3L4FA

Crystal structure of betapix coiled-coil domain and shank pdz complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
MEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for asymmetric association of the betaPIX coiled coil and shank PDZ
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein/protein binding
molecule keywords Rho guanine nucleotide exchange factor 7
total genus 24
structure length 61
sequence length 61
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l4fA00
2YKOA 2YKPA 2W6BA 2YKQA 3EQ2A 1JOCA 3CL3D 3BRTB 3L4FA 3BRVB
chains in the Genus database with same CATH superfamily
3HD7A 1GU4A 1XTCC 1KYOH 1NTKE 1PZQA 1NTZD 3CLQA 5CCHD 1NH4A 1KQFB 1MV8A 1VQ7P 2OTKE 1BCCE 3AEAC 3CXHI 4IFMA 3H6PA 1SFCB 3CXHH 1M1KQ 2R3SA 3CWBD 1Q81Q 4I7ZC 1PGOA 3JC22 2PGDA 3H1KJ 3HUSB 1U7MA 2JKVA 2H8PD 1VDFA 2FYNC 1IFNA 3PRJA 3Q1MA 2AEJA 3E7KA 1OZHA 1Q90D 1SQBK 2YMKA 3BATA 1R5SA 3M0DC 1VF5D 1LTJB 1SLQA 1SQXJ 3MP7B 4RKUJ 4AQRD 1FZFA 2Z4EA 5APWA 5KKZB 1G1IA 3RK3D 1KILB 1NTZE 3L70J 2K1AA 1FZCC 3L74D 5AVUB 4C7NA 1BSNA 1M57D 4Y99C 1E79H 2HG5D 2WITA 3L36A 5AW0B 1SQXE 1RF1A 2V7QJ 1AA0A 3L70G 5AW6B 4Z1MH 2KZJA 3L75E 5KLVE 1KN7A 4JF7A 1SQBJ 2E5TA 2QJPB 4HYTB 1SQQD 4K35A 2Q6QA 3PHLA 3CCMP 4YPCA 1RE4C 2QRXA 4OH8B 1AV1A 3A2AA 4GOEA 4PD4H 3L75G 2I1JA 3B5ND 2E75B 3SFDC 1HH0A 4OWFA 5TISH 2QG4A 3CC2P 1ZR2A 1RE4A 2AXTE 3CCLP 1YITP 1LTIC 3VMYA 3Q3DA 4R4MA 2PAJA 1SQPJ 2QIWA 3AE6C 3VMZA 3U1AA 1LWUB 5GTHH 1KQLA 4L75A 2N9BA 2JJLA 3FGAD 1GL2C 2A06D 3L71J 2BEQD 1YJNP 1FJKA 3FWNA 4IL6H 1K73Q 1CI6A 1OVUA 1RF1C 1NU1G 3BRVB 1EXIA 4XE5B 1T3UA 1MUUA 2V7QH 1L4AD 2KS1B 3KXDA 4B86A 5GTIH 1L0LG 1NTMG 1PV3A 3AE3C 3M06A 4M3LA 3MGNA 3L71E 3AE7C 3D70A 3V2PA 2O1KA 3B8EB 4U7JA 1S72P 2YO3A 1YJWP 4HH2A 5APTA 1SQVE 2IYOA 3H1LD 4PD4D 5K5GB 1DX7A 4WWIA 2C9NY 2BCCJ 3P8CE 3USSA 4I6MC 2KSJA 2LXCB 3MD0A 4GOFA 4K3AA 4JYBA 1OXZA 1S4XA 1USEA 1LTTC 4YTPC 4ASVA 3D6YA 2R32A 5KLVG 2E43A 1ZP0C 1BGYD 1KORA 2E74D 4N6JA 5AVRB 2IZ0A 2PRRA 2YXRB 1P84I 1J1DB 1KV4A 2ZFCA 2W8ZA 1SFCC 2R3CA 3OW2O 3L72D 1SQXG 3PTZA 3H1HE 2V4HA 2K9JB 1YBKA 1OWAA 1JY2N 2AEFA 4ZKPA 5KJ7A 1BDDA 1LTJC 3L75J 1W2BO 5AW7B 2M5AA 3GF3A 1J1DC 2D2CB 5L8RJ 1BE3G 1L2PA 2ZT9B 2JEEA 2RMZA 2AEMA 3K5BA 5APXA 3SSUA 4I2LC 1M8OB 3TDKA 5GTIE 1L0NE 1KILD 2W6JH 4RJTA 3SWFA 1EZVE 4N78E 1RH5B 1FDIA 1WRGA 2KLUA 1VQOP 2WWWA 1E5WA 2Q7CA 2HR3A 4C7NB 3AE8C 5E79H 5C39A 3CC4P 1L0NJ 4GKGA 3MHVA 2XKMA 1VPCA 1GZLA 3ITKA 1VQ9P 3KYQA 1L4AA 1ZLLA 3IF4A 2POHA 2AXCA 3NTNA 1AJYA 1FZEA 2IFNA 1VQ8P 1PP9E 5CMZA 1NAFA 1Z56A 1IJDB 1BGYJ 2K37A 2Z5IA 1J2JB 1LTSC 3HD7C 3RK3E 3S4RA 3V2RA 2PP6A 4KT0J 1VQ4P 5CJ0A 3M9BA 3G6EP 1KILE 4H0LC 3H1KG 3L71G 1KYOI 2BCCD 4N3YB 3G71P 2FFDB 2Z5HA 3I5CA 2OGUA 3H1IG 3G9RA 2WPSA 3WMM0 1VL2A 4BRYA 2OTLP 2BCCE 3BCCE 1YHQP 3AEDC 2JP3A 3GG2A 2HPCA 3JSVC 1KILC 1WT6A 3L72E 5E79E 4DOJA 1NHLA 1H0TA 1SQPG 1G1JA 1NTKJ 3P7KA 2KS1A 4ZKUA 4WB4A 1NJIQ 1K05A 3VP9A 1NWQA 2WSFJ 5CHXA 5H2FH 2NPSA 2ZVNB 3KPEA 1HVVA 1LP1B 3RK2C 3V2QA 3D71A 3RBXA 1M90Q 2Y9YA 1KD1Q 1U57A 1X79B 2FKWB 2FXPA 1GDTA 1ZN5A 2B9BA 3KDPB 3ZDMA 3G4SP 2IFMA 1JY3O 1D7MA 2IPPA 3RL0B 2JR8A 2E76B 2GUVA 2DW3A 1LT9C 1P84D 2KK7A 4IFFA 1HGZA 3L70E 1PIXA 2O01N 2W90A 4GODA 5AW5B 3TNUA 4NPDA 2IBZE 1EZVI 2J58A 3CCJP 2KI7B 2RN0A 2KP8A 3AECC 1GL2B 1L0NK 2XU6A 4OGQC 2LKMA 3OA7A 4L76A 1NTZG 1TU3F 5AVVB 3TGUE 5M1BA 1ZR4A 1KC8Q 3VN0A 3TGUD 2QM7A 2G8YA 2ZT9C 1N73C 3HE4B 5APSA 2QJYB 3U59A 3L70D 3CWBG 3L74J 3VTPC 1NVOA 4OGQB 2J5UA 1BGYE 1LTBC 3GHGC 1EDKA 3FXDA 3AE5C 3QH9A 1FDMA 1P84E 2B88A 2R5DA 1SQQG 2WSCH 2ZXEB 2QE7H 3CD6P 5KTBA 1IK7A 2K9YA 3E1RA 3AE1C 3H1JJ 1T2KC 1VQLP 1CSBA 3L75D 1UIXA 3W68A 1IFIA 1JB0J 1SQVK 1RY3A 4R4LA 2P67A 1EDLA 2FYUJ 2KUBA 2WQYC 2KB7P 1NTZJ 3WU2E 2O3JA 3AEEC 4OGQD 4O9BA 4C7RA 2YKPA 5AVSB 3A0BH 4H0LD 1KZUB 3S9OA 1YTZI 3NMDA 5CBNA 4C46A 1GTWA 2D2CC 3HD7D 3L73E 2N9YB 3H1LJ 3SFEC 2WSEH 4I7ZB 5KAIH 1HWTC 3B5NC 1SQVJ 4WVZA 1EDJA 5B66H 3V4WA 1NKZB 2WSSH 2XV5A 3MIWA 4WY4A 4YXWH 2B87A 3FWLA 1X8YA 2IBZI 3PLNA 3O8ZA 4DJGA 2XNXA 3KHUA 2Q9IA 1URQB 2XNDH 1S5LH 3L4FA 1CW5A 1H0TB 1PP9D 2XZRA 2YXQB 3A0HE 1PPJG 3AEBC 4D6TE 5AVZB 2WT7A 2E42A 3CMEP 1QL1A 4AYCA 1EC5A 3C8VA 5KLVD 3TYYA 2MKVA 3VYIA 1PGJA 3N7NA 4DZOA 1SQXK 1QVFO 3TGUJ 1HTLC 2N1TD 2Q3EA 2W83C 3WU2H 1SQXD 1VF5C 1DEEG 1EZVG 2G3AA 3A0BE 4IL6X 3V4QA 2QJKC 1CI6B 1S9KE 1HUCA 2E76C 3U1CA 1SQVG 2BCCG 4N78D 1BE3D 4OVNF 3H1IJ 2B89A 4I1LA 4W80A 5KJ7D 1GD2E 2H7HA 1JMBA 3JCUH 2Y0DA 3L72J 3BASA 1EQ7A 1ZRTE 1N7SB 3B71A 1L0ND 2FYUG 1M1JA 3LW5J 4TT3H 1LGHB 3H1JD 2KYVA 5CCGA 1NKNA 3IN6A 1FDOA 2YKOA 2HODB 4RESB 1G2CA 2QVAA 2KSEA 2Q1KA 4LC1A 1OW8A 4QMAA 1N2DC 1MFZA 2FYNB 2IDBA 4NPEA 1RQVA 1R5LA 1QX8A 1NOHA 3O6QB 1DD3A 4MN4C 5APYA 5AVWB 3T97B 4DT0A 4EOTA 3WUVA 1BDCA 3HTKA 1H88A 1KTMA 2BASA 1NTKD 1PP9J 3Q5RA 3TF5A 4KHXA 1JCDA 2M8RA 5BU8B 2Y0EA 1ZXGA 5AVQB 2OQQA 2KIKA 2K9JA 3LW5H 1WMKA 1MKMA 3H1LE 2FYUE 3P32A 4PD4E 3L37A 3AE4C 2M5AB 3P8CD 2CPSA 5AW2B 4H13B 3H1KD 1VQKP 1FAVA 3L71D 3LIEA 1RF0C 4W7ZA 5TISE 5CCHA 3BVHA 1AVYA 2AXTH 3EQ2A 2N1TA 2KNCB 4HB1A 1AVOA 1SQBG 1YQ4C 3H32A 2FFDC 1QL2A 4BWNA 2I1KA 2N1TC 3AEFC 1JY2P 2O01H 3B5NB 4IL6E 2D2CD 2IBZG 3S1KA 3H25A 3VMAA 4BXLA 1JNMA 2IYPA 2M3EA 1J1EC 2R5BA 4JPZB 3BCCD 5CBOA 1KYOE 1L4AB 3MZWB 3RGUA 3W67A 1Q2NA 3H1JE 2WPRA 3LIDA 4EIJA 1RE3A 1FZCB 3CXHE 2Y9ZA 1IFPA 1BCCJ 2B87B 1PL5A 3KZIE 1YI2P 4CPGA 1URQA 2YO2A 1FOSE 1RE3C 2ZYAA 2C9LY 1Q82Q 2J59M 2WPVB 1SVFA 2ZAEB 3CX5I 1N86A 2WT7B 1JTHB 1VQMP 3Q2YA 1L0LJ 1NTMJ 1NU1K 2W6BA 2OYHC 3WUUA 3A3YB 1PP9G 3V5BA 2I8DA 2YNYA 1JUNA 1YQ3C 1VF5B 2OYOA 5APVA 1S3JA 5B5EE 1IFJA 1PGPA 1FBMA 1Y9BA 2OYHB 4D6TD 1GK6A 1M1JC 1N7SC 4U3FD 1U7JA 3TGUG 2R44A 3L74E 3C9IA 2ITAA 3QWOC 1GW3A 1KMIZ 1FJPA 3CWBJ 2OTJP 2HYNA 1EZVD 3AE2C 4WY4D 2QSIA 2O01J 3RBZA 1M7LA 3TK1A 1N7SA 1T3JA 3CMAP 1K9MQ 2NRGA 1M1JB 1PGQA 1OIPA 5APUA 2W6AA 4GIFA 1BSHA 1SQBE 2OARA 2WZ7A 1HJ0A 3FXEA 1KFNA 3KZIH 4EI2A 5BVZA 3L73D 1IZNB 3CCUP 2E74C 3CCEP 4H0LB 2WTYA 1IO4A 3WUTA 4XA4A 3L35A 1LTAC 3L73J 1T8ZA 3O6QA 1IC2A 1NTZK 3SWYA 3N4XA 3T97A 1W2EA 5CCGD 1BCCD 1USDA 2FYUK 2KZIA 3HTKB 3C1LA 4GT1A 1FZBA 4Y28J 4Y99B 4JYCA 1URQD 2QJPC 3IR9A 5GTHE 5AW1B 4EYYQ 2KLVA 1T6AA 2WSCJ 1AQTA 5DJUB 5B5EH 1HF9A 3HUSA 3II6A 1NTKG 2FBWC 1SFCD 4DCKA 1KB9D 1SQVD 2CK3H 2M3BA 3V6IA 2K88A 1LNQA 3HE4A 1SS1A 3UIAA 1S1CX 2LXBA 3VOPA 2N1TB 1LTJA 1SQPK 2P10A 2QJKB 1GK4A 2FXMA 2NPSD 2RH0A 1QLED 3SWKA 2Q3IA 3H32B 1LWUC 3RL0g 5KLVJ 1Y8AA 1LT9B 1L4AC 2YMYA 3H1HG 2A06E 2FY8A 1NYHA 3RL0C 3CCVP 5CJ4A 1RF1B 1N7SD 1PPJD 2JO1A 5CCHC 2C0WA 3Q5PA 1NGMB 4JBZA 1VQ6P 1QGKB 4HJGH 1X22A 2IBZD 4PJ0E 1OFCX 3TSIA 5H2FE 3V2NA 1QVGO 3KQGA 3NXSA 1GW4A 1AFOA 1FZCA 4ASWA 1JY2O 2NZ2A 2QJYC 3GF7A 5AVTB 2QM8A 1JOCA 1JY3P 4TLFA 1YJ9P 1EDIA 2WSEJ 2O1JA 5AW9B 2LR2A 3H1IE 2E75D 4H44C 1LTGC 1JTHA 5AVYB 4EDFA 1DIPA 2H88C 5KJ7C 1IFMA 4UB6H 3CCRP 3RK3C 1L0NG 1LWUA 2FYUD 3H1HJ 3MTUE 3CI9A 3H1JG 1CZQA 3OJAB 4WY4B 1HGVA 1NTKK 4LLHA 5BU5A 2FYZA 1R8EA 1SQQJ 1BE3J 2KXPB 3CX5E 3CCQP 2RKLA 1ZV8A 2OYIA 3PH0A 3HE5A 2ZYDA 5APQA 1RF0A 1RQUA 1S5LX 4H44D 4NPFX 4ZMDA 2GUSA 3EFFK 2HLOA 2M0BA 2OYIC 3RL0D 3HUSC 4PJ0H 3CL3D 3CPWO 3IAOA 2A45I 2MJZA 2NPSC 1N8RQ 5AW8B 2ZYGA 1FZGA 2SPZA 1DH3A 4YXDC 1L0LD 1LT1A 1NTMD 2IZ1A 2P2UA 1VQPP 1A02F 1GU5A 1W5CE 2P7JA 2GM4A 4H13D 3CWBE 1X0TA 1ZRTD 4ZNCA 4GDOA 1N73B 1GMJA 1H8AA 2YKQA 1BE3E 4U3FE 4UB6E 2H43A 1Y47A 1URQC 3EWKA 4PV1B 2ZXXA 3GHGB 1X9VA 1M56D 3RK2B 1N7LA 1IFDA 3IFMA 2XDJA 2JWDA 2YIUB 1KB9E 3CCSP 2W27A 2HODA 2L91A 1G2CB 1NAYA 1IK9A 1SQPE 1NU1E 3HRNA 3FX0A 3CX5H 3M9QA 3R4YA 5KLVK 4U3FG 1NU1D 4PD4I 4PV1C 3M9HA 5AW4B 1VQNP 2Q5UA 1FS0E 3HD7B 1JCCA 1OMIA 3P8MC 3A7OA 5TJHA 2A45H 5KLIC 3OAKA 1VQ5P 1K04A 3PP5A 5AVXB 1DD4A 1ZW0A 2ZT9D 1NO4A 3GMAA 1PFIA 5B66E 4LGDE 1T2KD 5EFWB 1SFCA 3H1LG 1OW7A 2H89C 1DEBA 1YYCA 2WSFH 3CXHD 1LT9A 5KAFE 1YIJP 2IX7C 4AUWA 1MFTA 5KLIB 2CPBA 2PFXA 2E5YA 4XFJA 1SQBD 3A0HH 2JDIH 1L0LE 1NTME 3MUDA 1JM0A 1JEKA 5DJTB 1H89A 1Q86Q 1BGYG 1OW6A 3L74G 3H1HD 2E74B 2KNCA 3PJSK 4RO0A 2E76D 5AW3B 1L0LK 1NTMK 3L72G 5KKZC 1KFMA 1A02J 1KILA 1KB9H 1OVRA 3CX5D 1XTGB 3BCCG 4A7PA 1RHZB 4IFDK 1LJ2A 3M0DA 3I56P 3B5NA 4W7YA 3F5HA 3CC7P 4H13C 1K8AQ 3F89A 2GA1A 1HJBA 1UIIA 1YTZT 1FU1A 1OX3A 3H1KE 3JCUE 3I55P 3AEGC 4BRYB 3ABVC 2UWJE 2FXOA 3M91A 3EFGA 2ZJSE 1ZMEC 3NFQA 1P84H 4IOIH 2QEXP 2HPCB 2FFDA 1FOSF 2WMMA 1FZAA 1JO5A 2A45G 2JWAA 1FC2C 2P1JA 2VRSA 3AE9C 4KJMA 3H1ID 4WBAA 5KAFH 1Q7YQ 2KOGA 4U3FJ 2OYIB 1QEXA 1SP4A 4D6TJ 3HE5B 4UB8E 2E75C 1AQ5A 1KQSO 1MZ9A 2P58A 2A06G 4HKZH 3A5TA 1KYOD 3VP8A 1PPJE 2NPSB 4D6TG 1NU1J 4L73A 3D6ZA 1LP1A 3E1IA 3R2PA 1GL2D 1OVVA 2C0XA 2OYHA 3BRTB 1SQQK 1JY3N 2ZVOB 2Y0CA 1EXJA 1J1EB 3GLMA 4H44B 4PV1D 1N73A 1ZOYC 3RK2D 2K3RA 1JMMA 1KQGB 2L5GB 3GW6A 3M0AA 3L73G 3B4SA 1SQQE 4L74A 5KAIE 3Q5SA 3TNUB 1S9KD 3GHGA 3VMXA 2WPQA 2YIUC 1HBWA 5CCGC 4WY4C 1KB9I 2WVRA 1S2EA 1GL2A 3BCCJ 3G3ZA 4JQ0D 2QA4P 1S5LE 1BCCG 1FE6A 1SQPD 3RK3B 2HFED 2BEZF 4UB8H 3MUDC
chains in the Genus database with same CATH topology
3HD7A 1GU4A 1XTCC 5CCHD 3CLQA 1NH4A 1MV8A 4IFMA 3H6PA 1SFCB 3HUSB 2H8PD 1VDFA 1IFNA 1SQBK 3BATA 3M0DC 1LTJB 1SLQA 4AQRD 2Z4EA 1FZFA 5APWA 1G1IA 3RK3D 1KILB 1FZCC 5AVUB 4C7NA 4Y99C 2HG5D 2WITA 5AW0B 3L36A 1RF1A 5AW6B 4JF7A 4HYTB 1RE4C 4OH8B 3A2AA 2I1JA 3B5ND 1HH0A 1ZR2A 1RE4A 1LTIC 3VMYA 2PAJA 3VMZA 3U1AA 1LWUB 1KQLA 2N9BA 2JJLA 1GL2C 1FJKA 1CI6A 1RF1C 3BRVB 4XE5B 1T3UA 1MUUA 1L4AD 4B86A 3M06A 4M3LA 3MGNA 3V2PA 2O1KA 3B8EB 2YO3A 4HH2A 5APTA 1DX7A 2C9NY 3P8CE 4I6MC 2KSJA 3MD0A 4JYBA 1OXZA 1LTTC 2R32A 2E43A 5AVRB 4N6JA 1J1DB 2ZFCA 1SFCC 2R3CA 1OWAA 1JY2N 4ZKPA 5KJ7A 1LTJC 5AW7B 1J1DC 2JEEA 5APXA 4I2LC 1KILD 3SWFA 4N78E 1WRGA 2WWWA 1E5WA 2Q7CA 4C7NB 4GKGA 2XKMA 1VPCA 1GZLA 3KYQA 1L4AA 1ZLLA 2POHA 3NTNA 1FZEA 2IFNA 5CMZA 1NAFA 1Z56A 1IJDB 3HD7C 2Z5IA 1LTSC 1J2JB 3V2RA 2PP6A 5CJ0A 3M9BA 4N3YB 2Z5HA 3I5CA 3WMM0 2WPSA 2HPCA 1KILC 1WT6A 4DOJA 1NHLA 1G1JA 3P7KA 4ZKUA 4WB4A 3VP9A 1NWQA 5CHXA 2NPSA 3KPEA 1HVVA 3RK2C 3V2QA 1X79B 2FKWB 1GDTA 1ZN5A 3KDPB 2IFMA 1JY3O 2IPPA 3RL0B 2GUVA 1LT9C 4IFFA 1HGZA 5AW5B 3TNUA 2J58A 2KP8A 1GL2B 1L0NK 2XU6A 5AVVB 2LKMA 3OA7A 1CW5A 1ZR4A 3VN0A 2QM7A 1N73C 3HE4B 5APSA 3U59A 3VTPC 1LTBC 3GHGC 1FDMA 2R5DA 2WSCH 2ZXEB 5KTBA 1T2KC 1CSBA 1IFIA 1SQVK 1RY3A 2P67A 2KB7P 4O9BA 2YKPA 5AVSB 1KZUB 1YTZI 3NMDA 1GTWA 4C46A 3HD7D 2WSEH 1HWTC 3B5NC 3V4WA 1NKZB 2XV5A 3MIWA 4WY4A 1X8YA 3O8ZA 2XNXA 2Q9IA 1URQB 3L4FA 2XZRA 2WT7A 2E42A 5AVZB 1QL1A 4AYCA 3TYYA 3VYIA 3N7NA 4DZOA 1SQXK 1HTLC 2N1TD 3V4QA 1CI6B 1S9KE 1HUCA 3U1CA 4N78D 5KJ7D 4I1LA 1GD2E 4W80A 2H7HA 3BASA 1EQ7A 1N7SB 1M1JA 1LGHB 5CCGA 2KYVA 1NKNA 2YKOA 2HODB 4RESB 1G2CA 4LC1A 1N2DC 1MFZA 5AVWB 1NOHA 5APYA 4EOTA 3HTKA 1H88A 2BASA 4KHXA 1JCDA 2M8RA 5BU8B 5AVQB 3LW5H 3P32A 3L37A 3P8CD 2CPSA 5AW2B 1FAVA 3LIEA 1RF0C 4W7ZA 3BVHA 5CCHA 3EQ2A 2N1TA 3H32A 2FFDC 1QL2A 2I1KA 2N1TC 1JY2P 2O01H 3B5NB 1JNMA 1J1EC 2R5BA 1L4AB 4EIJA 2WPRA 3LIDA 1RE3A 1FZCB 1URQA 2YO2A 1FOSE 1RE3C 2C9LY 2J59M 1SVFA 2WT7B 1N86A 1JTHB 2W6BA 1NU1K 2OYHC 3A3YB 3V5BA 2YNYA 1JUNA 5APVA 1IFJA 1FBMA 2OYHB 1GK6A 1M1JC 1N7SC 3C9IA 1GW3A 1FJPA 2HYNA 3TK1A 4WY4D 1M7LA 1N7SA 1T3JA 1M1JB 5APUA 2W6AA 4GIFA 2OARA 2WZ7A 1KFNA 5BVZA 2WTYA 1IO4A 4XA4A 3L35A 1LTAC 1T8ZA 1IC2A 1NTZK 3SWYA 3N4XA 3T97A 1W2EA 5CCGD 4Y99B 2FYUK 3HTKB 4GT1A 1FZBA 4JYCA 1URQD 3IR9A 5AW1B 2KLVA 3HUSA 3II6A 1SFCD 2M3BA 3HE4A 3UIAA 3VOPA 2N1TB 1LTJA 1SQPK 4C7RA 1GK4A 2FXMA 2NPSD 2Q3IA 3H32B 1LWUC 1LT9B 1L4AC 2YMYA 3RL0C 5CJ4A 1RF1B 1N7SD 5CCHC 2C0WA 3V2NA 3TSIA 1AFOA 3NXSA 3KQGA 1GW4A 1FZCA 1JY2O 5AVTB 2QM8A 1JOCA 1JY3P 2O1JA 5AW9B 1LTGC 1JTHA 5AVYB 5KJ7C 1IFMA 3RK3C 1LWUA 3MTUE 4WY4B 3CI9A 3OJAB 1CZQA 5BU5A 2FFDB 1HGVA 1NTKK 4LLHA 2FYZA 2OYIA 1ZV8A 3HE5A 5APQA 1RF0A 2GUSA 2HLOA 2OYIC 3RL0D 3HUSC 3CL3D 2A45I 2MJZA 2NPSC 5AW8B 1FZGA 1DH3A 2P2UA 1A02F 1GU5A 2P7JA 2GM4A 1N73B 1H8AA 2YKQA 2H43A 1URQC 3GHGB 1X9VA 3RK2B 1N7LA 1IFDA 3IFMA 2XDJA 2W27A 2HODA 1G2CB 1IK9A 3M9QA 3HRNA 5KLVK 3M9HA 5AW4B 2Q5UA 3HD7B 1JCCA 3P8MC 3A7OA 2A45H 3OAKA 5AVXB 3PP5A 1NO4A 1PFIA 1T2KD 4LGDE 1SFCA 1DEBA 1YYCA 2WSFH 1LT9A 2IX7C 4AUWA 2CPBA 3MUDA 1H89A 5AW3B 1L0LK 1NTMK 1KFMA 1A02J 1KILA 1XTGB 4IFDK 3M0DA 3B5NA 4W7YA 1HJBA 1YTZT 1FU1A 3M91A 3EFGA 3NFQA 2HPCB 2FFDA 1JO5A 1FOSF 1FZAA 2A45G 2P1JA 2VRSA 4WBAA 2OYIB 2KOGA 1SP4A 3HE5B 1AQ5A 1MZ9A 3A5TA 3VP8A 2NPSB 3E1IA 3R2PA 1GL2D 2C0XA 2OYHA 3BRTB 1SQQK 1JY3N 1J1EB 1N73A 3RK2D 1JMMA 2L5GB 3M0AA 1S9KD 3TNUB 3GHGA 3VMXA 2WPQA 1HBWA 5CCGC 4WY4C 3G3ZA 1GL2A 3RK3B 2HFED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKO A;  2YKP A;  2W6B A;  2YKQ A;  3EQ2 A;  1JOC A;  3CL3 D;  3BRT B;  3L4F A;  3BRV B; 
#chains in the Genus database with same CATH topology
 3HD7 A;  1GU4 A;  1XTC C;  1KYO H;  1NTK E;  1PZQ A;  1NTZ D;  3CLQ A;  5CCH D;  1NH4 A;  1KQF B;  1MV8 A;  1VQ7 P;  2OTK E;  1BCC E;  3AEA C;  3CXH I;  4IFM A;  3H6P A;  1SFC B;  3CXH H;  1M1K Q;  2R3S A;  3CWB D;  1Q81 Q;  4I7Z C;  1PGO A;  3JC2 2;  2PGD A;  3H1K J;  3HUS B;  1U7M A;  2JKV A;  2H8P D;  1VDF A;  2FYN C;  1IFN A;  3PRJ A;  3Q1M A;  2AEJ A;  3E7K A;  1OZH A;  1Q90 D;  1SQB K;  2YMK A;  3BAT A;  1R5S A;  3M0D C;  1VF5 D;  1LTJ B;  1SLQ A;  1SQX J;  3MP7 B;  4RKU J;  4AQR D;  1FZF A;  2Z4E A;  5APW A;  5KKZ B;  1G1I A;  3RK3 D;  1KIL B;  1NTZ E;  3L70 J;  2K1A A;  1FZC C;  3L74 D;  5AVU B;  4C7N A;  1BSN A;  1M57 D;  4Y99 C;  1E79 H;  2HG5 D;  2WIT A;  3L36 A;  5AW0 B;  1SQX E;  1RF1 A;  2V7Q J;  1AA0 A;  3L70 G;  5AW6 B;  4Z1M H;  2KZJ A;  3L75 E;  5KLV E;  1KN7 A;  4JF7 A;  1SQB J;  2E5T A;  2QJP B;  4HYT B;  1SQQ D;  4K35 A;  2Q6Q A;  3PHL A;  3CCM P;  4YPC A;  1RE4 C;  2QRX A;  4OH8 B;  1AV1 A;  3A2A A;  4GOE A;  4PD4 H;  3L75 G;  2I1J A;  3B5N D;  2E75 B;  3SFD C;  1HH0 A;  4OWF A;  5TIS H;  2QG4 A;  3CC2 P;  1ZR2 A;  1RE4 A;  2AXT E;  3CCL P;  1YIT P;  1LTI C;  3VMY A;  3Q3D A;  4R4M A;  2PAJ A;  1SQP J;  2QIW A;  3AE6 C;  3VMZ A;  3U1A A;  1LWU B;  5GTH H;  1KQL A;  4L75 A;  2N9B A;  2JJL A;  3FGA D;  1GL2 C;  2A06 D;  3L71 J;  2BEQ D;  1YJN P;  1FJK A;  3FWN A;  4IL6 H;  1K73 Q;  1CI6 A;  1OVU A;  1RF1 C;  1NU1 G;  3BRV B;  1EXI A;  4XE5 B;  1T3U A;  1MUU A;  2V7Q H;  1L4A D;  2KS1 B;  3KXD A;  4B86 A;  5GTI H;  1L0L G;  1NTM G;  1PV3 A;  3AE3 C;  3M06 A;  4M3L A;  3MGN A;  3L71 E;  3AE7 C;  3D70 A;  3V2P A;  2O1K A;  3B8E B;  4U7J A;  1S72 P;  2YO3 A;  1YJW P;  4HH2 A;  5APT A;  1SQV E;  2IYO A;  3H1L D;  4PD4 D;  5K5G B;  1DX7 A;  4WWI A;  2C9N Y;  2BCC J;  3P8C E;  3USS A;  4I6M C;  2KSJ A;  2LXC B;  3MD0 A;  4GOF A;  4K3A A;  4JYB A;  1OXZ A;  1S4X A;  1USE A;  1LTT C;  4YTP C;  4ASV A;  3D6Y A;  2R32 A;  5KLV G;  2E43 A;  1ZP0 C;  1BGY D;  1KOR A;  2E74 D;  4N6J A;  5AVR B;  2IZ0 A;  2PRR A;  2YXR B;  1P84 I;  1J1D B;  1KV4 A;  2ZFC A;  2W8Z A;  1SFC C;  2R3C A;  3OW2 O;  3L72 D;  1SQX G;  3PTZ A;  3H1H E;  2V4H A;  2K9J B;  1YBK A;  1OWA A;  1JY2 N;  2AEF A;  4ZKP A;  5KJ7 A;  1BDD A;  1LTJ C;  3L75 J;  1W2B O;  5AW7 B;  2M5A A;  3GF3 A;  1J1D C;  2D2C B;  5L8R J;  1BE3 G;  1L2P A;  2ZT9 B;  2JEE A;  2RMZ A;  2AEM A;  3K5B A;  5APX A;  3SSU A;  4I2L C;  1M8O B;  3TDK A;  5GTI E;  1L0N E;  1KIL D;  2W6J H;  4RJT A;  3SWF A;  1EZV E;  4N78 E;  1RH5 B;  1FDI A;  1WRG A;  2KLU A;  1VQO P;  2WWW A;  1E5W A;  2Q7C A;  2HR3 A;  4C7N B;  3AE8 C;  5E79 H;  5C39 A;  3CC4 P;  1L0N J;  4GKG A;  3MHV A;  2XKM A;  1VPC A;  1GZL A;  3ITK A;  1VQ9 P;  3KYQ A;  1L4A A;  1ZLL A;  3IF4 A;  2POH A;  2AXC A;  3NTN A;  1AJY A;  1FZE A;  2IFN A;  1VQ8 P;  1PP9 E;  5CMZ A;  1NAF A;  1Z56 A;  1IJD B;  1BGY J;  2K37 A;  2Z5I A;  1J2J B;  1LTS C;  3HD7 C;  3RK3 E;  3S4R A;  3V2R A;  2PP6 A;  4KT0 J;  1VQ4 P;  5CJ0 A;  3M9B A;  3G6E P;  1KIL E;  4H0L C;  3H1K G;  3L71 G;  1KYO I;  2BCC D;  4N3Y B;  3G71 P;  2FFD B;  2Z5H A;  3I5C A;  2OGU A;  3H1I G;  3G9R A;  2WPS A;  3WMM 0;  1VL2 A;  4BRY A;  2OTL P;  2BCC E;  3BCC E;  1YHQ P;  3AED C;  2JP3 A;  3GG2 A;  2HPC A;  3JSV C;  1KIL C;  1WT6 A;  3L72 E;  5E79 E;  4DOJ A;  1NHL A;  1H0T A;  1SQP G;  1G1J A;  1NTK J;  3P7K A;  2KS1 A;  4ZKU A;  4WB4 A;  1NJI Q;  1K05 A;  3VP9 A;  1NWQ A;  2WSF J;  5CHX A;  5H2F H;  2NPS A;  2ZVN B;  3KPE A;  1HVV A;  1LP1 B;  3RK2 C;  3V2Q A;  3D71 A;  3RBX A;  1M90 Q;  2Y9Y A;  1KD1 Q;  1U57 A;  1X79 B;  2FKW B;  2FXP A;  1GDT A;  1ZN5 A;  2B9B A;  3KDP B;  3ZDM A;  3G4S P;  2IFM A;  1JY3 O;  1D7M A;  2IPP A;  3RL0 B;  2JR8 A;  2E76 B;  2GUV A;  2DW3 A;  1LT9 C;  1P84 D;  2KK7 A;  4IFF A;  1HGZ A;  3L70 E;  1PIX A;  2O01 N;  2W90 A;  4GOD A;  5AW5 B;  3TNU A;  4NPD A;  2IBZ E;  1EZV I;  2J58 A;  3CCJ P;  2KI7 B;  2RN0 A;  2KP8 A;  3AEC C;  1GL2 B;  1L0N K;  2XU6 A;  4OGQ C;  2LKM A;  3OA7 A;  4L76 A;  1NTZ G;  1TU3 F;  5AVV B;  3TGU E;  5M1B A;  1ZR4 A;  1KC8 Q;  3VN0 A;  3TGU D;  2QM7 A;  2G8Y A;  2ZT9 C;  1N73 C;  3HE4 B;  5APS A;  2QJY B;  3U59 A;  3L70 D;  3CWB G;  3L74 J;  3VTP C;  1NVO A;  4OGQ B;  2J5U A;  1BGY E;  1LTB C;  3GHG C;  1EDK A;  3FXD A;  3AE5 C;  3QH9 A;  1FDM A;  1P84 E;  2B88 A;  2R5D A;  1SQQ G;  2WSC H;  2ZXE B;  2QE7 H;  3CD6 P;  5KTB A;  1IK7 A;  2K9Y A;  3E1R A;  3AE1 C;  3H1J J;  1T2K C;  1VQL P;  1CSB A;  3L75 D;  1UIX A;  3W68 A;  1IFI A;  1JB0 J;  1SQV K;  1RY3 A;  4R4L A;  2P67 A;  1EDL A;  2FYU J;  2KUB A;  2WQY C;  2KB7 P;  1NTZ J;  3WU2 E;  2O3J A;  3AEE C;  4OGQ D;  4O9B A;  4C7R A;  2YKP A;  5AVS B;  3A0B H;  4H0L D;  1KZU B;  3S9O A;  1YTZ I;  3NMD A;  5CBN A;  4C46 A;  1GTW A;  2D2C C;  3HD7 D;  3L73 E;  2N9Y B;  3H1L J;  3SFE C;  2WSE H;  4I7Z B;  5KAI H;  1HWT C;  3B5N C;  1SQV J;  4WVZ A;  1EDJ A;  5B66 H;  3V4W A;  1NKZ B;  2WSS H;  2XV5 A;  3MIW A;  4WY4 A;  4YXW H;  2B87 A;  3FWL A;  1X8Y A;  2IBZ I;  3PLN A;  3O8Z A;  4DJG A;  2XNX A;  3KHU A;  2Q9I A;  1URQ B;  2XND H;  1S5L H;  3L4F A;  1CW5 A;  1H0T B;  1PP9 D;  2XZR A;  2YXQ B;  3A0H E;  1PPJ G;  3AEB C;  4D6T E;  5AVZ B;  2WT7 A;  2E42 A;  3CME P;  1QL1 A;  4AYC A;  1EC5 A;  3C8V A;  5KLV D;  3TYY A;  2MKV A;  3VYI A;  1PGJ A;  3N7N A;  4DZO A;  1SQX K;  1QVF O;  3TGU J;  1HTL C;  2N1T D;  2Q3E A;  2W83 C;  3WU2 H;  1SQX D;  1VF5 C;  1DEE G;  1EZV G;  2G3A A;  3A0B E;  4IL6 X;  3V4Q A;  2QJK C;  1CI6 B;  1S9K E;  1HUC A;  2E76 C;  3U1C A;  1SQV G;  2BCC G;  4N78 D;  1BE3 D;  4OVN F;  3H1I J;  2B89 A;  4I1L A;  4W80 A;  5KJ7 D;  1GD2 E;  2H7H A;  1JMB A;  3JCU H;  2Y0D A;  3L72 J;  3BAS A;  1EQ7 A;  1ZRT E;  1N7S B;  3B71 A;  1L0N D;  2FYU G;  1M1J A;  3LW5 J;  4TT3 H;  1LGH B;  3H1J D;  2KYV A;  5CCG A;  1NKN A;  3IN6 A;  1FDO A;  2YKO A;  2HOD B;  4RES B;  1G2C A;  2QVA A;  2KSE A;  2Q1K A;  4LC1 A;  1OW8 A;  4QMA A;  1N2D C;  1MFZ A;  2FYN B;  2IDB A;  4NPE A;  1RQV A;  1R5L A;  1QX8 A;  1NOH A;  3O6Q B;  1DD3 A;  4MN4 C;  5APY A;  5AVW B;  3T97 B;  4DT0 A;  4EOT A;  3WUV A;  1BDC A;  3HTK A;  1H88 A;  1KTM A;  2BAS A;  1NTK D;  1PP9 J;  3Q5R A;  3TF5 A;  4KHX A;  1JCD A;  2M8R A;  5BU8 B;  2Y0E A;  1ZXG A;  5AVQ B;  2OQQ A;  2KIK A;  2K9J A;  3LW5 H;  1WMK A;  1MKM A;  3H1L E;  2FYU E;  3P32 A;  4PD4 E;  3L37 A;  3AE4 C;  2M5A B;  3P8C D;  2CPS A;  5AW2 B;  4H13 B;  3H1K D;  1VQK P;  1FAV A;  3L71 D;  3LIE A;  1RF0 C;  4W7Z A;  5TIS E;  5CCH A;  3BVH A;  1AVY A;  2AXT H;  3EQ2 A;  2N1T A;  2KNC B;  4HB1 A;  1AVO A;  1SQB G;  1YQ4 C;  3H32 A;  2FFD C;  1QL2 A;  4BWN A;  2I1K A;  2N1T C;  3AEF C;  1JY2 P;  2O01 H;  3B5N B;  4IL6 E;  2D2C D;  2IBZ G;  3S1K A;  3H25 A;  3VMA A;  4BXL A;  1JNM A;  2IYP A;  2M3E A;  1J1E C;  2R5B A;  4JPZ B;  3BCC D;  5CBO A;  1KYO E;  1L4A B;  3MZW B;  3RGU A;  3W67 A;  1Q2N A;  3H1J E;  2WPR A;  3LID A;  4EIJ A;  1RE3 A;  1FZC B;  3CXH E;  2Y9Z A;  1IFP A;  1BCC J;  2B87 B;  1PL5 A;  3KZI E;  1YI2 P;  4CPG A;  1URQ A;  2YO2 A;  1FOS E;  1RE3 C;  2ZYA A;  2C9L Y;  1Q82 Q;  2J59 M;  2WPV B;  1SVF A;  2ZAE B;  3CX5 I;  1N86 A;  2WT7 B;  1JTH B;  1VQM P;  3Q2Y A;  1L0L J;  1NTM J;  1NU1 K;  2W6B A;  2OYH C;  3WUU A;  3A3Y B;  1PP9 G;  3V5B A;  2I8D A;  2YNY A;  1JUN A;  1YQ3 C;  1VF5 B;  2OYO A;  5APV A;  1S3J A;  5B5E E;  1IFJ A;  1PGP A;  1FBM A;  1Y9B A;  2OYH B;  4D6T D;  1GK6 A;  1M1J C;  1N7S C;  4U3F D;  1U7J A;  3TGU G;  2R44 A;  3L74 E;  3C9I A;  2ITA A;  3QWO C;  1GW3 A;  1KMI Z;  1FJP A;  3CWB J;  2OTJ P;  2HYN A;  1EZV D;  3AE2 C;  4WY4 D;  2QSI A;  2O01 J;  3RBZ A;  1M7L A;  3TK1 A;  1N7S A;  1T3J A;  3CMA P;  1K9M Q;  2NRG A;  1M1J B;  1PGQ A;  1OIP A;  5APU A;  2W6A A;  4GIF A;  1BSH A;  1SQB E;  2OAR A;  2WZ7 A;  1HJ0 A;  3FXE A;  1KFN A;  3KZI H;  4EI2 A;  5BVZ A;  3L73 D;  1IZN B;  3CCU P;  2E74 C;  3CCE P;  4H0L B;  2WTY A;  1IO4 A;  3WUT A;  4XA4 A;  3L35 A;  1LTA C;  3L73 J;  1T8Z A;  3O6Q A;  1IC2 A;  1NTZ K;  3SWY A;  3N4X A;  3T97 A;  1W2E A;  5CCG D;  1BCC D;  1USD A;  2FYU K;  2KZI A;  3HTK B;  3C1L A;  4GT1 A;  1FZB A;  4Y28 J;  4Y99 B;  4JYC A;  1URQ D;  2QJP C;  3IR9 A;  5GTH E;  5AW1 B;  4EYY Q;  2KLV A;  1T6A A;  2WSC J;  1AQT A;  5DJU B;  5B5E H;  1HF9 A;  3HUS A;  3II6 A;  1NTK G;  2FBW C;  1SFC D;  4DCK A;  1KB9 D;  1SQV D;  2CK3 H;  2M3B A;  3V6I A;  2K88 A;  1LNQ A;  3HE4 A;  1SS1 A;  3UIA A;  1S1C X;  2LXB A;  3VOP A;  2N1T B;  1LTJ A;  1SQP K;  2P10 A;  2QJK B;  1GK4 A;  2FXM A;  2NPS D;  2RH0 A;  1QLE D;  3SWK A;  2Q3I A;  3H32 B;  1LWU C;  3RL0 g;  5KLV J;  1Y8A A;  1LT9 B;  1L4A C;  2YMY A;  3H1H G;  2A06 E;  2FY8 A;  1NYH A;  3RL0 C;  3CCV P;  5CJ4 A;  1RF1 B;  1N7S D;  1PPJ D;  2JO1 A;  5CCH C;  2C0W A;  3Q5P A;  1NGM B;  4JBZ A;  1VQ6 P;  1QGK B;  4HJG H;  1X22 A;  2IBZ D;  4PJ0 E;  1OFC X;  3TSI A;  5H2F E;  3V2N A;  1QVG O;  3KQG A;  3NXS A;  1GW4 A;  1AFO A;  1FZC A;  4ASW A;  1JY2 O;  2NZ2 A;  2QJY C;  3GF7 A;  5AVT B;  2QM8 A;  1JOC A;  1JY3 P;  4TLF A;  1YJ9 P;  1EDI A;  2WSE J;  2O1J A;  5AW9 B;  2LR2 A;  3H1I E;  2E75 D;  4H44 C;  1LTG C;  1JTH A;  5AVY B;  4EDF A;  1DIP A;  2H88 C;  5KJ7 C;  1IFM A;  4UB6 H;  3CCR P;  3RK3 C;  1L0N G;  1LWU A;  2FYU D;  3H1H J;  3MTU E;  3CI9 A;  3H1J G;  1CZQ A;  3OJA B;  4WY4 B;  1HGV A;  1NTK K;  4LLH A;  5BU5 A;  2FYZ A;  1R8E A;  1SQQ J;  1BE3 J;  2KXP B;  3CX5 E;  3CCQ P;  2RKL A;  1ZV8 A;  2OYI A;  3PH0 A;  3HE5 A;  2ZYD A;  5APQ A;  1RF0 A;  1RQU A;  1S5L X;  4H44 D;  4NPF X;  4ZMD A;  2GUS A;  3EFF K;  2HLO A;  2M0B A;  2OYI C;  3RL0 D;  3HUS C;  4PJ0 H;  3CL3 D;  3CPW O;  3IAO A;  2A45 I;  2MJZ A;  2NPS C;  1N8R Q;  5AW8 B;  2ZYG A;  1FZG A;  2SPZ A;  1DH3 A;  4YXD C;  1L0L D;  1LT1 A;  1NTM D;  2IZ1 A;  2P2U A;  1VQP P;  1A02 F;  1GU5 A;  1W5C E;  2P7J A;  2GM4 A;  4H13 D;  3CWB E;  1X0T A;  1ZRT D;  4ZNC A;  4GDO A;  1N73 B;  1GMJ A;  1H8A A;  2YKQ A;  1BE3 E;  4U3F E;  4UB6 E;  2H43 A;  1Y47 A;  1URQ C;  3EWK A;  4PV1 B;  2ZXX A;  3GHG B;  1X9V A;  1M56 D;  3RK2 B;  1N7L A;  1IFD A;  3IFM A;  2XDJ A;  2JWD A;  2YIU B;  1KB9 E;  3CCS P;  2W27 A;  2HOD A;  2L91 A;  1G2C B;  1NAY A;  1IK9 A;  1SQP E;  1NU1 E;  3HRN A;  3FX0 A;  3CX5 H;  3M9Q A;  3R4Y A;  5KLV K;  4U3F G;  1NU1 D;  4PD4 I;  4PV1 C;  3M9H A;  5AW4 B;  1VQN P;  2Q5U A;  1FS0 E;  3HD7 B;  1JCC A;  1OMI A;  3P8M C;  3A7O A;  5TJH A;  2A45 H;  5KLI C;  3OAK A;  1VQ5 P;  1K04 A;  3PP5 A;  5AVX B;  1DD4 A;  1ZW0 A;  2ZT9 D;  1NO4 A;  3GMA A;  1PFI A;  5B66 E;  4LGD E;  1T2K D;  5EFW B;  1SFC A;  3H1L G;  1OW7 A;  2H89 C;  1DEB A;  1YYC A;  2WSF H;  3CXH D;  1LT9 A;  5KAF E;  1YIJ P;  2IX7 C;  4AUW A;  1MFT A;  5KLI B;  2CPB A;  2PFX A;  2E5Y A;  4XFJ A;  1SQB D;  3A0H H;  2JDI H;  1L0L E;  1NTM E;  3MUD A;  1JM0 A;  1JEK A;  5DJT B;  1H89 A;  1Q86 Q;  1BGY G;  1OW6 A;  3L74 G;  3H1H D;  2E74 B;  2KNC A;  3PJS K;  4RO0 A;  2E76 D;  5AW3 B;  1L0L K;  1NTM K;  3L72 G;  5KKZ C;  1KFM A;  1A02 J;  1KIL A;  1KB9 H;  1OVR A;  3CX5 D;  1XTG B;  3BCC G;  4A7P A;  1RHZ B;  4IFD K;  1LJ2 A;  3M0D A;  3I56 P;  3B5N A;  4W7Y A;  3F5H A;  3CC7 P;  4H13 C;  1K8A Q;  3F89 A;  2GA1 A;  1HJB A;  1UII A;  1YTZ T;  1FU1 A;  1OX3 A;  3H1K E;  3JCU E;  3I55 P;  3AEG C;  4BRY B;  3ABV C;  2UWJ E;  2FXO A;  3M91 A;  3EFG A;  2ZJS E;  1ZME C;  3NFQ A;  1P84 H;  4IOI H;  2QEX P;  2HPC B;  2FFD A;  1FOS F;  2WMM A;  1FZA A;  1JO5 A;  2A45 G;  2JWA A;  1FC2 C;  2P1J A;  2VRS A;  3AE9 C;  4KJM A;  3H1I D;  4WBA A;  5KAF H;  1Q7Y Q;  2KOG A;  4U3F J;  2OYI B;  1QEX A;  1SP4 A;  4D6T J;  3HE5 B;  4UB8 E;  2E75 C;  1AQ5 A;  1KQS O;  1MZ9 A;  2P58 A;  2A06 G;  4HKZ H;  3A5T A;  1KYO D;  3VP8 A;  1PPJ E;  2NPS B;  4D6T G;  1NU1 J;  4L73 A;  3D6Z A;  1LP1 A;  3E1I A;  3R2P A;  1GL2 D;  1OVV A;  2C0X A;  2OYH A;  3BRT B;  1SQQ K;  1JY3 N;  2ZVO B;  2Y0C A;  1EXJ A;  1J1E B;  3GLM A;  4H44 B;  4PV1 D;  1N73 A;  1ZOY C;  3RK2 D;  2K3R A;  1JMM A;  1KQG B;  2L5G B;  3GW6 A;  3M0A A;  3L73 G;  3B4S A;  1SQQ E;  4L74 A;  5KAI E;  3Q5S A;  3TNU B;  1S9K D;  3GHG A;  3VMX A;  2WPQ A;  2YIU C;  1HBW A;  5CCG C;  4WY4 C;  1KB9 I;  2WVR A;  1S2E A;  1GL2 A;  3BCC J;  3G3Z A;  4JQ0 D;  2QA4 P;  1S5L E;  1BCC G;  1FE6 A;  1SQP D;  3RK3 B;  2HFE D;  2BEZ F;  4UB8 H;  3MUD C; 
#chains in the Genus database with same CATH homology
 3HD7 A;  1GU4 A;  1XTC C;  5CCH D;  3CLQ A;  1NH4 A;  1MV8 A;  4IFM A;  3H6P A;  1SFC B;  3HUS B;  2H8P D;  1VDF A;  1IFN A;  1SQB K;  3BAT A;  3M0D C;  1LTJ B;  1SLQ A;  4AQR D;  2Z4E A;  1FZF A;  5APW A;  1G1I A;  3RK3 D;  1KIL B;  1FZC C;  5AVU B;  4C7N A;  4Y99 C;  2HG5 D;  2WIT A;  5AW0 B;  3L36 A;  1RF1 A;  5AW6 B;  4JF7 A;  4HYT B;  1RE4 C;  4OH8 B;  3A2A A;  2I1J A;  3B5N D;  1HH0 A;  1ZR2 A;  1RE4 A;  1LTI C;  3VMY A;  2PAJ A;  3VMZ A;  3U1A A;  1LWU B;  1KQL A;  2N9B A;  2JJL A;  1GL2 C;  1FJK A;  1CI6 A;  1RF1 C;  3BRV B;  4XE5 B;  1T3U A;  1MUU A;  1L4A D;  4B86 A;  3M06 A;  4M3L A;  3MGN A;  3V2P A;  2O1K A;  3B8E B;  2YO3 A;  4HH2 A;  5APT A;  1DX7 A;  2C9N Y;  3P8C E;  4I6M C;  2KSJ A;  3MD0 A;  4JYB A;  1OXZ A;  1LTT C;  2R32 A;  2E43 A;  5AVR B;  4N6J A;  1J1D B;  2ZFC A;  1SFC C;  2R3C A;  1OWA A;  1JY2 N;  4ZKP A;  5KJ7 A;  1LTJ C;  5AW7 B;  1J1D C;  2JEE A;  5APX A;  4I2L C;  1KIL D;  3SWF A;  4N78 E;  1WRG A;  2WWW A;  1E5W A;  2Q7C A;  4C7N B;  4GKG A;  2XKM A;  1VPC A;  1GZL A;  3KYQ A;  1L4A A;  1ZLL A;  2POH A;  3NTN A;  1FZE A;  2IFN A;  5CMZ A;  1NAF A;  1Z56 A;  1IJD B;  3HD7 C;  2Z5I A;  1LTS C;  1J2J B;  3V2R A;  2PP6 A;  5CJ0 A;  3M9B A;  4N3Y B;  2Z5H A;  3I5C A;  3WMM 0;  2WPS A;  2HPC A;  1KIL C;  1WT6 A;  4DOJ A;  1NHL A;  1G1J A;  3P7K A;  4ZKU A;  4WB4 A;  3VP9 A;  1NWQ A;  5CHX A;  2NPS A;  3KPE A;  1HVV A;  3RK2 C;  3V2Q A;  1X79 B;  2FKW B;  1GDT A;  1ZN5 A;  3KDP B;  2IFM A;  1JY3 O;  2IPP A;  3RL0 B;  2GUV A;  1LT9 C;  4IFF A;  1HGZ A;  5AW5 B;  3TNU A;  2J58 A;  2KP8 A;  1GL2 B;  1L0N K;  2XU6 A;  5AVV B;  2LKM A;  3OA7 A;  1CW5 A;  1ZR4 A;  3VN0 A;  2QM7 A;  1N73 C;  3HE4 B;  5APS A;  3U59 A;  3VTP C;  1LTB C;  3GHG C;  1FDM A;  2R5D A;  2WSC H;  2ZXE B;  5KTB A;  1T2K C;  1CSB A;  1IFI A;  1SQV K;  1RY3 A;  2P67 A;  2KB7 P;  4O9B A;  2YKP A;  5AVS B;  1KZU B;  1YTZ I;  3NMD A;  1GTW A;  4C46 A;  3HD7 D;  2WSE H;  1HWT C;  3B5N C;  3V4W A;  1NKZ B;  2XV5 A;  3MIW A;  4WY4 A;  1X8Y A;  3O8Z A;  2XNX A;  2Q9I A;  1URQ B;  3L4F A;  2XZR A;  2WT7 A;  2E42 A;  5AVZ B;  1QL1 A;  4AYC A;  3TYY A;  3VYI A;  3N7N A;  4DZO A;  1SQX K;  1HTL C;  2N1T D;  3V4Q A;  1CI6 B;  1S9K E;  1HUC A;  3U1C A;  4N78 D;  5KJ7 D;  4I1L A;  1GD2 E;  4W80 A;  2H7H A;  3BAS A;  1EQ7 A;  1N7S B;  1M1J A;  1LGH B;  5CCG A;  2KYV A;  1NKN A;  2YKO A;  2HOD B;  4RES B;  1G2C A;  4LC1 A;  1N2D C;  1MFZ A;  5AVW B;  1NOH A;  5APY A;  4EOT A;  3HTK A;  1H88 A;  2BAS A;  4KHX A;  1JCD A;  2M8R A;  5BU8 B;  5AVQ B;  3LW5 H;  3P32 A;  3L37 A;  3P8C D;  2CPS A;  5AW2 B;  1FAV A;  3LIE A;  1RF0 C;  4W7Z A;  3BVH A;  5CCH A;  3EQ2 A;  2N1T A;  3H32 A;  2FFD C;  1QL2 A;  2I1K A;  2N1T C;  1JY2 P;  2O01 H;  3B5N B;  1JNM A;  1J1E C;  2R5B A;  1L4A B;  4EIJ A;  2WPR A;  3LID A;  1RE3 A;  1FZC B;  1URQ A;  2YO2 A;  1FOS E;  1RE3 C;  2C9L Y;  2J59 M;  1SVF A;  2WT7 B;  1N86 A;  1JTH B;  2W6B A;  1NU1 K;  2OYH C;  3A3Y B;  3V5B A;  2YNY A;  1JUN A;  5APV A;  1IFJ A;  1FBM A;  2OYH B;  1GK6 A;  1M1J C;  1N7S C;  3C9I A;  1GW3 A;  1FJP A;  2HYN A;  3TK1 A;  4WY4 D;  1M7L A;  1N7S A;  1T3J A;  1M1J B;  5APU A;  2W6A A;  4GIF A;  2OAR A;  2WZ7 A;  1KFN A;  5BVZ A;  2WTY A;  1IO4 A;  4XA4 A;  3L35 A;  1LTA C;  1T8Z A;  1IC2 A;  1NTZ K;  3SWY A;  3N4X A;  3T97 A;  1W2E A;  5CCG D;  4Y99 B;  2FYU K;  3HTK B;  4GT1 A;  1FZB A;  4JYC A;  1URQ D;  3IR9 A;  5AW1 B;  2KLV A;  3HUS A;  3II6 A;  1SFC D;  2M3B A;  3HE4 A;  3UIA A;  3VOP A;  2N1T B;  1LTJ A;  1SQP K;  4C7R A;  1GK4 A;  2FXM A;  2NPS D;  2Q3I A;  3H32 B;  1LWU C;  1LT9 B;  1L4A C;  2YMY A;  3RL0 C;  5CJ4 A;  1RF1 B;  1N7S D;  5CCH C;  2C0W A;  3V2N A;  3TSI A;  1AFO A;  3NXS A;  3KQG A;  1GW4 A;  1FZC A;  1JY2 O;  5AVT B;  2QM8 A;  1JOC A;  1JY3 P;  2O1J A;  5AW9 B;  1LTG C;  1JTH A;  5AVY B;  5KJ7 C;  1IFM A;  3RK3 C;  1LWU A;  3MTU E;  4WY4 B;  3CI9 A;  3OJA B;  1CZQ A;  5BU5 A;  2FFD B;  1HGV A;  1NTK K;  4LLH A;  2FYZ A;  2OYI A;  1ZV8 A;  3HE5 A;  5APQ A;  1RF0 A;  2GUS A;  2HLO A;  2OYI C;  3RL0 D;  3HUS C;  3CL3 D;  2A45 I;  2MJZ A;  2NPS C;  5AW8 B;  1FZG A;  1DH3 A;  2P2U A;  1A02 F;  1GU5 A;  2P7J A;  2GM4 A;  1N73 B;  1H8A A;  2YKQ A;  2H43 A;  1URQ C;  3GHG B;  1X9V A;  3RK2 B;  1N7L A;  1IFD A;  3IFM A;  2XDJ A;  2W27 A;  2HOD A;  1G2C B;  1IK9 A;  3M9Q A;  3HRN A;  5KLV K;  3M9H A;  5AW4 B;  2Q5U A;  3HD7 B;  1JCC A;  3P8M C;  3A7O A;  2A45 H;  3OAK A;  5AVX B;  3PP5 A;  1NO4 A;  1PFI A;  1T2K D;  4LGD E;  1SFC A;  1DEB A;  1YYC A;  2WSF H;  1LT9 A;  2IX7 C;  4AUW A;  2CPB A;  3MUD A;  1H89 A;  5AW3 B;  1L0L K;  1NTM K;  1KFM A;  1A02 J;  1KIL A;  1XTG B;  4IFD K;  3M0D A;  3B5N A;  4W7Y A;  1HJB A;  1YTZ T;  1FU1 A;  3M91 A;  3EFG A;  3NFQ A;  2HPC B;  2FFD A;  1JO5 A;  1FOS F;  1FZA A;  2A45 G;  2P1J A;  2VRS A;  4WBA A;  2OYI B;  2KOG A;  1SP4 A;  3HE5 B;  1AQ5 A;  1MZ9 A;  3A5T A;  3VP8 A;  2NPS B;  3E1I A;  3R2P A;  1GL2 D;  2C0X A;  2OYH A;  3BRT B;  1SQQ K;  1JY3 N;  1J1E B;  1N73 A;  3RK2 D;  1JMM A;  2L5G B;  3M0A A;  1S9K D;  3TNU B;  3GHG A;  3VMX A;  2WPQ A;  1HBW A;  5CCG C;  4WY4 C;  3G3Z A;  1GL2 A;  3RK3 B;  2HFE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...