 1R15A 1ZSYA 4OM8A 1IOLA 3GG2A 2VOEA 3I9MA 3O26A 4O59O 4FFOA 4E5KA 4I9HA 1F8FA 1XDWA 3AW9A 3DBRA 3GVPA 4WEOA 1T26A 1Y9EA 1UZMA 3FNGA 5JAIA 2WYUA 4DL9A 2R00C 1GPDG 3CZRA 4EEXA 2AEJA 2NV6A 2DM6A 3JSAA 5A3VA 5CHEA 4CUJA 4WPGA 3TNLA 5ITWA 4CLDA 4QQRA 3VH2A 5JDCC 3VHRA 1ULSA 3FD8A 4KDFA 2HAEA 4CR6A 3AFMA 3S2GA 3PFWO 1RM4A 4BMSA 1PWZA 4YYZA 4DBZA 3QWFA 2PLAA 5G0WA 3IMFA 3JQ8A 1PQUA 3WLFA 1G0NA 3TFQA 1PJ3A 1VE9A 2XOXA 4AJ1A 5EQDA 1YE3A 4HBGA 4IMPA 4RVSA 1F8GA 4I9NA 1CQJA 2BFAA 1O89A 3AUUA 4GMFA 4CJXA 3ZCXA 3C7CB 3K9QO 2ZYAA 4MPDA 3GN1A 5DOVA 3KSUA 2O7SA 4E5NA 3H9QA 4FQ8A 4J43A 3B1JA 4FOOA 3RJ5A 1DC4A 3DFZA 1GV1A 4ALIA 1W4ZA 3TSCA 1W6UA 2ZK7A 4U7WA 4BO6A 2PZLA 1DC3A 2NM0A 2Y0DA 2CMDA 4J90A 1PWXA 3DAPA 5G4KA 3ETDA 4CLHA 3DZJA 4CQLA 3WICA 3TN7A 4CM9D 1I5RA 3ENKA 3MOGA 1XQ1A 4JBGA 3ASVA 4XYEA 2IZ0A 2QG4A 4AICA 3RU7A 3LSYA 1NPDA 3O9ZA 3D0OA 3OP4A 4UUPA 4JN6B 4DGSA 2VRCD 5IDYA 3U9LA 2J3JA 5HRUA 2Q4BA 5FYDA 4BNHA 1DIGA 5JO0A 2EKQA 2GN9A 2Q50A 4F45A 4BB5A 5A5EA 4K26A 3GQVA 5JO9A 2AW5A 1R0LA 2D0IA 2J6IA 3H8VA 3CXRA 3ZU2A 2ZB8A 4DYVA 1NPTO 4BNUA 3N58A 2C54A 3ZV6A 2YW9A 2FSSA 4FC7A 4GWGA 1PS8A 1ZMOA 3U3XA 5I9MA 1AXGA 3OEYA 3OETA 3DFUA 4YBZA 1E3SA 3R3JA 4E30A 3VPXA 2ZTMA 3V2HA 1ENPA 2WSBA 3RFTA 1DSSG 5KTKA 5G0TA 4CM6A 4CMJA 4FFPA 2BFOA 3FNFA 5HTOA 2V6GA 4OO3A 2I6TA 1DIRA 4IS2A 2GN6A 4AVYA 1ZJYA 4BKUA 1UXIA 3MTGA 5IXSA 2JFGA 2RIRA 4XGNA 1XLTA 1MG0A 4AJIA 1VKNA 1R4NB 4P4GA 4UEKA 3U4DA 5CP8A 3LT2A 1RM3A 3WJ7A 1KEWA 2HRBA 4HADA 1KVQA 4OQZA 4C7KA 1D7OA 4QX6A 2E48A 2VWHA 1I8TA 4MVJF 2IZ1A 3GHYA 4MVJD 1I36A 2QZ9A 4XQGA 5KWEA 2AG8A 2BI7A 3S2IA 4WEQA 2JCVA 3WWZA 2FPPA 3E8XA 1V3UA 5EQFA 5AYVA 4JJIA 4AJNA 1KVTA 1A7AA 1Y7TA 2BFMA 2GDZA 4GGPA 4HXYA 3BMQA 3D64A 4YQZA 8LDHA 2DBVO 3LC2O 2V6BA 2Y68A 1B16A 3CZMA 3QWHA 1RWBA 3JQ6A 3A14A 4P8RA 5AQ1A 3RBXA 1DIBA 3OIDA 2I65A 3DMTC 1ZXBA 1LLCA 3RUHA 2Q2QA 3AY3A 1A5ZA 4HUJA 4CL3A 1TI7A 1WPQA 5K6AA 3LK7A 2FOIA 3JQAA 4RVFA 4XA8A 2G82A 3ORFA 4G5HA 4AJKA 1HE2A 3RBZA 1OFGA 2AQIA 3TJRA 2WEKA 1P0CA 3QRWA 3H9EO 2IEDA 3PIDA 3GMDA 2NUAA 4IM7A 3JQ9C 3IAHA 4N7RA 4CL8A 3PQFA 4IQGA 4XX0A 2EERA 4R4JA 1EE2A 5ENDA 1TA4A 3RU9A 1PL8A 3SJUA 3CIFA 1EVYA 1JN0A 4UREA 1R37A 1B14A 1GYRA 1BDMA 2J8ZA 2CY0A 4RV9A 2GN8A 3ZHZA 1GADO 1WDMA 4N5MA 4I1IA 1ZW1A 3W1VA 5TSDA 3IDSA 5KVVA 3PLRA 3GRKA 3PWSA 2NU7A 3ZGYA 3R0IA 3DZFA 4DMLA 1ISHA 2VCYA 3PHHA 3ADOA 3DHEA 3KV3O 1X7GA 2OBNA 4M1QA 1D1SA 1AHIA 3W8EA 4TRMA 1JWAB 4WLUA 4FCCA 3WTCA 3U4CA 1A27A 3I9LA 2X9NA 2NQ8A 4U6SA 1ZO8A 3LT4A 1LRKA 2GZ1A 1DJNA 1P74A 2FP4A 4QO7A 1VCTA 2VHVA 3PPIA 1PGNA 1LLQA 2BH9A 1A72A 1J49A 1PJLA 3BZUA 1E3IA 3GGPA 3KVOA 2VHYA 2Z95A 4MVJM 4WJZA 4OMUA 1LLDA 4BO9A 3FR8A 4A7PA 4KP7A 5EJ2A 1LI4A 4MIEA 1Z7EA 3LQFA 4DQUA 1PEDA 4JBHA 2O3QA 4I8XA 4IIUA 4ND3A 4W82A 3LYLA 5A9SA 1WNTA 1QV7A 1U7TA 3BTOA 5JC1A 4WLOA 1RYDA 4KUGA 2VTDA 3VZSA 3D5TA 4BO2A 1BXKA 1T4DA 3L9XA 1WDLA 2ZJ1A 4KTVE 3H5RA 3X2FA 3D3WB 3JYOA 1NQOA 1P1JA 2E4AA 3AY6A 4HKTA 1MG5A 1W73A 4B7CA 3NV9A 3BTSA 3L77A 4GKVA 4CMEA 4WNIA 1PJCA 4AFNA 4KUEA 2EJWA 3SLGA 1XU7A 3AUTA 5C37A 4Z6KA 4YJGB 4FIZA 2NU9A 3MWEB 3PYLA 3ROMA 5KVQA 4D0RA 1Q2XA 3UFXA 1D3AA 2Q1WA 1EQUA 5JDIC 4L74A 3GY0A 5COAA 3GEDA 5DCWA 3D3EA 4XYLA 1FDTA 1PQPA 4ZRMA 1I2CA 1ZK2A 3KSZO 2B5VA 3W6UA 1PJ2A 3WR5A 4D45A 2DQ4A 1A4UA 3CSDA 3LC1O 5JYEA 3OH8A 4OXNA 4QFCA 5TGDA 1YRLA 3EHEA 4JJFA 1YGYA 1DLIA 1LDGA 2Y93A 3DBHA 3BTUA 1YL7A 4WGGA 2AQ8A 3PJDA 1UXJA 3LDHA 4BNZA 1HXHA 3DBRB 4TRJA 3OHSX 5AXAA 1DLJA 1UH5A 5FI3A 1XG5A 4FFNA 2Q49A 2D3TA 1LSUA 1N1GA 2NTJA 2O48X 2Q2VA 3LU1A 2PKQO 4D43A 2V7PA 3FNHA 2RHRA 2W2LD 1EVJA 4RDIA 3M2TA 1OC2A 2CZCA 1BXZA 4J1TA 4R5MA 2O3TA 1N8KA 3OBBA 4RDHA 5B12A 3GHHA 1QP8A 2EP5A 2HK9A 2PY6A 3DOJA 4OOFA 3DAFA 3Q2IA 3L6DA 1MGOA 2X22A 1PGQA 3GEGA 1X15A 1MV8A 1UZLA 3VH3A 1WZIA 2HJRA 2C20A 1P3DA 2GZ3A 2UUPA 3DHYA 1ORRA 1DRWA 3GVIA 1LLUA 3C7AA 3K2BA 2PGLA 3ZWPA 2VNAA 3D4PA 3PHIA 3T4XA 4YT4A 2VUSA 3NT5A 5FFFA 3H9JA 3HFSA 3FNEA 3RROA 1ARZA 1ZUD1 2E49A 3HN7A 2PKQP 1IL0A 3JYQA 4AJJA 1PJSA 4MKRA 3STHA 2VWQA 3ZV5A 3ZWCA 3QIVA 4NBVA 4PLYA 3QSGA 2EF1A 1E7MA 1OAAA 4EUFA 1E6WA 2UV8A 1HSZA 3T4EA 1Y8RB 4Q3CA 4K6FA 4YA6A 1JKJA 3WNVA 1UUFA 4RQTA 3B70A 1ML3A 1MFPA 4U0KA 4BV9A 4CMBA 4YXFA 4UUMA 2IYPA 1HDYA 4BHTA 2EIHA 2Y1FA 5IFLA 4GWKA 3OJOA 1P45A 2HMWA 3TDKA 4YT2A 4BKQA 1HE3A 1CQIA 4CMIA 1AHHA 1T24A 2AE2A 1G6KA 2O2YA 3K31A 3MJTA 4DBVO 1NPYA 4GVXA 1E3EA 1GDHA 3AWDA 1VJ1A 5ENVA 4CM8B 4YRBA 3RVDA 2OP1A 4K28A 4BS9A 1GD1O 4DIFA 3DHNA 1LXCA 3UUWA 1KVUA 5G0UA 3NUGA 3ZHYA 4A73A 2NTVA 1DHRA 4D3FA 3UXYA 5CEFA 5I7VA 1SNYA 3OIGA 1ENOA 2YV3A 1LNQA 1IYZA 1GU7A 4GX1A 2EKPA 1GYQA 4I5EA 4MP3A 4D7AA 1QLJA 3COSA 1SO8A 2I3GA 2OGUA 2ZTUA 1T2CA 1BXGA 2G0TA 3G1TA 4QXMA 2CD9A 4D41A 2HK8A 2DTEA 4ND5A 4YJGA 2QRKA 5LCXA 3DR3A 1YH3A 3CMMA 2FMUA 3NDJA 4GL4A 2ZQYA 4RPLA 1NBOA 1ONOA 3PYXA 4GBJA 4Z3KA 1RYEA 4QO8A 3HQ4O 4BGVA 4DIOA 4YQYA 4A0SA 3OQ6A 3F9IA 3T7EA 4F6LA 1Q0QA 1LTHR 1P1RA 5ER9A 2YYYA 2Z5LA 1JU9A 1T25A 2GZ2A 2NNLD 1QORA 3E18A 4U8GA 2C0CA 1E7RA 4ZVVA 1GZ4A 2VRCA 3WQRA 5U9CA 3ZWXA 3H4VA 2OHXA 1TXGA 2Q1TA 4EUHA 2O4UX 2B0JA 4LVCA 4C4OA 3EVTA 1ISJA 1V6AA 2PV7A 1F12A 1KVSA 2D59A 1ZEJA 4XIJA 3PGJA 4W9NC 2YJZA 5G2OA 4O1MA 1VC2A 2QIOA 1QSGA 3X2EA 2NADA 1F14A 4CUKA 1E5LA 1GFSA 2BELA 3GT0A 4DYDA 3ICPA 5FWNA 2JCXA 3L07A 2H9IA 2SCUA 3JTMA 2Z1NA 1YQXA 4EJ6A 4E13A 4CQMA 1BVRA 4XYMA 4IDGA 4C7JA 2ZB7A 3DOOA 4NQZA 4JP2A 3UF0A 3WIDA 2I67A 5JC8A 1C1XB 1UDBA 1E77A 1EVZA 1UP7A 1YDEA 4KZPA 1H6AA 1GAEO 2RH8A 3B1FA 1UXHA 2YDYA 4GPD1 5GZ1A 1NFQA 2CVOA 3U4HA 2O3UA 3K8ZA 3WG9A 3JQ9A 5DBFA 3IUSA 5F21A 2JKVA 3L6OO 3NGLA 1GTMA 1XU9A 3GR6A 4J6FA 1ISMA 3HSKA 5JY6A 1NYTA 3RIHA 3JYPA 3RFXA 3ITKA 4Q3AA 1WW8A 1WMBA 1ZVMA 4XGIA 2GLXA 3DOCA 4PLHA 3WYCA 1VL0A 3BMQB 3F6YA 4LRTB 3RASA 2PWZA 4R01A 4CR7A 4YRAA 3RSHA 1PX0A 5I9LA 3PDUA 3INTA 5BNTA 3IKTA 4XDZA 2P68A 2JD2A 3LLSA 4D42A 4JK3A 2CUKA 3FR7A 3AI1A 4WCFB 2YHIA 1ZXLA 1QG6A 3HWRA 3OFSA 1HDCA 5BSGA 2WYWA 4GVLA 4WLEA 3U5TA 4AJPA 1U1IA 4CM1A 4IJKA 1BXGB 4NFHA 4QUKA 5DF1A 3DO5A 5KJ1A 2DBZA 3GVHA 4YJDA 1F0YA 1NVGA 2AA3A 1ID1A 4LCEA 3GNTA 1N92A 1LSOA 4PG7A 3EDMA 4PLZA 4BGEA 3F47A 4BNIA 4RPKA 3AUAA 2HKIA 2VYNA 3NYWA 4FGWA 4DA9A 5L51A 1WAMA 1S6YA 2BKNA 5TT0A 1Y1PA 1XIVA 2VZ0A 3WB9A 2QQ5A 4D0SA 3EZLA 3LLVA 4FOSA 1KBZA 1DFGA 1I32A 1X13A 4RVHA 1N7HA 5CDYA 1EDOA 3FN4A 3VVBA 5K0ZA 1DO8A 1IPFA 4LISA 3I6QA 1BG6A 2DU8A 2Q46A 1LUAA 4IDBA 4GH5A 2JD1A 3HFGA 9LDBA 1FDVA 2PKRA 5G4KB 3GN2A 3NT4A 4L0QA 3HDJA 4BO4A 2WD7A 4LRSB 1F06A 2AMFA 1VRWA 2PGJA 2D5CA 2F1KA 4H3VA 3OSUA 4XTTA 4NFSA 2FHSA 1NR1A 3JQCA 3OIFA 3E1KA 3JQFC 5AVOA 3NX4A 3U0BA 4B4VA 3ZWMA 3E48A 3JYLA 1R4MB 1ZK4A 2WJPA 1L7DA 2GSDA 4UUOA 4CUZA 1V0JA 2D2IA 4WCDA 5KKAA 3V8BA 2J5QA 2BGMA 1YVEI 3C3XA 3VC7A 3NAQA 4I9UA 1DRVA 4RGBA 1V3VA 2NACA 2UAGA 3OJFA 3TFOA 4O6VA 1S7CA 3SLKA 3S2EA 4KUHA 2ZTLA 4EEZA 1U2DA 2R6JA 3H5NA 1V35A 1RPNA 4DPLA 3PYMA 4RVDA 1QYXA 1GCUA 2QYSA 4YWJA 4UVEA 3AOGA 4IDFA 4CM4B 3BMCB 4LN1A 2CDBA 2RHCA 4J16A 4RPGA 4AJOA 4Y8VA 3P7MA 2X86A 3O8QA 3JD2A 4GAEA 1PR9A 1R0KA 1VSVA 1XGKA 2CVQA 5L7WA 2GNAA 3VPGA 1HLPA 2HDHA 1TB4A 1EUDA 3UKOA 3VPFA 1B26A 3AM4A 5TJ9A 4NU5A 4YAJA 2G1UA 3KTDA 5JSFA 3CMCO 4J2HA 3UCEA 3IC5A 3PZRA 3K92A 3M6IA 3RWBA 5HM8A 1MUUA 1UJMA 4BNFA 2VHZA 1H9AA 3DZIA 3HUDA 2Z1MA 5JMWA 1T2EA 1KEPA 1QYCA 4J2OA 4KDEA 1N5DA 5B37A 1YL6A 2C7VA 4FN4A 4FD3A 1LU9A 2HMVA 3P2OA 4QT0A 3BMOA 4ONEA 5L4SA 4N18A 4Y6RA 4OKIA 4BOYA 1VL6A 4IQ0A 4BNJA 3SXPA 5FEUA 1XSEA 1JVSA 4R5HA 4E33A 3PHLA 4BO5A 3PRJA 4LMPA 4OXKA 3QE3A 5BSFA 1UDAA 1GZ3A 3RAJA 4S1VA 1L7EA 3RUDA 2O4CA 4J4TA 3L4SO 3DL2A 3RC1A 4PLCA 1W8DA 5BSHA 1OMOA 5G0SA 2CF5A 4B7XA 1BTOA 5BR7A 1TT5A 2VUTA 5CEJA 3RUAA 5C3MA 1DJQA 2O3JA 4CV0A 3HE3A 5DCUA 6LDHA 2VHWA 2RH4A 1EZ4A 1K6IA 4DQVA 5CPFA 1SZJG 2IZZA 4CLRB 3WGGA 4FFMA 4Z0HO 4WLFA 2V6FA 3RC7A 2DLDA 1G0OA 5CPBA 2B4TO 4YTEA 2Q1UA 3EVNA 5ILOA 4FJ0A 1QLHA 4NHEA 4QTZA 5THQA 4II3A 2P5UA 4CMCA 1XEAA 4NFYA 1N7GA 3UVEA 3TOZA 2P9CA 2X8LA 3ONFA 4CV1A 1N1EA 2B69A 3GNQA 4ROSA 4A2CA 4JBIA 4ALKA 1NXQA 4CV3A 4PG6A 1FDUA 3V2UA 4P38A 4BNGA 1BMDA 3GVCA 3RQSA 3UOGA 2O3RA 2HO5A 2HRZA 3ANMA 3FWZA 1E3WA 4FPXA 1HZJA 4QSMA 3TF5A 2C5EA 3D7LA 3VAZA 1R66A 2J5RA 3W8FA 3E5MA 3V5NA 5JDCA 3FHLA 4IQ8A 4IZHA 3I3OA 4M54A 4IPTA 5ILGA 4IINA 3VOSA 4HFNA 3L4BC 3NTOA 1C0IA 3PQEA 4GLLA 4QEDA 1ZJZA 5JNLA 3QQPA 2YDXA 2OL4A 1O94A 1EBFA 3PI7A
chains in the Genus database with same CATH superfamily
2MJUA 9LDTA 1AKUA 2DGDA 1U98A 1IZ0A 1PR2A 4AKSA 1BDIA 2HQCA 2N7YA 3EQ6A 1WC1A 1RQXA 3VZQA 2DWCA 3QU9A 5HE9A 2HN9A 1EMDA 1C4CA 1RKXA 2AIRA 1RT2A 5GJBA 3HLKA 4AG6A 2R8XA 4HY3A 3G86A 4L02A 1E2FA 1X60A 3O2IA 4H4MA 4BE4A 3SIXA 3LPAA 2WA1A 5D0HA 1QY7A 5JS6A 4CMHA 1S9EA 3RU2A 5BSVA 1ICIA 1GQOA 1GV0A 5EA2A 1I3OB 3FDJA 1FP2A 1RRFA 3SE7A 1P2TA 4P2FA 5F2NA 2JRLA 4QIWD 4C0XA 2VSOA 2LKDA 4ZCPA 1FX2A 4J3JA 3FDZA 5AM3A 3R97A 2RGCA 3CCCA 5TF4A 3DTVB 5JYDA 1P9RA 9GPBA 2IEIA 3QHPA 1F7UA 3G8TA 4JJ7A 3VU3A 3QJ5A 2VCHA 1THZA 2HMTA 3RC8A 4EI7A 3H5YA 2JLWA 2AFIA 4K4TA 4QR0A 1QHIA 4EO7A 1N2SA 1E7QA 3VDNB 4BTEA 4RKEA 4NAHA 1NX9A 4M8NE 2DD8S 2QYGA 1Q86T 2PFSA 3LPLA 1AA9A 1TQHA 3LCRA 4P7GA 3ESCA 4MAMA 3EDQB 2GUGA 1VG8A 2HC9A 5DLPA 2W9AA 3RYLA 2ZVDA 2IP2A 5IFKA 2ZOFA 2POCA 2QEXS 3MD9A 4FSXA 3CCVS 3K5HA 3KL4A 1U8FO 4U9HS 4D9GA 2J0QD 1HQUA 3QU4A 3EMKA 1WR8A 3VH4A 2CJKA 4ZKEA 3FPBA 4PO8A 2JLXA 4MCIA 4EBFA 4FB5A 1Y1LA 4NV3A 2GCEA 4ZVSB 3DI6B 1U2DC 1VJTA 4W7SA 5K0GA 2KXFA 1QRRA 4MVJP 4TTAA 3B3GA 3HDGA 2QENA 5A05A 2C2XA 3B8EA 4GR5A 4FGKA 1RC1A 4JUBA 3U6BA 3JQFA 5LYYA 1IN1A 3LWBA 5JFGA 2VDIA 3B7WA 3KQWA 1B93A 2O23A 3UAVA 1ZEMA 4N12A 3AEKB 3PFEA 3RT9A 5JEEA 2JJ1D 1CUYA 1J9ZA 3GH3A 2RK6A 4FQ5A 2XOEA 1CQJB 3D6HA 2NSCA 4X6XA 2E1RA 2QN2A 2CFRA 2GPAA 5IJ9A 1WEXA 1QRSA 5CXUA 4CM4A 2QL7A 4Z7JA 2QLLA 5FB3A 4O4GA 4Z3DA 1UKAA 3ACCA 4M5KA 1EFLA 1SWWA 2YJ5A 1W36B 2L42A 1TC1A 4HQNA 3I6YA 3KM0A 5JECA 4J0CA 5L3ZA 4PVDA 3B13B 3IAS9 4JJAA 3A37A 5SYMA 3BFVA 4OJYA 1VCNA 3SC3A 1SC4B 3ZWNA 3OLZA 4U39A 1RT1A 3VR4A 1FDNA 1WUHS 3WY9A 1YQDA 2C58A 1CZKA 3FUXA 4ZQFA 2FR0A 4IKAA 4U7HA 3PC8C 4WCFC 3P0EA 5DSTA 3R7BA 1SULA 1G8AA 3DBLA 3RJZA 4P10A 5A4JA 2I7DA 1Q14A 2C4HA 1F60B 2ERYA 2AL7A 1X4DA 1N32F 4DLAA 4UEOA 3IS9B 4K9MA 4ITUA 1C29B 3GG9A 3CDUA 1ULRA 3U1TA 4USVA 1MBZA 5KYVA 1FQWA 3TAHA 4N6OA 2QLNA 4K05A 1ZGHA 1D1TA 4MUJA 3GEPA 5D4NA 3T9AA 1IY8A 4D79A 3SIPA 4TKMA 3TNYA 1CRWG 3WTBA 3MF5A 3EGXB 5IJ0B 2GRUA 3M5DA 1S8AA 4OJKA 1ZKMA 2PR2A 4ZN1A 1RNLA 1VA5A 4X1KA 3SJCA 4DCJB 2GEVA 1GZUA 3TD6A 4ED8A 2OCXA 1EWVA 2WSLA 2P9EA 1UODA 4YJFB 4M9ZA 3R9WA 1L1FA 1BGVA 3ENWA 2HNYA 4AJ4A 5EMNA 1XMOJ 1BC6A 2UXCF 4BO8A 4DV6B 3N6RA 1IBLB 1GNLA 3DHXA 1HR0F 4RK7A 4DA4A 1QF9A 1I1HA 1U3GA 1AF7A 3AVXA 4LRAA 1KEEA 1DAOA 1JHDA 4BB6A 4FLEA 2KYZA 4G8JA 1D09B 3UNYA 3T3IA 3WOHA 4DUYB 5CNJA 2ZAMA 3JR7A 5D5PA 1SHKA 5AVQA 3LDGA 1U2GA 4WXMA 2OC9A 1I4WA 2IT1A 1QUEA 2Z0GA 2FPIA 3HZGA 2B1GA 3ZCUA 4G5GA 4F5ZA 3E22A 2ZRBA 3G8QA 2IH2A 1J27A 3DGPB 2NN3C 3L82B 1W26A 1USGA 3OKFA 3GB0A 1R27B 1L3CA 1OYVA 2R8PA 1NNLA 2GAAA 4KQWA 1HL7A 1Z8HA 5F4ZA 4ES2A 4IRKA 2FOXA 1TC2A 2FCRA 4PSKA 3BQ1A 4W5RA 3ZY4A 2R4TA 1LFWA 1QGDA 2YN4A 1KF0A 4X94A 2GZDA 5EZSA 4Y2VA 3ZC4A 1L8OA 5LKRA 1IC6A 4PWDA 3IUYA 2XF2A 2MZSA 1ENYA 5CA1A 3OQMA 4K8OA 3NGTA 2I2XB 2F40A 4DX8H 3CRW1 5DXAA 4H1HA 3ULHA 4LFAF 1ESEA 3WNCA 1DKNA 4OY3A 2E7ZA 3E9MA 4CL2A 4BLUA 2M3DA 3ON5A 2PSFA 1UBUS 1X4GA 4IFTA 2HEIA 2VQSA 3JSXA 4L51A 3FGNA 3R27A 2HHXA 3DD1A 4HAZA 1QAJA 3WRYC 5KFUA 1W75A 3SYNA 3POTB 1D2RA 3U31A 3ZY6A 2ZREA 2C7PA 3FMBA 4B3JA 1JB1A 3FXAA 4AS2A 5KFLA 3IBFB 1V5IB 1WJ9A 2FDXA 1HWKA 4EVIA 4ZK6A 5A76A 3LGAA 1LS6A 3M6FA 4A8KA 3X1DA 4ZP9A 3IERA 3V6KA 3OEEA 4WBNA 2RHWA 4L9RA 4O2RA 4DL3A 2PD3A 1JRLA 2NPIA 3SXUA 3CCSS 2PVSA 2PS1A 2A9VA 3ABOB 3UQYS 3FTPA 1U7HA 2C31A 2VUUA 1LWNA 1YE5A 2CK3A 2PZBA 1IDOA 2GT1A 1KFCB 2EBUA 4Q7JB 3RADC 1EARA 4LX0A 3EM1A 1UFQA 3WRWA 1KR2A 3HJBA 4BEWA 2CNKA 1EGHA 3UV7A 2A35A 3BL5A 3DE0X 5IKOA 4XUDA 4BVFA 1O0BA 3SWWA 5IUKC 1KJIA 3L79A 4E5SA 2GJSA 4JLDA 4WCVA 4JUDX 4CN8A 2WM8A 3CVUA 3R0ZA 1ZP6A 2J3MA 5I7EA 2O52A 2FQWA 3DM9B 4DJDC 4TLEA 4EGAA 1H0RA 5C5IA 1WMAA 1LVHA 5KB3A 1VLLA 2C2KB 1X1DA 4OJTA 1AO0A 4TTIA 1OBFO 4LYHA 3BWEA 3OJUA 2MSNA 1H85A 5KHLB 4RUAA 3LWDA 5KMGA 3F7TA 2PZJA 1M5VC 1X38A 4NBSA 2ADCA 4ZVOA 2EPIA 3R7SA 1FXLA 2B1QA 4PVCA 3M5CA 3ZVLA 3U6KA 2BVNA 3BULA 3EOZA 1F60A 1RWKA 2APOA 5HBMB 2ZROA 3ZHQA 4KHRA 4V0LA 1GHTA 1HNXF 3D1LA 4UHHA 1M1XB 1DEXA 1Q7BA 4ZWNA 3B6JA 1XC9A 3NTXA 3GFQA 1JLEB 3CRZA 1KFJB 3DLBA 2QIPA 3KHLA 1YS6A 2WI8A 1UBGA 3OTWA 4CVNA 1YQGA 3TJMA 5JISA 2D74A 4NU6A 3BUSA 4D96A 1TDJA 3BE5A 4AYBD 4RD4A 2WYIA 2MSTA 3A58B 4KNVA 3G82B 2M6RA 3KELA 2EFYA 2UU9B 2VHCA 3HYCA 2LDXA 4K9RA 1FUKA 4QOFA 1D4AA 5C1OA 3ORHA 3VKWA 3KQOA 3VR2D 4CEIB 2B2NA 4FOTA 1WHVA 2NAFA 3ICCA 3BG5A 1Z6QA 3MBIA 3EODA 5KNCA 3V80A 2FJXA 4LOJA 2G7ZA 2QYTA 1F3FA 5H68A 2ZVSA 4MV1A 5J40A 4M7OA 2GASA 1S2NA 1EJ7L 1DOAA 4LIRA 3M1LA 1O1YA 2C3OA 5HQ3A 4YFYA 1A82A 5H3CA 3PKMA 1Z82A 2F48A 4TM7A 3VHXA 5EEGA 4R9UC 4AULA 1NAIA 4Q9HA 1YZ7A 3A9CA 4YUXA 3TW4A 4X64F 3O4JA 3UMYA 1RT7B 4EWLA 1EP1B 2AXEA 2ZJ2A 3E1SA 4CI0B 1I9GA 3EGOA 4L5IA 1ZZEA 5KG2A 5CB6A 4BB9A 4F50A 1VIAA 3UBMA 4DXHA 4MITA 5IK2D 3FSJX 3LX6A 3SV3A 2CNKB 2REQA 3VKVA 5CURA 4L4XA 2VNIA 2D74B 2QAJA 3IP3A 3C3CA 2MSWA 3I9KA 2NSDA 4QVIA 2TSYB 3LKVA 4EG8A 4PGGA 3FLMA 2ZRJA 4YMUA 2FF5A 2IITA 2C5BA 1TM1E 3BF8A 4Q7AA 1DDOA 1B1AA 5J4VA 4F7DA 2ZNZA 4I1YA 4TKVA 4LF4B 3DTVA 5KFIA 3EYZA 2V58A 3ZHVA 3J7YU 1QQ5A 1LDEA 2DUUA 5DDPC 4ILKA 4HWGA 3RQIA 3COVA 3UIEA 1MQSA 1CRPA 4ZZIA 5B57C 2F00A 4LPSA 3LF2A 2RUSA 4BE9A 1NUTA 1JBKA 2PE8A 3BMCA 3UA3A 2GD1O 2ZUFA 3S8YA 4B75A 5BJRA 3R40A 1XCOA 4N7TA 1KI6B 4WFAQ 3ZCTA 1BEUB 4MQFA 2FJWA 1YFLA 1ECPA 4F4UA 4PC2A 4XJTA 1YGPA 5C4IA 2VAPA 3EFOB 1G63A 4D57A 3BSCA 4JI3F 4QUBA 3BA1A 4NV0A 3E9NA 2ZJAA 5KYUA 2E1AA 3AIKA 1NDKA 2RT3A 1PSDA 2A5FA 2X0KA 4JS0A 4OVKA 4MW9A 3GNLA 3EYWA 2ZOSA 2LQ5A 5AK0A 3WJ1A 2XZOA 2LIPA 3N0TA 5LUBA 3Q2SC 2IODA 4K9SA 1R8HA 5F64A 3R6WA 2IHKA 2A3JA 1I6LA 2WPDD 3A1NA 3OIUA 2G4CA 2QSJA 2JLYA 5E9WA 1OYWA 3GLGE 2EVZA 5BN1A 1UZMA 5MFPA 5JAIA 4YRFA 1I4TD 4ZOLB 1UBCA 1YU9A 5KFTA 1CUEA 4DTCA 3W63A 4KRWA 1RM4A 4TN1A 2ZT7A 3X44A 1CU1A 1G7RA 3JQ8A 2PRJA 1W85A 1F1JA 4QGFA 1CJVB 3AR7A 2KSQA 2RMLA 2WU3A 3P9NA 4IMPA 1ITZA 3GJ3A 1F8GA 4MXDA 4IIJF 2AC2A 2R2TA 2MYPA 5GM2A 3SSOA 3MM9B 1J2VA 4MIAA 3B36A 1IEVA 4ER5A 1MPTA 4OA5A 5F9HA 1O4VA 3H17A 1OY6A 1UJ6A 3DFZA 3OZCA 1W5SA 4CLHA 1C81A 1R6UA 4CQLA 5LXTF 4TT3D 4CM9D 4C8ZA 3IQGX 3WAJA 2QL9B 4C4ZA 4B02A 2Q4BA 2GN9A 4F45A 3H8VA 1P9YA 3SCIE 4OB7A 5LLDA 3LUCA 2FVXA 3LP6A 5GMKa 1WXHA 2I3DA 2FUKA 1X8XA 3OEYA 1S3GA 3J80Y 2VLBA 1NSFA 3DFUA 4E30A 1IVNA 3KQMA 2UVVA 1H3NA 4ZKDA 2XUGA 4OD0A 3N7TA 2W42A 4JV5B 3RAEC 2YJTD 4AVYA 3GLJA 5HIIA 3ZD6A 1JU3A 4MUAA 4AJIA 3B3AA 3SOPA 4FYHA 1RM3A 3OSNA 4OQZA 1I7QB 2Y0SD 5K8UA 1VYUA 5D85A 4QXPA 3FQLA 1J2TA 2L0XA 5KWEA 4JYAF 2VJVA 2BPOA 4KMRA 4BX3A 5AYVA 2YBDA 4X3PA 3RHFA 2CFXA 4TKVB 5AVOA 8LDHA 4KFUA 2VU5A 1FP4B 1WJGA 1NJXA 5DHSA 2FXVA 2P30A 1JZSA 3KPYA 4IRMA 3UAZA 3I2YX 2QX0A 2N47A 4B9UA 3TUZC 4IDOA 4ZCLA 4JYZA 1TI7A 4JLMA 5JAHA 4FK8A 1NRWA 4X64J 4BTLA 2JEOA 3QU2A 1I5EA 4DFDA 3DNMA 2IEDA 3FFBA 3TYXA 2G71A 3GMDA 1D2NA 2HYDA 2P0EA 5KX5A 4R4JA 2PI5A 3RVSA 3EGXA 3M9WA 2KMLA 2J8ZA 2VEDA 2ROGA 1GXUA 2RH5A 2X6QA 2CWXA 1A9SA 1X7GA 3ISVA 1D1SA 2Q9AA 2JLQA 3CGIA 1UIMA 3T7DA 3U4CA 3ZX4A 3ZHTA 1H3EA 3W5BA 2ZZNA 3DR5A 4QJBA 1ZO8A 5D3MB 3BILA 4V0KA 4AM8A 4EJSB 4LDAA 2VHVA 4EAQA 4XAQA 1R43A 2FPGB 4G1EB 1S1TA 2Z95A 4MVJM 1VJGA 3JWGA 3GEBA 1SQFA 4MB0A 3MEEA 4FHCA 4JLBA 2YFYA 1MO2A 4KP7A 2ZRIA 4NOHA 5B7NA 4D9MA 4E98A 2XCIA 1FA0A 1GSAA 4JBHA 2DFNA 4ND3A 1Y00A 1RBMA 4DV7B 4ZYWA 2H4WA 1YX2A 3FOEC 3JYOA 1WC0A 2RG7A 3ANYB 3DI6A 4WNIA 4DQIA 5HILA 4TQAA 2WHQA 4JI2B 3MWEB 3U3JA 1JNRB 1Z22A 4J37A 4WL0A 4GM4A 3M8QA 1DHMA 1PQPA 3WR5A 3KSZO 3DAHA 2VHTA 4L3VA 2OR3A 5KQSA 1NZAA 4Q4JA 5E6UA 1YGYA 1W0JD 5IWAJ 1QCYA 3HXOA 1DX4A 1OTXA 2CQCA 1RHJA 2FEAA 3G5LA 4TRJA 5T41A 1UH5A 4OFWA 5ESWA 2CJWA 4YLEA 1KVKA 3CDBA 2M2IA 3KKPA 2Z9CA 1EFVA 2EP5A 4F8YA 8MHTA 4A91A 3V8EA 1G8GA 3CF0A 4YH1A 2MMGA 1Y80A 3CJTA 5FFFA 3FYUC 3HFSA 2ENUA 3JSYA 5M2PA 4FNHA 4HWSA 5FI1B 2P0YA 1P1LA 4KH1B 2MHCA 4AJJA 4PLYA 1MSWD 3ISNC 1E7MA 1MZPA 3M32B 1WUKS 3S2SA 3I58A 4C1NA 2BW0A 1P2DA 3D0KA 1YCGA 4BKQA 1HE3A 3RVDA 2OP1A 1NJ6A 1XEWY 4L0CA 3IGFA 2ZJPQ 1V9OA 2X1GA 3HXPA 1ANKA 4DA8A 5HK9A 4GX1A 4OGGA 1FFWB 2VJQA 1OZGA 1KS2A 1EQMA 3CUWA 4BGVA 4QO8A 3RRKA 4YQYA 2I91A 1H66A 3OT5A 3B5EA 1WD6A 1MRSA 2P2ZA 3DOMA 5HUHA 4PZYA 4JYBA 3HPQA 2VRCA 4TS3A 4ECAA 3BDPA 3VQTA 1TXGA 1YRHA 2C99A 4MQEB 3UPTA 2FLLA 1YQQA 3W5SA 4PS1A 3CE8A 1JDTA 4QD3A 1XTVA 4W9NC 4BDPA 2O5VA 4M99A 4DJFC 2F8SA 1PG2A 2JZ5A 3A6FA 4DYDA 5IABA 2VAWA 1TCVA 3L07A 2SCUA 2R1VB 1Y6GA 3T54A 4EJ6A 4E13A 3M34A 4N7MA 1KIAA 2RI6A 3UF0A 1UWBA 2PJDA 1C1XB 4G01B 5AE1A 2V3CC 1GAEO 4HVCA 1C0TA 2JKVA 1BDJA 4J6FA 4KE8A 1F4LA 3V2UC 1PR0A 2P6PA 1RADA 1G2OA 4PLHA 1VL0A 3L0IB 3DOFA 4EFAC 4CE6A 1Y89A 3DLAA 3SHOA 2DR9A 5I9LA 3NW9A 2VP9A 4YC7A 2YWKA 1OB5A 5DYYA 1Y7PA 3MMPA 1KXJA 1G20A 2JIPA 5IKMA 1D3WA 1ZN9A 3MRVA 4UZCA 1LSOA 1I51B 3CC2S 5LJLA 4EHNA 1IQPA 2PTHA 2ZBDA 3KQQA 5KQPA 4XQ0A 1WI8A 2QD4A 4GKJB 3F5DA 5K1ZA 5FRDA 2QW0X 5BN3A 4PPNA 2DU8A 4Q7KA 2Q46A 3EMBA 3Q8LA 3KWMA 5BUCA 1RAGB 2V55B 1F06A 4F71A 4WFKA 1HI8A 1GTVA 2QPAA 4PXDA 3TQSA 1V48A 2HQFA 1JNZB 2CDNA 1Z36A 3VU9B 5EHXA 3MAAB 2D2IA 1T8SA 3C3XA 3VC7A 4RGBA 2Q5FA 4K6MA 2LTAA 3TWZA 4CNYA 1U80A 2ZTLA 3ZGVA 2VDKB 2D3O1 4MWSA 3H99A 3T5KA 2QYSA 4UVEA 4BVEA 3DLGA 4O02B 3JD2A 3O2SB 4A8PA 4HDRB 1E6VB 3VPFA 2WW8A 3ETOA 1MIHA 2N75A 4YRTA 2N3OA 2QR3A 3W7AA 2MINB 4NLSA 2PFKA 2KRRA 5LMNB 4L1KA 5A8WA 2BTQA 2EYUA 1GMWD 4RK1A 1LBIA 4L9WA 1EG2A 2CUZA 3PYFA 4Q1DA 4E33A 3RW7A 3HRKA 1UDAA 3PRDA 4AKTA 5D8HB 1QH1A 1AV7A 5DK4A 4E5UA 2OFWA 1FS4A 3RUAA 1TJ3A 3S99A 3Q22A 4GOOD 3FI0A 1EYZA 4ZJYA 3CUVA 5CPFA 3WGGA 4P33A 3X0DA 2CNDA 2YJ3A 3HSDA 2VA3A 5CM8B 3QZ7A 3BXHA 3GPCA 2XD9A 4QBKA 4WK1A 2RNEA 4EF6A 5J2TA 4RUCA 5CFMA 3EJWA 3JZMA 4M3NA 1RAAA 4O29A 4IV5A 4CV3A 4QE3A 1SCBA 2JLZA 3G2QA 4Z8XA 2O3RA 1KEEB 1LBQA 2HRZA 1OLXA 2QAGC 3K7RA 4GPZA 4WW0A 3TF5A 2XLJA 1WETA 1KHWA 3RSFA 4QGBA 4BGDA 4IQ8A 5JI3E 4LG1A 3GJ4A 2DNZA 3ABRB 5G0RA 1NOKA 3NOCA 4BEVA 1O94A 1B2LA 3OQIA 3TI0A 1GPYA 2OYSA 1TRKA 4RTPA 3CJ5A 5I9IA 4LC1A 3K5PA 5BQOA 5DNWA 3B12A 3QNUA 4ZPCA 1I3NA 1ZUHA 3L0PA 1N56A 3NOVA 1S4QA 1PV1A 2UZIR 3TK1A 1RAIB 1U8CB 1P73A 2WJYA 3V97A 5E0OA 3UAXA 1ADFA 1K7SN 3I01A 3UEOA 4YS6A 3S6JA 2ATLA 3LHKA 3MLEA 2CIMA 1EGMB 1ST2A 3PU6A 2NSYA 1R31A 2DHGA 2WNSA 1HTBA 2M7SA 3CHYA 2NUPA 4Q7EA 2CPZA 3D2LA 2H9YA 3AQ4A 3WRVA 2BFCA 4IYQA 4AN4A 5MGBA 1P1HA 3TLGB 1CZOA 1RHRA 1RKIA 5P21A 4Q0BB 1TMYA 2XT9A 4N5HX 1UXKA 4AAYA 2ATXA 3PRVA 3CJ0A 4MW7A 4JIGA 2BFCB 5HZKA 3PXEA 5KOHB 5CDUA 3A2NA 5CDTA 3L8FA 2DXDA 5CFLA 2PQ0A 3HXQA 1T4BA 4ZIRA 3LKBA 2I22A 3EB9A 4RNNA 2IUUA 2HF7A 4PZEA 4XM1A 3WS7A 1V3ZA 3H2HA 1ISRA 2ZKIA 1E69A 3A2LA 3BXOA 4MP6A 5D3MA 1TK5A 4G4JA 4RUHA 1JQBA 4PXSA 2CHEA 1XWFA 3LBYA 1IG0A 2VYND 1GN9A 2F4VB 2PSJA 3CVOA 3NOOA 1YUNA 4LEIA 5IWCA 5B7PA 2E55A 3HCAA 3N2YA 3KLIB 4DG1B 1DI0A 1QWOA 1VQKS 4M0KA 4LBVA 4B3MF 3IWXA 3KJVA 3KOAA 2H07A 4ND7A 2F65A 2YZ2A 1XL1A 5C31A 1KL7A 3WDOA 2X2EA 4TYQA 4G25A 1ESNA 4DX5A 3WLLA 4U96A 3O3LA 1WLYA 3E3MA 3WKBA 5KMGB 3CIOA 1KNXA 2JI7A 2KO1A 2GGSA 3AEUB 2FHKA 2CHUA 4W1QA 4U8VA 4V1CI 1PT5A 4G0YA 1VHJA 4M8LA 1YRQA 1KEKA 5DRKA 4DMRA 1P0PA 1CERA 5FUYA 4BGIA 4MRMB 1UWAA 3H5XA 3C16C 2AD9A 3ORSA 4F2RA 2JAOA 3TLXA 3H6KA 1YJVA 4JI5B 1FMCA 4BAGA 4P4SB 1GUFA 1G98A 2FQQA 5K45A 3NMUF 3PJFA 2GJFA 1XRPA 3MSXA 3BEGB 2E4ZA 5FTMA 1XQ9A 2KWIA 5ERYA 4POAA 1E8MA 1AB6A 1YJCA 4AO7A 3EUWA 2C4VA 1EUCA 1L1EA 1MB0A 1UP4A 3DEJA 2C3MA 1K3UB 4MHOA 3TRIA 1QR6A 2HV8A 4IXWA 4JI8J 2CJXA 2QTMA 2B78A 2RHLA 4P4LA 2E5LF 4MGEA 1FFXA 1UJ5A 3QGIA 3BMNA 3ZWVA 1B6TA 3OIWA 1BS9A 3QJPA 2EKLA 3I0MA 3CNLA 1M2KA 3M2UA 1JT2A 2DAPA 4KXYA 5AFSA 4HN2A 1X7WA 2EFHB 1AS2A 2UXBF 2CPEA 1ZINA 4JBXA 4G23A 4Q9KA 3GLQA 5T5QA 3BEOA 1W9HA 1FKPA 2WJWA 3V1KA 1UPUA 1I3LA 1PU2A 2HQSA 1SBHA 3N75A 3L1JA 4S2EA 1NMSA 1G8HA 1LSSA 1G8SA 1THGA 1JQKA 5B0BA 1HH4A 3FFAA 1NI4B 2FJ0A 5DGAA 2RAPA 1Z83A 4DV4J 3KHSA 1N33B 3I4PA 1GZ6A 4N3AA 1J0DA 2OV8A 2O1EA 1FNSA 1Y5RA 2BFNA 1OQAA 4UZEA 1L9XA 4JI1B 3TI9A 3ZHCA 1JWBB 2R7OA 4AY5A 4U6QA 4N8DA 3FVYA 1J2UA 4HQFA 5EN4A 4JV0A 5JCJA 1SC3B 3VAIA 4ZZ1A 1H2EA 4F3NA 5J2MA 3W4KA 2DR0A 1UFVA 4WFNQ 3A0UA 3Q7IA 1EVKA 4S04A 4EMBA 2R00A 1UFLA 2ZULA 4AE5A 4WDRA 3W2TA 1KH3A 3T3HA 1F2HA 4X1YA 2FPHX 3PXAA 1UKYA 3ZDXB 1SUBA 1YI0A 2RD2A 2G80A 2R66A 1RZUA 4MWBA 5KVAA 4DDKA 1AKYA 1MU2B 4RFSB 1NW8A 2C4KA 3QVXA 3P2IA 3MUFA 4EB6A 4DDVA 2OD4A 1VPEA 4RMIA 3W9BA 2QE7D 2W5UA 4P08A 3PXBA 1OLSA 2PQMA 3I5AA 2ZIZA 4DABA 5L4NA 5IZHA 5I5EA 3K1JA 1L6IA 1FFXB 1C0UB 1B7GO 4IFYA 3M9XA 1NPRA 3QIAA 3C19A 3KJFA 2PH3A 4DG9A 1Y34E 1RLTA 2BQRA 5F1PA 3VJKA 2XWQA 2X5XA 5FORA 1U3WA 5FPHA 1H98A 4J4HA 5BMOA 4MJXA 1HV8A 2FV8A 4MR7A 1F8UA 3KHKA 1X87A 4NCIA 3A70A 1JJVA 4JA2A 2GO9A 3D54D 2OFPA 1TNDA 3VO2A 3BSWA 1C9JA 1UK6A 3AOCA 2PH7A 5DIFA 1Y0BA 4IH9A 1RTHB 4Q6WA 3QXSA 1JPUA 2JGFA 4TGLA 5FPSA 2XHZA 3Q3GE 3L8CA 1CR0A 2YIDA 3FRHA 5AHOA 1R3NA 3RUFA 4HOYA 1R8XA 5IXYA 2GMHA 3KVYA 4DXAA 5BOSA 1M34B 5K4HA 3GLFA 2O8FA 3EBPA 1WNEA 4TYBA 2FN7A 3PZBA 3AONB 3ZWOA 4UEJA 4TUYA 4O4JF 1SAYA 3UW1A 5CYOA 3JATA 3V1UA 3VU0A 5IV4A 3CZAA 5J1NA 2VPWA 1AKTA 3D3CJ 5KTTA 1PR1A 3JW8A 1YDFA 1SH3A 2R7SA 3R7NB 1W87A 4I1TA 3IMQJ 4Y0FA 5JVGQ 1X1EA 5GVQA 5ES3A 1JLBB 5MDHA 3DLCA 5KG5A 5KVSA 1YL5A 1UDWA 1NP7A 3AU8A 2QL7B 1SC4A 1NC3A 2H1OA 3R9XB 2I6XA 1U0SA 2FP3A 1T0JB 5EERA 1GT91 1CY0A 4QWBA 5K9ZA 2O3SA 2R8GA 2B7CA 3R3SA 5DT9A 1OIXA 4LC0A 3FJ1A 1K0FA 4QYMA 1NSAA 3TKAA 4OHOA 4D8UA 2CEAA 2UZ1A 3K6KA 2QTCA 1FFHA 4Z4QA 2C28A 3AF4A 1XNQB 5GGXA 2IUFA 3G89A 2QPLA 4Z0PA 2FJDB 1FSZA 1S9FA 4ETWA 4O4IF 1LWEB 2QTZA 4HATA 2LRHA 2YVSA 5KCZA 5HJ5A 2MSKA 2K1RB 1WD5A 4RF2A 5DLFA 2BF4A 3Q2KA 3EK2A 3EWAA 3S6EA 2YV1A 5A5FA 5L7TA 5IAEA 2CNNA 1UZUA 3VUEA 1CSEE 3NEYA 1LQUA 2Z2IA 1HWLA 5DDQC 1QVWA 1JLBA 2CZVC 4HDCA 1ZQ1A 2A57A 3MOSA 3LUDA 3RK4A 1RVV1 4MVJE 4XD2A 3I87A 4YP1A 1E3LA 1U49A 3PHCA 2I80A 2PEBA 2VKRA 2UYQA 4XDYA 3A6EA 3RWOA 4PN3A 1C9NA 1X9WA 4P7BA 1H3FA 2OPQA 1RA7A 1KIFA 2XB6A 1EGAA 2ZRMA 3K09A 3UPFA 5LA6B 3JB9k 1TJYA 3AF5A 4GBMA 3RV3A 3JCZA 2IUTA 3KAQA 2QJOA 3QA9A 4FC6A 1MABA 3OT1A 4L6V3 1N2BA 5M5BA 1JMYA 4CO1A 2Q8PA 1JDUA 2QM8A 1ECCA 3OZSA 2I76A 1BE4A 4Q3NA 2EP8A 4UDYX 5BR8B 3DW1X 1QDUB 2PMHA 3UN3A 2JIZD 4QOGA 1A5AB 2EG9A 3HBLA 4KW7A 2RC5A 3DF9A 3GRCA 1BQXA 2JHAA 4UTOA 1C30B 1D0SA 2BDPA 2X0JA 4Q7LA 2XUIA 3HU1A 5DTQA 1U7UA 3KPUA 2K87A 5A8KA 2HQRA 4ZI7A 2QWXA 1XR3A 1P2BA 3MT0A 1TK0A 1U8WA 1XK6A 3BH6A 4PWYA 1UK7A 4F11A 4N47A 2H2FA 1QH1B 1G291 2XCOA 2WVEA 4XXHA 5A02A 2V7XA 3DXFA 3ZV4A 3IQWA 3FA2A 5M2RA 1QYDA 4E22A 3A4LA 4K1LA 3A3KA 2YR0A 3QX7A 1BQEA 3STTA 2J0XA 4XCQA 4PC7A 3L6RA 4C0AC 1R7IA 1SG6A 3PNQA 4U95A 2H3EA 3LA8A 2F8LA 2JIRA 3D4LA 3B9QA 3KRTA 4MUHA 1JHVA 2CUTA 2WSFC 4P6QA 1GYPA 4KB5A 1CBKA 1ULZA 2PFGA 4G1QB 1YQWA 4F04A 4IDNA 3GR0A 3B4DA 2XMBA 3HP6A 1E1QA 2HA5A 1MHTA 4PYKA 1XXHE 4IIHA 4LX8A 1KZGB 1SMKA 1E62A 2SBTA 3H2LA 3JQBA 2G9UA 1NSQA 3RNOA 1C14A 2NT3A 4R81A 3JQGA 4F25A 4N5LA 2BUNA 3G9QA 1N4DA 4OUDA 2D1FA 4F3QA 1HR0J 1FYFA 3C6MA 2WKQA 1A98A 4PXEA 1HDXA 4G0NA 1V5IA 5FXMA 2XSJA 1LDMA 5TS3A 1OXXK 1HD0A 3I3SR 3HVIA 3T5HA 4HGOA 1EFHA 4KL8S 3LRPA 3ME5A 3D4BA 1FKPB 3F6EX 3UT0A 4CFZA 3HB0A 2NU8A 1KEUA 1Y8QB 2CDRB 3TL3A 3PA6A 3GSIA 2YVKA 2P35A 4NZPA 4R8UA 1T9TA 3QJYA 2YCLA 3JQKA 4FDUA 3A25A 2PMKA 1RQ7A 1OWOA 1Q21A 1XZKA 3AD7C 4JLAA 5KNDD 1PV4A 1E4EA 1KP3A 3PQ3A 2ASJA 1EE1A 1AXEA 3UCXA 3PQ8A 1DTWB 3ND9A 1QUFA 1VIYA 2X9GA 3DKIA 3SDEB 3GJTA 1QM9A 4Q1VA 1X5PA 2TMGA 4CLPA 2AXQA 2ZDPA 5ALEA 4PWDB 5TC4A 3CEAA 5K2OA 4INOA 3QEKA 3DT8A 2ZEJA 1RPJA 3O26A 5CUQA 1PYDA 5E4JA 3CRVA 1WTAA 4H18A 2FEPA 2WYUA 5EJAA 4BVGA 3TR0A 3IM9A 1MN6A 3F6RA 4YCBA 1D9ZA 1XMXA 4WPGA 1ULSA 3PX7A 3CISA 5KCMA 2WTNA 1JEEA 3NIWA 4B2PA 1NMYA 4NS1A 1S3SA 1JHUA 1K66A 4IFIA 3U13A 3TPZA 2BMDA 1HL6A 2R6DA 1N6KA 2UP1A 1A9XB 4FQ8A 3KBBA 1RACB 1UKBA 3L7OA 4OM7A 4UY8T 2UUAF 2H4FA 2OCPA 3ZS9A 1U8TA 4YMIA 1ZA2A 2CD7A 2ZIXB 2EFOA 1TGYA 4JN6B 5E9AA 3V4RA 3I0RB 4A2QA 1RI5A 2W8KA 3RSGA 3V1NA 2UUBF 3GQVA 4MA5A 3FNBA 2RDJA 4CGZA 5I9MA 4FF2A 1E3SA 2YX1A 1FW6A 1XK7A 3MUNA 3RFTA 2VH7A 1NURA 2F8EX 1NRXA 3A9UA 1ZJYA 3VPBA 1XLTA 2O8DA 5HF5A 4PPQA 2Y0BA 2NYRA 1KVQA 5EI5A 2IDMA 3FDFA 4P73A 4YHHJ 5HJYA 1W88A 1RMYA 4ED2A 2Z2LA 3TRJA 2Z6AA 2VH2A 4LTMA 1FRFS 3BMQA 1CX9B 2QRHA 1B16A 3MMBA 5AK3A 3QWHA 2CL5A 3A14A 2X4IA 1LJUA 3G8DA 4ER0A 1PYSB 1QC5B 3ZYZA 3AB3A 3GJQB 4UBOA 4AKGA 3NBYC 4HNSA 3UV6A 2G82A 1EX8A 1HE2A 1NBWB 5KZMB 4EM6A 2Q43A 4DFJA 4FGZA 1R6AA 1R0WA 3IAHA 2KHZA 1TA4A 1EVYA 4B45A 2AOWA 4EO6A 5ED0A 4DR1J 3PWSA 4YY3J 3N5CA 3LFHA 1FMLA 5J1PA 2QLFB 2Q3FA 3I9LA 5B0FA 4KG7A 2G1JA 2Q62A 2AW3A 5A4AA 2QRMA 2CXHA 2QAGB 3PE4A 3BZUA 5D6GA 1XVLA 4C8LA 4ZI5A 4KV8B 4WJZA 2FC8A 1K3FA 3EDRB 4ZVMA 4BO9A 3JVUA 3AR8A 2B8WA 3PQ6A 4C20A 3LPCA 3LYLA 1NTRA 1FL9A 2YQ0A 3OZUA 2VTDA 2Q3JA 3AY6A 2IS4A 3NV9A 2YH0A 3I6BA 1ZD9A 2VA9A 3R7SB 3AUTA 4YJGB 1YJBA 3KP1A 3KALA 4LV6A 2WNIA 4E4RA 3J7Z5 1A96A 4M5HA 1ZK2A 3W6UA 1K86A 1PJ2A 1UEKA 3COZA 2A9OA 4JJFA 4JVOA 4BV2A 1HXHA 1T5HX 1QG4A 2HMYB 2BMEA 4HEA6 3AKEA 1KD1T 2MHNA 4D43A 2RHRA 4D8VA 3C3DA 1BXZA 4R5MA 4RDHA 2PY6A 2Q6CA 2VF5X 5D1NA 5K8PA 3DAFA 1UINA 5CJ2A 2B4UA 2AOVA 2PUJA 5FBRB 2RB4A 5DG9A 4HLUA 4GBGA 3IQHX 4EWTA 4FVTA 3U27A 2GSWA 5DTMA 3ITNA 2AHOA 2PKQP 4POOA 1VMAA 4XVCA 4DS4A 3BCUA 3FFIB 1Y8RB 1CUSA 4FZ3A 1RJDA 4BV9A 4USJC 2IYPA 4WKNA 2Y1FA 4GWKA 2ZAIA 2YKAA 4CMIA 1T24A 2O2XA 3LKZA 4EGLA 1F2UA 1NPYA 2IH5A 2HF8A 1NVKA 3ADKA 3UUEA 2CQ2A 1T91A 1CY7A 4M22A 4UPVA 5DN6D 1E1YA 4MKHA 3HHLB 1NK6A 3I2JA 4L72B 3UENA 3L6BA 3OIGA 4MP3A 5K5MA 4NL4H 1R0RE 1T2CA 2HYIC 4DY6A 3IESA 1QIIA 4ILEA 2Q6LA 3NDJA 4RPLA 4C3MA 1NBOA 1DRJA 4LYJA 5D4PA 3V4LA 1Q0QA 1CXZA 3W2VB 2JJ8A 2Z5LA 4CCYA 1I4OA 5DNVA 1ODCA 2V4RA 4BIMA 1ZHOA 2Q1TA 1HQEA 1HWJA 2HCFA 1DT3A 3GBVA 4QPTA 2HLHA 2Z2KA 2BJ1A 4XIJA 3E9EA 4JLVA 1W5BA 2X76A 1KJZA 1W85B 2QIOA 3DE3X 5LIPA 4ENUA 4L72A 3TRGA 2IXDA 4B6PA 1YQXA 4CQMA 3GGDA 3USES 3G96A 5JC8A 1UDBA 4YHBA 3IA0A 4CT8A 4UXHA 4Q00A 1JLAB 3VR5D 5EXTA 1U9YA 3PR3A 3U3KA 4JZYA 2Z8YM 3HLYA 1LWOA 3L0YA 1EKSA 4MYUA 3GSDA 2XA1A 2Q1LA 1U1RA 4XO0A 2MJLA 3CJ4A 2H1YA 3LLSA 1NNDA 1FXWF 5G1PA 4CNQA 3A1WA 3MEKA 1ZXLA 1FU7A 1QG6A 2DQSA 3MEGB 2VFTA 2ILYA 2WYWA 3MMNA 1RWOB 1T43A 4QUKA 1RAOA 2EKDA 4Y00A 3D3KA 1T9UA 2F1FA 1AZWA 1DTTA 1UOOA 4E2FB 1HPZA 4QWWA 2R3VA 3CC8A 4DA9A 1HMYA 1WAMA 2OBLA 4EKDA 3MYYA 1PNTA 2H3HA 4MW2A 2MKSA 4MLPA 4BQOA 4LXGA 1TZ0A 2WJGA 3GN2A 2XVYA 3JZIA 4HDMB 3RNLA 4C6TA 4RMGA 2IIBA 5E3IA 5J1TB 5YASA 4B3SB 4Q9IA 1FZQA 3LY8A 3M2UB 4CUZA 5AHWA 4XWGA 4YR0A 2D5IA 1OX5A 5KFFA 2GZHA 4HNTA 4Z4IA 2J5BA 4RU1A 3H5NA 1M1GA 1CS0B 1E20A 4P0PB 4PM4A 3CVXA 2V7EA 1PK7A 1SCIA 3M0EA 1Z5NA 2I7VA 4WXWA 1TB4A 3IHLA 5TJ9A 3PFNA 3GILA 2G1UA 1QHYA 2BMVA 5AI5A 1PEYA 1BN7A 1C30A 1F48A 1FDIA 3SIPB 2ID8A 1RT4A 2V7QD 3EVMA 3LXMA 5HFJA 4J2OA 4GI1A 4S35A 2OZVA 4KMOA 2AX4A 1YL6A 4RXMA 5FV7A 2WTUA 3IUEA 2KLHA 4Y6RA 4Q2MA 2JLVA 2DYKA 2JZOA 1WXWA 1XHEA 4B6GA 4FYXA 5IHXA 4K1XA 3WL3A 4OXKA 4F72A 4QIFA 2HS0A 1TADA 3FKSD 4IH5A 1XMJA 3NASA 3GRRA 4NLYA 1TT5A 3DMNA 2EFPA 3OZIA 3ILIA 2O07A 3WX8A 4EIWA 1SKYB 2O2EA 1GPWB 1KH1A 2C1EA 4GDMA 3WLNA 2V6FA 2DT9A 1S7GA 4DM7A 1DKMA 5H9FJ 1G0OA 1L5SA 4ZVPB 2Q29A 3ZU6A 3GB9A 2PO4A 1LOUA 2QGFA 3AGPA 1JE1A 4TMTA 4CFSA 4URGA 5BMVA 1K5DA 4B09A 4G1MB 2XLBA 4E15A 3HXKA 4E1BA 4JMLA 5I7AA 3UB4A 1BMDA 3BXFA 2Z3VA 3RQSA 3AINA 3FWZA 2X14A 2ZIAA 3EG9B 2J5RA