3L4FA

Crystal structure of betapix coiled-coil domain and shank pdz complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'MEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 7
publication title Structural basis for asymmetric association of the betaPIX coiled coil and shank PDZ
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein/protein binding
total genus 24
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l4fA00
2YKQA 2W6BA 3BRTB 3EQ2A 3L4FA 3BRVB 1JOCA 2YKPA 2YKOA 3CL3D
chains in the Genus database with same CATH superfamily
5KJ7C 1QVGO 3AEEC 3T97A 2NPSD 1GL2D 1SP4A 2WMMA 1KILD 4U3FE 3HTKA 1L0NG 2K9JA 3FX0A 2K1AA 2J59M 5CMZA 1RH5B 2XNXA 1ZMEC 3CX5D 1KN7A 1YQ4C 3H1JE 5KLVK 1RF1A 4HB1A 3PTZA 4UB6E 2PAJA 1SFCA 3GHGC 3FWLA 1OIPA 2GUVA 4TT3H 3L4FA 4AYCA 2P10A 1EC5A 1K73Q 2E42A 4TLFA 4GT1A 1J1EC 2JWDA 1LT9A 3MUDA 1VQMP 1FOSF 3HE5A 4N78E 4RKUJ 3GHGB 1IFPA 3ABVC 2WITA 2FXPA 2ZT9C 4IFDK 2WPVB 4NPFX 1J1EB 3HD7D 1CSBA 1SQPJ 3W67A 2O1KA 5C39A 5AW5B 3S9OA 3O6QB 1NTZG 3TDKA 3M9BA 2A45H 1VF5B 1NTKK 1PIXA 2POHA 3E1RA 1IC2A 4UB6H 4OWFA 1VDFA 5AVWB 5AW6B 1SQBG 1VQ5P 3AE6C 4B86A 4MN4C 1S72P 3H1LD 2FYUJ 5B66E 1URQD 3H1HE 3GF7A 2Y9YA 2FBWC 3G9RA 3L71D 4HH2A 1FOSE 3CC4P 1PPJD 4ZKUA 3I5CA 2HODB 3CX5H 1Z56A 2I1JA 1SQQG 3G3ZA 1L0LG 3M91A 5KKZC 1KYOI 4JBZA 3GHGA 3AE5C 1DD3A 4C7RA 3FWNA 1ZRTE 2LXCB 2P1JA 3LIDA 2OQQA 2KSEA 2KSJA 1NJIQ 3NXSA 5APQA 4RESB 2OYHB 4U3FG 4I1LA 2QEXP 2QM8A 1GZLA 5KAFH 2WSFJ 5KAIE 1EDLA 2A45G 1NTMK 4H13B 3P8CE 1BCCE 3H1JG 2OTLP 1J1DC 1MFTA 1JCDA 1USEA 5CCGC 1IFDA 3IAOA 3L74D 2HYNA 2DW3A 3E1IA 3FXDA 4PV1B 3H1KJ 3SWYA 1SQVE 1J1DB 2GM4A 4WVZA 2P7JA 1RQUA 2I8DA 1FZCB 1IK7A 1OW6A 2ZYAA 2A06G 3AE8C 2Q9IA 2BCCE 1S5LE 4H44C 1LGHB 2H88C 4CPGA 1ZXGA 4HJGH 3GF3A 2YNYA 1WT6A 4DT0A 1AJYA 2WSCJ 1D7MA 3L75D 1GW4A 1GU5A 3H1HJ 2NPSC 1IFMA 1GL2C 3V2PA 1KILC 3M9HA 1M7LA 2J5UA 5KAIH 2G3AA 1SQXD 5DJUB 3KHUA 1L0NK 2J58A 4WWIA 1E79H 5AW1B 2NPSB 1GL2B 1KILB 1OVUA 4WY4D 1BE3E 1HVVA 2W6BA 5APWA 5KLVJ 2RMZA 2KOGA 2ZJSE 1AVYA 1GW3A 4C46A 4YTPC 1PP9E 1RQVA 1OXZA 3CWBG 4Y28J 3HD7C 5KJ7D 1SVFA 3MIWA 5CCGA 1P84E 1PGPA 1NTME 1FZCA 1T3UA 1S4XA 5CHXA 4BRYA 4EDFA 3L71G 1NTZK 1X9VA 1Y9BA 5K5GB 1YJ9P 3H6PA 1MKMA 3AEBC 2FXOA 3V2NA 1N86A 4JYCA 3CCEP 1NTKJ 1OVVA 2BCCJ 1NU1E 3CMEP 4YPCA 3VN0A 1BCCG 2KB7P 1URQC 5CBNA 1LJ2A 1BDDA 2N9BA 2NRGA 2PP6A 2NPSA 3A3YB 3P32A 1GL2A 3A0BE 1VQNP 1KILA 1DEBA 3RBZA 1JMMA 2WSSH 2KNCB 3N7NA 3USSA 3AE3C 3SWKA 5E79H 1SQVG 1ZLLA 1URQB 2ZVNB 2KP8A 2M8RA 1P84H 4IL6E 1KQFB 1YITP 3SFEC 1Y47A 1KTMA 1OWAA 3M9QA 1MFZA 1SQQK 3AECC 1NKNA 1L0LK 1BE3J 2CK3H 2B87B 4R4LA 1LTIC 4OVNF 3L74G 1X22A 2LKMA 3BCCJ 3B71A 5AVYB 4ZKPA 3E7KA 1NAFA 3F5HA 2YMYA 1PP9J 1UIIA 4DOJA 3HD7A 2O3JA 1VQPP 3L70D 3AEFC 1L4AB 1FZEA 3A0BH 1R8EA 1NTMJ 2D2CD 3HUSC 2AXCA 1ZW0A 2Q6QA 2XV5A 2L91A 4Y99C 5APTA 3L75G 2Q3EA 1HBWA 3GLMA 1N73C 1U7JA 4PD4D 3K5BA 4IL6H 5BU8B 2AEFA 1HJ0A 2QVAA 1JOCA 3HTKB 3HUSB 5EFWB 3CCRP 2K9JB 5GTHH 2FYNC 1QL1A 2KNCA 2YKPA 4Y99B 2XNDH 1SQPD 1URQA 1Q2NA 1HJBA 3BVHA 2QRXA 2YIUC 2Y9ZA 4ZNCA 3B4SA 4I2LC 2IYOA 2JR8A 1SQBE 3RK3C 1GK6A 1S9KD 3SSUA 2YIUB 3TGUJ 2B87A 3HE5B 3HE4B 1LP1A 1R5LA 3EWKA 2M5AB 3I55P 3OJAB 2E74C 1KB9E 2P2UA 1NU1G 1M57D 2KK7A 1L0NJ 1S3JA 1SQQE 2PRRA 1LTJC 2IFMA 3Q5RA 1H8AA 2QJYC 3B5ND 4WY4B 2YO3A 1VQ7P 3TSIA 3CCUP 2C0XA 1IFNA 3L36A 1KYOE 2IBZI 5KLIC 3ITKA 2LR2A 1YHQP 1FZGA 2OTKE 3HUSA 1H89A 5KLIB 1WRGA 2H43A 4L76A 2R32A 1N73A 1IJDB 2FFDC 1KFMA 1T8ZA 1RY3A 1KB9H 3L72D 3CCVP 4D6TE 4K35A 1QVFO 3H25A 1NTZJ 1BGYE 2XU6A 2SPZA 1JCCA 1KILE 2P67A 3HE4A 2E75D 2A06E 1NWQA 1M1JC 2M5AA 3CPWO 1HTLC 3H1KD 4LC1A 1KYOH 3WUVA 1SQBJ 3CX5E 2JO1A 3OA7A 1KQSO 1BSHA 3GMAA 3BASA 1AQ5A 1M1JB 1SQVK 4WY4A 3IR9A 4RO0A 1LTGC 1QGKB 2E5TA 2JWAA 2ZT9B 3MZWB 1CI6A 1U7MA 5AVQB 3AEAC 3L70G 2KS1A 2Z4EA 3R4YA 1LTJA 2K9YA 2N1TC 1SQQJ 3S1KA 1MV8A 1L0LJ 4JYBA 1U57A 5KAFE 4PJ0E 4PD4I 1YJNP 2V4HA 3CD6P 2RN0A 3AE2C 3A0HE 1LTBC 5KJ7A 1AQTA 1DD4A 5AW7B 1IK9A 3EQ2A 2AXTE 2R44A 5KLVD 2D2CC 1JY3O 2V7QH 2WPQA 4U3FJ 1SQPG 1N7SD 2ZFCA 3VMAA 1TU3F 3CWBE 3JCUE 3NFQA 2FFDA 3H1JJ 5L8RJ 4AUWA 3RK2D 2KUBA 1SS1A 1YI2P 2KYVA 3EFGA 3L35A 4AQRD 3L71E 5KKZB 2GUSA 1PPJE 1M1JA 1X79B 1HF9A 2YXQB 4PJ0H 1JY2O 1Q90D 2B89A 1EZVD 2W90A 1EDJA 3A0HH 4IFFA 3S4RA 1FDOA 5AW9B 2AXTH 1NTKD 5B5EE 1ZV8A 1GU4A 1OW7A 4D6TG 1BGYG 5APVA 4DZOA 4IOIH 3JCUH 1OFCX 1NU1K 2N1TA 2JDIH 3B5NC 2IX7C 1M90Q 3L73D 1WMKA 2NZ2A 4BWNA 4BRYB 5CCHD 1AA0A 4OGQD 1Q86Q 3QWOC 3WUTA 3OAKA 3L74E 4BXLA 3L72G 4H44B 2R5DA 1FDIA 4UB8E 4N3YB 1W2EA 3RK3D 3H32A 3CC2P 1AV1A 1BSNA 3A2AA 3RL0D 4XA4A 3H1ID 3TK1A 1N7LA 4GKGA 3CWBJ 3BCCD 1PL5A 2E74D 5B5EH 4U7JA 1JEKA 3L75E 3SFDC 3L37A 4JQ0D 1K8AQ 1IFJA 1R5SA 1NH4A 3LIEA 4YXDC 2E75C 3O8ZA 3C9IA 3G6EP 1SQXE 5E79E 1A02F 2WSEH 1K05A 4KT0J 3AE1C 1BCCJ 2W8ZA 1EQ7A 2O01H 3IF4A 1DX7A 2E75B 3Q3DA 1LWUC 3Q5SA 4UB8H 3PLNA 3RGUA 5AW0B 3H1LG 1NOHA 1Q81Q 1YTZT 1QX8A 3M0AA 1L2PA 2BASA 3HD7B 3TNUA 1SQVJ 2K3RA 3VOPA 2IBZD 1PPJG 4LLHA 5KLVG 3B5NA 2WTYA 1KMIZ 1KV4A 1VQ4P 4HYTB 3TGUD 5AVRB 5BU5A 3PRJA 1SQBK 3U59A 2JJLA 4JF7A 1NAYA 5AW8B 2JKVA 2ZXXA 5TJHA 2IYPA 1L0ND 3L74J 2WWWA 2XZRA 2KI7B 1N7SC 2B9BA 1GTWA 1OZHA 2H89C 2E5YA 2ZYGA 1RHZB 1JMBA 4H0LD 1EZVI 3RK2C 1GDTA 5GTHE 1N7SB 1CW5A 2WVRA 1IO4A 4KJMA 1LP1B 3L75J 2N1TD 2ZAEB 1W5CE 3RK2B 2P58A 3CCMP 3MTUE 3TYYA 3OW2O 3V2RA 1GK4A 3VP9A 3D6YA 3L73G 1PGJA 1NTZD 2M0BA 3P8MC 1BDCA 2ITAA 2QJKC 4L74A 3LW5H 1VQ6P 3CXHD 1XTGB 2O1JA 1VL2A 3BATA 3UIAA 4GOFA 2Z5IA 5AVZB 1SQXG 3KDPB 1H88A 5CCHC 2QJKB 3H1IG 3PH0A 1NU1J 3VMYA 3L70E 4C7NA 4OGQC 1N73B 1HGVA 1AVOA 1NO4A 1OX3A 3KZIE 1NKZB 2FYNB 2FXMA 3RBXA 3N4XA 3M06A 1N7SA 3II6A 1G2CA 5CJ4A 2E76C 3B8EB 3AE9C 4PD4E 3RL0C 1DEEG 2RH0A 1A02J 1L0LD 1UIXA 1FDMA 5AW3B 2KZJA 4DJGA 3RK3B 4PV1D 2FYUD 1PFIA 1SQPE 3RL0B 1RE3C 1RE4C 2QE7H 4Z1MH 5AVTB 1JY3P 2E74B 3KXDA 4U3FD 1CI6B 1S9KE 2YMKA 1HH0A 2M3EA 2KS1B 2Y0CA 1FS0E 3CLQA 1KFNA 3H1JD 5GTIH 2IBZG 1LTJB 1IFIA 2G8YA 2QJYB 3KZIH 3CI9A 3P7KA 1JTHB 3KYQA 2KLVA 4IFMA 3V6IA 4PD4H 2HPCA 1LNQA 2K37A 4GIFA 4N78D 3TF5A 2A06D 2QIWA 2YKQA 3IN6A 3Q2YA 1JY2P 2UWJE 2KIKA 1S2EA 1S1CX 5APSA 1VQLP 2Q3IA 5CCHA 3MD0A 1DH3A 1PGQA 2WT7B 2HFED 2W27A 2FFDB 4HKZH 1K9MQ 3L70J 3BRTB 1OMIA 1YJWP 3PHLA 3RL0g 1YIJP 1CZQA 1YYCA 3VYIA 4XE5B 1YTZI 5APXA 1H0TB 1XTCC 1HWTC 4H0LC 3WU2E 1YQ3C 1LTAC 2MKVA 2C0WA 5KTBA 3L72E 4WB4A 2Q7CA 4OH8B 2W83C 1VQKP 3V4WA 3C1LA 5BVZA 3F89A 1VF5C 2AEMA 2R3SA 3H1HD 1RE3A 3V4QA 3AEGC 2B88A 1RE4A 4H0LB 3ZDMA 1QL2A 5AVUB 1PV3A 3H1KE 3D6ZA 3CXHI 1JTHA 3M0DC 1OVRA 1Q7YQ 2OYIC 1HUCA 3CWBD 4W7YA 1EXIA 2N1TB 2Z5HA 4EYYQ 2RKLA 4L73A 2K88A 4EOTA 1ZRTD 4O9BA 2OYIB 3MP7B 1LTTC 3HRNA 2WT7A 1KB9I 3C8VA 3JSVC 3PJSK 3AEDC 2WSFH 3WU2H 3U1CA 2D2CB 1X0TA 3H32B 1RF0C 1T2KD 3H1LE 1NHLA 3GW6A 3CMAP 1H0TA 3P8CD 1BCCD 4D6TJ 1YBKA 5AW2B 1BGYJ 1ZR4A 2KXPB 1SQXK 2OYHC 3JC22 5KLVE 2FYUG 3R2PA 4H13C 2Q1KA 1LT1A 1SQVD 1JB0J 1LTSC 2V7QJ 4KHXA 2JEEA 4A7PA 1L4AD 3D71A 1GD2E 4YXWH 1ZOYC 2A45I 3O6QA 1VQ8P 2BCCD 2BEZF 1HGZA 2BEQD 4PV1C 2WSCH 3L72J 5B66H 1FJPA 1FZCC 2FYZA 2OARA 3NTNA 3A7OA 2PFXA 1KQGB 2YO2A 1EZVE 3M0DA 2FY8A 2QM7A 3Q5PA 3I56P 2OYIA 3TNUB 1K04A 3MHVA 5AVVB 1JNMA 3MGNA 5AVXB 1SFCD 2HR3A 3B5NB 1NTKE 3IFMA 3CX5I 2H7HA 1M56D 1BE3D 2WPRA 1VQOP 2HODA 1IZNB 2IPPA 2E43A 2E76D 5AVSB 4I7ZC 5AW4B 3G71P 3VMXA 3H1KG 3L73E 1NVOA 1G1JA 3VP8A 1J2JB 1PP9D 1RF0A 3CCSP 2QJPC 4GOEA 1M1KQ 1PGOA 2H8PD 2WZ7A 3H1LJ 2XDJA 1KD1Q 4I7ZB 1FE6A 2C9LY 2C9NY 1P84D 1NTMD 3AE7C 3CCQP 2OYHA 3L71J 1KZUB 4W7ZA 1KORA 3RK3E 3CCJP 3CL3D 2QJPB 5M1BA 1KQLA 1ZR2A 2Y0DA 3H1HG 3H1IE 2N9YB 4M3LA 1KC8Q 3SWFA 2HG5D 3BCCE 3PP5A 2XKMA 1S5LH 1JO5A 2CPBA 2HLOA 2QSIA 2KZIA 1NU1D 2ZXEB 2L5GB 1FZAA 2W6JH 1FZBA 1Y8AA 1MUUA 1NYHA 4XFJA 1QLED 1LWUB 1EDKA 2IZ1A 2IDBA 4NPEA 3D70A 2JP3A 5CJ0A 2GA1A 1E5WA 3Q1MA 1GMJA 1QEXA 2QG4A 4LGDE 3KQGA 1FU1A 1W2BO 2R5BA 2YKOA 1JY3N 2WSEJ 3A5TA 4ZMDA 3V2QA 2O01J 2O01N 4W80A 5CBOA 3V5BA 4EIJA 3KPEA 1S5LX 4C7NB 4K3AA 4NPDA 4DCKA 2IBZE 1N2DC 3WUUA 3U1AA 1SQPK 2VRSA 2ZT9D 1AFOA 3L73J 4RJTA 1EZVG 1T2KC 3TGUE 1VF5D 3NMDA 1G2CB 1Q82Q 1JY2N 1NTKG 2BCCG 4JPZB 1VPCA 1NGMB 1L0NE 1T3JA 3CCLP 2KLUA 3QH9A 4R4MA 4WBAA 2ZYDA 1SQXJ 2IZ0A 2FYUK 1ZP0C 3H1IJ 1FBMA 1L4AC 1OW8A 1LWUA 1MZ9A 4ASWA 1X8YA 1JM0A 1EDIA 4GDOA 1BE3G 1DIPA 1EXJA 3BRVB 1SQBD 1N8RQ 5TISE 2YXRB 2HPCB 1RF1C 2I1KA 2OTJP 3T97B 5GTIE 3FXEA 3BCCG 1SFCC 3G4SP 3FGAD 1PP9G 1M8OB 1NTZE 2IFNA 5DJTB 2CPSA 1G1IA 5H2FE 1KB9D 2PGDA 1P84I 1VQ9P 4H13D 5APUA 2WPSA 2ZVOB 1RF1B 1SLQA 3CXHE 4OGQB 1LT9C 1ZN5A 3MUDC 3GG2A 1NTMG 4GODA 1SQQD 1SFCB 3LW5J 4L75A 4I6MC 1JUNA 2AEJA 3WMM0 2Y0EA 3EFFK 1KYOD 2MJZA 2FKWB 1PZQA 2E76B 3W68A 1USDA 1LT9B 2QA4P 5CCGD 2WQYC 1FJKA 2OYOA 4EI2A 4ASVA 4WY4C 3VMZA 4N6JA 5APYA 2LXBA 3CC7P 4IL6X 5TISH 3AE4C 2Q5UA 1FC2C 1L0LE 2OGUA 1L4AA 1FZFA 2W6AA 4H44D 4QMAA 2FYUE 2M3BA 5H2FH 1FAVA 1T6AA 3TGUG 3VTPC 4D6TD 1BGYD 3CXHH 2R3CA
chains in the Genus database with same CATH topology
5KJ7C 3H32B 1RF0C 5AVYB 2NPSD 3T97A 4ZKPA 1T2KD 1GL2D 1IFJA 1NAFA 1NHLA 1SP4A 2YMYA 1NH4A 3LIEA 1KILD 3O8ZA 3C9IA 3HTKA 3P8CD 4DOJA 3HD7A 5AW2B 1ZR4A 2J59M 1L4AB 1FZEA 1SQXK 1A02F 2OYHC 5CMZA 2XNXA 2WSEH 5KLVK 1RF1A 3HUSC 1EQ7A 2O01H 3R2PA 1DX7A 2PAJA 2XV5A 1SFCA 4Y99C 3GHGC 5APTA 1LWUC 1LTSC 4KHXA 2GUVA 3L4FA 1HBWA 1N73C 4AYCA 5AW0B 2JEEA 1L4AD 1NOHA 5BU8B 1GD2E 1YTZT 2E42A 2A45I 3M0AA 1JOCA 3HTKB 4GT1A 3TNUA 2BASA 3HD7B 3HUSB 1J1EC 1LT9A 3MUDA 3VOPA 1HGZA 1FOSF 1QL1A 3HE5A 4N78E 2WSCH 2YKPA 4Y99B 3GHGB 4LLHA 2WITA 3B5NA 1URQA 1FJPA 1HJBA 3BVHA 1FZCC 2WTYA 2FYZA 2OARA 3NTNA 4I2LC 4IFDK 4HYTB 5AVRB 5BU5A 1J1EB 3HD7D 3A7OA 1CSBA 1SQBK 3U59A 3RK3C 2O1KA 1GK6A 2JJLA 2YO2A 5AW5B 4JF7A 3M0DA 2QM7A 5AW8B 1S9KD 2OYIA 3TNUB 2WWWA 5AVVB 3HE5B 3HE4B 3M9BA 2A45H 1JNMA 2XZRA 3MGNA 5AVXB 1SFCD 1N7SC 3B5NB 1GTWA 3IFMA 3OJAB 2H7HA 1NTKK 2POHA 2P2UA 1IC2A 2WPRA 2HODA 1VDFA 2IPPA 5AVWB 5AW6B 2E43A 5AVSB 3RK2C 4B86A 1LTJC 1GDTA 2IFMA 1N7SB 5AW4B 1H8AA 3VMXA 3B5ND 1CW5A 1URQD 4WY4B 2YO3A 3TSIA 1G1JA 2C0XA 1IFNA 3L36A 1J2JB 3VP8A 1IO4A 1RF0A 4HH2A 2N1TD 1FOSE 2H8PD 2WZ7A 4ZKUA 2XDJA 3I5CA 3RK2B 2C9LY 2C9NY 2HODB 3MTUE 3TYYA 1FZGA 1Z56A 2OYHA 2I1JA 3V2RA 1KZUB 4W7ZA 3HUSA 3G3ZA 1H89A 3CL3D 1GK4A 1KQLA 3VP9A 3M91A 1ZR2A 3GHGA 1WRGA 2H43A 2R32A 4C7RA 4M3LA 1N73A 3SWFA 3P8MC 1IJDB 2HG5D 2FFDC 2P1JA 3LIDA 1KFMA 3PP5A 2XKMA 1T8ZA 2KSJA 1RY3A 1JO5A 3LW5H 3NXSA 1XTGB 2CPBA 5APQA 4RESB 2HLOA 2O1JA 2OYHB 2ZXEB 4I1LA 2XU6A 2QM8A 2L5GB 1FZAA 3BATA 1FZBA 3UIAA 1GZLA 2Z5IA 1MUUA 5AVZB 3KDPB 2A45G 1JCCA 1NTMK 2P67A 3HE4A 1H88A 5CCHC 1LWUB 3P8CE 1NWQA 1M1JC 1J1DC 1HTLC 4LC1A 3VMYA 1JCDA 4C7NA 1N73B 5CJ0A 1IFDA 5CCGC 1E5WA 4LGDE 3KQGA 1HGVA 1NO4A 1FU1A 3OA7A 1NKZB 2HYNA 2R5BA 2YKOA 1JY3N 3BASA 2FXMA 3E1IA 3SWYA 3N4XA 3M06A 1N7SA 1AQ5A 1M1JB 3II6A 3A5TA 1SQVK 1J1DB 1G2CA 2GM4A 3V2QA 2P7JA 4WY4A 5CJ4A 3IR9A 1LTGC 3B8EB 3RL0C 1FZCB 4W80A 1A02J 1CI6A 1FDMA 3V5BA 4EIJA 5AVQB 2Q9IA 3KPEA 5AW3B 1LGHB 4C7NB 2Z4EA 3RK3B 1LTJA 1PFIA 1N2DC 2YNYA 3U1AA 1WT6A 2N1TC 1SQPK 1MV8A 2VRSA 3RL0B 4JYBA 1RE3C 1AFOA 1GW4A 1RE4C 1GU5A 2NPSC 1T2KC 1IFMA 1GL2C 3V2PA 3NMDA 1G2CB 1JY3P 1KILC 5AVTB 3M9HA 1M7LA 1LTBC 5KJ7A 1JY2N 1CI6B 1S9KE 5AW7B 1IK9A 1HH0A 3EQ2A 1VPCA 3CLQA 1T3JA 1JY3O 1KFNA 1L0NK 2J58A 1LTJB 5AW1B 2WPQA 2NPSB 1IFIA 1GL2B 1N7SD 1KILB 3CI9A 4WY4D 2ZFCA 4WBAA 3P7KA 1HVVA 2FYUK 2W6BA 5APWA 1JTHB 3KYQA 3NFQA 2FFDA 2KLVA 1FBMA 1L4AC 4IFMA 4AUWA 1LWUA 2KOGA 2HPCA 3RK2D 1MZ9A 2KYVA 1GW3A 4GIFA 4N78D 4C46A 2YKQA 3EFGA 1JY2P 3L35A 4AQRD 1X8YA 5APSA 2GUSA 2Q3IA 5CCHA 3MD0A 1M1JA 1OXZA 1DH3A 1X79B 3HD7C 2WT7B 2HFED 5KJ7D 3BRVB 2W27A 1SVFA 3MIWA 1JY2O 5CCGA 1FZCA 2FFDB 1T3UA 3BRTB 2HPCB 1RF1C 1CZQA 2I1KA 1YYCA 3VYIA 5CHXA 4XE5B 1YTZI 4IFFA 5APXA 1SFCC 5AW9B 1ZV8A 1XTCC 2IFNA 2CPSA 1GU4A 1NTZK 1X9VA 1HWTC 1G1IA 2WPSA 3H6PA 5APVA 1LTAC 5APUA 4DZOA 2C0WA 3V2NA 1N86A 4JYCA 5KTBA 1SLQA 1RF1B 4WB4A 1LT9C 1ZN5A 2Q7CA 4OH8B 1SFCB 3V4WA 1NU1K 5BVZA 2N1TA 3VN0A 2KB7P 3B5NC 4I6MC 2IX7C 1JUNA 1URQC 3WMM0 1RE3A 3V4QA 2N9BA 1RE4A 2PP6A 1QL2A 2NPSA 3A3YB 2MJZA 3P32A 5AVUB 5CCHD 1GL2A 1KILA 2FKWB 1DEBA 1JMMA 1LT9B 5CCGD 3N7NA 3OAKA 1FJKA 1JTHA 3M0DC 1ZLLA 1URQB 2OYIC 1HUCA 4WY4C 3VMZA 2R5DA 4N6JA 4N3YB 2KP8A 4W7YA 1W2EA 3RK3D 2M8RA 3H32A 5APYA 2N1TB 2Z5HA 3A2AA 3RL0D 4XA4A 3TK1A 1OWAA 2Q5UA 3M9QA 1MFZA 1SQQK 1N7LA 4GKGA 1NKNA 1L4AA 4EOTA 4O9BA 1L0LK 1FZFA 2OYIB 2W6AA 1LTTC 3HRNA 2M3BA 2WT7A 1FAVA 1LTIC 2WSFH 3VTPC 3U1CA 2LKMA 2R3CA 3L37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKQ A;  2W6B A;  3BRT B;  3EQ2 A;  3L4F A;  3BRV B;  1JOC A;  2YKP A;  2YKO A;  3CL3 D; 
#chains in the Genus database with same CATH topology
 5KJ7 C;  1QVG O;  3AEE C;  3T97 A;  2NPS D;  1GL2 D;  1SP4 A;  2WMM A;  1KIL D;  4U3F E;  3HTK A;  1L0N G;  2K9J A;  3FX0 A;  2K1A A;  2J59 M;  5CMZ A;  1RH5 B;  2XNX A;  1ZME C;  3CX5 D;  1KN7 A;  1YQ4 C;  3H1J E;  5KLV K;  1RF1 A;  4HB1 A;  3PTZ A;  4UB6 E;  2PAJ A;  1SFC A;  3GHG C;  3FWL A;  1OIP A;  2GUV A;  4TT3 H;  3L4F A;  4AYC A;  2P10 A;  1EC5 A;  1K73 Q;  2E42 A;  4TLF A;  4GT1 A;  1J1E C;  2JWD A;  1LT9 A;  3MUD A;  1VQM P;  1FOS F;  3HE5 A;  4N78 E;  4RKU J;  3GHG B;  1IFP A;  3ABV C;  2WIT A;  2FXP A;  2ZT9 C;  4IFD K;  2WPV B;  4NPF X;  1J1E B;  3HD7 D;  1CSB A;  1SQP J;  3W67 A;  2O1K A;  5C39 A;  5AW5 B;  3S9O A;  3O6Q B;  1NTZ G;  3TDK A;  3M9B A;  2A45 H;  1VF5 B;  1NTK K;  1PIX A;  2POH A;  3E1R A;  1IC2 A;  4UB6 H;  4OWF A;  1VDF A;  5AVW B;  5AW6 B;  1SQB G;  1VQ5 P;  3AE6 C;  4B86 A;  4MN4 C;  1S72 P;  3H1L D;  2FYU J;  5B66 E;  1URQ D;  3H1H E;  3GF7 A;  2Y9Y A;  2FBW C;  3G9R A;  3L71 D;  4HH2 A;  1FOS E;  3CC4 P;  1PPJ D;  4ZKU A;  3I5C A;  2HOD B;  3CX5 H;  1Z56 A;  2I1J A;  1SQQ G;  3G3Z A;  1L0L G;  3M91 A;  5KKZ C;  1KYO I;  4JBZ A;  3GHG A;  3AE5 C;  1DD3 A;  4C7R A;  3FWN A;  1ZRT E;  2LXC B;  2P1J A;  3LID A;  2OQQ A;  2KSE A;  2KSJ A;  1NJI Q;  3NXS A;  5APQ A;  4RES B;  2OYH B;  4U3F G;  4I1L A;  2QEX P;  2QM8 A;  1GZL A;  5KAF H;  2WSF J;  5KAI E;  1EDL A;  2A45 G;  1NTM K;  4H13 B;  3P8C E;  1BCC E;  3H1J G;  2OTL P;  1J1D C;  1MFT A;  1JCD A;  1USE A;  5CCG C;  1IFD A;  3IAO A;  3L74 D;  2HYN A;  2DW3 A;  3E1I A;  3FXD A;  4PV1 B;  3H1K J;  3SWY A;  1SQV E;  1J1D B;  2GM4 A;  4WVZ A;  2P7J A;  1RQU A;  2I8D A;  1FZC B;  1IK7 A;  1OW6 A;  2ZYA A;  2A06 G;  3AE8 C;  2Q9I A;  2BCC E;  1S5L E;  4H44 C;  1LGH B;  2H88 C;  4CPG A;  1ZXG A;  4HJG H;  3GF3 A;  2YNY A;  1WT6 A;  4DT0 A;  1AJY A;  2WSC J;  1D7M A;  3L75 D;  1GW4 A;  1GU5 A;  3H1H J;  2NPS C;  1IFM A;  1GL2 C;  3V2P A;  1KIL C;  3M9H A;  1M7L A;  2J5U A;  5KAI H;  2G3A A;  1SQX D;  5DJU B;  3KHU A;  1L0N K;  2J58 A;  4WWI A;  1E79 H;  5AW1 B;  2NPS B;  1GL2 B;  1KIL B;  1OVU A;  4WY4 D;  1BE3 E;  1HVV A;  2W6B A;  5APW A;  5KLV J;  2RMZ A;  2KOG A;  2ZJS E;  1AVY A;  1GW3 A;  4C46 A;  4YTP C;  1PP9 E;  1RQV A;  1OXZ A;  3CWB G;  4Y28 J;  3HD7 C;  5KJ7 D;  1SVF A;  3MIW A;  5CCG A;  1P84 E;  1PGP A;  1NTM E;  1FZC A;  1T3U A;  1S4X A;  5CHX A;  4BRY A;  4EDF A;  3L71 G;  1NTZ K;  1X9V A;  1Y9B A;  5K5G B;  1YJ9 P;  3H6P A;  1MKM A;  3AEB C;  2FXO A;  3V2N A;  1N86 A;  4JYC A;  3CCE P;  1NTK J;  1OVV A;  2BCC J;  1NU1 E;  3CME P;  4YPC A;  3VN0 A;  1BCC G;  2KB7 P;  1URQ C;  5CBN A;  1LJ2 A;  1BDD A;  2N9B A;  2NRG A;  2PP6 A;  2NPS A;  3A3Y B;  3P32 A;  1GL2 A;  3A0B E;  1VQN P;  1KIL A;  1DEB A;  3RBZ A;  1JMM A;  2WSS H;  2KNC B;  3N7N A;  3USS A;  3AE3 C;  3SWK A;  5E79 H;  1SQV G;  1ZLL A;  1URQ B;  2ZVN B;  2KP8 A;  2M8R A;  1P84 H;  4IL6 E;  1KQF B;  1YIT P;  3SFE C;  1Y47 A;  1KTM A;  1OWA A;  3M9Q A;  1MFZ A;  1SQQ K;  3AEC C;  1NKN A;  1L0L K;  1BE3 J;  2CK3 H;  2B87 B;  4R4L A;  1LTI C;  4OVN F;  3L74 G;  1X22 A;  2LKM A;  3BCC J;  3B71 A;  5AVY B;  4ZKP A;  3E7K A;  1NAF A;  3F5H A;  2YMY A;  1PP9 J;  1UII A;  4DOJ A;  3HD7 A;  2O3J A;  1VQP P;  3L70 D;  3AEF C;  1L4A B;  1FZE A;  3A0B H;  1R8E A;  1NTM J;  2D2C D;  3HUS C;  2AXC A;  1ZW0 A;  2Q6Q A;  2XV5 A;  2L91 A;  4Y99 C;  5APT A;  3L75 G;  2Q3E A;  1HBW A;  3GLM A;  1N73 C;  1U7J A;  4PD4 D;  3K5B A;  4IL6 H;  5BU8 B;  2AEF A;  1HJ0 A;  2QVA A;  1JOC A;  3HTK B;  3HUS B;  5EFW B;  3CCR P;  2K9J B;  5GTH H;  2FYN C;  1QL1 A;  2KNC A;  2YKP A;  4Y99 B;  2XND H;  1SQP D;  1URQ A;  1Q2N A;  1HJB A;  3BVH A;  2QRX A;  2YIU C;  2Y9Z A;  4ZNC A;  3B4S A;  4I2L C;  2IYO A;  2JR8 A;  1SQB E;  3RK3 C;  1GK6 A;  1S9K D;  3SSU A;  2YIU B;  3TGU J;  2B87 A;  3HE5 B;  3HE4 B;  1LP1 A;  1R5L A;  3EWK A;  2M5A B;  3I55 P;  3OJA B;  2E74 C;  1KB9 E;  2P2U A;  1NU1 G;  1M57 D;  2KK7 A;  1L0N J;  1S3J A;  1SQQ E;  2PRR A;  1LTJ C;  2IFM A;  3Q5R A;  1H8A A;  2QJY C;  3B5N D;  4WY4 B;  2YO3 A;  1VQ7 P;  3TSI A;  3CCU P;  2C0X A;  1IFN A;  3L36 A;  1KYO E;  2IBZ I;  5KLI C;  3ITK A;  2LR2 A;  1YHQ P;  1FZG A;  2OTK E;  3HUS A;  1H89 A;  5KLI B;  1WRG A;  2H43 A;  4L76 A;  2R32 A;  1N73 A;  1IJD B;  2FFD C;  1KFM A;  1T8Z A;  1RY3 A;  1KB9 H;  3L72 D;  3CCV P;  4D6T E;  4K35 A;  1QVF O;  3H25 A;  1NTZ J;  1BGY E;  2XU6 A;  2SPZ A;  1JCC A;  1KIL E;  2P67 A;  3HE4 A;  2E75 D;  2A06 E;  1NWQ A;  1M1J C;  2M5A A;  3CPW O;  1HTL C;  3H1K D;  4LC1 A;  1KYO H;  3WUV A;  1SQB J;  3CX5 E;  2JO1 A;  3OA7 A;  1KQS O;  1BSH A;  3GMA A;  3BAS A;  1AQ5 A;  1M1J B;  1SQV K;  4WY4 A;  3IR9 A;  4RO0 A;  1LTG C;  1QGK B;  2E5T A;  2JWA A;  2ZT9 B;  3MZW B;  1CI6 A;  1U7M A;  5AVQ B;  3AEA C;  3L70 G;  2KS1 A;  2Z4E A;  3R4Y A;  1LTJ A;  2K9Y A;  2N1T C;  1SQQ J;  3S1K A;  1MV8 A;  1L0L J;  4JYB A;  1U57 A;  5KAF E;  4PJ0 E;  4PD4 I;  1YJN P;  2V4H A;  3CD6 P;  2RN0 A;  3AE2 C;  3A0H E;  1LTB C;  5KJ7 A;  1AQT A;  1DD4 A;  5AW7 B;  1IK9 A;  3EQ2 A;  2AXT E;  2R44 A;  5KLV D;  2D2C C;  1JY3 O;  2V7Q H;  2WPQ A;  4U3F J;  1SQP G;  1N7S D;  2ZFC A;  3VMA A;  1TU3 F;  3CWB E;  3JCU E;  3NFQ A;  2FFD A;  3H1J J;  5L8R J;  4AUW A;  3RK2 D;  2KUB A;  1SS1 A;  1YI2 P;  2KYV A;  3EFG A;  3L35 A;  4AQR D;  3L71 E;  5KKZ B;  2GUS A;  1PPJ E;  1M1J A;  1X79 B;  1HF9 A;  2YXQ B;  4PJ0 H;  1JY2 O;  1Q90 D;  2B89 A;  1EZV D;  2W90 A;  1EDJ A;  3A0H H;  4IFF A;  3S4R A;  1FDO A;  5AW9 B;  2AXT H;  1NTK D;  5B5E E;  1ZV8 A;  1GU4 A;  1OW7 A;  4D6T G;  1BGY G;  5APV A;  4DZO A;  4IOI H;  3JCU H;  1OFC X;  1NU1 K;  2N1T A;  2JDI H;  3B5N C;  2IX7 C;  1M90 Q;  3L73 D;  1WMK A;  2NZ2 A;  4BWN A;  4BRY B;  5CCH D;  1AA0 A;  4OGQ D;  1Q86 Q;  3QWO C;  3WUT A;  3OAK A;  3L74 E;  4BXL A;  3L72 G;  4H44 B;  2R5D A;  1FDI A;  4UB8 E;  4N3Y B;  1W2E A;  3RK3 D;  3H32 A;  3CC2 P;  1AV1 A;  1BSN A;  3A2A A;  3RL0 D;  4XA4 A;  3H1I D;  3TK1 A;  1N7L A;  4GKG A;  3CWB J;  3BCC D;  1PL5 A;  2E74 D;  5B5E H;  4U7J A;  1JEK A;  3L75 E;  3SFD C;  3L37 A;  4JQ0 D;  1K8A Q;  1IFJ A;  1R5S A;  1NH4 A;  3LIE A;  4YXD C;  2E75 C;  3O8Z A;  3C9I A;  3G6E P;  1SQX E;  5E79 E;  1A02 F;  2WSE H;  1K05 A;  4KT0 J;  3AE1 C;  1BCC J;  2W8Z A;  1EQ7 A;  2O01 H;  3IF4 A;  1DX7 A;  2E75 B;  3Q3D A;  1LWU C;  3Q5S A;  4UB8 H;  3PLN A;  3RGU A;  5AW0 B;  3H1L G;  1NOH A;  1Q81 Q;  1YTZ T;  1QX8 A;  3M0A A;  1L2P A;  2BAS A;  3HD7 B;  3TNU A;  1SQV J;  2K3R A;  3VOP A;  2IBZ D;  1PPJ G;  4LLH A;  5KLV G;  3B5N A;  2WTY A;  1KMI Z;  1KV4 A;  1VQ4 P;  4HYT B;  3TGU D;  5AVR B;  5BU5 A;  3PRJ A;  1SQB K;  3U59 A;  2JJL A;  4JF7 A;  1NAY A;  5AW8 B;  2JKV A;  2ZXX A;  5TJH A;  2IYP A;  1L0N D;  3L74 J;  2WWW A;  2XZR A;  2KI7 B;  1N7S C;  2B9B A;  1GTW A;  1OZH A;  2H89 C;  2E5Y A;  2ZYG A;  1RHZ B;  1JMB A;  4H0L D;  1EZV I;  3RK2 C;  1GDT A;  5GTH E;  1N7S B;  1CW5 A;  2WVR A;  1IO4 A;  4KJM A;  1LP1 B;  3L75 J;  2N1T D;  2ZAE B;  1W5C E;  3RK2 B;  2P58 A;  3CCM P;  3MTU E;  3TYY A;  3OW2 O;  3V2R A;  1GK4 A;  3VP9 A;  3D6Y A;  3L73 G;  1PGJ A;  1NTZ D;  2M0B A;  3P8M C;  1BDC A;  2ITA A;  2QJK C;  4L74 A;  3LW5 H;  1VQ6 P;  3CXH D;  1XTG B;  2O1J A;  1VL2 A;  3BAT A;  3UIA A;  4GOF A;  2Z5I A;  5AVZ B;  1SQX G;  3KDP B;  1H88 A;  5CCH C;  2QJK B;  3H1I G;  3PH0 A;  1NU1 J;  3VMY A;  3L70 E;  4C7N A;  4OGQ C;  1N73 B;  1HGV A;  1AVO A;  1NO4 A;  1OX3 A;  3KZI E;  1NKZ B;  2FYN B;  2FXM A;  3RBX A;  3N4X A;  3M06 A;  1N7S A;  3II6 A;  1G2C A;  5CJ4 A;  2E76 C;  3B8E B;  3AE9 C;  4PD4 E;  3RL0 C;  1DEE G;  2RH0 A;  1A02 J;  1L0L D;  1UIX A;  1FDM A;  5AW3 B;  2KZJ A;  4DJG A;  3RK3 B;  4PV1 D;  2FYU D;  1PFI A;  1SQP E;  3RL0 B;  1RE3 C;  1RE4 C;  2QE7 H;  4Z1M H;  5AVT B;  1JY3 P;  2E74 B;  3KXD A;  4U3F D;  1CI6 B;  1S9K E;  2YMK A;  1HH0 A;  2M3E A;  2KS1 B;  2Y0C A;  1FS0 E;  3CLQ A;  1KFN A;  3H1J D;  5GTI H;  2IBZ G;  1LTJ B;  1IFI A;  2G8Y A;  2QJY B;  3KZI H;  3CI9 A;  3P7K A;  1JTH B;  3KYQ A;  2KLV A;  4IFM A;  3V6I A;  4PD4 H;  2HPC A;  1LNQ A;  2K37 A;  4GIF A;  4N78 D;  3TF5 A;  2A06 D;  2QIW A;  2YKQ A;  3IN6 A;  3Q2Y A;  1JY2 P;  2UWJ E;  2KIK A;  1S2E A;  1S1C X;  5APS A;  1VQL P;  2Q3I A;  5CCH A;  3MD0 A;  1DH3 A;  1PGQ A;  2WT7 B;  2HFE D;  2W27 A;  2FFD B;  4HKZ H;  1K9M Q;  3L70 J;  3BRT B;  1OMI A;  1YJW P;  3PHL A;  3RL0 g;  1YIJ P;  1CZQ A;  1YYC A;  3VYI A;  4XE5 B;  1YTZ I;  5APX A;  1H0T B;  1XTC C;  1HWT C;  4H0L C;  3WU2 E;  1YQ3 C;  1LTA C;  2MKV A;  2C0W A;  5KTB A;  3L72 E;  4WB4 A;  2Q7C A;  4OH8 B;  2W83 C;  1VQK P;  3V4W A;  3C1L A;  5BVZ A;  3F89 A;  1VF5 C;  2AEM A;  2R3S A;  3H1H D;  1RE3 A;  3V4Q A;  3AEG C;  2B88 A;  1RE4 A;  4H0L B;  3ZDM A;  1QL2 A;  5AVU B;  1PV3 A;  3H1K E;  3D6Z A;  3CXH I;  1JTH A;  3M0D C;  1OVR A;  1Q7Y Q;  2OYI C;  1HUC A;  3CWB D;  4W7Y A;  1EXI A;  2N1T B;  2Z5H A;  4EYY Q;  2RKL A;  4L73 A;  2K88 A;  4EOT A;  1ZRT D;  4O9B A;  2OYI B;  3MP7 B;  1LTT C;  3HRN A;  2WT7 A;  1KB9 I;  3C8V A;  3JSV C;  3PJS K;  3AED C;  2WSF H;  3WU2 H;  3U1C A;  2D2C B;  1X0T A;  3H32 B;  1RF0 C;  1T2K D;  3H1L E;  1NHL A;  3GW6 A;  3CMA P;  1H0T A;  3P8C D;  1BCC D;  4D6T J;  1YBK A;  5AW2 B;  1BGY J;  1ZR4 A;  2KXP B;  1SQX K;  2OYH C;  3JC2 2;  5KLV E;  2FYU G;  3R2P A;  4H13 C;  2Q1K A;  1LT1 A;  1SQV D;  1JB0 J;  1LTS C;  2V7Q J;  4KHX A;  2JEE A;  4A7P A;  1L4A D;  3D71 A;  1GD2 E;  4YXW H;  1ZOY C;  2A45 I;  3O6Q A;  1VQ8 P;  2BCC D;  2BEZ F;  1HGZ A;  2BEQ D;  4PV1 C;  2WSC H;  3L72 J;  5B66 H;  1FJP A;  1FZC C;  2FYZ A;  2OAR A;  3NTN A;  3A7O A;  2PFX A;  1KQG B;  2YO2 A;  1EZV E;  3M0D A;  2FY8 A;  2QM7 A;  3Q5P A;  3I56 P;  2OYI A;  3TNU B;  1K04 A;  3MHV A;  5AVV B;  1JNM A;  3MGN A;  5AVX B;  1SFC D;  2HR3 A;  3B5N B;  1NTK E;  3IFM A;  3CX5 I;  2H7H A;  1M56 D;  1BE3 D;  2WPR A;  1VQO P;  2HOD A;  1IZN B;  2IPP A;  2E43 A;  2E76 D;  5AVS B;  4I7Z C;  5AW4 B;  3G71 P;  3VMX A;  3H1K G;  3L73 E;  1NVO A;  1G1J A;  3VP8 A;  1J2J B;  1PP9 D;  1RF0 A;  3CCS P;  2QJP C;  4GOE A;  1M1K Q;  1PGO A;  2H8P D;  2WZ7 A;  3H1L J;  2XDJ A;  1KD1 Q;  4I7Z B;  1FE6 A;  2C9L Y;  2C9N Y;  1P84 D;  1NTM D;  3AE7 C;  3CCQ P;  2OYH A;  3L71 J;  1KZU B;  4W7Z A;  1KOR A;  3RK3 E;  3CCJ P;  3CL3 D;  2QJP B;  5M1B A;  1KQL A;  1ZR2 A;  2Y0D A;  3H1H G;  3H1I E;  2N9Y B;  4M3L A;  1KC8 Q;  3SWF A;  2HG5 D;  3BCC E;  3PP5 A;  2XKM A;  1S5L H;  1JO5 A;  2CPB A;  2HLO A;  2QSI A;  2KZI A;  1NU1 D;  2ZXE B;  2L5G B;  1FZA A;  2W6J H;  1FZB A;  1Y8A A;  1MUU A;  1NYH A;  4XFJ A;  1QLE D;  1LWU B;  1EDK A;  2IZ1 A;  2IDB A;  4NPE A;  3D70 A;  2JP3 A;  5CJ0 A;  2GA1 A;  1E5W A;  3Q1M A;  1GMJ A;  1QEX A;  2QG4 A;  4LGD E;  3KQG A;  1FU1 A;  1W2B O;  2R5B A;  2YKO A;  1JY3 N;  2WSE J;  3A5T A;  4ZMD A;  3V2Q A;  2O01 J;  2O01 N;  4W80 A;  5CBO A;  3V5B A;  4EIJ A;  3KPE A;  1S5L X;  4C7N B;  4K3A A;  4NPD A;  4DCK A;  2IBZ E;  1N2D C;  3WUU A;  3U1A A;  1SQP K;  2VRS A;  2ZT9 D;  1AFO A;  3L73 J;  4RJT A;  1EZV G;  1T2K C;  3TGU E;  1VF5 D;  3NMD A;  1G2C B;  1Q82 Q;  1JY2 N;  1NTK G;  2BCC G;  4JPZ B;  1VPC A;  1NGM B;  1L0N E;  1T3J A;  3CCL P;  2KLU A;  3QH9 A;  4R4M A;  4WBA A;  2ZYD A;  1SQX J;  2IZ0 A;  2FYU K;  1ZP0 C;  3H1I J;  1FBM A;  1L4A C;  1OW8 A;  1LWU A;  1MZ9 A;  4ASW A;  1X8Y A;  1JM0 A;  1EDI A;  4GDO A;  1BE3 G;  1DIP A;  1EXJ A;  3BRV B;  1SQB D;  1N8R Q;  5TIS E;  2YXR B;  2HPC B;  1RF1 C;  2I1K A;  2OTJ P;  3T97 B;  5GTI E;  3FXE A;  3BCC G;  1SFC C;  3G4S P;  3FGA D;  1PP9 G;  1M8O B;  1NTZ E;  2IFN A;  5DJT B;  2CPS A;  1G1I A;  5H2F E;  1KB9 D;  2PGD A;  1P84 I;  1VQ9 P;  4H13 D;  5APU A;  2WPS A;  2ZVO B;  1RF1 B;  1SLQ A;  3CXH E;  4OGQ B;  1LT9 C;  1ZN5 A;  3MUD C;  3GG2 A;  1NTM G;  4GOD A;  1SQQ D;  1SFC B;  3LW5 J;  4L75 A;  4I6M C;  1JUN A;  2AEJ A;  3WMM 0;  2Y0E A;  3EFF K;  1KYO D;  2MJZ A;  2FKW B;  1PZQ A;  2E76 B;  3W68 A;  1USD A;  1LT9 B;  2QA4 P;  5CCG D;  2WQY C;  1FJK A;  2OYO A;  4EI2 A;  4ASV A;  4WY4 C;  3VMZ A;  4N6J A;  5APY A;  2LXB A;  3CC7 P;  4IL6 X;  5TIS H;  3AE4 C;  2Q5U A;  1FC2 C;  1L0L E;  2OGU A;  1L4A A;  1FZF A;  2W6A A;  4H44 D;  4QMA A;  2FYU E;  2M3B A;  5H2F H;  1FAV A;  1T6A A;  3TGU G;  3VTP C;  4D6T D;  1BGY D;  3CXH H;  2R3C A; 
#chains in the Genus database with same CATH homology
 5KJ7 C;  3H32 B;  1RF0 C;  5AVY B;  2NPS D;  3T97 A;  4ZKP A;  1T2K D;  1GL2 D;  1IFJ A;  1NAF A;  1NHL A;  1SP4 A;  2YMY A;  1NH4 A;  3LIE A;  1KIL D;  3O8Z A;  3C9I A;  3HTK A;  3P8C D;  4DOJ A;  3HD7 A;  5AW2 B;  1ZR4 A;  2J59 M;  1L4A B;  1FZE A;  1SQX K;  1A02 F;  2OYH C;  5CMZ A;  2XNX A;  2WSE H;  5KLV K;  1RF1 A;  3HUS C;  1EQ7 A;  2O01 H;  3R2P A;  1DX7 A;  2PAJ A;  2XV5 A;  1SFC A;  4Y99 C;  3GHG C;  5APT A;  1LWU C;  1LTS C;  4KHX A;  2GUV A;  3L4F A;  1HBW A;  1N73 C;  4AYC A;  5AW0 B;  2JEE A;  1L4A D;  1NOH A;  5BU8 B;  1GD2 E;  1YTZ T;  2E42 A;  2A45 I;  3M0A A;  1JOC A;  3HTK B;  4GT1 A;  3TNU A;  2BAS A;  3HD7 B;  3HUS B;  1J1E C;  1LT9 A;  3MUD A;  3VOP A;  1HGZ A;  1FOS F;  1QL1 A;  3HE5 A;  4N78 E;  2WSC H;  2YKP A;  4Y99 B;  3GHG B;  4LLH A;  2WIT A;  3B5N A;  1URQ A;  1FJP A;  1HJB A;  3BVH A;  1FZC C;  2WTY A;  2FYZ A;  2OAR A;  3NTN A;  4I2L C;  4IFD K;  4HYT B;  5AVR B;  5BU5 A;  1J1E B;  3HD7 D;  3A7O A;  1CSB A;  1SQB K;  3U59 A;  3RK3 C;  2O1K A;  1GK6 A;  2JJL A;  2YO2 A;  5AW5 B;  4JF7 A;  3M0D A;  2QM7 A;  5AW8 B;  1S9K D;  2OYI A;  3TNU B;  2WWW A;  5AVV B;  3HE5 B;  3HE4 B;  3M9B A;  2A45 H;  1JNM A;  2XZR A;  3MGN A;  5AVX B;  1SFC D;  1N7S C;  3B5N B;  1GTW A;  3IFM A;  3OJA B;  2H7H A;  1NTK K;  2POH A;  2P2U A;  1IC2 A;  2WPR A;  2HOD A;  1VDF A;  2IPP A;  5AVW B;  5AW6 B;  2E43 A;  5AVS B;  3RK2 C;  4B86 A;  1LTJ C;  1GDT A;  2IFM A;  1N7S B;  5AW4 B;  1H8A A;  3VMX A;  3B5N D;  1CW5 A;  1URQ D;  4WY4 B;  2YO3 A;  3TSI A;  1G1J A;  2C0X A;  1IFN A;  3L36 A;  1J2J B;  3VP8 A;  1IO4 A;  1RF0 A;  4HH2 A;  2N1T D;  1FOS E;  2H8P D;  2WZ7 A;  4ZKU A;  2XDJ A;  3I5C A;  3RK2 B;  2C9L Y;  2C9N Y;  2HOD B;  3MTU E;  3TYY A;  1FZG A;  1Z56 A;  2OYH A;  2I1J A;  3V2R A;  1KZU B;  4W7Z A;  3HUS A;  3G3Z A;  1H89 A;  3CL3 D;  1GK4 A;  1KQL A;  3VP9 A;  3M91 A;  1ZR2 A;  3GHG A;  1WRG A;  2H43 A;  2R32 A;  4C7R A;  4M3L A;  1N73 A;  3SWF A;  3P8M C;  1IJD B;  2HG5 D;  2FFD C;  2P1J A;  3LID A;  1KFM A;  3PP5 A;  2XKM A;  1T8Z A;  2KSJ A;  1RY3 A;  1JO5 A;  3LW5 H;  3NXS A;  1XTG B;  2CPB A;  5APQ A;  4RES B;  2HLO A;  2O1J A;  2OYH B;  2ZXE B;  4I1L A;  2XU6 A;  2QM8 A;  2L5G B;  1FZA A;  3BAT A;  1FZB A;  3UIA A;  1GZL A;  2Z5I A;  1MUU A;  5AVZ B;  3KDP B;  2A45 G;  1JCC A;  1NTM K;  2P67 A;  3HE4 A;  1H88 A;  5CCH C;  1LWU B;  3P8C E;  1NWQ A;  1M1J C;  1J1D C;  1HTL C;  4LC1 A;  3VMY A;  1JCD A;  4C7N A;  1N73 B;  5CJ0 A;  1IFD A;  5CCG C;  1E5W A;  4LGD E;  3KQG A;  1HGV A;  1NO4 A;  1FU1 A;  3OA7 A;  1NKZ B;  2HYN A;  2R5B A;  2YKO A;  1JY3 N;  3BAS A;  2FXM A;  3E1I A;  3SWY A;  3N4X A;  3M06 A;  1N7S A;  1AQ5 A;  1M1J B;  3II6 A;  3A5T A;  1SQV K;  1J1D B;  1G2C A;  2GM4 A;  3V2Q A;  2P7J A;  4WY4 A;  5CJ4 A;  3IR9 A;  1LTG C;  3B8E B;  3RL0 C;  1FZC B;  4W80 A;  1A02 J;  1CI6 A;  1FDM A;  3V5B A;  4EIJ A;  5AVQ B;  2Q9I A;  3KPE A;  5AW3 B;  1LGH B;  4C7N B;  2Z4E A;  3RK3 B;  1LTJ A;  1PFI A;  1N2D C;  2YNY A;  3U1A A;  1WT6 A;  2N1T C;  1SQP K;  1MV8 A;  2VRS A;  3RL0 B;  4JYB A;  1RE3 C;  1AFO A;  1GW4 A;  1RE4 C;  1GU5 A;  2NPS C;  1T2K C;  1IFM A;  1GL2 C;  3V2P A;  3NMD A;  1G2C B;  1JY3 P;  1KIL C;  5AVT B;  3M9H A;  1M7L A;  1LTB C;  5KJ7 A;  1JY2 N;  1CI6 B;  1S9K E;  5AW7 B;  1IK9 A;  1HH0 A;  3EQ2 A;  1VPC A;  3CLQ A;  1T3J A;  1JY3 O;  1KFN A;  1L0N K;  2J58 A;  1LTJ B;  5AW1 B;  2WPQ A;  2NPS B;  1IFI A;  1GL2 B;  1N7S D;  1KIL B;  3CI9 A;  4WY4 D;  2ZFC A;  4WBA A;  3P7K A;  1HVV A;  2FYU K;  2W6B A;  5APW A;  1JTH B;  3KYQ A;  3NFQ A;  2FFD A;  2KLV A;  1FBM A;  1L4A C;  4IFM A;  4AUW A;  1LWU A;  2KOG A;  2HPC A;  3RK2 D;  1MZ9 A;  2KYV A;  1GW3 A;  4GIF A;  4N78 D;  4C46 A;  2YKQ A;  3EFG A;  1JY2 P;  3L35 A;  4AQR D;  1X8Y A;  5APS A;  2GUS A;  2Q3I A;  5CCH A;  3MD0 A;  1M1J A;  1OXZ A;  1DH3 A;  1X79 B;  3HD7 C;  2WT7 B;  2HFE D;  5KJ7 D;  3BRV B;  2W27 A;  1SVF A;  3MIW A;  1JY2 O;  5CCG A;  1FZC A;  2FFD B;  1T3U A;  3BRT B;  2HPC B;  1RF1 C;  1CZQ A;  2I1K A;  1YYC A;  3VYI A;  5CHX A;  4XE5 B;  1YTZ I;  4IFF A;  5APX A;  1SFC C;  5AW9 B;  1ZV8 A;  1XTC C;  2IFN A;  2CPS A;  1GU4 A;  1NTZ K;  1X9V A;  1HWT C;  1G1I A;  2WPS A;  3H6P A;  5APV A;  1LTA C;  5APU A;  4DZO A;  2C0W A;  3V2N A;  1N86 A;  4JYC A;  5KTB A;  1SLQ A;  1RF1 B;  4WB4 A;  1LT9 C;  1ZN5 A;  2Q7C A;  4OH8 B;  1SFC B;  3V4W A;  1NU1 K;  5BVZ A;  2N1T A;  3VN0 A;  2KB7 P;  3B5N C;  4I6M C;  2IX7 C;  1JUN A;  1URQ C;  3WMM 0;  1RE3 A;  3V4Q A;  2N9B A;  1RE4 A;  2PP6 A;  1QL2 A;  2NPS A;  3A3Y B;  2MJZ A;  3P32 A;  5AVU B;  5CCH D;  1GL2 A;  1KIL A;  2FKW B;  1DEB A;  1JMM A;  1LT9 B;  5CCG D;  3N7N A;  3OAK A;  1FJK A;  1JTH A;  3M0D C;  1ZLL A;  1URQ B;  2OYI C;  1HUC A;  4WY4 C;  3VMZ A;  2R5D A;  4N6J A;  4N3Y B;  2KP8 A;  4W7Y A;  1W2E A;  3RK3 D;  2M8R A;  3H32 A;  5APY A;  2N1T B;  2Z5H A;  3A2A A;  3RL0 D;  4XA4 A;  3TK1 A;  1OWA A;  2Q5U A;  3M9Q A;  1MFZ A;  1SQQ K;  1N7L A;  4GKG A;  1NKN A;  1L4A A;  4EOT A;  4O9B A;  1L0L K;  1FZF A;  2OYI B;  2W6A A;  1LTT C;  3HRN A;  2M3B A;  2WT7 A;  1FAV A;  1LTI C;  2WSF H;  3VTP C;  3U1C A;  2LKM A;  2R3C A;  3L37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...