3L4FA

Crystal structure of betapix coiled-coil domain and shank pdz complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
MEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for asymmetric association of the betaPIX coiled coil and shank PDZ
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein/protein binding
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 24
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l4fA00
2YKOA 2W6BA 3BRVB 3CL3D 2YKPA 2YKQA 3EQ2A 3L4FA 1JOCA 3BRTB
chains in the Genus database with same CATH superfamily
1HF9A 5CCHC 2D2CB 2E5TA 3F5HA 1QEXA 3FXEA 1L0NK 2K9JA 3CC4P 4I1LA 3KYQA 4L74A 1K73Q 3OW2O 1CSBA 3PJSK 1L4AD 1YIJP 2QJKB 2ZVOB 1L0LD 1IO4A 1P84D 3H6PA 1PGOA 2ITAA 3O8ZA 3OAKA 3V2RA 1VQPP 1ZW0A 2AXCA 1S1CX 2WSFJ 3HE4B 1Q7YQ 4H13C 1IFMA 2WWWA 2BCCD 5AVQB 3W67A 3M0AA 3EFFK 3C8VA 2JKVA 4I7ZB 1QVGO 1KYOD 1SQPD 4DCKA 3H1ID 1G1JA 1NTZD 2Q3IA 4DT0A 4NPEA 3WU2H 4JPZB 4WB4A 2OTLP 3GF7A 3H32A 4HH2A 1EDLA 1JUNA 1KILC 3HTKB 3PTZA 3B71A 1JCDA 5EFWB 1KQGB 1SQVJ 2JO1A 1YHQP 3AEEC 2QVAA 1M57D 4ZKPA 1JCCA 3NFQA 2XU6A 1LP1A 1VQ4P 4UB8H 1NTZG 5AW7B 3AE5C 2O01H 3L70E 1JY2O 5KLVJ 1USEA 1XTGB 2IFMA 1LTAC 1USDA 3B4SA 3MP7B 2FKWB 4NPFX 3KXDA 1VDFA 3VMXA 1GW3A 5APYA 1L4AC 1NU1J 1FS0E 2B88A 2Y9ZA 3M9QA 1J1EB 1AA0A 2BCCE 1K9MQ 3R2PA 1JY3P 1KB9D 2Y9YA 4IOIH 1RE3C 2A06E 3BVHA 1AV1A 2OTJP 5CCHD 4AYCA 2WSSH 1GL2C 2WPRA 3G9RA 1L0NG 5AW9B 2W83C 5M1BA 5TISE 2KK7A 2FYZA 3L72J 2QG4A 1RQVA 1U7MA 2Z5IA 3GLMA 3VP8A 1URQC 3O6QA 5CCGC 1N7SA 2XNXA 3ABVC 3TDKA 3Q5PA 2D2CD 1GU4A 1A02J 3CC2P 1ZV8A 3LIEA 3CCLP 1KTMA 1RF0C 3JCUE 1KB9I 2YKOA 2Q7CA 5KAIH 2P2UA 2WTYA 1SQXK 1S5LE 3V4QA 3CWBE 3GHGC 1NYHA 5K5GB 3AE8C 1NHLA 1UIXA 2ZXEB 1JY3O 3BCCJ 4EIJA 1RF1B 1GDTA 3B5NB 2CK3H 3OJAB 2NPSB 2W6AA 4W7ZA 3L74J 1VQKP 2WSFH 1EZVG 5AVSB 5AVTB 1EZVE 1MFTA 1QL1A 3GG2A 4OGQC 5AVWB 3KDPB 3BATA 3H1LD 2WZ7A 4N78D 4PD4E 4U7JA 3VP9A 1SQQK 2R3CA 3CXHI 1DEEG 1FZCB 3L74D 3PLNA 3LW5H 2AXTE 4OVNF 3VMAA 1K8AQ 2JWDA 2NPSD 3CL3D 5APTA 4R4LA 1LTJA 1OW8A 3P8CE 1JO5A 2E5YA 1JOCA 5KJ7C 3D70A 1VQ9P 1PZQA 3B8EB 2O1KA 1S5LX 5AVRB 4D6TD 2Y0EA 3O6QB 1IJDB 2BCCJ 3CX5D 1PP9J 4HB1A 4PJ0E 2FYUD 2M8RA 4H0LC 4ZKUA 4I6MC 4U3FE 4UB8E 2ZYAA 3H1LG 1DD4A 2HFED 2ZFCA 3GW6A 5AW5B 3V2PA 1ZR4A 1NTME 1RF1C 2KLUA 5TJHA 5KKZC 2L5GB 2Q9IA 5AW0B 1PL5A 3UIAA 2OYHA 3A0HH 3P7KA 1NU1K 3AE9C 1LTIC 2R5DA 4UB6E 3V2NA 2JDIH 3L37A 2E76D 2LKMA 5KJ7D 2GM4A 4KJMA 2I1JA 1NTKJ 1LP1B 1BCCG 2GUVA 1HGVA 1M8OB 4JYBA 4H44D 2QJKC 1DD3A 3MZWB 3USSA 3TGUD 4Y28J 1SQXE 3RK2D 3H1HJ 3L70J 2OYIA 1QVFO 4OGQD 1MUUA 2E76B 4EDFA 3TK1A 2ZT9D 1SQBJ 3RL0D 2H8PD 3SWKA 1SQPG 2Q5UA 2YO3A 1FE6A 3RK3D 1FZFA 1BE3G 1OX3A 2ZJSE 1SQBE 1R5SA 3RL0C 3BCCD 3CLQA 3H1HD 3SFDC 4D6TG 1MZ9A 2QRXA 4M3LA 4L73A 5AVVB 4BXLA 1YYCA 1VF5C 3EFGA 3RK2C 3L75G 1ZR2A 3A2AA 1HUCA 1SFCD 2WPSA 2XKMA 3L71G 1N7LA 1TU3F 3RL0B 2E74B 1VQOP 3M9BA 1AFOA 2WITA 2N1TB 5AW2B 3CX5H 1SQQJ 2H7HA 1UIIA 3JSVC 3D71A 4PV1D 2HODA 4XE5B 3V6IA 3MTUE 1S9KE 5APSA 3GHGB 1JB0J 5B66E 5CCGA 3FX0A 3HE5A 3M06A 1FZCA 1FJPA 1EZVD 5CMZA 4YXWH 1KV4A 3Q5RA 3B5NA 3C1LA 3CD6P 3KZIH 2YKPA 1SVFA 2YKQA 4YXDC 2IZ1A 3L73E 1JTHA 2W6JH 1NU1G 3GF3A 3L73G 1U57A 1NAYA 4H13B 3S9OA 5KTBA 1KFMA 2UWJE 3L74E 3TGUG 4PV1B 1NAFA 3U1CA 1BGYJ 1FZAA 4K3AA 3B5NC 3CCUP 3H1KD 5L8RJ 4H0LB 1BDCA 4HYTB 2VRSA 1LTBC 2M5AB 5CHXA 1YJ9P 3L72G 1NJIQ 3PHLA 1L0LG 5KLVE 1KYOE 2JWAA 4BWNA 1HVVA 1X9VA 3L4FA 3H1IE 1BGYD 1VQNP 2Y0DA 3PH0A 1HH0A 1KILD 2OYOA 2KP8A 2Z5HA 2C9LY 2QM8A 4YTPC 2E42A 1OIPA 2WT7A 4OGQB 1E79H 4TLFA 2ZXXA 3RGUA 2W8ZA 3HD7A 2J5UA 2ZT9B 3KQGA 4N78E 1IZNB 3H1JJ 4ASWA 5BU5A 2KOGA 1YITP 3WUTA 1YQ3C 3KHUA 4KHXA 1H8AA 1VL2A 3CC7P 3PP5A 1J1DB 1KB9H 4NPDA 2V7QH 4Y99C 2NZ2A 2P10A 1NTZK 5KLVK 3CCQP 1VQMP 4GT1A 1H89A 2E43A 2CPBA 5H2FH 3Q1MA 2C9NY 1EZVI 2OQQA 4EI2A 4WY4A 1NU1D 3L73J 3RBXA 2IFNA 2Q3EA 5APVA 1H0TA 4PD4I 1NO4A 3WMM0 1NTKE 3PRJA 5CCGD 1BGYE 1ZRTD 3I5CA 1URQD 2FYUG 3H25A 1DX7A 1JMBA 1YTZT 1P84E 3GMAA 1SP4A 2W6BA 3R4YA 2AEMA 4JQ0D 4BRYA 4GKGA 4C46A 1Y9BA 2BCCG 1L0LJ 2FXOA 1AVYA 3FWLA 5KAFE 2KI7B 2JJLA 3BRTB 1SFCC 1ZN5A 5AW8B 3MD0A 2GUSA 1L0NE 1PGQA 5CBOA 2IYOA 3BASA 1DH3A 1M1JA 1FOSF 2FBWC 1FZEA 1GK6A 2XZRA 3HE4A 2A45H 4LLHA 1SQVG 1CI6B 4PJ0H 1KYOH 3AE3C 1PIXA 3H1IJ 1OVRA 2HPCB 3SSUA 1JTHB 2A06G 1NTZJ 2YMKA 2ZT9C 4RO0A 1VQ8P 1SFCA 4W7YA 4ZMDA 1EXIA 5AVUB 1LWUA 1W2EA 1P84H 2IX7C 1N2DC 5AW4B 1XTCC 3L70D 1M1JC 3U1AA 2POHA 1OZHA 2R5BA 2YXQB 4YPCA 2WT7B 3KZIE 3MGNA 1QGKB 3MHVA 2E76C 2PGDA 5KJ7A 2C0WA 3V5BA 3FGAD 1M7LA 1S2EA 1JNMA 2B89A 4RKUJ 2IZ0A 3RK2B 1BE3J 4GOFA 4BRYB 1FZBA 1LNQA 3VMZA 1JY2P 4D6TJ 2FYUE 1IFNA 5AVXB 1BE3E 1DEBA 1PP9D 2IPPA 1QX8A 3H1JD 3AEFC 1EDIA 3A0BH 3SFEC 1IFDA 3HD7C 1PGJA 3V4WA 3CMEP 3E1IA 2KYVA 2HR3A 3LIDA 5APWA 2V7QJ 2LXBA 3RK3C 1NTKK 5B5EH 1HJBA 1WMKA 1U7JA 2WSCH 2QIWA 1Z56A 3L73D 5KKZB 3GHGA 3AEDC 1SFCB 1J2JB 1FDOA 1BSNA 2K88A 2QEXP 1Q81Q 3VMYA 1S4XA 1ZMEC 4UB6H 1SQBK 1RF0A 1SQVK 1FJKA 4H44C 2K3RA 3HD7B 4KT0J 5CJ0A 2K1AA 1FOSE 2IBZI 3H1KE 3TF5A 1VQ6P 2FXMA 2FYNC 2N9YB 3TNUB 5GTHE 1VF5B 1NH4A 1SQXD 2A06D 1AQ5A 3TGUJ 3NXSA 2BEQD 4U3FJ 4L75A 4OH8B 1Q86Q 1PGPA 2C0XA 3M91A 1NTMG 1JEKA 1CW5A 1DIPA 1T3UA 3L75D 2OTKE 1RE3A 2R44A 1PPJE 3HD7D 4H13D 5AVYB 2KB7P 4EYYQ 1SQBD 2L91A 2O01J 1FBMA 4HKZH 4ASVA 4DJGA 3BCCE 2YNYA 2IBZD 3NMDA 1L4AA 1YJWP 3ITKA 2JP3A 1FZCC 3W68A 4H0LD 3N4XA 1KYOI 4GIFA 5C39A 1LTJB 2W90A 2A45I 1KMIZ 1RQUA 1VPCA 1N7SD 1RHZB 2HYNA 3M9HA 1RY3A 1T8ZA 1LGHB 3AECC 2XDJA 3TSIA 1NGMB 1KILB 1E5WA 2I8DA 3CI9A 2NPSC 2Q6QA 3L35A 2B87B 4LGDE 2R3SA 5H2FE 3H1JG 2JR8A 4O9BA 1A02F 3E1RA 2N1TA 1FC2C 1NTKG 4K35A 1LTTC 1SQPE 1SS1A 5AW1B 2HPCA 1AVOA 2WSEH 3CX5E 3T97A 1R8EA 3CXHH 2WSCJ 2E74D 4PD4H 2HG5D 1NVOA 2KS1B 1SQXG 1OWAA 2G3AA 2ZYGA 3IAOA 1GL2B 3P8CD 1LJ2A 1JMMA 4WY4D 2CPSA 4AQRD 1YJNP 1W5CE 5CCHA 1NTMJ 3AE1C 3P32A 3H1KJ 1G2CA 2K9YA 1G1IA 5KLVD 4C7NB 5BVZA 1T2KD 2Z4EA 2M3EA 1PV3A 1L4AB 1K04A 2LXCB 2V4HA 1YTZI 3FWNA 4L76A 2OYIC 2D2CC 2H88C 5DJUB 1P84I 1URQB 3E7KA 4WY4B 1QL2A 1WT6A 3Q2YA 1NTMD 1HWTC 3L72D 1Y47A 1M56D 1SQQD 2YXRB 1EXJA 3BCCG 5KLVG 1LTSC 1LT9C 1KORA 1IFJA 1HGZA 2O1JA 3CCMP 3Q5SA 2KIKA 3CWBJ 3H1IG 3L74G 2Y0CA 3A5TA 3AE2C 4IFFA 1BCCJ 5TISH 3HE5B 1D7MA 1GZLA 2KZJA 3HRNA 3IN6A 1FAVA 1IFPA 2NRGA 2QE7H 1BDDA 2SPZA 1R5LA 1VQLP 3A0HE 3MUDC 2W27A 3VOPA 1OVVA 2P7JA 3L70G 2J59M 3VTPC 1S9KD 1L0NJ 2RH0A 4DOJA 5KAFH 4WBAA 4RESB 1KQSO 1RF1A 1BCCD 1NU1E 2B9BA 1NKNA 3HTKA 3I56P 3H32B 3D6YA 1N7SB 2M5AA 2KSJA 2KUBA 2YIUC 1NTZE 1EC5A 3L75E 4U3FD 3RK3E 1PP9G 3G6EP 4C7NA 3BRVB 3C9IA 3H1KG 2RN0A 2H89C 3M0DA 1SQVD 4B86A 4GODA 4N3YB 3L75J 1W2BO 2IYPA 3L71E 5B66H 3N7NA 1LTJC 2LR2A 3H1LJ 2PP6A 1NOHA 2Q1KA 3F89A 1VQ7P 1JM0A 1SQPK 1YBKA 1S3JA 2AEFA 1GD2E 4IFDK 1CZQA 1N73B 4AUWA 5APUA 1S5LH 3AEGC 4TT3H 2FXPA 4WY4C 2MJZA 1X8YA 1L2PA 2KZIA 3CWBG 3JCUH 4IFMA 3NTNA 5KAIE 2FFDC 2N1TC 3HUSA 4CPGA 5B5EE 2BASA 1KQFB 1N73C 1JY3N 1FDMA 1Q90D 1IK7A 1BCCE 4D6TE 1IK9A 2QSIA 1IC2A 2NPSA 4HJGH 1URQA 4JBZA 2K37A 2P1JA 4A7PA 5GTIH 2ZAEB 2FYNB 2ZYDA 1GU5A 1J1EC 3D6ZA 1HJ0A 4JF7A 2OYHB 1L0LE 4N6JA 1KILE 1OMIA 1OW6A 2A45G 2YMYA 4Z1MH 1M1KQ 3S4RA 1RE4C 2KXPB 2IBZE 3VN0A 3S1KA 3H1HE 3CCSP 1N7SC 3A7OA 3L71D 1SQPJ 1N8RQ 2FY8A 1X22A 3V2QA 3TYYA 4EOTA 3CPWO 1VF5D 2BEZF 4XA4A 1N86A 2AEJA 2I1KA 3Q3DA 1GL2A 2WMMA 3SWYA 2QJYC 4R4MA 1KZUB 1ZRTE 2PAJA 1QLED 2G8YA 2RKLA 3L71J 2IDBA 2WPVB 1FU1A 1L0LK 1LWUB 2WSEJ 3KPEA 1AQTA 3L72E 4IL6X 4IL6E 4QMAA 1SQQE 3TGUE 3CMAP 1VQ5P 1K05A 3IFMA 1SLQA 1SQQG 1YI2P 2QJYB 2PFXA 1KILA 2DW3A 3MIWA 3WUUA 1RE4A 1RH5B 2B87A 2AXTH 3H1LE 4PD4D 3HUSB 4WVZA 5APQA 1GMJA 3CCVP 3CXHD 5AW6B 3AE4C 1NTKD 1Q2NA 3IR9A 3G71P 2E75C 3II6A 1KC8Q 1NTMK 3SWFA 5AW3B 1LTGC 1KD1Q 4ZNCA 1J1DC 3H1HG 1JY2N 4C7RA 1EDKA 1Q82Q 2R32A 3JC22 3AEBC 2KNCA 4I2LC 5CBNA 1CI6A 1WRGA 2N9BA 1ZLLA 1BSHA 1M90Q 1SQBG 1BGYG 2GA1A 1LT9B 1YQ4C 1KB9E 2FYUJ 1T2KC 5KLIC 1GW4A 1L0ND 1T3JA 1ZP0C 3A0BE 1MV8A 1SQXJ 3CX5I 4XFJA 3WU2E 5BU8B 2FFDB 3IF4A 1KFNA 1G2CB 1Y8AA 2QJPB 1OFCX 3EWKA 1X0TA 3B5ND 5GTIE 3I55P 1PPJD 1T6AA 1H0TB 1HTLC 3QWOC 3RBZA 1KQLA 3HUSC 3AE6C 1OXZA 3QH9A 4W80A 5E79E 2FFDA 3G4SP 2E75B 2JEEA 3P8MC 5KLIB 1ZOYC 1X79B 3L36A 3M0DC 3AEAC 4GOEA 1FDIA 3K5BA 1EDJA 2YO2A 2PRRA 1EQ7A 3CWBD 3CXHE 3RK3B 3U59A 2KSEA 1BE3D 1PP9E 1GTWA 3G3ZA 3H1JE 3A3YB 4PV1C 3VYIA 1AJYA 1N73A 2K9JB 1LWUC 1NWQA 2OARA 1LT1A 1S72P 2E75D 2WPQA 2FYUK 4RJTA 1H88A 1HBWA 4WWIA 2YIUB 4IL6H 2P67A 4I7ZC 2HODB 3CCJP 4DZOA 4MN4C 4LC1A 3FXDA 2HLOA 2N1TD 2O01N 1IFIA 1PFIA 1MFZA 3OA7A 2XV5A 2OYHC 4JYCA 2M3BA 2QJPC 1OW7A 4Y99B 4U3FG 1SQVE 4OWFA 3ZDMA 3EQ2A 1M1JB 2J58A 5DJTB 5GTHH 2E74C 5APXA 3RL0g 3WUVA 1KN7A 2M0BA 2O3JA 3MUDA 4GDOA 2WVRA 1NKZB 1FZGA 2RMZA 2ZVNB 2KS1A 1PPJG 1OVUA 2OGUA 3CCRP 2H43A 2KNCB 5CJ4A 3CCEP 3LW5J 2KLVA 3TNUA 1MKMA 1GK4A 2MKVA 2XNDH 3AE7C 2OYIB 1LT9A 2IBZG 4H44B 5AVZB 2P58A 2QA4P 1ZXGA 2QM7A 2WQYC 3T97B 1GL2D 5E79H
chains in the Genus database with same CATH topology
5CCHC 1L0NK 4I1LA 3KYQA 1CSBA 1L4AD 3H6PA 3O8ZA 3OAKA 3V2RA 3HE4B 1IFMA 2WWWA 5AVQB 3M0AA 1G1JA 2Q3IA 4WB4A 4HH2A 3H32A 1JUNA 1KILC 3HTKB 1JCDA 4ZKPA 1JCCA 3NFQA 2XU6A 5AW7B 2O01H 1JY2O 1XTGB 2IFMA 1LTAC 2FKWB 1VDFA 3VMXA 1GW3A 5APYA 1L4AC 3M9QA 1J1EB 3R2PA 1JY3P 3BVHA 1RE3C 5CCHD 4AYCA 1GL2C 2WPRA 5AW9B 2FYZA 2Z5IA 3VP8A 1URQC 5CCGC 1N7SA 2XNXA 1GU4A 1A02J 1ZV8A 3LIEA 1RF0C 2YKOA 2Q7CA 2P2UA 2WTYA 1SQXK 3V4QA 3GHGC 1NHLA 4EIJA 2ZXEB 1JY3O 1RF1B 1GDTA 3B5NB 3OJAB 2NPSB 2W6AA 4W7ZA 2WSFH 5AVSB 5AVTB 1QL1A 5AVWB 3KDPB 3BATA 2WZ7A 4N78D 3VP9A 1SQQK 2R3CA 1FZCB 3LW5H 2NPSD 3CL3D 5APTA 1LTJA 3P8CE 1JO5A 1JOCA 5KJ7C 3B8EB 2O1KA 5AVRB 1IJDB 2M8RA 4ZKUA 4I6MC 1IO4A 2HFED 2ZFCA 1ZR4A 1RF1C 3V2PA 2L5GB 2Q9IA 5AW0B 3UIAA 2OYHA 3P7KA 1NU1K 1LTIC 2R5DA 3V2NA 3L37A 2LKMA 5KJ7D 2GM4A 2I1JA 2GUVA 1HGVA 4JYBA 3RK2D 2OYIA 1MUUA 3TK1A 3RL0D 2H8PD 2YO3A 2Q5UA 3RK3D 1FZFA 3RL0C 3CLQA 1MZ9A 4M3LA 5AVVB 1YYCA 3EFGA 3RK2C 1ZR2A 3A2AA 1HUCA 1SFCD 2WPSA 2XKMA 1N7LA 3RL0B 3M9BA 1AFOA 2WITA 2N1TB 5AW2B 2H7HA 2HODA 4XE5B 3MTUE 1S9KE 5APSA 3GHGB 5CCGA 1FZCA 1FJPA 3HE5A 3M06A 5CMZA 3B5NA 2YKPA 1SVFA 2YKQA 1JTHA 5KTBA 1KFMA 1NAFA 3U1CA 1FZAA 3B5NC 4HYTB 2VRSA 1LTBC 5CHXA 1HVVA 1X9VA 3L4FA 1HH0A 1KILD 2KP8A 2Z5HA 2C9LY 2QM8A 2E42A 2WT7A 3HD7A 4N78E 3KQGA 5BU5A 2KOGA 4KHXA 1H8AA 3PP5A 1J1DB 4Y99C 1NTZK 4GT1A 1H89A 2E43A 2CPBA 2C9NY 4WY4A 2IFNA 5APVA 1NO4A 3WMM0 5CCGD 1DX7A 3I5CA 1URQD 1YTZT 1SP4A 2W6BA 4C46A 4GKGA 2JJLA 3BRTB 1SFCC 1ZN5A 5AW8B 3MD0A 2GUSA 1DH3A 1FOSF 3BASA 1M1JA 4LLHA 1FZEA 1GK6A 3HE4A 2XZRA 2A45H 1CI6B 2HPCB 1JTHB 1SFCA 4W7YA 5AVUB 1LWUA 1W2EA 2IX7C 1N2DC 5AW4B 1XTCC 1M1JC 3U1AA 2POHA 2R5BA 2WT7B 3MGNA 5KJ7A 2C0WA 3V5BA 1M7LA 1JNMA 3RK2B 1FZBA 3VMZA 1JY2P 5AVXB 1IFNA 2IPPA 1DEBA 1IFDA 3HD7C 3V4WA 3E1IA 2KYVA 3LIDA 5APWA 3RK3C 1NTKK 1HJBA 2WSCH 1Z56A 3GHGA 1SFCB 1J2JB 3VMYA 1SQBK 1RF0A 1SQVK 1FJKA 3HD7B 5CJ0A 1FOSE 2FXMA 3TNUB 1NH4A 1AQ5A 3NXSA 4OH8B 2C0XA 3M91A 1CW5A 1T3UA 3HD7D 1RE3A 5AVYB 2KB7P 1FBMA 2YNYA 3NMDA 1L4AA 1FZCC 3N4XA 4GIFA 1LTJB 2A45I 1VPCA 1N7SD 3M9HA 2HYNA 1RY3A 1T8ZA 1LGHB 2XDJA 3TSIA 1KILB 3L35A 1E5WA 3CI9A 2NPSC 4LGDE 1A02F 4O9BA 2N1TA 1LTTC 5AW1B 2HPCA 2WSEH 3T97A 2HG5D 1OWAA 3P8CD 4WY4D 1N73A 1GL2B 1JMMA 2CPSA 4AQRD 5CCHA 3P32A 2Z4EA 4C7NB 1G2CA 1G1IA 5BVZA 1T2KD 1L4AB 1YTZI 2OYIC 1URQB 4WY4B 1HWTC 1QL2A 1WT6A 1LTSC 1LT9C 1IFJA 1HGZA 2O1JA 3A5TA 4IFFA 3HE5B 1GZLA 3HRNA 1FAVA 3VOPA 2W27A 2P7JA 2J59M 3VTPC 1S9KD 4DOJA 4WBAA 4RESB 1RF1A 1NKNA 3HTKA 3H32B 1N7SB 2KSJA 4C7NA 3BRVB 3C9IA 3M0DA 4B86A 4N3YB 3N7NA 1LTJC 2PP6A 1NOHA 1SQPK 1GD2E 4IFDK 1CZQA 1N73B 4AUWA 5APUA 4WY4C 2MJZA 1X8YA 4IFMA 3NTNA 2FFDC 2N1TC 3HUSA 2BASA 1N73C 1JY3N 1FDMA 1IK9A 5KLVK 1IC2A 2NPSA 1URQA 2P1JA 1GU5A 1J1EC 4JF7A 2OYHB 4N6JA 2A45G 2YMYA 1RE4C 3VN0A 1N7SC 3A7OA 3V2QA 3TYYA 4EOTA 4XA4A 1N86A 2I1KA 1GL2A 3SWYA 1KZUB 2PAJA 1FU1A 1L0LK 1LWUB 3KPEA 5AVZB 5AW5B 3IFMA 1SLQA 1KILA 3MIWA 1RE4A 3HUSB 5APQA 5AW6B 3IR9A 3II6A 1NTMK 3SWFA 5AW3B 1LTGC 1J1DC 1JY2N 4C7RA 2R32A 4I2LC 1CI6A 1WRGA 2N9BA 1ZLLA 1LT9B 1T2KC 1GW4A 1T3JA 2FFDB 1MV8A 5BU8B 1KFNA 1G2CB 3B5ND 1HTLC 1KQLA 3HUSC 2FFDA 1OXZA 4W80A 2JEEA 3P8MC 1X79B 3L36A 3M0DC 2YO2A 1EQ7A 3RK3B 3U59A 1GTWA 3G3ZA 3A3YB 3VYIA 1LWUC 1NWQA 2OARA 2WPQA 2FYUK 1H88A 1HBWA 2P67A 2HODB 4DZOA 4LC1A 2HLOA 2N1TD 1IFIA 1PFIA 1MFZA 3OA7A 2XV5A 2OYHC 4JYCA 2M3BA 4Y99B 3EQ2A 1M1JB 2J58A 5APXA 3MUDA 1NKZB 1FZGA 2H43A 2KLVA 3TNUA 1GK4A 2OYIB 1LT9A 2QM7A 5CJ4A 1GL2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKO A;  2W6B A;  3BRV B;  3CL3 D;  2YKP A;  2YKQ A;  3EQ2 A;  3L4F A;  1JOC A;  3BRT B; 
#chains in the Genus database with same CATH topology
 1HF9 A;  5CCH C;  2D2C B;  2E5T A;  3F5H A;  1QEX A;  3FXE A;  1L0N K;  2K9J A;  3CC4 P;  4I1L A;  3KYQ A;  4L74 A;  1K73 Q;  3OW2 O;  1CSB A;  3PJS K;  1L4A D;  1YIJ P;  2QJK B;  2ZVO B;  1L0L D;  1IO4 A;  1P84 D;  3H6P A;  1PGO A;  2ITA A;  3O8Z A;  3OAK A;  3V2R A;  1VQP P;  1ZW0 A;  2AXC A;  1S1C X;  2WSF J;  3HE4 B;  1Q7Y Q;  4H13 C;  1IFM A;  2WWW A;  2BCC D;  5AVQ B;  3W67 A;  3M0A A;  3EFF K;  3C8V A;  2JKV A;  4I7Z B;  1QVG O;  1KYO D;  1SQP D;  4DCK A;  3H1I D;  1G1J A;  1NTZ D;  2Q3I A;  4DT0 A;  4NPE A;  3WU2 H;  4JPZ B;  4WB4 A;  2OTL P;  3GF7 A;  3H32 A;  4HH2 A;  1EDL A;  1JUN A;  1KIL C;  3HTK B;  3PTZ A;  3B71 A;  1JCD A;  5EFW B;  1KQG B;  1SQV J;  2JO1 A;  1YHQ P;  3AEE C;  2QVA A;  1M57 D;  4ZKP A;  1JCC A;  3NFQ A;  2XU6 A;  1LP1 A;  1VQ4 P;  4UB8 H;  1NTZ G;  5AW7 B;  3AE5 C;  2O01 H;  3L70 E;  1JY2 O;  5KLV J;  1USE A;  1XTG B;  2IFM A;  1LTA C;  1USD A;  3B4S A;  3MP7 B;  2FKW B;  4NPF X;  3KXD A;  1VDF A;  3VMX A;  1GW3 A;  5APY A;  1L4A C;  1NU1 J;  1FS0 E;  2B88 A;  2Y9Z A;  3M9Q A;  1J1E B;  1AA0 A;  2BCC E;  1K9M Q;  3R2P A;  1JY3 P;  1KB9 D;  2Y9Y A;  4IOI H;  1RE3 C;  2A06 E;  3BVH A;  1AV1 A;  2OTJ P;  5CCH D;  4AYC A;  2WSS H;  1GL2 C;  2WPR A;  3G9R A;  1L0N G;  5AW9 B;  2W83 C;  5M1B A;  5TIS E;  2KK7 A;  2FYZ A;  3L72 J;  2QG4 A;  1RQV A;  1U7M A;  2Z5I A;  3GLM A;  3VP8 A;  1URQ C;  3O6Q A;  5CCG C;  1N7S A;  2XNX A;  3ABV C;  3TDK A;  3Q5P A;  2D2C D;  1GU4 A;  1A02 J;  3CC2 P;  1ZV8 A;  3LIE A;  3CCL P;  1KTM A;  1RF0 C;  3JCU E;  1KB9 I;  2YKO A;  2Q7C A;  5KAI H;  2P2U A;  2WTY A;  1SQX K;  1S5L E;  3V4Q A;  3CWB E;  3GHG C;  1NYH A;  5K5G B;  3AE8 C;  1NHL A;  1UIX A;  2ZXE B;  1JY3 O;  3BCC J;  4EIJ A;  1RF1 B;  1GDT A;  3B5N B;  2CK3 H;  3OJA B;  2NPS B;  2W6A A;  4W7Z A;  3L74 J;  1VQK P;  2WSF H;  1EZV G;  5AVS B;  5AVT B;  1EZV E;  1MFT A;  1QL1 A;  3GG2 A;  4OGQ C;  5AVW B;  3KDP B;  3BAT A;  3H1L D;  2WZ7 A;  4N78 D;  4PD4 E;  4U7J A;  3VP9 A;  1SQQ K;  2R3C A;  3CXH I;  1DEE G;  1FZC B;  3L74 D;  3PLN A;  3LW5 H;  2AXT E;  4OVN F;  3VMA A;  1K8A Q;  2JWD A;  2NPS D;  3CL3 D;  5APT A;  4R4L A;  1LTJ A;  1OW8 A;  3P8C E;  1JO5 A;  2E5Y A;  1JOC A;  5KJ7 C;  3D70 A;  1VQ9 P;  1PZQ A;  3B8E B;  2O1K A;  1S5L X;  5AVR B;  4D6T D;  2Y0E A;  3O6Q B;  1IJD B;  2BCC J;  3CX5 D;  1PP9 J;  4HB1 A;  4PJ0 E;  2FYU D;  2M8R A;  4H0L C;  4ZKU A;  4I6M C;  4U3F E;  4UB8 E;  2ZYA A;  3H1L G;  1DD4 A;  2HFE D;  2ZFC A;  3GW6 A;  5AW5 B;  3V2P A;  1ZR4 A;  1NTM E;  1RF1 C;  2KLU A;  5TJH A;  5KKZ C;  2L5G B;  2Q9I A;  5AW0 B;  1PL5 A;  3UIA A;  2OYH A;  3A0H H;  3P7K A;  1NU1 K;  3AE9 C;  1LTI C;  2R5D A;  4UB6 E;  3V2N A;  2JDI H;  3L37 A;  2E76 D;  2LKM A;  5KJ7 D;  2GM4 A;  4KJM A;  2I1J A;  1NTK J;  1LP1 B;  1BCC G;  2GUV A;  1HGV A;  1M8O B;  4JYB A;  4H44 D;  2QJK C;  1DD3 A;  3MZW B;  3USS A;  3TGU D;  4Y28 J;  1SQX E;  3RK2 D;  3H1H J;  3L70 J;  2OYI A;  1QVF O;  4OGQ D;  1MUU A;  2E76 B;  4EDF A;  3TK1 A;  2ZT9 D;  1SQB J;  3RL0 D;  2H8P D;  3SWK A;  1SQP G;  2Q5U A;  2YO3 A;  1FE6 A;  3RK3 D;  1FZF A;  1BE3 G;  1OX3 A;  2ZJS E;  1SQB E;  1R5S A;  3RL0 C;  3BCC D;  3CLQ A;  3H1H D;  3SFD C;  4D6T G;  1MZ9 A;  2QRX A;  4M3L A;  4L73 A;  5AVV B;  4BXL A;  1YYC A;  1VF5 C;  3EFG A;  3RK2 C;  3L75 G;  1ZR2 A;  3A2A A;  1HUC A;  1SFC D;  2WPS A;  2XKM A;  3L71 G;  1N7L A;  1TU3 F;  3RL0 B;  2E74 B;  1VQO P;  3M9B A;  1AFO A;  2WIT A;  2N1T B;  5AW2 B;  3CX5 H;  1SQQ J;  2H7H A;  1UII A;  3JSV C;  3D71 A;  4PV1 D;  2HOD A;  4XE5 B;  3V6I A;  3MTU E;  1S9K E;  5APS A;  3GHG B;  1JB0 J;  5B66 E;  5CCG A;  3FX0 A;  3HE5 A;  3M06 A;  1FZC A;  1FJP A;  1EZV D;  5CMZ A;  4YXW H;  1KV4 A;  3Q5R A;  3B5N A;  3C1L A;  3CD6 P;  3KZI H;  2YKP A;  1SVF A;  2YKQ A;  4YXD C;  2IZ1 A;  3L73 E;  1JTH A;  2W6J H;  1NU1 G;  3GF3 A;  3L73 G;  1U57 A;  1NAY A;  4H13 B;  3S9O A;  5KTB A;  1KFM A;  2UWJ E;  3L74 E;  3TGU G;  4PV1 B;  1NAF A;  3U1C A;  1BGY J;  1FZA A;  4K3A A;  3B5N C;  3CCU P;  3H1K D;  5L8R J;  4H0L B;  1BDC A;  4HYT B;  2VRS A;  1LTB C;  2M5A B;  5CHX A;  1YJ9 P;  3L72 G;  1NJI Q;  3PHL A;  1L0L G;  5KLV E;  1KYO E;  2JWA A;  4BWN A;  1HVV A;  1X9V A;  3L4F A;  3H1I E;  1BGY D;  1VQN P;  2Y0D A;  3PH0 A;  1HH0 A;  1KIL D;  2OYO A;  2KP8 A;  2Z5H A;  2C9L Y;  2QM8 A;  4YTP C;  2E42 A;  1OIP A;  2WT7 A;  4OGQ B;  1E79 H;  4TLF A;  2ZXX A;  3RGU A;  2W8Z A;  3HD7 A;  2J5U A;  2ZT9 B;  3KQG A;  4N78 E;  1IZN B;  3H1J J;  4ASW A;  5BU5 A;  2KOG A;  1YIT P;  3WUT A;  1YQ3 C;  3KHU A;  4KHX A;  1H8A A;  1VL2 A;  3CC7 P;  3PP5 A;  1J1D B;  1KB9 H;  4NPD A;  2V7Q H;  4Y99 C;  2NZ2 A;  2P10 A;  1NTZ K;  5KLV K;  3CCQ P;  1VQM P;  4GT1 A;  1H89 A;  2E43 A;  2CPB A;  5H2F H;  3Q1M A;  2C9N Y;  1EZV I;  2OQQ A;  4EI2 A;  4WY4 A;  1NU1 D;  3L73 J;  3RBX A;  2IFN A;  2Q3E A;  5APV A;  1H0T A;  4PD4 I;  1NO4 A;  3WMM 0;  1NTK E;  3PRJ A;  5CCG D;  1BGY E;  1ZRT D;  3I5C A;  1URQ D;  2FYU G;  3H25 A;  1DX7 A;  1JMB A;  1YTZ T;  1P84 E;  3GMA A;  1SP4 A;  2W6B A;  3R4Y A;  2AEM A;  4JQ0 D;  4BRY A;  4GKG A;  4C46 A;  1Y9B A;  2BCC G;  1L0L J;  2FXO A;  1AVY A;  3FWL A;  5KAF E;  2KI7 B;  2JJL A;  3BRT B;  1SFC C;  1ZN5 A;  5AW8 B;  3MD0 A;  2GUS A;  1L0N E;  1PGQ A;  5CBO A;  2IYO A;  3BAS A;  1DH3 A;  1M1J A;  1FOS F;  2FBW C;  1FZE A;  1GK6 A;  2XZR A;  3HE4 A;  2A45 H;  4LLH A;  1SQV G;  1CI6 B;  4PJ0 H;  1KYO H;  3AE3 C;  1PIX A;  3H1I J;  1OVR A;  2HPC B;  3SSU A;  1JTH B;  2A06 G;  1NTZ J;  2YMK A;  2ZT9 C;  4RO0 A;  1VQ8 P;  1SFC A;  4W7Y A;  4ZMD A;  1EXI A;  5AVU B;  1LWU A;  1W2E A;  1P84 H;  2IX7 C;  1N2D C;  5AW4 B;  1XTC C;  3L70 D;  1M1J C;  3U1A A;  2POH A;  1OZH A;  2R5B A;  2YXQ B;  4YPC A;  2WT7 B;  3KZI E;  3MGN A;  1QGK B;  3MHV A;  2E76 C;  2PGD A;  5KJ7 A;  2C0W A;  3V5B A;  3FGA D;  1M7L A;  1S2E A;  1JNM A;  2B89 A;  4RKU J;  2IZ0 A;  3RK2 B;  1BE3 J;  4GOF A;  4BRY B;  1FZB A;  1LNQ A;  3VMZ A;  1JY2 P;  4D6T J;  2FYU E;  1IFN A;  5AVX B;  1BE3 E;  1DEB A;  1PP9 D;  2IPP A;  1QX8 A;  3H1J D;  3AEF C;  1EDI A;  3A0B H;  3SFE C;  1IFD A;  3HD7 C;  1PGJ A;  3V4W A;  3CME P;  3E1I A;  2KYV A;  2HR3 A;  3LID A;  5APW A;  2V7Q J;  2LXB A;  3RK3 C;  1NTK K;  5B5E H;  1HJB A;  1WMK A;  1U7J A;  2WSC H;  2QIW A;  1Z56 A;  3L73 D;  5KKZ B;  3GHG A;  3AED C;  1SFC B;  1J2J B;  1FDO A;  1BSN A;  2K88 A;  2QEX P;  1Q81 Q;  3VMY A;  1S4X A;  1ZME C;  4UB6 H;  1SQB K;  1RF0 A;  1SQV K;  1FJK A;  4H44 C;  2K3R A;  3HD7 B;  4KT0 J;  5CJ0 A;  2K1A A;  1FOS E;  2IBZ I;  3H1K E;  3TF5 A;  1VQ6 P;  2FXM A;  2FYN C;  2N9Y B;  3TNU B;  5GTH E;  1VF5 B;  1NH4 A;  1SQX D;  2A06 D;  1AQ5 A;  3TGU J;  3NXS A;  2BEQ D;  4U3F J;  4L75 A;  4OH8 B;  1Q86 Q;  1PGP A;  2C0X A;  3M91 A;  1NTM G;  1JEK A;  1CW5 A;  1DIP A;  1T3U A;  3L75 D;  2OTK E;  1RE3 A;  2R44 A;  1PPJ E;  3HD7 D;  4H13 D;  5AVY B;  2KB7 P;  4EYY Q;  1SQB D;  2L91 A;  2O01 J;  1FBM A;  4HKZ H;  4ASV A;  4DJG A;  3BCC E;  2YNY A;  2IBZ D;  3NMD A;  1L4A A;  1YJW P;  3ITK A;  2JP3 A;  1FZC C;  3W68 A;  4H0L D;  3N4X A;  1KYO I;  4GIF A;  5C39 A;  1LTJ B;  2W90 A;  2A45 I;  1KMI Z;  1RQU A;  1VPC A;  1N7S D;  1RHZ B;  2HYN A;  3M9H A;  1RY3 A;  1T8Z A;  1LGH B;  3AEC C;  2XDJ A;  3TSI A;  1NGM B;  1KIL B;  1E5W A;  2I8D A;  3CI9 A;  2NPS C;  2Q6Q A;  3L35 A;  2B87 B;  4LGD E;  2R3S A;  5H2F E;  3H1J G;  2JR8 A;  4O9B A;  1A02 F;  3E1R A;  2N1T A;  1FC2 C;  1NTK G;  4K35 A;  1LTT C;  1SQP E;  1SS1 A;  5AW1 B;  2HPC A;  1AVO A;  2WSE H;  3CX5 E;  3T97 A;  1R8E A;  3CXH H;  2WSC J;  2E74 D;  4PD4 H;  2HG5 D;  1NVO A;  2KS1 B;  1SQX G;  1OWA A;  2G3A A;  2ZYG A;  3IAO A;  1GL2 B;  3P8C D;  1LJ2 A;  1JMM A;  4WY4 D;  2CPS A;  4AQR D;  1YJN P;  1W5C E;  5CCH A;  1NTM J;  3AE1 C;  3P32 A;  3H1K J;  1G2C A;  2K9Y A;  1G1I A;  5KLV D;  4C7N B;  5BVZ A;  1T2K D;  2Z4E A;  2M3E A;  1PV3 A;  1L4A B;  1K04 A;  2LXC B;  2V4H A;  1YTZ I;  3FWN A;  4L76 A;  2OYI C;  2D2C C;  2H88 C;  5DJU B;  1P84 I;  1URQ B;  3E7K A;  4WY4 B;  1QL2 A;  1WT6 A;  3Q2Y A;  1NTM D;  1HWT C;  3L72 D;  1Y47 A;  1M56 D;  1SQQ D;  2YXR B;  1EXJ A;  3BCC G;  5KLV G;  1LTS C;  1LT9 C;  1KOR A;  1IFJ A;  1HGZ A;  2O1J A;  3CCM P;  3Q5S A;  2KIK A;  3CWB J;  3H1I G;  3L74 G;  2Y0C A;  3A5T A;  3AE2 C;  4IFF A;  1BCC J;  5TIS H;  3HE5 B;  1D7M A;  1GZL A;  2KZJ A;  3HRN A;  3IN6 A;  1FAV A;  1IFP A;  2NRG A;  2QE7 H;  1BDD A;  2SPZ A;  1R5L A;  1VQL P;  3A0H E;  3MUD C;  2W27 A;  3VOP A;  1OVV A;  2P7J A;  3L70 G;  2J59 M;  3VTP C;  1S9K D;  1L0N J;  2RH0 A;  4DOJ A;  5KAF H;  4WBA A;  4RES B;  1KQS O;  1RF1 A;  1BCC D;  1NU1 E;  2B9B A;  1NKN A;  3HTK A;  3I56 P;  3H32 B;  3D6Y A;  1N7S B;  2M5A A;  2KSJ A;  2KUB A;  2YIU C;  1NTZ E;  1EC5 A;  3L75 E;  4U3F D;  3RK3 E;  1PP9 G;  3G6E P;  4C7N A;  3BRV B;  3C9I A;  3H1K G;  2RN0 A;  2H89 C;  3M0D A;  1SQV D;  4B86 A;  4GOD A;  4N3Y B;  3L75 J;  1W2B O;  2IYP A;  3L71 E;  5B66 H;  3N7N A;  1LTJ C;  2LR2 A;  3H1L J;  2PP6 A;  1NOH A;  2Q1K A;  3F89 A;  1VQ7 P;  1JM0 A;  1SQP K;  1YBK A;  1S3J A;  2AEF A;  1GD2 E;  4IFD K;  1CZQ A;  1N73 B;  4AUW A;  5APU A;  1S5L H;  3AEG C;  4TT3 H;  2FXP A;  4WY4 C;  2MJZ A;  1X8Y A;  1L2P A;  2KZI A;  3CWB G;  3JCU H;  4IFM A;  3NTN A;  5KAI E;  2FFD C;  2N1T C;  3HUS A;  4CPG A;  5B5E E;  2BAS A;  1KQF B;  1N73 C;  1JY3 N;  1FDM A;  1Q90 D;  1IK7 A;  1BCC E;  4D6T E;  1IK9 A;  2QSI A;  1IC2 A;  2NPS A;  4HJG H;  1URQ A;  4JBZ A;  2K37 A;  2P1J A;  4A7P A;  5GTI H;  2ZAE B;  2FYN B;  2ZYD A;  1GU5 A;  1J1E C;  3D6Z A;  1HJ0 A;  4JF7 A;  2OYH B;  1L0L E;  4N6J A;  1KIL E;  1OMI A;  1OW6 A;  2A45 G;  2YMY A;  4Z1M H;  1M1K Q;  3S4R A;  1RE4 C;  2KXP B;  2IBZ E;  3VN0 A;  3S1K A;  3H1H E;  3CCS P;  1N7S C;  3A7O A;  3L71 D;  1SQP J;  1N8R Q;  2FY8 A;  1X22 A;  3V2Q A;  3TYY A;  4EOT A;  3CPW O;  1VF5 D;  2BEZ F;  4XA4 A;  1N86 A;  2AEJ A;  2I1K A;  3Q3D A;  1GL2 A;  2WMM A;  3SWY A;  2QJY C;  4R4M A;  1KZU B;  1ZRT E;  2PAJ A;  1QLE D;  2G8Y A;  2RKL A;  3L71 J;  2IDB A;  2WPV B;  1FU1 A;  1L0L K;  1LWU B;  2WSE J;  3KPE A;  1AQT A;  3L72 E;  4IL6 X;  4IL6 E;  4QMA A;  1SQQ E;  3TGU E;  3CMA P;  1VQ5 P;  1K05 A;  3IFM A;  1SLQ A;  1SQQ G;  1YI2 P;  2QJY B;  2PFX A;  1KIL A;  2DW3 A;  3MIW A;  3WUU A;  1RE4 A;  1RH5 B;  2B87 A;  2AXT H;  3H1L E;  4PD4 D;  3HUS B;  4WVZ A;  5APQ A;  1GMJ A;  3CCV P;  3CXH D;  5AW6 B;  3AE4 C;  1NTK D;  1Q2N A;  3IR9 A;  3G71 P;  2E75 C;  3II6 A;  1KC8 Q;  1NTM K;  3SWF A;  5AW3 B;  1LTG C;  1KD1 Q;  4ZNC A;  1J1D C;  3H1H G;  1JY2 N;  4C7R A;  1EDK A;  1Q82 Q;  2R32 A;  3JC2 2;  3AEB C;  2KNC A;  4I2L C;  5CBN A;  1CI6 A;  1WRG A;  2N9B A;  1ZLL A;  1BSH A;  1M90 Q;  1SQB G;  1BGY G;  2GA1 A;  1LT9 B;  1YQ4 C;  1KB9 E;  2FYU J;  1T2K C;  5KLI C;  1GW4 A;  1L0N D;  1T3J A;  1ZP0 C;  3A0B E;  1MV8 A;  1SQX J;  3CX5 I;  4XFJ A;  3WU2 E;  5BU8 B;  2FFD B;  3IF4 A;  1KFN A;  1G2C B;  1Y8A A;  2QJP B;  1OFC X;  3EWK A;  1X0T A;  3B5N D;  5GTI E;  3I55 P;  1PPJ D;  1T6A A;  1H0T B;  1HTL C;  3QWO C;  3RBZ A;  1KQL A;  3HUS C;  3AE6 C;  1OXZ A;  3QH9 A;  4W80 A;  5E79 E;  2FFD A;  3G4S P;  2E75 B;  2JEE A;  3P8M C;  5KLI B;  1ZOY C;  1X79 B;  3L36 A;  3M0D C;  3AEA C;  4GOE A;  1FDI A;  3K5B A;  1EDJ A;  2YO2 A;  2PRR A;  1EQ7 A;  3CWB D;  3CXH E;  3RK3 B;  3U59 A;  2KSE A;  1BE3 D;  1PP9 E;  1GTW A;  3G3Z A;  3H1J E;  3A3Y B;  4PV1 C;  3VYI A;  1AJY A;  1N73 A;  2K9J B;  1LWU C;  1NWQ A;  2OAR A;  1LT1 A;  1S72 P;  2E75 D;  2WPQ A;  2FYU K;  4RJT A;  1H88 A;  1HBW A;  4WWI A;  2YIU B;  4IL6 H;  2P67 A;  4I7Z C;  2HOD B;  3CCJ P;  4DZO A;  4MN4 C;  4LC1 A;  3FXD A;  2HLO A;  2N1T D;  2O01 N;  1IFI A;  1PFI A;  1MFZ A;  3OA7 A;  2XV5 A;  2OYH C;  4JYC A;  2M3B A;  2QJP C;  1OW7 A;  4Y99 B;  4U3F G;  1SQV E;  4OWF A;  3ZDM A;  3EQ2 A;  1M1J B;  2J58 A;  5DJT B;  5GTH H;  2E74 C;  5APX A;  3RL0 g;  3WUV A;  1KN7 A;  2M0B A;  2O3J A;  3MUD A;  4GDO A;  2WVR A;  1NKZ B;  1FZG A;  2RMZ A;  2ZVN B;  2KS1 A;  1PPJ G;  1OVU A;  2OGU A;  3CCR P;  2H43 A;  2KNC B;  5CJ4 A;  3CCE P;  3LW5 J;  2KLV A;  3TNU A;  1MKM A;  1GK4 A;  2MKV A;  2XND H;  3AE7 C;  2OYI B;  1LT9 A;  2IBZ G;  4H44 B;  5AVZ B;  2P58 A;  2QA4 P;  1ZXG A;  2QM7 A;  2WQY C;  3T97 B;  1GL2 D;  5E79 H; 
#chains in the Genus database with same CATH homology
 5CCH C;  1L0N K;  4I1L A;  3KYQ A;  1CSB A;  1L4A D;  3H6P A;  3O8Z A;  3OAK A;  3V2R A;  3HE4 B;  1IFM A;  2WWW A;  5AVQ B;  3M0A A;  1G1J A;  2Q3I A;  4WB4 A;  4HH2 A;  3H32 A;  1JUN A;  1KIL C;  3HTK B;  1JCD A;  4ZKP A;  1JCC A;  3NFQ A;  2XU6 A;  5AW7 B;  2O01 H;  1JY2 O;  1XTG B;  2IFM A;  1LTA C;  2FKW B;  1VDF A;  3VMX A;  1GW3 A;  5APY A;  1L4A C;  3M9Q A;  1J1E B;  3R2P A;  1JY3 P;  3BVH A;  1RE3 C;  5CCH D;  4AYC A;  1GL2 C;  2WPR A;  5AW9 B;  2FYZ A;  2Z5I A;  3VP8 A;  1URQ C;  5CCG C;  1N7S A;  2XNX A;  1GU4 A;  1A02 J;  1ZV8 A;  3LIE A;  1RF0 C;  2YKO A;  2Q7C A;  2P2U A;  2WTY A;  1SQX K;  3V4Q A;  3GHG C;  1NHL A;  4EIJ A;  2ZXE B;  1JY3 O;  1RF1 B;  1GDT A;  3B5N B;  3OJA B;  2NPS B;  2W6A A;  4W7Z A;  2WSF H;  5AVS B;  5AVT B;  1QL1 A;  5AVW B;  3KDP B;  3BAT A;  2WZ7 A;  4N78 D;  3VP9 A;  1SQQ K;  2R3C A;  1FZC B;  3LW5 H;  2NPS D;  3CL3 D;  5APT A;  1LTJ A;  3P8C E;  1JO5 A;  1JOC A;  5KJ7 C;  3B8E B;  2O1K A;  5AVR B;  1IJD B;  2M8R A;  4ZKU A;  4I6M C;  1IO4 A;  2HFE D;  2ZFC A;  1ZR4 A;  1RF1 C;  3V2P A;  2L5G B;  2Q9I A;  5AW0 B;  3UIA A;  2OYH A;  3P7K A;  1NU1 K;  1LTI C;  2R5D A;  3V2N A;  3L37 A;  2LKM A;  5KJ7 D;  2GM4 A;  2I1J A;  2GUV A;  1HGV A;  4JYB A;  3RK2 D;  2OYI A;  1MUU A;  3TK1 A;  3RL0 D;  2H8P D;  2YO3 A;  2Q5U A;  3RK3 D;  1FZF A;  3RL0 C;  3CLQ A;  1MZ9 A;  4M3L A;  5AVV B;  1YYC A;  3EFG A;  3RK2 C;  1ZR2 A;  3A2A A;  1HUC A;  1SFC D;  2WPS A;  2XKM A;  1N7L A;  3RL0 B;  3M9B A;  1AFO A;  2WIT A;  2N1T B;  5AW2 B;  2H7H A;  2HOD A;  4XE5 B;  3MTU E;  1S9K E;  5APS A;  3GHG B;  5CCG A;  1FZC A;  1FJP A;  3HE5 A;  3M06 A;  5CMZ A;  3B5N A;  2YKP A;  1SVF A;  2YKQ A;  1JTH A;  5KTB A;  1KFM A;  1NAF A;  3U1C A;  1FZA A;  3B5N C;  4HYT B;  2VRS A;  1LTB C;  5CHX A;  1HVV A;  1X9V A;  3L4F A;  1HH0 A;  1KIL D;  2KP8 A;  2Z5H A;  2C9L Y;  2QM8 A;  2E42 A;  2WT7 A;  3HD7 A;  4N78 E;  3KQG A;  5BU5 A;  2KOG A;  4KHX A;  1H8A A;  3PP5 A;  1J1D B;  4Y99 C;  1NTZ K;  4GT1 A;  1H89 A;  2E43 A;  2CPB A;  2C9N Y;  4WY4 A;  2IFN A;  5APV A;  1NO4 A;  3WMM 0;  5CCG D;  1DX7 A;  3I5C A;  1URQ D;  1YTZ T;  1SP4 A;  2W6B A;  4C46 A;  4GKG A;  2JJL A;  3BRT B;  1SFC C;  1ZN5 A;  5AW8 B;  3MD0 A;  2GUS A;  1DH3 A;  1FOS F;  3BAS A;  1M1J A;  4LLH A;  1FZE A;  1GK6 A;  3HE4 A;  2XZR A;  2A45 H;  1CI6 B;  2HPC B;  1JTH B;  1SFC A;  4W7Y A;  5AVU B;  1LWU A;  1W2E A;  2IX7 C;  1N2D C;  5AW4 B;  1XTC C;  1M1J C;  3U1A A;  2POH A;  2R5B A;  2WT7 B;  3MGN A;  5KJ7 A;  2C0W A;  3V5B A;  1M7L A;  1JNM A;  3RK2 B;  1FZB A;  3VMZ A;  1JY2 P;  5AVX B;  1IFN A;  2IPP A;  1DEB A;  1IFD A;  3HD7 C;  3V4W A;  3E1I A;  2KYV A;  3LID A;  5APW A;  3RK3 C;  1NTK K;  1HJB A;  2WSC H;  1Z56 A;  3GHG A;  1SFC B;  1J2J B;  3VMY A;  1SQB K;  1RF0 A;  1SQV K;  1FJK A;  3HD7 B;  5CJ0 A;  1FOS E;  2FXM A;  3TNU B;  1NH4 A;  1AQ5 A;  3NXS A;  4OH8 B;  2C0X A;  3M91 A;  1CW5 A;  1T3U A;  3HD7 D;  1RE3 A;  5AVY B;  2KB7 P;  1FBM A;  2YNY A;  3NMD A;  1L4A A;  1FZC C;  3N4X A;  4GIF A;  1LTJ B;  2A45 I;  1VPC A;  1N7S D;  3M9H A;  2HYN A;  1RY3 A;  1T8Z A;  1LGH B;  2XDJ A;  3TSI A;  1KIL B;  3L35 A;  1E5W A;  3CI9 A;  2NPS C;  4LGD E;  1A02 F;  4O9B A;  2N1T A;  1LTT C;  5AW1 B;  2HPC A;  2WSE H;  3T97 A;  2HG5 D;  1OWA A;  3P8C D;  4WY4 D;  1N73 A;  1GL2 B;  1JMM A;  2CPS A;  4AQR D;  5CCH A;  3P32 A;  2Z4E A;  4C7N B;  1G2C A;  1G1I A;  5BVZ A;  1T2K D;  1L4A B;  1YTZ I;  2OYI C;  1URQ B;  4WY4 B;  1HWT C;  1QL2 A;  1WT6 A;  1LTS C;  1LT9 C;  1IFJ A;  1HGZ A;  2O1J A;  3A5T A;  4IFF A;  3HE5 B;  1GZL A;  3HRN A;  1FAV A;  3VOP A;  2W27 A;  2P7J A;  2J59 M;  3VTP C;  1S9K D;  4DOJ A;  4WBA A;  4RES B;  1RF1 A;  1NKN A;  3HTK A;  3H32 B;  1N7S B;  2KSJ A;  4C7N A;  3BRV B;  3C9I A;  3M0D A;  4B86 A;  4N3Y B;  3N7N A;  1LTJ C;  2PP6 A;  1NOH A;  1SQP K;  1GD2 E;  4IFD K;  1CZQ A;  1N73 B;  4AUW A;  5APU A;  4WY4 C;  2MJZ A;  1X8Y A;  4IFM A;  3NTN A;  2FFD C;  2N1T C;  3HUS A;  2BAS A;  1N73 C;  1JY3 N;  1FDM A;  1IK9 A;  5KLV K;  1IC2 A;  2NPS A;  1URQ A;  2P1J A;  1GU5 A;  1J1E C;  4JF7 A;  2OYH B;  4N6J A;  2A45 G;  2YMY A;  1RE4 C;  3VN0 A;  1N7S C;  3A7O A;  3V2Q A;  3TYY A;  4EOT A;  4XA4 A;  1N86 A;  2I1K A;  1GL2 A;  3SWY A;  1KZU B;  2PAJ A;  1FU1 A;  1L0L K;  1LWU B;  3KPE A;  5AVZ B;  5AW5 B;  3IFM A;  1SLQ A;  1KIL A;  3MIW A;  1RE4 A;  3HUS B;  5APQ A;  5AW6 B;  3IR9 A;  3II6 A;  1NTM K;  3SWF A;  5AW3 B;  1LTG C;  1J1D C;  1JY2 N;  4C7R A;  2R32 A;  4I2L C;  1CI6 A;  1WRG A;  2N9B A;  1ZLL A;  1LT9 B;  1T2K C;  1GW4 A;  1T3J A;  2FFD B;  1MV8 A;  5BU8 B;  1KFN A;  1G2C B;  3B5N D;  1HTL C;  1KQL A;  3HUS C;  2FFD A;  1OXZ A;  4W80 A;  2JEE A;  3P8M C;  1X79 B;  3L36 A;  3M0D C;  2YO2 A;  1EQ7 A;  3RK3 B;  3U59 A;  1GTW A;  3G3Z A;  3A3Y B;  3VYI A;  1LWU C;  1NWQ A;  2OAR A;  2WPQ A;  2FYU K;  1H88 A;  1HBW A;  2P67 A;  2HOD B;  4DZO A;  4LC1 A;  2HLO A;  2N1T D;  1IFI A;  1PFI A;  1MFZ A;  3OA7 A;  2XV5 A;  2OYH C;  4JYC A;  2M3B A;  4Y99 B;  3EQ2 A;  1M1J B;  2J58 A;  5APX A;  3MUD A;  1NKZ B;  1FZG A;  2H43 A;  2KLV A;  3TNU A;  1GK4 A;  2OYI B;  1LT9 A;  2QM7 A;  5CJ4 A;  1GL2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...