3L4FA

Crystal structure of betapix coiled-coil domain and shank pdz complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
MEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for asymmetric association of the betaPIX coiled coil and shank PDZ
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein/protein binding
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 24
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l4fA00
3L4FA 2W6BA 2YKOA 1JOCA 3CL3D 3BRVB 2YKPA 3EQ2A 3BRTB 2YKQA
chains in the Genus database with same CATH superfamily
2E76D 3TNUA 2IFNA 1GL2D 1EZVG 2P67A 2B9BA 2R5DA 3N7NA 3V4QA 3TNUB 2FYUD 3AE9C 1K8AQ 2Q7CA 1IC2A 1P84H 3O6QB 1T8ZA 1XTCC 1FJKA 1LP1B 4I7ZB 4C7NA 2N9BA 4OVNF 3O6QA 4RESB 2XDJA 1IJDB 5APXA 1SQVJ 4PJ0H 4H13B 1FAVA 1ZOYC 2WMMA 5BVZA 3Q5RA 1L0LK 1KILA 2C9LY 4KHXA 4YXDC 1N86A 1OZHA 2KXPB 1DIPA 4N3YB 1PGOA 2LKMA 1ZV8A 3MZWB 3RK2D 1FDIA 4KJMA 4WY4B 4NPDA 4QMAA 1SQXE 1LTAC 1SQQD 5KTBA 4WBAA 3AEEC 2KNCB 2ZYDA 3AEFC 2RN0A 1N73A 3KZIE 5CCGA 1MFTA 3RBZA 1PPJE 2NRGA 4EDFA 3MD0A 4PV1B 1OVVA 1R5LA 3C8VA 3AE2C 4TLFA 2BEZF 1BSNA 4DCKA 1EXJA 1EXIA 2IDBA 1BCCD 2OYOA 3L71J 1DEEG 1KORA 3B71A 3CCEP 1IFDA 1LTJA 2YIUB 3L70E 4OWFA 3VMYA 2XU6A 4UB6H 2YKPA 4DJGA 2NZ2A 1QL2A 1FDOA 1W5CE 1E79H 1YQ4C 1AQTA 1WRGA 1CZQA 3V4WA 3A3YB 3FWNA 2ZVOB 2ZT9C 1MFZA 1NTKE 5K5GB 1N2DC 1YI2P 2PAJA 3GF3A 3LW5J 4C7NB 1GU5A 5APTA 2RMZA 2A45I 2BCCE 5APWA 1FZCC 5DJUB 5L8RJ 3SFDC 1FZEA 1S4XA 3L75E 3QH9A 1Q2NA 4L73A 5GTHE 3WU2H 1J2JB 1YJNP 1LTBC 3H32B 4U3FJ 1NYHA 1EZVI 1P84I 4N78E 1FDMA 1SQQK 1JOCA 5KLVE 2W83C 1RQVA 3NTNA 2KIKA 3ITKA 4K3AA 1AJYA 5B66E 5CCHA 5TISH 3WMM0 1N73B 1QVFO 5AW3B 1NTKG 3TGUJ 5B5EE 3G71P 4AUWA 1AFOA 2O1KA 1QGKB 1PGPA 1HF9A 1NWQA 2IYPA 2WQYC 3EQ2A 4LGDE 4N6JA 3F89A 3MUDA 3RK2B 1HJ0A 1HTLC 1G2CA 1Y9BA 2A45G 1KFNA 5CHXA 1X8YA 2E5TA 1GK6A 1PL5A 3PLNA 4KT0J 4OGQC 3TSIA 3U1AA 2D2CB 3WUUA 4LLHA 5GTIH 1W2BO 1T6AA 3G9RA 1FZCA 3D6ZA 4Y99C 3L74G 5BU5A 1KMIZ 1BCCE 3L74J 1NTZE 2FKWB 2GA1A 1GL2C 2M3BA 1PGJA 1KILD 1HH0A 1R5SA 1TU3F 1BE3D 1LP1A 3B4SA 3CX5D 1KILE 3GG2A 5AVXB 1GU4A 1IZNB 3WUTA 3ZDMA 3HUSB 3KQGA 3CWBD 3HTKA 3MTUE 3V2QA 3CX5H 1YJWP 2WITA 1NHLA 3A0BE 1H0TA 2N1TA 2VRSA 2WSCJ 3FX0A 3K5BA 3LIEA 2E75C 1SFCD 3CCLP 1NTKJ 1SQXD 1Q90D 3M9QA 1K04A 3TGUG 2HG5D 5C39A 4UB8H 3CWBE 1HGZA 1KB9E 1OVUA 3H1LE 3VP8A 2G8YA 2H89C 2W6JH 3TYYA 1UIXA 3Q1MA 4O9BA 1H88A 2HR3A 5CCGD 5KJ7A 5KLIB 2QG4A 3WUVA 1JNMA 1KD1Q 1CSBA 1GD2E 2V7QH 1KYOD 1KFMA 3OA7A 2Z5IA 1URQD 5B5EH 2E76B 3G6EP 2FXOA 1VQ4P 1CI6B 2OYIA 2QE7H 3CXHI 1RHZB 3BCCG 1ZMEC 3L75D 1JM0A 3VMXA 1YITP 3AECC 5KAIE 3L73D 2E74C 3HD7A 5AVUB 3L4FA 1L0NJ 2A06E 1YJ9P 1BE3E 1LNQA 3M0AA 3M0DA 5KAIH 1HGVA 4H13D 1QEXA 4IOIH 2R3CA 3L74E 1M57D 3CXHH 5APQA 3RL0D 1N7SD 2J5UA 5E79H 2K9YA 1NGMB 1U57A 1R8EA 1S72P 1YIJP 1VPCA 5E79E 2QJYB 1SQVE 2OYIC 1OXZA 1YQ3C 2LR2A 2E74B 1PP9J 1PZQA 1JTHB 3RL0C 3A0BH 4H13C 2ZJSE 3D6YA 1OFCX 1PIXA 2M8RA 2ITAA 4WY4A 1OW7A 2I1JA 3BCCE 1KYOI 1LT9A 2KYVA 1ZRTD 2M3EA 4K35A 3TGUE 1Y8AA 2FBWC 2WSFH 3AE4C 3V5BA 4ASWA 1S3JA 5KAFH 2H43A 2P7JA 3CI9A 3AEBC 3BASA 2P2UA 3BCCD 3L37A 4TT3H 2Y9ZA 1URQC 2ZVNB 3BATA 3BRTB 3F5HA 2HODB 4WY4D 1NTMK 3H1IG 4IFMA 4H44D 2WT7B 3CCRP 2CK3H 1LWUA 2MKVA 1IFMA 3JSVC 1S2EA 3FXDA 3AE3C 1KQSO 2FFDB 3PRJA 2N9YB 2N1TC 3PH0A 1FOSE 2E43A 1JY2O 4XFJA 2FYUG 2YO3A 2FYNC 3L35A 1CW5A 2PGDA 1IFNA 1YYCA 3L72J 5KLVG 3H1HD 2HPCA 4DOJA 1RY3A 4JPZB 2YMYA 1J1EC 2A06G 2K88A 3VP9A 1OX3A 1X0TA 3MHVA 2Q3IA 3CXHE 1EDIA 3C9IA 3HTKB 1L4AD 4W7ZA 5CJ4A 1T2KD 3H25A 1ZR2A 3IFMA 4H0LB 1RF0C 1VF5C 3IN6A 4AQRD 1W2EA 3N4XA 3S4RA 4BXLA 5AVRB 1K73Q 1M90Q 4PD4E 1NU1D 4WWIA 3VMZA 5KKZC 2KB7P 3CD6P 2K9JA 2HYNA 1FOSF 3BCCJ 1X9VA 3L70G 1BCCG 2ZYGA 2C0XA 1M56D 3MGNA 3H1ID 4GKGA 4PD4I 3KDPB 1JMMA 3HD7C 1FJPA 1A02F 2HLOA 1IO4A 2M5AA 1SQXJ 3C1LA 2NPSB 5AVWB 3BVHA 1K9MQ 2JWAA 3SFEC 1JUNA 1BGYJ 3V6IA 1CI6A 1EQ7A 1SQPG 3R4YA 1VQNP 2HODA 3JC22 1L0ND 4ZKUA 1PP9D 2N1TD 3A0HH 3SWFA 2IBZD 2KSEA 2WZ7A 3S9OA 1VQ7P 1BE3J 1H0TB 3CX5E 3L75J 3A0HE 3A5TA 2H88C 2AXCA 2KZIA 2WSEJ 3ABVC 2IZ0A 4WY4C 1VQKP 3A7OA 1MZ9A 1FBMA 3M9BA 3OAKA 5CCHC 1X79B 2KP8A 1N7LA 1OWAA 2KSJA 4JBZA 2AXTH 1GL2B 2D2CD 2OQQA 4BRYB 1GMJA 2W8ZA 1IK9A 1SS1A 2P58A 1VF5D 2CPBA 5AVSB 5AW4B 1NJIQ 3CC4P 2QJPB 1EZVD 2FFDC 2WVRA 2C0WA 2Y9YA 1SQPK 3B5NB 2QM7A 4ASVA 4Y99B 1M1JA 4JF7A 4XA4A 2GM4A 1LWUC 2WSFJ 2V7QJ 1NTKD 2QJYC 4GDOA 5AW1B 2QEXP 3CC7P 3EWKA 1DD3A 1EZVE 1NVOA 1LT1A 3RK3B 1MUUA 1KQLA 2B88A 4UB6E 3CWBJ 2LXBA 1PPJG 1NTZG 2IYOA 2ZT9B 3B5NC 1IK7A 1OVRA 1HBWA 1KZUB 4EI2A 1DEBA 3IF4A 1LT9C 4JQ0D 2HFED 4OH8B 5AVYB 5AW5B 2WT7A 1HJBA 1KTMA 2ZAEB 1VL2A 1PP9G 2KI7B 1P84E 3AEAC 4R4LA 1RE4A 5EFWB 1L0LD 4YTPC 1BGYG 1IFIA 4LC1A 3M91A 4B86A 3JCUE 3L73J 1ZP0C 5KLIC 2IBZG 1KV4A 3VTPC 2Q5UA 1SQXG 5KLVK 1Z56A 2QJKB 1JB0J 4IL6H 2PRRA 2UWJE 4CPGA 3HE4A 4WB4A 1VQPP 1BCCJ 1RF1C 4IL6E 3RGUA 1JCCA 3NMDA 4UB8E 3TF5A 3FWLA 5TISE 2J59M 3B5ND 3I55P 5AVTB 3VMAA 2O01J 4RJTA 1N8RQ 1H8AA 1N7SC 5AVVB 1PP9E 1PPJD 5B66H 3HUSC 3GMAA 4I6MC 3V2PA 4WVZA 1NTKK 2FYUE 2IBZI 2W27A 5APYA 2O3JA 2L5GB 1G2CB 2BCCJ 4L75A 1LTJB 3RK3D 5GTIE 2E74D 1KYOH 1VQLP 3NXSA 1FZCB 1RE3C 3H6PA 4YPCA 2M0BA 5APVA 2W6BA 1E5WA 1L0NK 3H1JG 1KYOE 3RL0g 5KKZB 2RKLA 1U7JA 5AW9B 2KLUA 2B87B 4JYCA 3FGAD 2OTLP 2KLVA 1G1JA 4U3FE 3CCUP 2YKQA 3H1HE 4ZKPA 1SQBK 3G3ZA 3D71A 1A02J 3D70A 3RK2C 2B87A 2RH0A 4ZNCA 3AE8C 3U1CA 2Z4EA 5CJ0A 1S9KD 2NPSC 5CBNA 3AEGC 4DZOA 3L71D 3CCJP 4Y28J 4N78D 2OTJP 2Q3EA 3TK1A 3R2PA 4H44B 1VQ6P 1RE3A 4D6TE 1USDA 3H32A 1PV3A 2FYNB 3CC2P 1SQXK 2O01N 4EIJA 4C7RA 2JO1A 1GL2A 1SQPD 1NKNA 2E75D 3H1JE 1MKMA 1KQFB 3UIAA 1U7MA 2DW3A 2BEQD 4ZMDA 2LXCB 2KUBA 1AVYA 1SQQJ 3MUDC 5AW0B 2QA4P 2KK7A 4C46A 2K9JB 1FC2C 3U59A 1XTGB 1LTIC 3AE1C 3VN0A 4NPEA 2Y0DA 1FE6A 1L4AB 5BU8B 4I1LA 4GIFA 3USSA 2I1KA 3W67A 1PGQA 1AA0A 4IFDK 4I2LC 2AEJA 1SQVD 1FZBA 2E5YA 2NPSA 4W80A 1EC5A 3H1KE 1NAYA 2K37A 2YIUC 1P84D 1ZN5A 2WSEH 1VDFA 5APUA 1L0LJ 3LW5H 1JTHA 1HVVA 5H2FE 3CL3D 1L0NE 2A06D 3I56P 1NTZK 2ZFCA 4M3LA 4HB1A 5H2FH 1GK4A 3SWKA 1GDTA 3A2AA 3PTZA 3L75G 1PFIA 5CBOA 4RO0A 2OTKE 3EFFK 3Q5PA 1LTGC 3H1LG 1EDKA 3OW2O 2WPQA 1S9KE 1NU1K 4BRYA 2G3AA 2W6AA 4DT0A 3GW6A 3QWOC 4HJGH 5AVQB 1KB9D 1KB9H 1IFJA 2JDIH 1BSHA 3HE5B 4L74A 4EOTA 1N7SB 2POHA 1L0NG 1SQPE 1SQQE 3GLMA 2B89A 4Z1MH 1KB9I 1M7LA 1NTME 1L0LG 1Q86Q 4GOEA 1NOHA 1NTMD 1SQBJ 3CCVP 2OYHC 1LWUB 3CXHD 2HPCB 2FFDA 1L4AA 1OW8A 1BE3G 1FZAA 1ZW0A 2XKMA 1GW3A 1BDDA 1JY3P 4GT1A 4I7ZC 4XE5B 1T2KC 5DJTB 2FXPA 3PJSK 3L36A 4U3FG 2GUSA 2R44A 5AVZB 3HE4B 1AV1A 1QX8A 3HUSA 1YTZI 3IAOA 4PJ0E 1JMBA 2ZXEB 3TDKA 2E76C 3P8MC 2Z5HA 2WWWA 3G4SP 1JY3N 2J58A 3T97B 2K3RA 1FS0E 1FU1A 1SQQG 2FYUJ 3P32A 1JCDA 2KZJA 2WPRA 1NAFA 4HH2A 4JYBA 3VYIA 1SQBG 3WU2E 2FYZA 2IFMA 1X22A 2BASA 2KS1B 2OYHA 3P8CE 3CWBG 2BCCD 2O01H 2YXRB 1RQUA 2PP6A 3H1IJ 4OGQB 5M1BA 2Q9IA 1YHQP 3KZIH 2IPPA 4H0LC 1HWTC 2XNDH 1AQ5A 1WT6A 4PD4H 1UIIA 2WPSA 4PD4D 3H1LD 1K05A 1USEA 5KJ7D 2R5BA 3CMAP 1VQ5P 3L71G 3CCQP 1ZXGA 4YXWH 5AW6B 5TJHA 1SFCB 2R3SA 1N73C 2XV5A 1RF0A 4L76A 1T3JA 1LJ2A 2K1AA 3L70D 3L72G 2I8DA 5KLVJ 4H0LD 2ZXXA 1FZFA 2JWDA 2FYUK 1JEKA 1L0LE 2OARA 1KILB 2XZRA 3H1KJ 3MIWA 3CPWO 1Q82Q 3L73E 4R4MA 3CLQA 3NFQA 3V2RA 2R32A 1L4AC 1IFPA 3II6A 1M1KQ 3GF7A 1BGYD 1URQB 1FZGA 5CMZA 2IX7C 3CCMP 5KLVD 3CMEP 1J1EB 1G1IA 2CPSA 2GUVA 3PHLA 4PV1C 1DH3A 1BDCA 1DX7A 3GHGA 3B8EB 4D6TD 2WPVB 2YNYA 3IR9A 1SQVG 2FY8A 3PP5A 1EDJA 5GTHH 1KC8Q 1H89A 1VQ8P 2Y0CA 1M1JC 3GHGB 3H1LJ 1GZLA 2QIWA 5KAFE 1LT9B 4AYCA 2N1TB 2QSIA 5AW7B 2JJLA 4OGQD 3KXDA 1S5LE 1YTZT 1NU1J 1GW4A 4W7YA 1AVOA 2SPZA 1OIPA 1MV8A 3H1JJ 4H44C 4D6TJ 3EFGA 1NU1E 3Q2YA 4GOFA 1JY2P 3H1JD 3L73G 3V2NA 5KJ7C 2A45H 1ZLLA 1VQOP 3VOPA 1N7SA 3M06A 3AEDC 1S1CX 2JKVA 3E1RA 1LTTC 2PFXA 2Y0EA 1SFCA 3I5CA 2KOGA 3FXEA 1RF1B 3H1HJ 1VF5B 4IL6X 1SQVK 2JP3A 1EDLA 3L74D 1SVFA 1QLED 2V4HA 4MN4C 1RF1A 1L2PA 1NKZB 1KQGB 3AE5C 1NTZD 1NTZJ 1SP4A 3RBXA 3RL0B 2WSSH 4RKUJ 3M0DC 3JCUH 4D6TG 1HUCA 2YKOA 3BRVB 3SSUA 2Q6QA 1VQMP 2AEFA 3HD7B 1M8OB 1SLQA 2QVAA 2KNCA 3OJAB 4NPFX 1OMIA 1URQA 2FXMA 4GODA 1QVGO 3E1IA 1VQ9P 2ZT9D 2JEEA 3RK3E 5APSA 3W68A 1BGYE 2Q1KA 1LTSC 2AXTE 3H1HG 3M9HA 1RE4C 2YO2A 2JR8A 2YMKA 3H1IE 1DD4A 2QJKC 4U7JA 2C9NY 2D2CC 4EYYQ 3KHUA 4U3FD 5CCHD 2P10A 3KPEA 1S5LH 2O1JA 1RH5B 2WTYA 2M5AB 4IFFA 1NO4A 3H1KG 3Q5SA 2WSCH 3HE5A 1NU1G 4A7PA 1QL1A 3Q3DA 2QJPC 2YXQB 3L72E 1NH4A 1Y47A 4HKZH 2W90A 4HYTB 3AE7C 4BWNA 2IZ1A 3MP7B 3O8ZA 5AW8B 3GHGC 2L91A 1J1DB 2QRXA 1SQBE 1D7MA 2BCCG 1S5LX 1NTMJ 1SQBD 3CX5I 3P7KA 1OW6A 1SFCC 2IBZE 3H1KD 3L72D 3CCSP 3HD7D 1JY3O 5CCGC 2P1JA 1Q7YQ 3AE6C 3L70J 2NPSD 3KYQA 2AEMA 3HRNA 2QM8A 1GTWA 3L71E 1J1DC 1JY2N 1KILC 2MJZA 2ZYAA 3T97A 1KN7A 2OYHB 2OGUA 3B5NA 3S1KA 2E75B 1T3UA 1M1JB 1LTJC 3LIDA 4PV1D 3E7KA 1Q81Q 1ZR4A 2KS1A 1ZRTE 3TGUD 3SWYA 1LGHB 5AW2B 1SQPJ 1NTMG 1YBKA 2H8PD 2XNXA 2OYIB 2E42A 2H7HA 3P8CD 1JO5A 3RK3C 1WMKA
chains in the Genus database with same CATH topology
3TNUA 2IFNA 1GL2D 2R5DA 2P67A 3V4QA 3N7NA 3TNUB 2Q7CA 1IC2A 1T8ZA 1XTCC 1FJKA 4C7NA 2N9BA 4RESB 2XDJA 1IJDB 5APXA 1FAVA 5BVZA 2C9LY 1L0LK 1KILA 4KHXA 1N86A 4N3YB 2LKMA 1ZV8A 3RK2D 4WY4B 1LTAC 5KTBA 4WBAA 1N73A 5CCGA 3MD0A 1IFDA 1LTJA 3VMYA 2XU6A 2YKPA 1QL2A 1WRGA 1CZQA 3V4WA 3A3YB 1MFZA 1N2DC 2PAJA 4C7NB 1GU5A 5APTA 1FZCC 2A45I 5APWA 1FZEA 1J2JB 1LTBC 3H32B 4N78E 1FDMA 1SQQK 1JOCA 3NTNA 5CCHA 3WMM0 1N73B 5AW3B 1AFOA 4AUWA 2O1KA 1NWQA 3EQ2A 4LGDE 4N6JA 3MUDA 3RK2B 1HTLC 1G2CA 2A45G 5CHXA 1KFNA 1X8YA 1GK6A 3TSIA 3U1AA 1FZCA 4LLHA 4Y99C 5BU5A 2FKWB 1GL2C 2M3BA 1KILD 1HH0A 5AVXB 1GU4A 3HUSB 3KQGA 3HTKA 3MTUE 3V2QA 2WITA 1NHLA 2N1TA 2VRSA 3LIEA 1SFCD 3M9QA 2HG5D 1HGZA 3VP8A 4O9BA 1H88A 5CCGD 5KJ7A 1JNMA 1GD2E 1CSBA 1KFMA 3OA7A 2Z5IA 1URQD 1CI6B 2OYIA 3VMXA 3HD7A 5AVUB 3L4FA 3M0AA 3M0DA 1HGVA 3TYYA 5APQA 2R3CA 2C9NY 3RL0D 1N7SD 1VPCA 2OYIC 1OXZA 3RL0C 1JTHB 2M8RA 4WY4A 2I1JA 1LT9A 2KYVA 2WSFH 3V5BA 2H43A 2P7JA 3CI9A 3BASA 2P2UA 3L37A 1URQC 3BATA 3BRTB 2HODB 4WY4D 1NTMK 4IFMA 2WT7B 1LWUA 2FFDB 1IFMA 2N1TC 2E43A 1JY2O 2YO3A 3L35A 1CW5A 1IFNA 1YYCA 2HPCA 4DOJA 1RY3A 2YMYA 1J1EC 3VP9A 2Q3IA 4W7ZA 3C9IA 3HTKB 5CJ4A 1L4AD 1T2KD 1ZR2A 3IFMA 1RF0C 4AQRD 1W2EA 3N4XA 5AVRB 3VMZA 2KB7P 2HYNA 1FOSF 1X9VA 4GKGA 2C0XA 3MGNA 1FJPA 3KDPB 1JMMA 3HD7C 1A02F 2HLOA 1IO4A 5AVWB 2NPSB 3BVHA 1JUNA 1CI6A 1EQ7A 2HODA 4ZKUA 2N1TD 3SWFA 2WZ7A 3A5TA 4WY4C 3A7OA 1MZ9A 1FBMA 3M9BA 3OAKA 5CCHC 1X79B 2KP8A 1N7LA 1OWAA 2KSJA 1GL2B 1IK9A 5AW4B 5AVSB 2CPBA 2FFDC 2C0WA 3B5NB 1SQPK 2QM7A 4Y99B 1M1JA 4JF7A 4XA4A 2GM4A 1LWUC 5AW1B 3RK3B 1MUUA 1KQLA 1HBWA 3B5NC 1KZUB 1DEBA 1LT9C 4OH8B 2HFED 5AVYB 2WT7A 5AW5B 1HJBA 1FOSE 1RE4A 1IFIA 4LC1A 3M91A 4B86A 3VTPC 2Q5UA 5KLVK 1Z56A 3HE4A 4WB4A 1RF1C 1JCCA 3NMDA 2J59M 3B5ND 5AVTB 1H8AA 1N7SC 5AVVB 3HUSC 4I6MC 3V2PA 1NTKK 2W27A 5APYA 2L5GB 1G2CB 3RK3D 1LTJB 3NXSA 1FZCB 1RE3C 3H6PA 5APVA 2W6BA 1E5WA 1L0NK 5AW9B 4JYCA 2KLVA 1G1JA 2YKQA 4ZKPA 1SQBK 3G3ZA 1A02J 3RK2C 3U1CA 5CJ0A 1S9KD 2NPSC 4DZOA 4N78D 3TK1A 3R2PA 1RE3A 3H32A 1SQXK 4EIJA 4C7RA 1GL2A 1NKNA 3UIAA 5AW0B 4C46A 3U59A 1XTGB 1LTIC 3VN0A 1L4AB 5BU8B 4I1LA 4GIFA 2I1KA 4I2LC 1FZBA 2NPSA 4W80A 1ZN5A 5APUA 2WSEH 1VDFA 3LW5H 1JTHA 1HVVA 3CL3D 1NTZK 2ZFCA 4M3LA 1GK4A 1GDTA 3A2AA 1PFIA 1LTGC 2WPQA 1S9KE 1NU1K 2W6AA 5AVQB 1IFJA 3HE5B 4EOTA 1N7SB 2POHA 1M7LA 1NOHA 2OYHC 1LWUB 2HPCB 2FFDA 1L4AA 2Z4EA 1FZAA 2XKMA 1GW3A 1JY3P 4GT1A 4XE5B 3L36A 2GUSA 5AVZB 3HE4B 3HUSA 1YTZI 2ZXEB 3P8MC 2Z5HA 2WWWA 1JY3N 2J58A 3P32A 1FU1A 4HH2A 2OYHA 4IFDK 1JCDA 2WPRA 3VYIA 1NAFA 4JYBA 2FYZA 2IFMA 2BASA 3P8CE 2O01H 2PP6A 2Q9IA 1HWTC 2IPPA 1AQ5A 1WT6A 2WPSA 5KJ7D 2R5BA 5AW6B 1N73C 1SFCB 2XV5A 1RF0A 1T3JA 1FZFA 2FYUK 2OARA 3MIWA 1KILB 2XZRA 3CLQA 3NFQA 3V2RA 2R32A 1L4AC 3II6A 1FZGA 1URQB 5CMZA 2IX7C 1J1EB 1G1IA 2CPSA 2GUVA 1DH3A 1DX7A 3GHGA 3B8EB 2YNYA 3PP5A 3IR9A 1H89A 3GHGB 1M1JC 1GZLA 1LT9B 4AYCA 2N1TB 1T2KC 5AW7B 2JJLA 1YTZT 1GW4A 4W7YA 1MV8A 3EFGA 1JY2P 5KJ7C 3V2NA 2A45H 1ZLLA 3VOPA 1N7SA 3M06A 1LTTC 3I5CA 1SFCA 2KOGA 1RF1B 1SQVK 1SVFA 1RF1A 1NKZB 1SP4A 3RL0B 3M0DC 1HUCA 2YKOA 3BRVB 3HD7B 1SLQA 3OJAB 2FXMA 1URQA 3E1IA 2JEEA 5APSA 1LTSC 3M9HA 1RE4C 2YO2A 5CCHD 3KPEA 2O1JA 2WTYA 4IFFA 1NO4A 2WSCH 3HE5A 1QL1A 1NH4A 4HYTB 3O8ZA 5AW8B 3GHGC 1J1DB 3P7KA 1SFCC 3HD7D 1JY3O 5CCGC 2P1JA 2NPSD 3KYQA 3HRNA 1GTWA 2QM8A 1J1DC 1JY2N 1KILC 2MJZA 3T97A 2OYHB 3B5NA 1T3UA 1M1JB 1LTJC 3LIDA 1ZR4A 3SWYA 1LGHB 5AW2B 2H7HA 2H8PD 2E42A 1JO5A 2XNXA 2OYIB 3P8CD 3RK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4F A;  2W6B A;  2YKO A;  1JOC A;  3CL3 D;  3BRV B;  2YKP A;  3EQ2 A;  3BRT B;  2YKQ A; 
#chains in the Genus database with same CATH topology
 2E76 D;  3TNU A;  2IFN A;  1GL2 D;  1EZV G;  2P67 A;  2B9B A;  2R5D A;  3N7N A;  3V4Q A;  3TNU B;  2FYU D;  3AE9 C;  1K8A Q;  2Q7C A;  1IC2 A;  1P84 H;  3O6Q B;  1T8Z A;  1XTC C;  1FJK A;  1LP1 B;  4I7Z B;  4C7N A;  2N9B A;  4OVN F;  3O6Q A;  4RES B;  2XDJ A;  1IJD B;  5APX A;  1SQV J;  4PJ0 H;  4H13 B;  1FAV A;  1ZOY C;  2WMM A;  5BVZ A;  3Q5R A;  1L0L K;  1KIL A;  2C9L Y;  4KHX A;  4YXD C;  1N86 A;  1OZH A;  2KXP B;  1DIP A;  4N3Y B;  1PGO A;  2LKM A;  1ZV8 A;  3MZW B;  3RK2 D;  1FDI A;  4KJM A;  4WY4 B;  4NPD A;  4QMA A;  1SQX E;  1LTA C;  1SQQ D;  5KTB A;  4WBA A;  3AEE C;  2KNC B;  2ZYD A;  3AEF C;  2RN0 A;  1N73 A;  3KZI E;  5CCG A;  1MFT A;  3RBZ A;  1PPJ E;  2NRG A;  4EDF A;  3MD0 A;  4PV1 B;  1OVV A;  1R5L A;  3C8V A;  3AE2 C;  4TLF A;  2BEZ F;  1BSN A;  4DCK A;  1EXJ A;  1EXI A;  2IDB A;  1BCC D;  2OYO A;  3L71 J;  1DEE G;  1KOR A;  3B71 A;  3CCE P;  1IFD A;  1LTJ A;  2YIU B;  3L70 E;  4OWF A;  3VMY A;  2XU6 A;  4UB6 H;  2YKP A;  4DJG A;  2NZ2 A;  1QL2 A;  1FDO A;  1W5C E;  1E79 H;  1YQ4 C;  1AQT A;  1WRG A;  1CZQ A;  3V4W A;  3A3Y B;  3FWN A;  2ZVO B;  2ZT9 C;  1MFZ A;  1NTK E;  5K5G B;  1N2D C;  1YI2 P;  2PAJ A;  3GF3 A;  3LW5 J;  4C7N B;  1GU5 A;  5APT A;  2RMZ A;  2A45 I;  2BCC E;  5APW A;  1FZC C;  5DJU B;  5L8R J;  3SFD C;  1FZE A;  1S4X A;  3L75 E;  3QH9 A;  1Q2N A;  4L73 A;  5GTH E;  3WU2 H;  1J2J B;  1YJN P;  1LTB C;  3H32 B;  4U3F J;  1NYH A;  1EZV I;  1P84 I;  4N78 E;  1FDM A;  1SQQ K;  1JOC A;  5KLV E;  2W83 C;  1RQV A;  3NTN A;  2KIK A;  3ITK A;  4K3A A;  1AJY A;  5B66 E;  5CCH A;  5TIS H;  3WMM 0;  1N73 B;  1QVF O;  5AW3 B;  1NTK G;  3TGU J;  5B5E E;  3G71 P;  4AUW A;  1AFO A;  2O1K A;  1QGK B;  1PGP A;  1HF9 A;  1NWQ A;  2IYP A;  2WQY C;  3EQ2 A;  4LGD E;  4N6J A;  3F89 A;  3MUD A;  3RK2 B;  1HJ0 A;  1HTL C;  1G2C A;  1Y9B A;  2A45 G;  1KFN A;  5CHX A;  1X8Y A;  2E5T A;  1GK6 A;  1PL5 A;  3PLN A;  4KT0 J;  4OGQ C;  3TSI A;  3U1A A;  2D2C B;  3WUU A;  4LLH A;  5GTI H;  1W2B O;  1T6A A;  3G9R A;  1FZC A;  3D6Z A;  4Y99 C;  3L74 G;  5BU5 A;  1KMI Z;  1BCC E;  3L74 J;  1NTZ E;  2FKW B;  2GA1 A;  1GL2 C;  2M3B A;  1PGJ A;  1KIL D;  1HH0 A;  1R5S A;  1TU3 F;  1BE3 D;  1LP1 A;  3B4S A;  3CX5 D;  1KIL E;  3GG2 A;  5AVX B;  1GU4 A;  1IZN B;  3WUT A;  3ZDM A;  3HUS B;  3KQG A;  3CWB D;  3HTK A;  3MTU E;  3V2Q A;  3CX5 H;  1YJW P;  2WIT A;  1NHL A;  3A0B E;  1H0T A;  2N1T A;  2VRS A;  2WSC J;  3FX0 A;  3K5B A;  3LIE A;  2E75 C;  1SFC D;  3CCL P;  1NTK J;  1SQX D;  1Q90 D;  3M9Q A;  1K04 A;  3TGU G;  2HG5 D;  5C39 A;  4UB8 H;  3CWB E;  1HGZ A;  1KB9 E;  1OVU A;  3H1L E;  3VP8 A;  2G8Y A;  2H89 C;  2W6J H;  3TYY A;  1UIX A;  3Q1M A;  4O9B A;  1H88 A;  2HR3 A;  5CCG D;  5KJ7 A;  5KLI B;  2QG4 A;  3WUV A;  1JNM A;  1KD1 Q;  1CSB A;  1GD2 E;  2V7Q H;  1KYO D;  1KFM A;  3OA7 A;  2Z5I A;  1URQ D;  5B5E H;  2E76 B;  3G6E P;  2FXO A;  1VQ4 P;  1CI6 B;  2OYI A;  2QE7 H;  3CXH I;  1RHZ B;  3BCC G;  1ZME C;  3L75 D;  1JM0 A;  3VMX A;  1YIT P;  3AEC C;  5KAI E;  3L73 D;  2E74 C;  3HD7 A;  5AVU B;  3L4F A;  1L0N J;  2A06 E;  1YJ9 P;  1BE3 E;  1LNQ A;  3M0A A;  3M0D A;  5KAI H;  1HGV A;  4H13 D;  1QEX A;  4IOI H;  2R3C A;  3L74 E;  1M57 D;  3CXH H;  5APQ A;  3RL0 D;  1N7S D;  2J5U A;  5E79 H;  2K9Y A;  1NGM B;  1U57 A;  1R8E A;  1S72 P;  1YIJ P;  1VPC A;  5E79 E;  2QJY B;  1SQV E;  2OYI C;  1OXZ A;  1YQ3 C;  2LR2 A;  2E74 B;  1PP9 J;  1PZQ A;  1JTH B;  3RL0 C;  3A0B H;  4H13 C;  2ZJS E;  3D6Y A;  1OFC X;  1PIX A;  2M8R A;  2ITA A;  4WY4 A;  1OW7 A;  2I1J A;  3BCC E;  1KYO I;  1LT9 A;  2KYV A;  1ZRT D;  2M3E A;  4K35 A;  3TGU E;  1Y8A A;  2FBW C;  2WSF H;  3AE4 C;  3V5B A;  4ASW A;  1S3J A;  5KAF H;  2H43 A;  2P7J A;  3CI9 A;  3AEB C;  3BAS A;  2P2U A;  3BCC D;  3L37 A;  4TT3 H;  2Y9Z A;  1URQ C;  2ZVN B;  3BAT A;  3BRT B;  3F5H A;  2HOD B;  4WY4 D;  1NTM K;  3H1I G;  4IFM A;  4H44 D;  2WT7 B;  3CCR P;  2CK3 H;  1LWU A;  2MKV A;  1IFM A;  3JSV C;  1S2E A;  3FXD A;  3AE3 C;  1KQS O;  2FFD B;  3PRJ A;  2N9Y B;  2N1T C;  3PH0 A;  1FOS E;  2E43 A;  1JY2 O;  4XFJ A;  2FYU G;  2YO3 A;  2FYN C;  3L35 A;  1CW5 A;  2PGD A;  1IFN A;  1YYC A;  3L72 J;  5KLV G;  3H1H D;  2HPC A;  4DOJ A;  1RY3 A;  4JPZ B;  2YMY A;  1J1E C;  2A06 G;  2K88 A;  3VP9 A;  1OX3 A;  1X0T A;  3MHV A;  2Q3I A;  3CXH E;  1EDI A;  3C9I A;  3HTK B;  1L4A D;  4W7Z A;  5CJ4 A;  1T2K D;  3H25 A;  1ZR2 A;  3IFM A;  4H0L B;  1RF0 C;  1VF5 C;  3IN6 A;  4AQR D;  1W2E A;  3N4X A;  3S4R A;  4BXL A;  5AVR B;  1K73 Q;  1M90 Q;  4PD4 E;  1NU1 D;  4WWI A;  3VMZ A;  5KKZ C;  2KB7 P;  3CD6 P;  2K9J A;  2HYN A;  1FOS F;  3BCC J;  1X9V A;  3L70 G;  1BCC G;  2ZYG A;  2C0X A;  1M56 D;  3MGN A;  3H1I D;  4GKG A;  4PD4 I;  3KDP B;  1JMM A;  3HD7 C;  1FJP A;  1A02 F;  2HLO A;  1IO4 A;  2M5A A;  1SQX J;  3C1L A;  2NPS B;  5AVW B;  3BVH A;  1K9M Q;  2JWA A;  3SFE C;  1JUN A;  1BGY J;  3V6I A;  1CI6 A;  1EQ7 A;  1SQP G;  3R4Y A;  1VQN P;  2HOD A;  3JC2 2;  1L0N D;  4ZKU A;  1PP9 D;  2N1T D;  3A0H H;  3SWF A;  2IBZ D;  2KSE A;  2WZ7 A;  3S9O A;  1VQ7 P;  1BE3 J;  1H0T B;  3CX5 E;  3L75 J;  3A0H E;  3A5T A;  2H88 C;  2AXC A;  2KZI A;  2WSE J;  3ABV C;  2IZ0 A;  4WY4 C;  1VQK P;  3A7O A;  1MZ9 A;  1FBM A;  3M9B A;  3OAK A;  5CCH C;  1X79 B;  2KP8 A;  1N7L A;  1OWA A;  2KSJ A;  4JBZ A;  2AXT H;  1GL2 B;  2D2C D;  2OQQ A;  4BRY B;  1GMJ A;  2W8Z A;  1IK9 A;  1SS1 A;  2P58 A;  1VF5 D;  2CPB A;  5AVS B;  5AW4 B;  1NJI Q;  3CC4 P;  2QJP B;  1EZV D;  2FFD C;  2WVR A;  2C0W A;  2Y9Y A;  1SQP K;  3B5N B;  2QM7 A;  4ASV A;  4Y99 B;  1M1J A;  4JF7 A;  4XA4 A;  2GM4 A;  1LWU C;  2WSF J;  2V7Q J;  1NTK D;  2QJY C;  4GDO A;  5AW1 B;  2QEX P;  3CC7 P;  3EWK A;  1DD3 A;  1EZV E;  1NVO A;  1LT1 A;  3RK3 B;  1MUU A;  1KQL A;  2B88 A;  4UB6 E;  3CWB J;  2LXB A;  1PPJ G;  1NTZ G;  2IYO A;  2ZT9 B;  3B5N C;  1IK7 A;  1OVR A;  1HBW A;  1KZU B;  4EI2 A;  1DEB A;  3IF4 A;  1LT9 C;  4JQ0 D;  2HFE D;  4OH8 B;  5AVY B;  5AW5 B;  2WT7 A;  1HJB A;  1KTM A;  2ZAE B;  1VL2 A;  1PP9 G;  2KI7 B;  1P84 E;  3AEA C;  4R4L A;  1RE4 A;  5EFW B;  1L0L D;  4YTP C;  1BGY G;  1IFI A;  4LC1 A;  3M91 A;  4B86 A;  3JCU E;  3L73 J;  1ZP0 C;  5KLI C;  2IBZ G;  1KV4 A;  3VTP C;  2Q5U A;  1SQX G;  5KLV K;  1Z56 A;  2QJK B;  1JB0 J;  4IL6 H;  2PRR A;  2UWJ E;  4CPG A;  3HE4 A;  4WB4 A;  1VQP P;  1BCC J;  1RF1 C;  4IL6 E;  3RGU A;  1JCC A;  3NMD A;  4UB8 E;  3TF5 A;  3FWL A;  5TIS E;  2J59 M;  3B5N D;  3I55 P;  5AVT B;  3VMA A;  2O01 J;  4RJT A;  1N8R Q;  1H8A A;  1N7S C;  5AVV B;  1PP9 E;  1PPJ D;  5B66 H;  3HUS C;  3GMA A;  4I6M C;  3V2P A;  4WVZ A;  1NTK K;  2FYU E;  2IBZ I;  2W27 A;  5APY A;  2O3J A;  2L5G B;  1G2C B;  2BCC J;  4L75 A;  1LTJ B;  3RK3 D;  5GTI E;  2E74 D;  1KYO H;  1VQL P;  3NXS A;  1FZC B;  1RE3 C;  3H6P A;  4YPC A;  2M0B A;  5APV A;  2W6B A;  1E5W A;  1L0N K;  3H1J G;  1KYO E;  3RL0 g;  5KKZ B;  2RKL A;  1U7J A;  5AW9 B;  2KLU A;  2B87 B;  4JYC A;  3FGA D;  2OTL P;  2KLV A;  1G1J A;  4U3F E;  3CCU P;  2YKQ A;  3H1H E;  4ZKP A;  1SQB K;  3G3Z A;  3D71 A;  1A02 J;  3D70 A;  3RK2 C;  2B87 A;  2RH0 A;  4ZNC A;  3AE8 C;  3U1C A;  2Z4E A;  5CJ0 A;  1S9K D;  2NPS C;  5CBN A;  3AEG C;  4DZO A;  3L71 D;  3CCJ P;  4Y28 J;  4N78 D;  2OTJ P;  2Q3E A;  3TK1 A;  3R2P A;  4H44 B;  1VQ6 P;  1RE3 A;  4D6T E;  1USD A;  3H32 A;  1PV3 A;  2FYN B;  3CC2 P;  1SQX K;  2O01 N;  4EIJ A;  4C7R A;  2JO1 A;  1GL2 A;  1SQP D;  1NKN A;  2E75 D;  3H1J E;  1MKM A;  1KQF B;  3UIA A;  1U7M A;  2DW3 A;  2BEQ D;  4ZMD A;  2LXC B;  2KUB A;  1AVY A;  1SQQ J;  3MUD C;  5AW0 B;  2QA4 P;  2KK7 A;  4C46 A;  2K9J B;  1FC2 C;  3U59 A;  1XTG B;  1LTI C;  3AE1 C;  3VN0 A;  4NPE A;  2Y0D A;  1FE6 A;  1L4A B;  5BU8 B;  4I1L A;  4GIF A;  3USS A;  2I1K A;  3W67 A;  1PGQ A;  1AA0 A;  4IFD K;  4I2L C;  2AEJ A;  1SQV D;  1FZB A;  2E5Y A;  2NPS A;  4W80 A;  1EC5 A;  3H1K E;  1NAY A;  2K37 A;  2YIU C;  1P84 D;  1ZN5 A;  2WSE H;  1VDF A;  5APU A;  1L0L J;  3LW5 H;  1JTH A;  1HVV A;  5H2F E;  3CL3 D;  1L0N E;  2A06 D;  3I56 P;  1NTZ K;  2ZFC A;  4M3L A;  4HB1 A;  5H2F H;  1GK4 A;  3SWK A;  1GDT A;  3A2A A;  3PTZ A;  3L75 G;  1PFI A;  5CBO A;  4RO0 A;  2OTK E;  3EFF K;  3Q5P A;  1LTG C;  3H1L G;  1EDK A;  3OW2 O;  2WPQ A;  1S9K E;  1NU1 K;  4BRY A;  2G3A A;  2W6A A;  4DT0 A;  3GW6 A;  3QWO C;  4HJG H;  5AVQ B;  1KB9 D;  1KB9 H;  1IFJ A;  2JDI H;  1BSH A;  3HE5 B;  4L74 A;  4EOT A;  1N7S B;  2POH A;  1L0N G;  1SQP E;  1SQQ E;  3GLM A;  2B89 A;  4Z1M H;  1KB9 I;  1M7L A;  1NTM E;  1L0L G;  1Q86 Q;  4GOE A;  1NOH A;  1NTM D;  1SQB J;  3CCV P;  2OYH C;  1LWU B;  3CXH D;  2HPC B;  2FFD A;  1L4A A;  1OW8 A;  1BE3 G;  1FZA A;  1ZW0 A;  2XKM A;  1GW3 A;  1BDD A;  1JY3 P;  4GT1 A;  4I7Z C;  4XE5 B;  1T2K C;  5DJT B;  2FXP A;  3PJS K;  3L36 A;  4U3F G;  2GUS A;  2R44 A;  5AVZ B;  3HE4 B;  1AV1 A;  1QX8 A;  3HUS A;  1YTZ I;  3IAO A;  4PJ0 E;  1JMB A;  2ZXE B;  3TDK A;  2E76 C;  3P8M C;  2Z5H A;  2WWW A;  3G4S P;  1JY3 N;  2J58 A;  3T97 B;  2K3R A;  1FS0 E;  1FU1 A;  1SQQ G;  2FYU J;  3P32 A;  1JCD A;  2KZJ A;  2WPR A;  1NAF A;  4HH2 A;  4JYB A;  3VYI A;  1SQB G;  3WU2 E;  2FYZ A;  2IFM A;  1X22 A;  2BAS A;  2KS1 B;  2OYH A;  3P8C E;  3CWB G;  2BCC D;  2O01 H;  2YXR B;  1RQU A;  2PP6 A;  3H1I J;  4OGQ B;  5M1B A;  2Q9I A;  1YHQ P;  3KZI H;  2IPP A;  4H0L C;  1HWT C;  2XND H;  1AQ5 A;  1WT6 A;  4PD4 H;  1UII A;  2WPS A;  4PD4 D;  3H1L D;  1K05 A;  1USE A;  5KJ7 D;  2R5B A;  3CMA P;  1VQ5 P;  3L71 G;  3CCQ P;  1ZXG A;  4YXW H;  5AW6 B;  5TJH A;  1SFC B;  2R3S A;  1N73 C;  2XV5 A;  1RF0 A;  4L76 A;  1T3J A;  1LJ2 A;  2K1A A;  3L70 D;  3L72 G;  2I8D A;  5KLV J;  4H0L D;  2ZXX A;  1FZF A;  2JWD A;  2FYU K;  1JEK A;  1L0L E;  2OAR A;  1KIL B;  2XZR A;  3H1K J;  3MIW A;  3CPW O;  1Q82 Q;  3L73 E;  4R4M A;  3CLQ A;  3NFQ A;  3V2R A;  2R32 A;  1L4A C;  1IFP A;  3II6 A;  1M1K Q;  3GF7 A;  1BGY D;  1URQ B;  1FZG A;  5CMZ A;  2IX7 C;  3CCM P;  5KLV D;  3CME P;  1J1E B;  1G1I A;  2CPS A;  2GUV A;  3PHL A;  4PV1 C;  1DH3 A;  1BDC A;  1DX7 A;  3GHG A;  3B8E B;  4D6T D;  2WPV B;  2YNY A;  3IR9 A;  1SQV G;  2FY8 A;  3PP5 A;  1EDJ A;  5GTH H;  1KC8 Q;  1H89 A;  1VQ8 P;  2Y0C A;  1M1J C;  3GHG B;  3H1L J;  1GZL A;  2QIW A;  5KAF E;  1LT9 B;  4AYC A;  2N1T B;  2QSI A;  5AW7 B;  2JJL A;  4OGQ D;  3KXD A;  1S5L E;  1YTZ T;  1NU1 J;  1GW4 A;  4W7Y A;  1AVO A;  2SPZ A;  1OIP A;  1MV8 A;  3H1J J;  4H44 C;  4D6T J;  3EFG A;  1NU1 E;  3Q2Y A;  4GOF A;  1JY2 P;  3H1J D;  3L73 G;  3V2N A;  5KJ7 C;  2A45 H;  1ZLL A;  1VQO P;  3VOP A;  1N7S A;  3M06 A;  3AED C;  1S1C X;  2JKV A;  3E1R A;  1LTT C;  2PFX A;  2Y0E A;  1SFC A;  3I5C A;  2KOG A;  3FXE A;  1RF1 B;  3H1H J;  1VF5 B;  4IL6 X;  1SQV K;  2JP3 A;  1EDL A;  3L74 D;  1SVF A;  1QLE D;  2V4H A;  4MN4 C;  1RF1 A;  1L2P A;  1NKZ B;  1KQG B;  3AE5 C;  1NTZ D;  1NTZ J;  1SP4 A;  3RBX A;  3RL0 B;  2WSS H;  4RKU J;  3M0D C;  3JCU H;  4D6T G;  1HUC A;  2YKO A;  3BRV B;  3SSU A;  2Q6Q A;  1VQM P;  2AEF A;  3HD7 B;  1M8O B;  1SLQ A;  2QVA A;  2KNC A;  3OJA B;  4NPF X;  1OMI A;  1URQ A;  2FXM A;  4GOD A;  1QVG O;  3E1I A;  1VQ9 P;  2ZT9 D;  2JEE A;  3RK3 E;  5APS A;  3W68 A;  1BGY E;  2Q1K A;  1LTS C;  2AXT E;  3H1H G;  3M9H A;  1RE4 C;  2YO2 A;  2JR8 A;  2YMK A;  3H1I E;  1DD4 A;  2QJK C;  4U7J A;  2C9N Y;  2D2C C;  4EYY Q;  3KHU A;  4U3F D;  5CCH D;  2P10 A;  3KPE A;  1S5L H;  2O1J A;  1RH5 B;  2WTY A;  2M5A B;  4IFF A;  1NO4 A;  3H1K G;  3Q5S A;  2WSC H;  3HE5 A;  1NU1 G;  4A7P A;  1QL1 A;  3Q3D A;  2QJP C;  2YXQ B;  3L72 E;  1NH4 A;  1Y47 A;  4HKZ H;  2W90 A;  4HYT B;  3AE7 C;  4BWN A;  2IZ1 A;  3MP7 B;  3O8Z A;  5AW8 B;  3GHG C;  2L91 A;  1J1D B;  2QRX A;  1SQB E;  1D7M A;  2BCC G;  1S5L X;  1NTM J;  1SQB D;  3CX5 I;  3P7K A;  1OW6 A;  1SFC C;  2IBZ E;  3H1K D;  3L72 D;  3CCS P;  3HD7 D;  1JY3 O;  5CCG C;  2P1J A;  1Q7Y Q;  3AE6 C;  3L70 J;  2NPS D;  3KYQ A;  2AEM A;  3HRN A;  2QM8 A;  1GTW A;  3L71 E;  1J1D C;  1JY2 N;  1KIL C;  2MJZ A;  2ZYA A;  3T97 A;  1KN7 A;  2OYH B;  2OGU A;  3B5N A;  3S1K A;  2E75 B;  1T3U A;  1M1J B;  1LTJ C;  3LID A;  4PV1 D;  3E7K A;  1Q81 Q;  1ZR4 A;  2KS1 A;  1ZRT E;  3TGU D;  3SWY A;  1LGH B;  5AW2 B;  1SQP J;  1NTM G;  1YBK A;  2H8P D;  2XNX A;  2OYI B;  2E42 A;  2H7H A;  3P8C D;  1JO5 A;  3RK3 C;  1WMK A; 
#chains in the Genus database with same CATH homology
 3TNU A;  2IFN A;  1GL2 D;  2R5D A;  2P67 A;  3V4Q A;  3N7N A;  3TNU B;  2Q7C A;  1IC2 A;  1T8Z A;  1XTC C;  1FJK A;  4C7N A;  2N9B A;  4RES B;  2XDJ A;  1IJD B;  5APX A;  1FAV A;  5BVZ A;  2C9L Y;  1L0L K;  1KIL A;  4KHX A;  1N86 A;  4N3Y B;  2LKM A;  1ZV8 A;  3RK2 D;  4WY4 B;  1LTA C;  5KTB A;  4WBA A;  1N73 A;  5CCG A;  3MD0 A;  1IFD A;  1LTJ A;  3VMY A;  2XU6 A;  2YKP A;  1QL2 A;  1WRG A;  1CZQ A;  3V4W A;  3A3Y B;  1MFZ A;  1N2D C;  2PAJ A;  4C7N B;  1GU5 A;  5APT A;  1FZC C;  2A45 I;  5APW A;  1FZE A;  1J2J B;  1LTB C;  3H32 B;  4N78 E;  1FDM A;  1SQQ K;  1JOC A;  3NTN A;  5CCH A;  3WMM 0;  1N73 B;  5AW3 B;  1AFO A;  4AUW A;  2O1K A;  1NWQ A;  3EQ2 A;  4LGD E;  4N6J A;  3MUD A;  3RK2 B;  1HTL C;  1G2C A;  2A45 G;  5CHX A;  1KFN A;  1X8Y A;  1GK6 A;  3TSI A;  3U1A A;  1FZC A;  4LLH A;  4Y99 C;  5BU5 A;  2FKW B;  1GL2 C;  2M3B A;  1KIL D;  1HH0 A;  5AVX B;  1GU4 A;  3HUS B;  3KQG A;  3HTK A;  3MTU E;  3V2Q A;  2WIT A;  1NHL A;  2N1T A;  2VRS A;  3LIE A;  1SFC D;  3M9Q A;  2HG5 D;  1HGZ A;  3VP8 A;  4O9B A;  1H88 A;  5CCG D;  5KJ7 A;  1JNM A;  1GD2 E;  1CSB A;  1KFM A;  3OA7 A;  2Z5I A;  1URQ D;  1CI6 B;  2OYI A;  3VMX A;  3HD7 A;  5AVU B;  3L4F A;  3M0A A;  3M0D A;  1HGV A;  3TYY A;  5APQ A;  2R3C A;  2C9N Y;  3RL0 D;  1N7S D;  1VPC A;  2OYI C;  1OXZ A;  3RL0 C;  1JTH B;  2M8R A;  4WY4 A;  2I1J A;  1LT9 A;  2KYV A;  2WSF H;  3V5B A;  2H43 A;  2P7J A;  3CI9 A;  3BAS A;  2P2U A;  3L37 A;  1URQ C;  3BAT A;  3BRT B;  2HOD B;  4WY4 D;  1NTM K;  4IFM A;  2WT7 B;  1LWU A;  2FFD B;  1IFM A;  2N1T C;  2E43 A;  1JY2 O;  2YO3 A;  3L35 A;  1CW5 A;  1IFN A;  1YYC A;  2HPC A;  4DOJ A;  1RY3 A;  2YMY A;  1J1E C;  3VP9 A;  2Q3I A;  4W7Z A;  3C9I A;  3HTK B;  5CJ4 A;  1L4A D;  1T2K D;  1ZR2 A;  3IFM A;  1RF0 C;  4AQR D;  1W2E A;  3N4X A;  5AVR B;  3VMZ A;  2KB7 P;  2HYN A;  1FOS F;  1X9V A;  4GKG A;  2C0X A;  3MGN A;  1FJP A;  3KDP B;  1JMM A;  3HD7 C;  1A02 F;  2HLO A;  1IO4 A;  5AVW B;  2NPS B;  3BVH A;  1JUN A;  1CI6 A;  1EQ7 A;  2HOD A;  4ZKU A;  2N1T D;  3SWF A;  2WZ7 A;  3A5T A;  4WY4 C;  3A7O A;  1MZ9 A;  1FBM A;  3M9B A;  3OAK A;  5CCH C;  1X79 B;  2KP8 A;  1N7L A;  1OWA A;  2KSJ A;  1GL2 B;  1IK9 A;  5AW4 B;  5AVS B;  2CPB A;  2FFD C;  2C0W A;  3B5N B;  1SQP K;  2QM7 A;  4Y99 B;  1M1J A;  4JF7 A;  4XA4 A;  2GM4 A;  1LWU C;  5AW1 B;  3RK3 B;  1MUU A;  1KQL A;  1HBW A;  3B5N C;  1KZU B;  1DEB A;  1LT9 C;  4OH8 B;  2HFE D;  5AVY B;  2WT7 A;  5AW5 B;  1HJB A;  1FOS E;  1RE4 A;  1IFI A;  4LC1 A;  3M91 A;  4B86 A;  3VTP C;  2Q5U A;  5KLV K;  1Z56 A;  3HE4 A;  4WB4 A;  1RF1 C;  1JCC A;  3NMD A;  2J59 M;  3B5N D;  5AVT B;  1H8A A;  1N7S C;  5AVV B;  3HUS C;  4I6M C;  3V2P A;  1NTK K;  2W27 A;  5APY A;  2L5G B;  1G2C B;  3RK3 D;  1LTJ B;  3NXS A;  1FZC B;  1RE3 C;  3H6P A;  5APV A;  2W6B A;  1E5W A;  1L0N K;  5AW9 B;  4JYC A;  2KLV A;  1G1J A;  2YKQ A;  4ZKP A;  1SQB K;  3G3Z A;  1A02 J;  3RK2 C;  3U1C A;  5CJ0 A;  1S9K D;  2NPS C;  4DZO A;  4N78 D;  3TK1 A;  3R2P A;  1RE3 A;  3H32 A;  1SQX K;  4EIJ A;  4C7R A;  1GL2 A;  1NKN A;  3UIA A;  5AW0 B;  4C46 A;  3U59 A;  1XTG B;  1LTI C;  3VN0 A;  1L4A B;  5BU8 B;  4I1L A;  4GIF A;  2I1K A;  4I2L C;  1FZB A;  2NPS A;  4W80 A;  1ZN5 A;  5APU A;  2WSE H;  1VDF A;  3LW5 H;  1JTH A;  1HVV A;  3CL3 D;  1NTZ K;  2ZFC A;  4M3L A;  1GK4 A;  1GDT A;  3A2A A;  1PFI A;  1LTG C;  2WPQ A;  1S9K E;  1NU1 K;  2W6A A;  5AVQ B;  1IFJ A;  3HE5 B;  4EOT A;  1N7S B;  2POH A;  1M7L A;  1NOH A;  2OYH C;  1LWU B;  2HPC B;  2FFD A;  1L4A A;  2Z4E A;  1FZA A;  2XKM A;  1GW3 A;  1JY3 P;  4GT1 A;  4XE5 B;  3L36 A;  2GUS A;  5AVZ B;  3HE4 B;  3HUS A;  1YTZ I;  2ZXE B;  3P8M C;  2Z5H A;  2WWW A;  1JY3 N;  2J58 A;  3P32 A;  1FU1 A;  4HH2 A;  2OYH A;  4IFD K;  1JCD A;  2WPR A;  3VYI A;  1NAF A;  4JYB A;  2FYZ A;  2IFM A;  2BAS A;  3P8C E;  2O01 H;  2PP6 A;  2Q9I A;  1HWT C;  2IPP A;  1AQ5 A;  1WT6 A;  2WPS A;  5KJ7 D;  2R5B A;  5AW6 B;  1N73 C;  1SFC B;  2XV5 A;  1RF0 A;  1T3J A;  1FZF A;  2FYU K;  2OAR A;  3MIW A;  1KIL B;  2XZR A;  3CLQ A;  3NFQ A;  3V2R A;  2R32 A;  1L4A C;  3II6 A;  1FZG A;  1URQ B;  5CMZ A;  2IX7 C;  1J1E B;  1G1I A;  2CPS A;  2GUV A;  1DH3 A;  1DX7 A;  3GHG A;  3B8E B;  2YNY A;  3PP5 A;  3IR9 A;  1H89 A;  3GHG B;  1M1J C;  1GZL A;  1LT9 B;  4AYC A;  2N1T B;  1T2K C;  5AW7 B;  2JJL A;  1YTZ T;  1GW4 A;  4W7Y A;  1MV8 A;  3EFG A;  1JY2 P;  5KJ7 C;  3V2N A;  2A45 H;  1ZLL A;  3VOP A;  1N7S A;  3M06 A;  1LTT C;  3I5C A;  1SFC A;  2KOG A;  1RF1 B;  1SQV K;  1SVF A;  1RF1 A;  1NKZ B;  1SP4 A;  3RL0 B;  3M0D C;  1HUC A;  2YKO A;  3BRV B;  3HD7 B;  1SLQ A;  3OJA B;  2FXM A;  1URQ A;  3E1I A;  2JEE A;  5APS A;  1LTS C;  3M9H A;  1RE4 C;  2YO2 A;  5CCH D;  3KPE A;  2O1J A;  2WTY A;  4IFF A;  1NO4 A;  2WSC H;  3HE5 A;  1QL1 A;  1NH4 A;  4HYT B;  3O8Z A;  5AW8 B;  3GHG C;  1J1D B;  3P7K A;  1SFC C;  3HD7 D;  1JY3 O;  5CCG C;  2P1J A;  2NPS D;  3KYQ A;  3HRN A;  1GTW A;  2QM8 A;  1J1D C;  1JY2 N;  1KIL C;  2MJZ A;  3T97 A;  2OYH B;  3B5N A;  1T3U A;  1M1J B;  1LTJ C;  3LID A;  1ZR4 A;  3SWY A;  1LGH B;  5AW2 B;  2H7H A;  2H8P D;  2E42 A;  1JO5 A;  2XNX A;  2OYI B;  3P8C D;  3RK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...