3L4NA

Crystal structure of yeast monothiol glutaredoxin grx6
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Monothiol glutaredoxin-6
publication title Structural and biochemical characterization of yeast monothiol glutaredoxin Grx6
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 113
sequence length 113
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l4nA00
1X5EA 5ELAA 1XBSA 3IAS2 1WP0A 2H75A 2DIZA 4TXOA 3FZ4A 4Q5NA 3E0UA 3CTGA 2XBIA 3HZ4A 4DVCA 1JLVA 4ZL9A 2YNXA 1WOUA 1GNWA 2ON7A 3QAGA 2I9HA 4YAVA 1K3OA 4BWSA 3F6DA 2QKEA 2LV3A 5IM9A 3LXZA 4LMWA 3CSHA 1V9WA 3F4RA 3GL5A 1M9AA 5L71A 3ZIJA 1XWBA 4NWYA 5DAKA 2VD1A 4WF4A 2VCWA 2VL2C 4ZB9A 4EL1A 1RQMA 2I1UA 4IHUA 3ZZXA 5C04A 2I4AA 4OO5A 1F9MA 1EV9A 1GUMA 3QR6A 2E2MA 1XW6A 1SJZA 2KLXA 4I5QA 1EGOA 2YJ7A 3L9VA 1YEPA 4MH3A 3TB2A 2F8AA 1SL1B 5AGYA 1A0RP 1F3AA 4I2UA 1M2AA 3LSZA 4YQMA 3IDVA 3KMOA 2VM2A 1KEBA 1LU4A 5ECNB 2DLXA 4TXVA 1O81A 2J9HA 2M72A 1ERVA 2ES7A 2VLTA 4IP1A 3TKSA 3C8EA 3ME7A 2CZ3A 2GSQA 2HZEA 3O6TA 3MSZA 4N0VA 1RK4A 2F3MA 3NZNA 2DJKA 3A5WA 5IQYA 5J4UA 1TXXA 3VPQA 1O8XA 2R4VA 3RBTA 3FRCA 3IOSA 1TRVA 3GYKA 3HVXA 4J2FA 3F9UA 3RHBA 4KDYA 3CTFA 4N10A 4TW5A 2TIRA 2YZUA 2ZNMA 4LA1A 5CRHA 2IMEA 2LNSA 2NDOA 5DCHA 1MD4A 2GSSA 3EU4A 4ZXGA 1YDKA 4X43A 2HXKA 3QAVA 1SENA 3IE3A 2VL2A 1E6BA 2VLUA 4PQIA 3GX8A 1MDIA 2RM5A 3LEFA 2VL3A 3M1GA 4J57E 5D9TA 5ABRA 1B4PA 2VIMA 2IN3A 1K0NA 3RAZA 3VK9A 1U87A 3C71A 6GSVA 5J3RA 1CQHA 2IFQA 2CV4A 2CA8A 3O76A 1TK5B 1U6TA 1SKSB 1FB6A 1BYEA 4K1FA 1S3DA 2H8LA 4L0UA 3BCIA 4XS4A 4D73B 4MPFA 2L57A 5IMCA 5DVBA 4IKHA 3TKQA 4HEA2 3FYGA 3GV1A 1XWCA 3HJMA 4L0WA 1AQXA 2HT9A 2XPEA 4MPGA 1HNCA 4FYUA 5G1LA 1G6YA 2ALBA 2O87A 2MMZA 3ZIVA 2I81A 2JU5A 2ON5A 3L9UA 5CP1A 3DKSA 1QUWA 1ZGNA 3L9SA 1MDKA 1O6JA 5LCZA 4WXTA 5EY6A 3UJ1A 3Q6OA 2IJYA 4JEDA 3ZL5A 3KEBA 5GAND 1RW1A 3IK9A 1V98A 3QMXA 4NMUA 2JSZA 5JWOB 1B9YC 1ZL9A 1S3CA 1X9WB 2FGXA 3UL3A 6GSSA 2DJJA 4AGSA 2N5BA 2C4JA 3MAKA 3US3A 4RI6A 1WJKA 2NPBA 1OE8A 1YEXA 3KGKA 4XIHA 3ERGA 1GULA 3KP9A 2R37A 3DRNA 4TR1B 1TK8B 4HOJA 2FWEA 4AJ6A 1T4YA 2YN1A 1OC9B 2B1LA 4MJCA 1DUGA 1WRYA 4IW9A 1NM3A 4CHSA 4LLRA 5COHA 2OE0A 5A4VA 2RIIA 1K3YA 4GXZA 3FHKA 2ZCTA 4NV2A 1VF1A 3H1NA 3GTUB 1Z3EA 2LQOA 3DD3A 3GKKA 1SK0A 4K7IA 5IMZA 3DYRA 3FR6A 1A2JA 4LMVA 4GRFA 2R6KA 4DSSA 2AUVA 19GSA 1NHOA 1X9MB 2YV9A 2VOCA 1ERUA 1AXDA 1EOGA 1HYUA 3RHCA 4IBPA 2PUKC 1A8YA 2C1YA 1EP8A 4MJEA 3VURA 5HFGA 1TTZA 1ML6A 6GSWA 1ZYEA 3AY8A 1ILOA 3IBHA 3LFLA 4GLTA 3GUSA 2C3QA 2QSIA 3TCOA 1GL8A 2GTUA 4HJ2A 2AAWA 4V1Ag 5IMDA 3GSSA 5C00A 2VCTA 5G30A 1PGTA 3I43A 1Z6MA 2B5EA 1ON4A 4TR4A 3IAM2 2DJ3A 4KUNA 4YQUA 1URMA 4ECBA 2CAIA 4DEJA 4EDYA 5GSSA 2H0IA 1KTEA 5D93A 1PL1A 4RQRA 4JE1A 1BJXA 3IR4A 2B1KA 2L4QA 2LUSA 1B48A 5CO3A 3WYWA 1XVQA 1WIKA 1XOBA 2B6MA 1GSDA 4EXJA 2LKUA 3BJ5A 4ZBBA 3DMLA 3WGXA 2KUCA 4G19A 3UMAA 5H5SA 3G7JA 4MF7A 2F51A 2WS2A 2V32A 1F2EA 2C0DA 11GSA 3KP8A 2H6YA 2WB9A 2HNLA 3GH6A 5DALA 4ZIJA 1UC7A 3QDNA 1EGRA 3FZ5A 4I2TA 5IOXA 2OADA 2OBKA 3TKRA 3TRPA 2V6KA 4H86A 2K6VA 5ECPB 1PX6A 3ZFLA 3FW2A 5E59A 3ZRDA 3BCKA 2KOKA 3HXSA 4X1UA 5IO0A 1TOFA 3TJFA 2YP6A 2V2GA 4KX4A 3ZMKA 3TJGA 4KDUA 5F06A 5ECOB 4IS0A 2C8UA 1TRUA 3CRTA 3M9KA 1ST9A 2QGVA 4HZ4A 4AJ8A 2K18A 1DSBA 2YCDA 3WT1A 2LJRA 2LSTA 1GSEA 1MEKA 5J5NA 4NHWA 1XPVA 2GZZA 2FUG2 1TDIA 1FG4A 1OVNA 3D21A 2VUPA 4O32A 3HCZA 2H30A 3ZVJD 4YH2A 1SU9A 4TXOB 5IOWA 2H70A 4G2EA 2CX3A 3J7Yk 3SWLA 2GZYA 3EURA 2H6XA 2VCVA 1V58A 3UEMA 2B7KA 1TKDB 1V40A 2N5AA 4HJMA 4JR4A 2B7JA 5IMAA 1EOHA 4L5OA 3TKSC 5JCGA 4ZL8A 3J7Yb 2DBCA 1FAAA 4JZQA 2FLSA 1AAZA 3F3QA 1U3AA 1USBA 5DAKB 5F0GA 2I3YA 1A23A 3CSIA 3DXBA 4QQ7A 3DIEA 5D96A 2JSYA 2H66A 1B8XA 1J0FA 3ZLPA 4KDXA 1XWKA 2FCHA 3QAWA 4AF2A 1T00A 3APSA 3KH9A 5EL8A 5G5FA 4XTSA 5CAXA 4GWRA 4IJ3A 3W6GA 3BD2A 5KEJA 1TP9A 1R5PA 1QXHA 4ZB8A 1UVZA 5GSTA 3G7IA 5D9WA 3K8NA 2HE3A 4ISDA 5HFKA 2PVOC 3ZYWA 4GTUA 1T3BA 2A4VA 3ZITA 5IMFA 1AQVA 2KHPA 4XS6A 3DGQA 1M0UA 4KNDA 3FR3A 1NW2A 1QK8A 3WGDA 4TN8A 2EIOA 3QPMA 3UVHA 5JWQB 2HZEB 4BWQA 2G0FA 10GSA 1S3AA 1A8LA 3ISOA 4K0NA 4NAXA 4QL7A 5G31A 1DBYA 3IV4A 3H8QA 3C73A 2A2SA 3KD0A 4PQHA 4EKZA 2YWNA 4KB3A 4KAEA 5DBQA 3M3MA 1SD8A 2O8VB 1KNGA 1OKTA 1HD2A 3E3EA 5J9CA 1GTUA 1V57A 4KCEA 1X9SB 4POLA 5ENUA 5G2ZA 1TI3A 2YJHA 3LG6A 5LD0A 4E8HA 4PNFA 2H71A 3FY7A 3VWWA 3GX0A 1JZRA 4XRAA 4PURA 1FHEA 3ZVJA 2PMTA 4MABA 2C80A 4ZL7A 3PR8A 2MZCA 4OO4A 2H0HA 5B8BA 2AJQB 5LNKe 2IFQB 1FB0A 1AC1A 4EE0A 1GSUA 2NVLA 3L4NA 4BA7A 3GKXA 1T8EB 2GQLA 1K0AA 5DJMA 4IELA 3P90A 4FH8A 2LJAA 4XS4B 2HLSA 2CVDA 5ECLB 4ECCA 5HR0A 2H76A 1ZCPA 4O5RA 4G10A 4ZB6A 3E9JB 2YOIA 1OYJA 3EINA 4EVMA 4IN0A 5A4WA 5H5QA 5CRGA 7GSSA 1NSWA 2PERA 1GH2A 4ACSA 3DWVA 2FA4A 2YV7A 3FR9A 3HVVA 5B6NA 2FNOA 3I6AA 3VPTA 2E2GA 3F6FA 3UBKA 3TJKA 2XBQA 4F9ZA 1WPIA 3TRXA 1FOVA 2VD0A 1LBKA 4K7OA 4MF5A 4HZ2A 2C3TA 4EDZA 3HY2A 1T1VA 3EYTA 4PX1A 1Z7RA 2X8CA 1YF0A 1GNEA 1YZXA 3HZ8A 3KZQA 2IL3A 2CVKA 2L6DA 2IMIA 1AUCA 4HQZA 2GS3A 2CVBA 3BBYA 3EMXA 3LYPA 3TKPA 2YWMA 2JACA 2LRNA 1XIYA 2IMFA 1TU8A 4GCIA 4HQSA 1GLPA 1BG5A 5IPGA 1O85A 1G7EA 2TRXA 3F4TA 4EO3A 3D5JA 3GA4A 4DSQA 3A2WA 1M99A 4K9ZA 2FWGA 3Q19A 1G6WA 1ABAA 1SK1A 1JZDA 1PL2A 3FZ9A 1BAYA 5ID2A 2RLIA 4D73A 2LJKA 1MDJA 1A2MA 1ZZYA 4ULXA 4EC0A 2FA8A 4PGTA 3LWAA 1WMJA 1A24A 3IA1A 2JADA 3KTLA 2G2QA 2L5OA 2DJ2A 4IQAA 4EUYA 2DIYA 1GSSA 5DQYA 5HR1A 5B8AA 2JZTA 1ZYQB 4ILFA 2BTOT 2WRTA 1WE0A 4OWYA 2L4CA 1XW5A 1E2YA 3GFKA 1MD3A 3CXGA 1A0FA 5KN0A 1TW9A 1YF1A 2L5LA 1UA5A 2OBIA 3IK7A 3IHQA 3SBCA 4TR0A 4MCUA 3H79A 4WF5A 2VLVA 4V1Ap 2CZ2A 3RDWA 3G7YA 3QCPA 4KGIA 5KN1A 1U3IA 3KMNA 3M9JA 4RI7A 2WFCA 2WGRA 2LTKA 2R5GA 1PMTA 5F8BA 3GKNA 3PH9A 3GMFA 4V2MA 1BX9A 3N5OA 4JRRA 2L6CA 3APOA 1Z5YE 2WZ9A 3C1SA 2PWJA 6GSUA 3H93A 3LQ7A 1MTCA 3HKRA 3O3TA 4O7HA 22GSA 5IMVA 4MJAA 1GTBA 1Y6EA 4IQ1A 1M2DA 3KCMA 3MWHA 1WWJA 1QQ2A 5DALB 2VAFA 2FD3A 3GIXA 4GSNA 4OFNA 4CW9A 3KTBA 4TVEA 4OD7A 4OCFA 5JWRB 4P3YB 2MMOA 4TKYA 1R26A 3V1WA 1PD21 4F03A 1SKWB 4RUVA 4QL9A 2YZHA 1R5AA 2K8SA 4POMA 1B4QA 5D9XA 3HD5A 1F6MC 4OFTA 2X99A 2DJ0A 2H1AA 4WBRD 1PA3A 1O7UA 5GAPD 1THXA 1XFLA 5ECMB 2OE1A 1JZWA 1PKZA 1VGLA 2HRNA 3QOUA 5B7CA 1QGVA 2VCZA 1NHYA 1TRSA 4PQ1A 4GSSA 2HZFA 3CYNA 3ME8A 3CMIA 3P8WA 5A4UA 1YKCA 1K0BA 4XRDA 4LL1B 2OACA 5H5RA 3HYPA 2WJUA 4ECIA 1JFUA 4LL4B 4DSRA 1VF3A 5DCGA 3GKMA 1XXUA 1SYRA 3PGTA 3ZMLA 1YQ1A 1I9DA 2M46A 3EU3A 3TOUA 4PUAA 2HSHA 4TR3A 1GSQA 1R4WA 5AN1A 5INYA 3HDCA 2XPDA 2O7KA 3DVWA 1IYHA 3G9BA 1SL0B 4IVFA 1Y25A 2YWIA 4KSMA 2Z9SA 3VWVA 2GQKA 3W8JA 3NIVA 4F82A 4HU7A 1SK2A 2RM6A 4ZILA 3KH7A 3P7XA 2CQ9A 1QMVA 3ERFA 3RPPA 4JBBA 2VCXA 6GSTA 5ECRB 3HJPA 1HNBA 1YY7A 2P31A 5KN2A 2OJLA 1FVKA 3QD9A 2JZSA 2H73A 2L59A 1X5CA 3NOFA 1M7TA 1K0CA 3PINA 2VL9A 1THOA 4GQFA 5DQSA 4BL7A 3VWXA 3VFIA 3EE2A 3C1RA 4PXOA 1XW9A 3WGEA 2BJXA 3I9V2 2EC4A 1AW9A 1H75A 3TGZA 5D9VA 2HYXA 4OCEA 5J41A 1PX7A 1J08A 1GLQA 4F0BA 5ECHB 2LRTA 1OAZA 2GGTA 4XCSA 4KW6A 2GT5A 1U88A 5HQPA 1SD9A 4JU5A 5HR2A 1LJRA 3L0HA 3U5RE 1FO5A 5E4WA 5CRDA 2DSAA 2MBSA 4PUFC 3VI7A 3UVTA 4MZBA 2AV4A 2V6OA 4N30A 4L8EA 1I5GA 4WEYA 4BVYA 1HNAA 1N2AA 4V2NA 2X8GA 2VM1A 4OMVA 3OR5A 3GSTA 1OE7A 5EPFA 2NTOA 2GZPA 5GZZB 5DDLA 2JZRA 4ZBDA 4GF0A 3UARA 4MJBA 1JLWA 4NHZA 1XCCA 5D73A 2YANA 2HI7A 4WETA 3FZAA 3GH9A 1Z9HA 2R3XA 4MLYA 4MA9A 4I97A 2PN8A 1VF2A 2PVQA 3CSJA 2MYGA 1AIUA 3RPNA 2B3SA 5CREA 2B5XA 4ECJA 2C3NA 4XS1A 2CT6A 3GURA 2PU9C 3QFBC 1TI1A 2F8FA 4O92A 2IIYA 2H1GA 3I69A 1GP1A 3LXTA 4YAPA 1BEDA 4Z7XA 4X0XA 5ELGA 2H19A 5EVOA 3VI5A 4FO5A 3M8NA 4N11A 2DMMA 3A2XA 2K9FA 1OKDA 4Q5RA 3FK8A 2EIQA 1XZOA 2MMAA 4ID0A 4L5LA 3EC3A 1V2AA 4K6XA 3TRQA 4EF0A 2H0GA 2JL4A 2H72A 1HQOA 20GSA 4RQXA 1Z6NA 1ACVA 2WULA 2GDRA 2O85A 1EP7A 5AISA 1XVWA 1GSYA 1ZOFA 3VWUA 1YKAA 1FW1A 2OE3A 2PPTA 2FHEA 1C72A 3S9FA 2LQQA 3UBLA 1GTIA 3UAPA 4KCAA 2O89A 5ECIB 1G0TA 1SL2B 5ECQB 5CNWA 3TUEA 2H01A 5JCUA 2DC5A 1BQ7A 2X8HA 3F0IA 3F3RA 2VCQA 5HFIA 4WR4A 14GSA 3MDKA 4IJIA 2YPMA 3ED3A 4F2IA 2OA7A 2KP2A 3F8UA 2YWOA 3TJBA 2H1BA 4MZCA 4PNGA 3KXOA 2X64A 1GUKA 4GSTA 5ID2B 2IWTA 3ERWA 1M2BA 3ZFBA 4KA0A 2AYTA 1F3BA 4K7NA 4FIWA 4HS1A 2P5QA 3BOAA 2E7PA 1GUHA 1X0RA 1TU7A 5B6MA 1FVJA 1G7OA 3Q18A 3D22A 3ZREA 2GSTA 1K0MA 3L78A 2C0GA 2B5YA 4KSOA 4Q5FA 12GSA 3UIWA 4BPYA 1XWGA 6GSXA 2ZUPA 4DSSB 4HI7A 3TOTA 2HFDA 3R2QA 5AIVA 1T7PB 3LGCA 4MH2A 4NV5A 5JCWA 2J23A 5AIXA 2RUEA 4MP4A 2H1DA 3D4MA 4HU9A 1X5DA 3DEXA 3VLNA 3HVSA 1PSQA 4ZBAA 1QFNA 1F37A 4ML1A 3D6IA 1VRSD 2MBTA 2MMNA 5ECSA 3TJJA 1M9BA 4J56E 1J9BA 1ERTA 5ECKB 2A2RA 2DJ1A 17GSA 4KE3A 3FEUA 1O8WA 2K8VA 3JCML 1DE1A 1GRXA 2XC2A 4POBA 1KBNA 4MK3A 2GLRA 3HHVA 3WD6A 1XWAA 1EZKA 2TRCP 1UN2A 4KH7A 5DJLA 4AJ7A 3GHAA 5G1KA 2REMA 4K8MA 1O73A 2C0FA 2P5RA 1DE2A 4TR1A 4MZWA 1AQWA 16GSA 1TRWA 4FYCA 1OC9A 1CQGA 1SJ6A 4V2LA 3D0ZA 3WT2A 2XHFA 2LNTA 5A5KA 2IPAA 3EMPA 3EVIA 1TK0B 4K0GA 3LORA 3Q74A 2EIRA 3A2VA 2CX4A 3IXRA 2HSYA 5FWGA 1JZOA 1K0OA 2D2ZA 2H6ZA 2HRFA 3GTUA 2GQMA 5D8IA 1EEMA 2V41A 3HA9A 18GSA 4POKA 4HDEA 3F4SA 4ML6A 3GRXA 4G9HA 1PKWA 4OFMA 2OKAA 4WR5A 3KIJA 3M0FA 1PN9A 3F63A 2E0QA 4JR6A 2KP1A 2F9SA 4N0ZA 1Q4JA 3D4TA 4WKWA 1YJ6A 1SKRB 3IC4A 4TOPA 5G5EA 1W89A 2NBSA 2C0EA 4HUAA 1PRXA 5FHIA 1W4VA 1EEJA 3IRAA 1K3LA 4NPBA 2IMKA 3GL3A 3MNGA 2GSRA 2M80A 4IP6A 3C7MA 3LYKA 2RUFA 1N8JA 1EWXA 4XHMA 1EV4A 3QFAC 3TDGA 2PBJA 4Q5QA 5KN3A 5CYYA 1PQNA 2QC7A 4MMMA 4MF6A 2GVPA 13GSA 2P0GA 4F0CA 2LS5A 1T4ZA 5J9BA 4K2DA 4E8EA 3TKSE 1IYIA 1OC3A 1SYXA 3KJYA 2LEGA 3GNJA 3CRUA 5FT3A 5F07A 4NXIA 4MDCA 1TJDA 2N5FA 8GSSA 3A3TA 2CAQA 4CDOA 2R2JA 2WDUA 1Z7PA 3FKFA 2AHEA 3APQA 1B9XC 3HJOA 3GN3A 4YQVA 2AB6A 3LJRA 3KM6A 3H4KA 3U6VA 2GT6A 1ERWA 3N9JA 3P2AA 1OC8A 3UOMA 2BMXA 9GSSA 5IO2A 3DVXA 4BVXA 2H74A 2PGTA 3EWLA 4I6XA 2FWHA 4IGJA 6GSYA 1R7HA 1A2LA 2DMLA 3ZTLA 2IMDA 4GQCA 2LRCA 1GSFA 3CBUA 3W8SA 5HR3A 1JHBA 4I8BA 4WBJA 2FWFA 1SJIA 5IPHA 1ZMAA 4FYBA 5CRWA 1XOAA 1K0DA 1GTAA 5F05A 2FY6A 1GWCA 1H4OA 2WCIA 5IIZA 3IPZA 4TRXA 1Q98A 1VF4A 2V1MA 2VO4A
chains in the Genus database with same CATH superfamily
1X5EA 5ELAA 1XBSA 3IAS2 1WP0A 4CY8A 2H75A 2DIZA 4TXOA 3FZ4A 4Q5NA 3E0UA 3CTGA 2XBIA 3HZ4A 4DVCA 1JLVA 4ZL9A 2YNXA 1WOUA 1GNWA 2ON7A 3QAGA 2I9HA 3R3EA 4YAVA 1K3OA 4BWSA 3F6DA 2QKEA 2LV3A 5IM9A 3LXZA 4LMWA 3CSHA 1V9WA 3F4RA 3GL5A 1M9AA 5L71A 3ZIJA 1XWBA 4NWYA 5DAKA 2VD1A 4WF4A 2VCWA 2VL2C 4ZB9A 4EL1A 1RQMA 2I1UA 4IHUA 3ZZXA 5C04A 2I4AA 4OO5A 1F9MA 1EV9A 1GUMA 3QR6A 2E2MA 1XW6A 1SJZA 2KLXA 4I5QA 1EGOA 2YJ7A 3L9VA 1YEPA 4MH3A 3TB2A 2F8AA 1SL1B 5AGYA 4BIKA 1A0RP 1F3AA 4I2UA 1M2AA 3LSZA 4YQMA 3IDVA 3KMOA 2VM2A 1KEBA 1LU4A 5ECNB 2DLXA 4TXVA 1O81A 2J9HA 2M72A 1ERVA 2ES7A 2VLTA 4IP1A 3TKSA 3C8EA 3ME7A 2CZ3A 2GSQA 2HZEA 3O6TA 3MSZA 4N0VA 1RK4A 2F3MA 3NZNA 2DJKA 3A5WA 5IQYA 5J4UA 1TXXA 3VPQA 1O8XA 2R4VA 3RBTA 3FRCA 3IOSA 1TRVA 3GYKA 3HVXA 4J2FA 3F9UA 3RHBA 4KDYA 2DKIA 3CTFA 4N10A 4TW5A 2TIRA 2YZUA 2ZNMA 4LA1A 5CRHA 2IMEA 2LNSA 2NDOA 5DCHA 1MD4A 2GSSA 3EU4A 4ZXGA 1YDKA 4X43A 2HXKA 3QAVA 1SENA 3IE3A 2VL2A 1E6BA 2VLUA 4PQIA 3GX8A 1MDIA 2RM5A 3LEFA 2VL3A 3M1GA 4J57E 5D9TA 5ABRA 1B4PA 2VIMA 2IN3A 1K0NA 3RAZA 3VK9A 1U87A 3C71A 6GSVA 5J3RA 1CQHA 2IFQA 2CV4A 2CA8A 3O76A 1TK5B 1U6TA 1SKSB 1FB6A 1BYEA 4K1FA 1S3DA 2A2PA 2H8LA 4L0UA 3BCIA 4XS4A 4D73B 4MPFA 2L57A 5IMCA 5DVBA 4IKHA 3TKQA 4HEA2 3FYGA 3GV1A 1XWCA 3HJMA 4L0WA 1AQXA 2HT9A 2XPEA 4MPGA 1HNCA 4FYUA 5G1LA 1G6YA 2ALBA 2O87A 2MMZA 3ZIVA 2I81A 2JU5A 2ON5A 3L9UA 5CP1A 3DKSA 1QUWA 1ZGNA 3L9SA 1MDKA 1O6JA 5LCZA 4WXTA 2R0PA 5EY6A 3UJ1A 3Q6OA 2IJYA 4JEDA 3ZL5A 3KEBA 5GAND 1RW1A 3IK9A 1V98A 3QMXA 4NMUA 2JSZA 5JWOB 1B9YC 1ZL9A 1S3CA 1X9WB 2FGXA 3UL3A 4MNNA 6GSSA 2DJJA 4AGSA 2N5BA 2C4JA 3MAKA 3US3A 4RI6A 1WJKA 2NPBA 1OE8A 1YEXA 3KGKA 4XIHA 3ERGA 1GULA 3KP9A 2R37A 3DRNA 4TR1B 2R0CA 1TK8B 4HOJA 2FWEA 4AJ6A 1T4YA 2YN1A 1OC9B 2B1LA 4MJCA 1DUGA 1WRYA 4IW9A 1NM3A 4CHSA 4LLRA 5COHA 2OE0A 5A4VA 2RIIA 1K3YA 4GXZA 3FHKA 2ZCTA 4NV2A 1VF1A 3H1NA 3GTUB 1Z3EA 2LQOA 3DD3A 3GKKA 1SK0A 4K7IA 5IMZA 3DYRA 3FR6A 1A2JA 4LMVA 4GRFA 2R6KA 4DSSA 2AUVA 19GSA 1NHOA 1X9MB 2YV9A 2VOCA 1ERUA 1AXDA 1EOGA 1HYUA 3RHCA 4IBPA 2PUKC 1A8YA 2C1YA 1EP8A 4MJEA 3VURA 5KOWA 5HFGA 1TTZA 1ML6A 6GSWA 1ZYEA 3AY8A 1ILOA 2QA1A 3IBHA 3LFLA 4GLTA 3GUSA 2C3QA 2QSIA 3TCOA 1GL8A 2GTUA 4HJ2A 2AAWA 4V1Ag 5IMDA 3GSSA 5C00A 2VCTA 5G30A 1PGTA 3I43A 1Z6MA 2B5EA 1ON4A 4TR4A 3IAM2 2DJ3A 4KUNA 4YQUA 1URMA 4ECBA 2CAIA 4DEJA 4EDYA 5GSSA 2H0IA 1KTEA 5D93A 1PL1A 4K5SA 4RQRA 4JE1A 1BJXA 3IR4A 2B1KA 2L4QA 2LUSA 1B48A 5CO3A 3WYWA 1XVQA 1WIKA 1XOBA 2B6MA 1GSDA 4EXJA 2LKUA 3BJ5A 4ZBBA 3DMLA 3WGXA 2KUCA 4G19A 3UMAA 5H5SA 3G7JA 4MF7A 2F51A 2WS2A 2V32A 1F2EA 3CQFA 2C0DA 11GSA 3KP8A 4K5RA 2H6YA 2WB9A 2HNLA 3GH6A 5DALA 4ZIJA 1UC7A 3QDNA 1EGRA 3FZ5A 4I2TA 5IOXA 2OADA 2OBKA 3TKRA 3TRPA 2V6KA 4H86A 2K6VA 5ECPB 1PX6A 3EPTA 3ZFLA 3FW2A 5E59A 3ZRDA 4BVXB 3BCKA 2KOKA 3HXSA 4X1UA 5IO0A 1TOFA 3TJFA 2YP6A 2V2GA 4KX4A 3ZMKA 3TJGA 4KDUA 5F06A 5ECOB 4IS0A 2C8UA 1TRUA 3CRTA 3M9KA 1ST9A 2QGVA 4HZ4A 4AJ8A 2K18A 1DSBA 2YCDA 3WT1A 2LJRA 2LSTA 1GSEA 1MEKA 5J5NA 4NHWA 1XPVA 2GZZA 2FUG2 1TDIA 1FG4A 1OVNA 3D21A 2VUPA 4O32A 3HCZA 2H30A 3ZVJD 4YH2A 1SU9A 4TXOB 5IOWA 2H70A 4O5QA 4G2EA 2CX3A 3J7Yk 3SWLA 2GZYA 3EURA 2H6XA 2VCVA 1V58A 3UEMA 2B7KA 1TKDB 1V40A 2N5AA 4HJMA 4JR4A 2B7JA 5IMAA 1EOHA 4L5OA 3TKSC 5JCGA 4ZL8A 3J7Yb 2DBCA 1FAAA 4JZQA 2FLSA 1AAZA 3F3QA 1U3AA 1USBA 5DAKB 5F0GA 2I3YA 1A23A 3CSIA 3DXBA 4QQ7A 3DIEA 5D96A 2JSYA 2H66A 1B8XA 1J0FA 3ZLPA 4KDXA 4YKGA 1XWKA 2FCHA 3QAWA 4AF2A 1T00A 3APSA 3KH9A 5EL8A 5G5FA 4XTSA 5CAXA 4GWRA 4IJ3A 3W6GA 3BD2A 5KEJA 1TP9A 1R5PA 1QXHA 4ZB8A 1UVZA 5GSTA 5BRTA 3G7IA 5D9WA 3K8NA 2HE3A 4ISDA 5HFKA 2PVOC 3ZYWA 4GTUA 1T3BA 2A4VA 3ZITA 5IMFA 1AQVA 2KHPA 4XS6A 3DGQA 1M0UA 4KNDA 3FR3A 1NW2A 1QK8A 3WGDA 4TN8A 2EIOA 3QPMA 3UVHA 5JWQB 2HZEB 4BWQA 2G0FA 10GSA 1S3AA 1A8LA 3ISOA 4K0NA 4NAXA 4QL7A 5G31A 1DBYA 3IV4A 3H8QA 3C73A 2A2SA 3KD0A 4PQHA 1PN0A 4EKZA 2YWNA 4KB3A 4KAEA 5DBQA 3M3MA 1SD8A 2O8VB 1KNGA 1OKTA 1HD2A 3E3EA 5J9CA 1GTUA 1V57A 4KCEA 1X9SB 4POLA 5ENUA 5G2ZA 1TI3A 2YJHA 3LG6A 5LD0A 4E8HA 4PNFA 2H71A 3FY7A 3VWWA 3GX0A 1JZRA 4XRAA 4PURA 1FHEA 3ZVJA 2PMTA 4MABA 2C80A 4ZL7A 3PR8A 2MZCA 4OO4A 2H0HA 5B8BA 1PFOA 2AJQB 5LNKe 2IFQB 1FB0A 1AC1A 4EE0A 1GSUA 2NVLA 3L4NA 4BA7A 4CY6A 4KF9A 3GKXA 1T8EB 2GQLA 1K0AA 5DJMA 1M3IA 4IELA 3P90A 4FH8A 2LJAA 4XS4B 2HLSA 2CVDA 5ECLB 4X4JA 4ECCA 5HR0A 2H76A 1ZCPA 4O5RA 4G10A 4ZB6A 3E9JB 2YOIA 1OYJA 3EINA 4EVMA 4IN0A 5A4WA 5H5QA 5CRGA 7GSSA 1NSWA 2PERA 1GH2A 4ACSA 2X4AA 3DWVA 2FA4A 2YV7A 3FR9A 3HVVA 5B6NA 2FNOA 3I6AA 3VPTA 2E2GA 1XG8A 3F6FA 3UBKA 3TJKA 2XBQA 4F9ZA 1WPIA 3TRXA 4ICYA 1FOVA 2VD0A 1LBKA 4K7OA 4MF5A 4HZ2A 2C3TA 4EDZA 3HY2A 1T1VA 3EYTA 4PX1A 1Z7RA 2X8CA 1YF0A 1GNEA 1YZXA 3HZ8A 3KZQA 2IL3A 2CVKA 2HRAA 2L6DA 2IMIA 1AUCA 4HQZA 2GS3A 2CVBA 3BBYA 3EMXA 3LYPA 4HSCX 3TKPA 2YWMA 2JACA 2LRNA 1XIYA 2IMFA 1TU8A 4GCIA 4HQSA 1GLPA 1BG5A 5IPGA 1O85A 1G7EA 2TRXA 3F4TA 4EO3A 3D5JA 3GA4A 4DSQA 3A2WA 1M99A 4K9ZA 2FWGA 3Q19A 1G6WA 1ABAA 1SK1A 1JZDA 1PL2A 3FZ9A 1BAYA 5ID2A 2RLIA 4D73A 4EIPA 2LJKA 1MDJA 1A2MA 1ZZYA 4ULXA 4EC0A 2FA8A 4PGTA 3LWAA 1WMJA 1A24A 3IA1A 2JADA 3KTLA 2G2QA 2L5OA 2DJ2A 4IQAA 4EUYA 2DIYA 1GSSA 5DQYA 5HR1A 5B8AA 2JZTA 1ZYQB 4ILFA 2BTOT 2WRTA 1WE0A 4OWYA 2L4CA 1XW5A 1E2YA 3GFKA 1MD3A 3CXGA 1A0FA 5KN0A 1TW9A 1YF1A 2L5LA 1UA5A 2OBIA 3IK7A 3IHQA 3SBCA 4TR0A 4MCUA 3H79A 4WF5A 2VLVA 4V1Ap 2CZ2A 3RDWA 3G7YA 3QCPA 2HSMA 4KGIA 5KN1A 1U3IA 3KMNA 3M9JA 4RI7A 2WFCA 2WGRA 2LTKA 2R5GA 1PMTA 5F8BA 3GKNA 3PH9A 3GMFA 4V2MA 1BX9A 3N5OA 3IC8A 4JRRA 2L6CA 3APOA 1Z5YE 2WZ9A 3C1SA 2PWJA 6GSUA 3H93A 3LQ7A 1MTCA 3HKRA 3O3TA 4O7HA 22GSA 5IMVA 4MJAA 1GTBA 1Y6EA 4IQ1A 1M2DA 3KCMA 3MWHA 1WWJA 1QQ2A 5DALB 2VAFA 2FD3A 3GIXA 4GSNA 4OFNA 4CW9A 3KTBA 4TVEA 4OD7A 4OCFA 5JWRB 4P3YB 2MMOA 4TKYA 1R26A 4USSA 3V1WA 1PD21 4F03A 1SKWB 4RUVA 4QL9A 2YZHA 1R5AA 2K8SA 4POMA 1B4QA 5D9XA 3HD5A 1F6MC 4OFTA 2X99A 2DJ0A 2R0GA 2H1AA 4WBRD 1PA3A 1O7UA 5GAPD 1THXA 1XFLA 5ECMB 2OE1A 1JZWA 1PKZA 1VGLA 4PTSA 2HRNA 3QOUA 5B7CA 1QGVA 2VCZA 1NHYA 1TRSA 4PQ1A 4GSSA 2HZFA 3CYNA 3ME8A 3CMIA 3P8WA 5A4UA 1YKCA 1K0BA 4XRDA 4LL1B 2OACA 5H5RA 3HYPA 2WJUA 4ECIA 1JFUA 4LL4B 4DSRA 1VF3A 5DCGA 3GKMA 1XXUA 1SYRA 3PGTA 3ZMLA 1YQ1A 1I9DA 2M46A 3EU3A 3TOUA 4PUAA 2HSHA 4TR3A 5BMUA 1GSQA 1R4WA 5AN1A 5INYA 3HDCA 2XPDA 2O7KA 3DVWA 1IYHA 4K2XA 3G9BA 1SL0B 4IVFA 1Y25A 2A4HA 2YWIA 4KSMA 2Z9SA 3VWVA 2GQKA 3W8JA 3NIVA 4F82A 4HU7A 1SK2A 4YKFA 2RM6A 4ZILA 3KH7A 3P7XA 2CQ9A 1QMVA 3ERFA 1FOHA 3RPPA 2X49A 2VCXA 4JBBA 6GSTA 5ECRB 3HJPA 1HNBA 1YY7A 2P31A 5KN2A 2OJLA 1FVKA 3QD9A 2JZSA 2H73A 2L59A 1X5CA 3NOFA 1M7TA 1K0CA 3PINA 2VL9A 1THOA 4GQFA 5DQSA 4BL7A 3VWXA 3VFIA 3EE2A 3C1RA 4PXOA 1XW9A 3WGEA 2BJXA 3I9V2 2EC4A 1AW9A 1H75A 3TGZA 5D9VA 2HYXA 4OCEA 5J41A 1PX7A 1J08A 1GLQA 4F0BA 5ECHB 2LRTA 1OAZA 2GGTA 4XCSA 4KW6A 2GT5A 1U88A 5HQPA 1SD9A 4JU5A 5HR2A 1LJRA 3L0HA 3U5RE 1FO5A 5E4WA 5CRDA 2DSAA 2MBSA 4PUFC 3VI7A 3UVTA 4MZBA 2AV4A 2V6OA 4N30A 4L8EA 1I5GA 4WEYA 4BVYA 1HNAA 1N2AA 4V2NA 2X8GA 2VM1A 4OMVA 3OR5A 3GSTA 1OE7A 5EPFA 2NTOA 2GZPA 5GZZB 5DDLA 2JZRA 4ZBDA 4GF0A 3UARA 4Z2RA 4MJBA 1JLWA 4NHZA 1XCCA 5D73A 2YANA 2HI7A 4WETA 3FZAA 3GH9A 1Z9HA 2R3XA 4MLYA 4MA9A 4I97A 2PN8A 1VF2A 2PVQA 3CSJA 2MYGA 1AIUA 3RPNA 2B3SA 5CREA 2B5XA 4ECJA 2C3NA 4XS1A 2CT6A 3GURA 2PU9C 3QFBC 1TI1A 2F8FA 4O92A 2IIYA 2H1GA 3I69A 1GP1A 3LXTA 4YAPA 1BEDA 4Z7XA 4X0XA 5ELGA 2H19A 5EVOA 4FQUA 3VI5A 4FO5A 3M8NA 4N11A 2DMMA 3A2XA 2K9FA 1OKDA 4Q5RA 3FK8A 2EIQA 1XZOA 2QA2A 2MMAA 4ID0A 4L5LA 3EC3A 1V2AA 4K6XA 3TRQA 4EF0A 4Z2TA 2H0GA 2JL4A 2H72A 1HQOA 20GSA 4RQXA 4G0KA 1Z6NA 1ACVA 2WULA 2GDRA 2O85A 1EP7A 5AISA 1XVWA 1GSYA 1ZOFA 4A5PA 3VWUA 4G0LA 1ZYPA 1YKAA 1FW1A 2OE3A 2PPTA 2FHEA 1C72A 3S9FA 2LQQA 3UBLA 1GTIA 3UAPA 4KCAA 2O89A 5ECIB 1G0TA 1SL2B 5ECQB 5CNWA 3TUEA 2H01A 5JCUA 2DC5A 1BQ7A 2X8HA 3F0IA 3F3RA 2VCQA 5HFIA 4WR4A 14GSA 3MDKA 4IJIA 2YPMA 3ED3A 3A5IA 4F2IA 2OA7A 2KP2A 3F8UA 2YWOA 3TJBA 2H1BA 4MZCA 4PNGA 3KXOA 2X64A 1GUKA 4GSTA 5ID2B 2IWTA 3ERWA 1M2BA 3ZFBA 4KA0A 2AYTA 1F3BA 3LW9A 4K7NA 4FIWA 4HS1A 2P5QA 3BOAA 2E7PA 3FMWA 1GUHA 1X0RA 1TU7A 5B6MA 1FVJA 1G7OA 3Q18A 3D22A 3ZREA 2GSTA 1K0MA 3L78A 2C0GA 2B5YA 4KSOA 4Q5FA 12GSA 3UIWA 4BPYA 1XWGA 6GSXA 2ZUPA 4DSSB 4HI7A 3TOTA 2HFDA 3R2QA 5AIVA 1T7PB 3LGCA 4MH2A 4NV5A 5JCWA 2J23A 5AIXA 2RUEA 4MP4A 2H1DA 3D4MA 4HU9A 1X5DA 3DEXA 3MIXA 3VLNA 3HVSA 5KOXA 1PSQA 4ZBAA 1QFNA 1F37A 4ML1A 3D6IA 1VRSD 2MBTA 2MMNA 5ECSA 3TJJA 1M9BA 4J56E 1J9BA 1ERTA 5ECKB 2A2RA 2DJ1A 17GSA 4KE3A 3FEUA 1O8WA 2K8VA 3JCML 1DE1A 1GRXA 2XC2A 4POBA 1KBNA 4MK3A 2GLRA 3HHVA 3WD6A 1XWAA 1EZKA 2TRCP 1UN2A 1M3JA 4KH7A 5DJLA 4AJ7A 3GHAA 1ZYNA 5G1KA 2REMA 4K8MA 1O73A 2C0FA 2HRKA 2P5RA 1DE2A 4TR1A 4MZWA 1AQWA 16GSA 1TRWA 4FYCA 3IHGA 3MYDA 1OC9A 1CQGA 1SJ6A 4V2LA 3D0ZA 3WT2A 2XHFA 2LNTA 2UZ8A 5A5KA 2IPAA 3EMPA 3EVIA 1TK0B 4K0GA 3LORA 3Q74A 2EIRA 3A2VA 2CX4A 3IXRA 2HSYA 5FWGA 1JZOA 1K0OA 2D2ZA 2H6ZA 2HRFA 3GTUA 2GQMA 5D8IA 1EEMA 2V41A 3HA9A 18GSA 4POKA 4HDEA 3F4SA 4ML6A 3GRXA 4G9HA 1PKWA 2DKHA 2OKAA 4OFMA 4WR5A 3KIJA 3M0FA 1PN9A 3F63A 2E0QA 4JR6A 2KP1A 2F9SA 4N0ZA 1Q4JA 3D4TA 4WKWA 4G0IA 1YJ6A 1SKRB 3IC4A 4TOPA 5G5EA 1W89A 2NBSA 2C0EA 4HUAA 1PRXA 5FHIA 1W4VA 1EEJA 3IRAA 1K3LA 4Z2UA 3HVNA 4NPBA 3PPUA 2IMKA 3GL3A 3MNGA 2GSRA 2M80A 4IP6A 3C7MA 3LYKA 2RUFA 1N8JA 1EWXA 4XHMA 1EV4A 3QFAC 3TDGA 2PBJA 4Q5QA 5KN3A 5CYYA 1PQNA 2QC7A 4MMMA 4MF6A 2GVPA 13GSA 2P0GA 4F0CA 2LS5A 1T4ZA 5J9BA 4K2DA 4E8EA 3TKSE 1IYIA 1OC3A 1SYXA 3KJYA 2LEGA 3GNJA 3CRUA 5FT3A 5F07A 4NXIA 4MDCA 1TJDA 2N5FA 8GSSA 3A3TA 2CAQA 4CDOA 2R2JA 2WDUA 1Z7PA 4BL7B 3FKFA 2AHEA 3APQA 1B9XC 3HJOA 3GN3A 4YQVA 2AB6A 3LJRA 3KM6A 3H4KA 3U6VA 2GT6A 1ERWA 3N9JA 4O5UA 3P2AA 1OC8A 3UOMA 2BMXA 9GSSA 5IO2A 3DVXA 4BVXA 2H74A 2PGTA 3EWLA 4I6XA 2FWHA 4IGJA 6GSYA 1R7HA 1A2LA 2DMLA 3ZTLA 2IMDA 1S3RA 4GQCA 2LRCA 1GSFA 3CBUA 3W8SA 5HR3A 1JHBA 4I8BA 4WBJA 2FWFA 1SJIA 5IPHA 1ZMAA 4FYBA 5CRWA 1XOAA 4EIQA 1K0DA 1GTAA 5F05A 4BVYB 2FY6A 1GWCA 1H4OA 2WCIA 5IIZA 3IPZA 4TRXA 1Q98A 1VF4A 2V1MA 2VO4A
chains in the Genus database with same CATH topology
1X5EA 5ELAA 1XBSA 3IAS2 1WP0A 4CY8A 2H75A 2DIZA 4TXOA 3FZ4A 4Q5NA 3E0UA 3CTGA 2XBIA 3HZ4A 4DVCA 1JLVA 4ZL9A 2YNXA 1WOUA 1GNWA 2ON7A 3QAGA 2I9HA 3R3EA 4YAVA 1K3OA 4BWSA 3F6DA 2QKEA 2LV3A 5IM9A 3LXZA 4LMWA 3CSHA 1V9WA 3F4RA 3GL5A 1M9AA 5L71A 3ZIJA 1XWBA 4NWYA 5DAKA 2VD1A 4WF4A 2VCWA 2VL2C 4ZB9A 4EL1A 1RQMA 2I1UA 4IHUA 3ZZXA 5C04A 2I4AA 4OO5A 1F9MA 1EV9A 1GUMA 3QR6A 2E2MA 1XW6A 1SJZA 2KLXA 4I5QA 1EGOA 2YJ7A 3L9VA 1YEPA 4MH3A 3TB2A 2F8AA 1SL1B 5AGYA 1A0RP 1F3AA 4I2UA 1M2AA 3LSZA 4YQMA 3IDVA 3KMOA 2VM2A 1KEBA 1LU4A 5ECNB 2DLXA 4TXVA 1O81A 2J9HA 2M72A 1ERVA 2ES7A 2VLTA 4IP1A 3TKSA 3C8EA 3ME7A 2CZ3A 2GSQA 2HZEA 3O6TA 3MSZA 4N0VA 1RK4A 2F3MA 3NZNA 2DJKA 3A5WA 5IQYA 5J4UA 1TXXA 3VPQA 1O8XA 2R4VA 3RBTA 3FRCA 3IOSA 1TRVA 3GYKA 3HVXA 4J2FA 3F9UA 3RHBA 4KDYA 2DKIA 3CTFA 4N10A 4TW5A 2TIRA 2YZUA 2ZNMA 4LA1A 5CRHA 2IMEA 2LNSA 2NDOA 5DCHA 1MD4A 2GSSA 3EU4A 4ZXGA 1YDKA 4X43A 2HXKA 3QAVA 1SENA 3IE3A 2VL2A 1E6BA 2VLUA 4PQIA 3GX8A 1MDIA 2RM5A 3LEFA 2VL3A 3M1GA 4J57E 5D9TA 5ABRA 1B4PA 2VIMA 2IN3A 1K0NA 3RAZA 3VK9A 1U87A 3C71A 6GSVA 5J3RA 1CQHA 2IFQA 2CV4A 2CA8A 3O76A 1TK5B 1U6TA 1SKSB 1FB6A 1BYEA 4K1FA 1S3DA 2A2PA 2H8LA 4L0UA 3BCIA 4XS4A 4D73B 4MPFA 2L57A 5IMCA 5DVBA 4IKHA 3TKQA 4HEA2 3FYGA 3GV1A 1XWCA 3HJMA 4L0WA 1AQXA 2HT9A 2XPEA 4MPGA 1HNCA 4FYUA 5G1LA 1G6YA 2ALBA 2O87A 2MMZA 3ZIVA 2I81A 2JU5A 2ON5A 3L9UA 5CP1A 3DKSA 1QUWA 1ZGNA 3L9SA 1MDKA 1O6JA 5LCZA 4WXTA 2R0PA 5EY6A 3UJ1A 3Q6OA 2IJYA 4JEDA 3ZL5A 3KEBA 5GAND 1RW1A 3IK9A 1V98A 3QMXA 4NMUA 2JSZA 5JWOB 1B9YC 1ZL9A 1S3CA 1X9WB 2FGXA 3UL3A 4MNNA 6GSSA 2DJJA 4AGSA 2N5BA 2C4JA 3MAKA 3US3A 4RI6A 1WJKA 2NPBA 1OE8A 1YEXA 3KGKA 4XIHA 3ERGA 1GULA 3KP9A 2R37A 3DRNA 4TR1B 2R0CA 1TK8B 4HOJA 2FWEA 4AJ6A 1T4YA 2YN1A 1OC9B 2B1LA 4MJCA 1DUGA 1WRYA 4IW9A 1NM3A 4CHSA 4LLRA 5COHA 2OE0A 5A4VA 2RIIA 1K3YA 4GXZA 3FHKA 2ZCTA 4NV2A 1VF1A 3H1NA 3GTUB 1Z3EA 2LQOA 3DD3A 3GKKA 1SK0A 4K7IA 5IMZA 3DYRA 3FR6A 1A2JA 4LMVA 4GRFA 2R6KA 4DSSA 2AUVA 19GSA 1NHOA 1X9MB 2YV9A 2VOCA 1ERUA 1AXDA 1EOGA 1HYUA 3RHCA 4IBPA 2PUKC 1A8YA 2C1YA 1EP8A 4MJEA 3VURA 5KOWA 5HFGA 1TTZA 1ML6A 6GSWA 1ZYEA 3AY8A 1ILOA 2QA1A 3IBHA 3LFLA 4GLTA 3GUSA 2C3QA 2QSIA 3TCOA 1GL8A 2GTUA 4HJ2A 2AAWA 4V1Ag 5IMDA 3GSSA 5C00A 2VCTA 5G30A 1PGTA 3I43A 1Z6MA 2B5EA 1ON4A 4TR4A 3IAM2 2DJ3A 4KUNA 4YQUA 1URMA 4ECBA 2CAIA 4DEJA 4EDYA 5GSSA 2H0IA 1KTEA 5D93A 1PL1A 4K5SA 4RQRA 4JE1A 1BJXA 3IR4A 2B1KA 2L4QA 2LUSA 1B48A 5CO3A 3WYWA 1XVQA 1WIKA 1XOBA 2B6MA 1GSDA 4EXJA 2LKUA 3BJ5A 4ZBBA 3DMLA 3WGXA 2KUCA 4G19A 3UMAA 5H5SA 3G7JA 4MF7A 2F51A 2WS2A 2V32A 1F2EA 2C0DA 11GSA 3KP8A 4K5RA 2H6YA 2WB9A 2HNLA 3GH6A 5DALA 4ZIJA 1UC7A 3QDNA 1EGRA 3FZ5A 4I2TA 5IOXA 2OADA 2OBKA 3TKRA 3TRPA 2V6KA 4H86A 2K6VA 5ECPB 1PX6A 3EPTA 3ZFLA 3FW2A 5E59A 3ZRDA 4BVXB 3BCKA 2KOKA 3HXSA 4X1UA 5IO0A 1TOFA 3TJFA 2YP6A 2V2GA 4KX4A 3ZMKA 3TJGA 4KDUA 5F06A 5ECOB 4IS0A 2C8UA 1TRUA 3CRTA 3M9KA 1ST9A 2QGVA 4HZ4A 4AJ8A 2K18A 1DSBA 2YCDA 3WT1A 2LJRA 2LSTA 1GSEA 1MEKA 5J5NA 4NHWA 1XPVA 2GZZA 2FUG2 1TDIA 1FG4A 1OVNA 3D21A 2VUPA 4O32A 3HCZA 2H30A 3ZVJD 4YH2A 1SU9A 4TXOB 5IOWA 2H70A 4O5QA 4G2EA 2CX3A 3J7Yk 3SWLA 2GZYA 3EURA 2H6XA 2VCVA 1V58A 3UEMA 2B7KA 1TKDB 1V40A 2N5AA 4HJMA 4JR4A 2B7JA 5IMAA 1EOHA 4L5OA 3TKSC 5JCGA 4ZL8A 3J7Yb 2DBCA 1FAAA 4JZQA 2FLSA 1AAZA 3F3QA 1U3AA 1USBA 5DAKB 5F0GA 2I3YA 1A23A 3CSIA 3DXBA 4QQ7A 3DIEA 5D96A 2JSYA 2H66A 1B8XA 1J0FA 3ZLPA 4KDXA 4YKGA 1XWKA 2FCHA 3QAWA 4AF2A 1T00A 3APSA 3KH9A 5EL8A 5G5FA 4XTSA 5CAXA 4GWRA 4IJ3A 3W6GA 3BD2A 5KEJA 1TP9A 1R5PA 1QXHA 4ZB8A 1UVZA 5GSTA 5BRTA 3G7IA 5D9WA 3K8NA 2HE3A 4ISDA 5HFKA 2PVOC 3ZYWA 4GTUA 1T3BA 2A4VA 3ZITA 5IMFA 1AQVA 2KHPA 4XS6A 3DGQA 1M0UA 4KNDA 3FR3A 1NW2A 1QK8A 3WGDA 4TN8A 2EIOA 3QPMA 3UVHA 5JWQB 2HZEB 4BWQA 2G0FA 10GSA 1S3AA 1A8LA 3ISOA 4K0NA 4NAXA 4QL7A 5G31A 1DBYA 3IV4A 3H8QA 3C73A 2A2SA 3KD0A 4PQHA 1PN0A 4EKZA 2YWNA 4KB3A 4KAEA 5DBQA 3M3MA 1SD8A 2O8VB 1KNGA 1OKTA 1HD2A 3E3EA 5J9CA 1GTUA 1V57A 4KCEA 1X9SB 4POLA 5ENUA 5G2ZA 1TI3A 2YJHA 3LG6A 5LD0A 4E8HA 4PNFA 2H71A 3FY7A 3VWWA 3GX0A 1JZRA 4XRAA 4PURA 1FHEA 3ZVJA 2PMTA 4MABA 2C80A 4ZL7A 3PR8A 2MZCA 4OO4A 2H0HA 5B8BA 2AJQB 5LNKe 2IFQB 1FB0A 1AC1A 4EE0A 1GSUA 2NVLA 3L4NA 4BA7A 4CY6A 4KF9A 3GKXA 1T8EB 2GQLA 1K0AA 5DJMA 4IELA 3P90A 4FH8A 2LJAA 4XS4B 2HLSA 2CVDA 5ECLB 4X4JA 4ECCA 5HR0A 2H76A 1ZCPA 4O5RA 4G10A 4ZB6A 3E9JB 2YOIA 1OYJA 3EINA 4EVMA 4IN0A 5A4WA 5H5QA 5CRGA 7GSSA 1NSWA 2PERA 1GH2A 4ACSA 2X4AA 3DWVA 2FA4A 2YV7A 3FR9A 3HVVA 5B6NA 2FNOA 3I6AA 3VPTA 2E2GA 3F6FA 3UBKA 3TJKA 2XBQA 4F9ZA 1WPIA 3TRXA 4ICYA 1FOVA 2VD0A 1LBKA 4K7OA 4MF5A 4HZ2A 2C3TA 4EDZA 3HY2A 1T1VA 3EYTA 4PX1A 1Z7RA 2X8CA 1YF0A 1GNEA 1YZXA 3HZ8A 3KZQA 2IL3A 2CVKA 2HRAA 2L6DA 2IMIA 1AUCA 4HQZA 2GS3A 2CVBA 3BBYA 3EMXA 3LYPA 3TKPA 2YWMA 2JACA 2LRNA 1XIYA 2IMFA 1TU8A 4GCIA 4HQSA 1GLPA 1BG5A 5IPGA 1O85A 1G7EA 2TRXA 3F4TA 4EO3A 3D5JA 3GA4A 4DSQA 3A2WA 1M99A 4K9ZA 2FWGA 3Q19A 1G6WA 1ABAA 1SK1A 1JZDA 1PL2A 3FZ9A 1BAYA 5ID2A 2RLIA 4D73A 4EIPA 2LJKA 1MDJA 1A2MA 1ZZYA 4ULXA 4EC0A 2FA8A 4PGTA 3LWAA 1WMJA 1A24A 3IA1A 2JADA 3KTLA 2G2QA 2L5OA 2DJ2A 4IQAA 4EUYA 2DIYA 1GSSA 5DQYA 5HR1A 5B8AA 2JZTA 1ZYQB 4ILFA 2BTOT 2WRTA 1WE0A 4OWYA 2L4CA 1XW5A 1E2YA 3GFKA 1MD3A 3CXGA 1A0FA 5KN0A 1TW9A 1YF1A 2L5LA 1UA5A 2OBIA 3IK7A 3IHQA 3SBCA 4TR0A 4MCUA 3H79A 4WF5A 2VLVA 4V1Ap 2CZ2A 3RDWA 3G7YA 3QCPA 2HSMA 4KGIA 5KN1A 1U3IA 3KMNA 3M9JA 4RI7A 2WFCA 2WGRA 2LTKA 2R5GA 1PMTA 5F8BA 3GKNA 3PH9A 3GMFA 4V2MA 1BX9A 3N5OA 3IC8A 4JRRA 2L6CA 3APOA 1Z5YE 2WZ9A 3C1SA 2PWJA 6GSUA 3H93A 3LQ7A 1MTCA 3HKRA 3O3TA 4O7HA 22GSA 5IMVA 4MJAA 1GTBA 1Y6EA 4IQ1A 1M2DA 3KCMA 3MWHA 1WWJA 1QQ2A 5DALB 2VAFA 2FD3A 3GIXA 4GSNA 4OFNA 4CW9A 3KTBA 4TVEA 4OD7A 4OCFA 5JWRB 4P3YB 2MMOA 4TKYA 1R26A 4USSA 3V1WA 1PD21 4F03A 1SKWB 4RUVA 4QL9A 2YZHA 1R5AA 2K8SA 4POMA 1B4QA 5D9XA 3HD5A 1F6MC 4OFTA 2X99A 2DJ0A 2R0GA 2H1AA 4WBRD 1PA3A 1O7UA 5GAPD 1THXA 1XFLA 5ECMB 2OE1A 1JZWA 1PKZA 1VGLA 4PTSA 2HRNA 3QOUA 5B7CA 1QGVA 2VCZA 1NHYA 1TRSA 4PQ1A 4GSSA 2HZFA 3CYNA 3ME8A 3CMIA 3P8WA 5A4UA 1YKCA 1K0BA 4XRDA 4LL1B 2OACA 5H5RA 3HYPA 2WJUA 4ECIA 1JFUA 4LL4B 4DSRA 1VF3A 5DCGA 3GKMA 1XXUA 1SYRA 3PGTA 3ZMLA 1YQ1A 1I9DA 2M46A 3EU3A 3TOUA 4PUAA 2HSHA 4TR3A 5BMUA 1GSQA 1R4WA 5AN1A 5INYA 3HDCA 2XPDA 2O7KA 3DVWA 1IYHA 4K2XA 3G9BA 1SL0B 4IVFA 1Y25A 2A4HA 2YWIA 4KSMA 2Z9SA 3VWVA 2GQKA 3W8JA 3NIVA 4F82A 4HU7A 1SK2A 4YKFA 2RM6A 4ZILA 3KH7A 3P7XA 2CQ9A 1QMVA 3ERFA 1FOHA 3RPPA 2X49A 2VCXA 4JBBA 6GSTA 5ECRB 3HJPA 1HNBA 1YY7A 2P31A 5KN2A 2OJLA 1FVKA 3QD9A 2JZSA 2H73A 2L59A 1X5CA 3NOFA 1M7TA 1K0CA 3PINA 2VL9A 1THOA 4GQFA 5DQSA 4BL7A 3VWXA 3VFIA 3EE2A 3C1RA 4PXOA 1XW9A 3WGEA 2BJXA 3I9V2 2EC4A 1AW9A 1H75A 3TGZA 5D9VA 2HYXA 4OCEA 5J41A 1PX7A 1J08A 1GLQA 4F0BA 5ECHB 2LRTA 1OAZA 2GGTA 4XCSA 4KW6A 2GT5A 1U88A 5HQPA 1SD9A 4JU5A 5HR2A 1LJRA 3L0HA 3U5RE 1FO5A 5E4WA 5CRDA 2DSAA 2MBSA 4PUFC 3VI7A 3UVTA 4MZBA 2AV4A 2V6OA 4N30A 4L8EA 1I5GA 4WEYA 4BVYA 1HNAA 1N2AA 4V2NA 2X8GA 2VM1A 4OMVA 3OR5A 3GSTA 1OE7A 5EPFA 2NTOA 2GZPA 5GZZB 5DDLA 2JZRA 4ZBDA 4GF0A 3UARA 4Z2RA 4MJBA 1JLWA 4NHZA 1XCCA 5D73A 2YANA 2HI7A 4WETA 3FZAA 3GH9A 1Z9HA 2R3XA 4MLYA 4MA9A 4I97A 2PN8A 1VF2A 2PVQA 3CSJA 2MYGA 1AIUA 3RPNA 2B3SA 5CREA 2B5XA 4ECJA 2C3NA 4XS1A 2CT6A 3GURA 2PU9C 3QFBC 1TI1A 2F8FA 4O92A 2IIYA 2H1GA 3I69A 1GP1A 3LXTA 4YAPA 1BEDA 4Z7XA 4X0XA 5ELGA 2H19A 5EVOA 4FQUA 3VI5A 4FO5A 3M8NA 4N11A 2DMMA 3A2XA 2K9FA 1OKDA 4Q5RA 3FK8A 2EIQA 1XZOA 2QA2A 2MMAA 4ID0A 4L5LA 3EC3A 1V2AA 4K6XA 3TRQA 4EF0A 4Z2TA 2H0GA 2JL4A 2H72A 1HQOA 20GSA 4RQXA 4G0KA 1Z6NA 1ACVA 2WULA 2GDRA 2O85A 1EP7A 5AISA 1XVWA 1GSYA 1ZOFA 4A5PA 3VWUA 4G0LA 1ZYPA 1YKAA 1FW1A 2OE3A 2PPTA 2FHEA 1C72A 3S9FA 2LQQA 3UBLA 1GTIA 3UAPA 4KCAA 2O89A 5ECIB 1G0TA 1SL2B 5ECQB 5CNWA 3TUEA 2H01A 5JCUA 2DC5A 1BQ7A 2X8HA 3F0IA 3F3RA 2VCQA 5HFIA 4WR4A 14GSA 3MDKA 4IJIA 2YPMA 3ED3A 3A5IA 4F2IA 2OA7A 2KP2A 3F8UA 2YWOA 3TJBA 2H1BA 4MZCA 4PNGA 3KXOA 2X64A 1GUKA 4GSTA 5ID2B 2IWTA 3ERWA 1M2BA 3ZFBA 4KA0A 2AYTA 1F3BA 3LW9A 4K7NA 4FIWA 4HS1A 2P5QA 3BOAA 2E7PA 3FMWA 1GUHA 1X0RA 1TU7A 5B6MA 1FVJA 1G7OA 3Q18A 3D22A 3ZREA 2GSTA 1K0MA 3L78A 2C0GA 2B5YA 4KSOA 4Q5FA 12GSA 3UIWA 4BPYA 1XWGA 6GSXA 2ZUPA 4DSSB 4HI7A 3TOTA 2HFDA 3R2QA 5AIVA 1T7PB 3LGCA 4MH2A 4NV5A 5JCWA 2J23A 5AIXA 2RUEA 4MP4A 2H1DA 3D4MA 4HU9A 1X5DA 3DEXA 3MIXA 3VLNA 3HVSA 5KOXA 1PSQA 4ZBAA 1QFNA 1F37A 4ML1A 3D6IA 1VRSD 2MBTA 2MMNA 5ECSA 3TJJA 1M9BA 4J56E 1J9BA 1ERTA 5ECKB 2A2RA 2DJ1A 17GSA 4KE3A 3FEUA 1O8WA 2K8VA 3JCML 1DE1A 1GRXA 2XC2A 4POBA 1KBNA 4MK3A 2GLRA 3HHVA 3WD6A 1XWAA 1EZKA 2TRCP 1UN2A 4KH7A 5DJLA 4AJ7A 3GHAA 1ZYNA 5G1KA 2REMA 4K8MA 1O73A 2C0FA 2HRKA 2P5RA 1DE2A 4TR1A 4MZWA 1AQWA 16GSA 1TRWA 4FYCA 3IHGA 3MYDA 1OC9A 1CQGA 1SJ6A 4V2LA 3D0ZA 3WT2A 2XHFA 2LNTA 2UZ8A 5A5KA 2IPAA 3EMPA 3EVIA 1TK0B 4K0GA 3LORA 3Q74A 2EIRA 3A2VA 2CX4A 3IXRA 2HSYA 5FWGA 1JZOA 1K0OA 2D2ZA 2H6ZA 2HRFA 3GTUA 2GQMA 5D8IA 1EEMA 2V41A 3HA9A 18GSA 4POKA 4HDEA 3F4SA 4ML6A 3GRXA 4G9HA 1PKWA 2DKHA 2OKAA 4OFMA 4WR5A 3KIJA 3M0FA 1PN9A 3F63A 2E0QA 4JR6A 2KP1A 2F9SA 4N0ZA 1Q4JA 3D4TA 4WKWA 4G0IA 1YJ6A 1SKRB 3IC4A 4TOPA 5G5EA 1W89A 2NBSA 2C0EA 4HUAA 1PRXA 5FHIA 1W4VA 1EEJA 3IRAA 1K3LA 4Z2UA 4NPBA 3PPUA 2IMKA 3GL3A 3MNGA 2GSRA 2M80A 4IP6A 3C7MA 3LYKA 2RUFA 1N8JA 1EWXA 4XHMA 1EV4A 3QFAC 3TDGA 2PBJA 4Q5QA 5KN3A 5CYYA 1PQNA 2QC7A 4MMMA 4MF6A 2GVPA 13GSA 2P0GA 4F0CA 2LS5A 1T4ZA 5J9BA 4K2DA 4E8EA 3TKSE 1IYIA 1OC3A 1SYXA 3KJYA 2LEGA 3GNJA 3CRUA 5FT3A 5F07A 4NXIA 4MDCA 1TJDA 2N5FA 8GSSA 3A3TA 2CAQA 4CDOA 2R2JA 2WDUA 1Z7PA 4BL7B 3FKFA 2AHEA 3APQA 1B9XC 3HJOA 3GN3A 4YQVA 2AB6A 3LJRA 3KM6A 3H4KA 3U6VA 2GT6A 1ERWA 3N9JA 4O5UA 3P2AA 1OC8A 3UOMA 2BMXA 9GSSA 5IO2A 3DVXA 4BVXA 2H74A 2PGTA 3EWLA 4I6XA 2FWHA 4IGJA 6GSYA 1R7HA 1A2LA 2DMLA 3ZTLA 2IMDA 4GQCA 2LRCA 1GSFA 3CBUA 3W8SA 5HR3A 1JHBA 4I8BA 4WBJA 2FWFA 1SJIA 5IPHA 1ZMAA 4FYBA 5CRWA 1XOAA 4EIQA 1K0DA 1GTAA 5F05A 4BVYB 2FY6A 1GWCA 1H4OA 2WCIA 5IIZA 3IPZA 4TRXA 1Q98A 1VF4A 2V1MA 2VO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5E A;  5ELA A;  1XBS A;  3IAS 2;  1WP0 A;  2H75 A;  2DIZ A;  4TXO A;  3FZ4 A;  4Q5N A;  3E0U A;  3CTG A;  2XBI A;  3HZ4 A;  4DVC A;  1JLV A;  4ZL9 A;  2YNX A;  1WOU A;  1GNW A;  2ON7 A;  3QAG A;  2I9H A;  4YAV A;  1K3O A;  4BWS A;  3F6D A;  2QKE A;  2LV3 A;  5IM9 A;  3LXZ A;  4LMW A;  3CSH A;  1V9W A;  3F4R A;  3GL5 A;  1M9A A;  5L71 A;  3ZIJ A;  1XWB A;  4NWY A;  5DAK A;  2VD1 A;  4WF4 A;  2VCW A;  2VL2 C;  4ZB9 A;  4EL1 A;  1RQM A;  2I1U A;  4IHU A;  3ZZX A;  5C04 A;  2I4A A;  4OO5 A;  1F9M A;  1EV9 A;  1GUM A;  3QR6 A;  2E2M A;  1XW6 A;  1SJZ A;  2KLX A;  4I5Q A;  1EGO A;  2YJ7 A;  3L9V A;  1YEP A;  4MH3 A;  3TB2 A;  2F8A A;  1SL1 B;  5AGY A;  1A0R P;  1F3A A;  4I2U A;  1M2A A;  3LSZ A;  4YQM A;  3IDV A;  3KMO A;  2VM2 A;  1KEB A;  1LU4 A;  5ECN B;  2DLX A;  4TXV A;  1O81 A;  2J9H A;  2M72 A;  1ERV A;  2ES7 A;  2VLT A;  4IP1 A;  3TKS A;  3C8E A;  3ME7 A;  2CZ3 A;  2GSQ A;  2HZE A;  3O6T A;  3MSZ A;  4N0V A;  1RK4 A;  2F3M A;  3NZN A;  2DJK A;  3A5W A;  5IQY A;  5J4U A;  1TXX A;  3VPQ A;  1O8X A;  2R4V A;  3RBT A;  3FRC A;  3IOS A;  1TRV A;  3GYK A;  3HVX A;  4J2F A;  3F9U A;  3RHB A;  4KDY A;  3CTF A;  4N10 A;  4TW5 A;  2TIR A;  2YZU A;  2ZNM A;  4LA1 A;  5CRH A;  2IME A;  2LNS A;  2NDO A;  5DCH A;  1MD4 A;  2GSS A;  3EU4 A;  4ZXG A;  1YDK A;  4X43 A;  2HXK A;  3QAV A;  1SEN A;  3IE3 A;  2VL2 A;  1E6B A;  2VLU A;  4PQI A;  3GX8 A;  1MDI A;  2RM5 A;  3LEF A;  2VL3 A;  3M1G A;  4J57 E;  5D9T A;  5ABR A;  1B4P A;  2VIM A;  2IN3 A;  1K0N A;  3RAZ A;  3VK9 A;  1U87 A;  3C71 A;  6GSV A;  5J3R A;  1CQH A;  2IFQ A;  2CV4 A;  2CA8 A;  3O76 A;  1TK5 B;  1U6T A;  1SKS B;  1FB6 A;  1BYE A;  4K1F A;  1S3D A;  2H8L A;  4L0U A;  3BCI A;  4XS4 A;  4D73 B;  4MPF A;  2L57 A;  5IMC A;  5DVB A;  4IKH A;  3TKQ A;  4HEA 2;  3FYG A;  3GV1 A;  1XWC A;  3HJM A;  4L0W A;  1AQX A;  2HT9 A;  2XPE A;  4MPG A;  1HNC A;  4FYU A;  5G1L A;  1G6Y A;  2ALB A;  2O87 A;  2MMZ A;  3ZIV A;  2I81 A;  2JU5 A;  2ON5 A;  3L9U A;  5CP1 A;  3DKS A;  1QUW A;  1ZGN A;  3L9S A;  1MDK A;  1O6J A;  5LCZ A;  4WXT A;  5EY6 A;  3UJ1 A;  3Q6O A;  2IJY A;  4JED A;  3ZL5 A;  3KEB A;  5GAN D;  1RW1 A;  3IK9 A;  1V98 A;  3QMX A;  4NMU A;  2JSZ A;  5JWO B;  1B9Y C;  1ZL9 A;  1S3C A;  1X9W B;  2FGX A;  3UL3 A;  6GSS A;  2DJJ A;  4AGS A;  2N5B A;  2C4J A;  3MAK A;  3US3 A;  4RI6 A;  1WJK A;  2NPB A;  1OE8 A;  1YEX A;  3KGK A;  4XIH A;  3ERG A;  1GUL A;  3KP9 A;  2R37 A;  3DRN A;  4TR1 B;  1TK8 B;  4HOJ A;  2FWE A;  4AJ6 A;  1T4Y A;  2YN1 A;  1OC9 B;  2B1L A;  4MJC A;  1DUG A;  1WRY A;  4IW9 A;  1NM3 A;  4CHS A;  4LLR A;  5COH A;  2OE0 A;  5A4V A;  2RII A;  1K3Y A;  4GXZ A;  3FHK A;  2ZCT A;  4NV2 A;  1VF1 A;  3H1N A;  3GTU B;  1Z3E A;  2LQO A;  3DD3 A;  3GKK A;  1SK0 A;  4K7I A;  5IMZ A;  3DYR A;  3FR6 A;  1A2J A;  4LMV A;  4GRF A;  2R6K A;  4DSS A;  2AUV A;  19GS A;  1NHO A;  1X9M B;  2YV9 A;  2VOC A;  1ERU A;  1AXD A;  1EOG A;  1HYU A;  3RHC A;  4IBP A;  2PUK C;  1A8Y A;  2C1Y A;  1EP8 A;  4MJE A;  3VUR A;  5HFG A;  1TTZ A;  1ML6 A;  6GSW A;  1ZYE A;  3AY8 A;  1ILO A;  3IBH A;  3LFL A;  4GLT A;  3GUS A;  2C3Q A;  2QSI A;  3TCO A;  1GL8 A;  2GTU A;  4HJ2 A;  2AAW A;  4V1A g;  5IMD A;  3GSS A;  5C00 A;  2VCT A;  5G30 A;  1PGT A;  3I43 A;  1Z6M A;  2B5E A;  1ON4 A;  4TR4 A;  3IAM 2;  2DJ3 A;  4KUN A;  4YQU A;  1URM A;  4ECB A;  2CAI A;  4DEJ A;  4EDY A;  5GSS A;  2H0I A;  1KTE A;  5D93 A;  1PL1 A;  4RQR A;  4JE1 A;  1BJX A;  3IR4 A;  2B1K A;  2L4Q A;  2LUS A;  1B48 A;  5CO3 A;  3WYW A;  1XVQ A;  1WIK A;  1XOB A;  2B6M A;  1GSD A;  4EXJ A;  2LKU A;  3BJ5 A;  4ZBB A;  3DML A;  3WGX A;  2KUC A;  4G19 A;  3UMA A;  5H5S A;  3G7J A;  4MF7 A;  2F51 A;  2WS2 A;  2V32 A;  1F2E A;  2C0D A;  11GS A;  3KP8 A;  2H6Y A;  2WB9 A;  2HNL A;  3GH6 A;  5DAL A;  4ZIJ A;  1UC7 A;  3QDN A;  1EGR A;  3FZ5 A;  4I2T A;  5IOX A;  2OAD A;  2OBK A;  3TKR A;  3TRP A;  2V6K A;  4H86 A;  2K6V A;  5ECP B;  1PX6 A;  3ZFL A;  3FW2 A;  5E59 A;  3ZRD A;  3BCK A;  2KOK A;  3HXS A;  4X1U A;  5IO0 A;  1TOF A;  3TJF A;  2YP6 A;  2V2G A;  4KX4 A;  3ZMK A;  3TJG A;  4KDU A;  5F06 A;  5ECO B;  4IS0 A;  2C8U A;  1TRU A;  3CRT A;  3M9K A;  1ST9 A;  2QGV A;  4HZ4 A;  4AJ8 A;  2K18 A;  1DSB A;  2YCD A;  3WT1 A;  2LJR A;  2LST A;  1GSE A;  1MEK A;  5J5N A;  4NHW A;  1XPV A;  2GZZ A;  2FUG 2;  1TDI A;  1FG4 A;  1OVN A;  3D21 A;  2VUP A;  4O32 A;  3HCZ A;  2H30 A;  3ZVJ D;  4YH2 A;  1SU9 A;  4TXO B;  5IOW A;  2H70 A;  4G2E A;  2CX3 A;  3J7Y k;  3SWL A;  2GZY A;  3EUR A;  2H6X A;  2VCV A;  1V58 A;  3UEM A;  2B7K A;  1TKD B;  1V40 A;  2N5A A;  4HJM A;  4JR4 A;  2B7J A;  5IMA A;  1EOH A;  4L5O A;  3TKS C;  5JCG A;  4ZL8 A;  3J7Y b;  2DBC A;  1FAA A;  4JZQ A;  2FLS A;  1AAZ A;  3F3Q A;  1U3A A;  1USB A;  5DAK B;  5F0G A;  2I3Y A;  1A23 A;  3CSI A;  3DXB A;  4QQ7 A;  3DIE A;  5D96 A;  2JSY A;  2H66 A;  1B8X A;  1J0F A;  3ZLP A;  4KDX A;  1XWK A;  2FCH A;  3QAW A;  4AF2 A;  1T00 A;  3APS A;  3KH9 A;  5EL8 A;  5G5F A;  4XTS A;  5CAX A;  4GWR A;  4IJ3 A;  3W6G A;  3BD2 A;  5KEJ A;  1TP9 A;  1R5P A;  1QXH A;  4ZB8 A;  1UVZ A;  5GST A;  3G7I A;  5D9W A;  3K8N A;  2HE3 A;  4ISD A;  5HFK A;  2PVO C;  3ZYW A;  4GTU A;  1T3B A;  2A4V A;  3ZIT A;  5IMF A;  1AQV A;  2KHP A;  4XS6 A;  3DGQ A;  1M0U A;  4KND A;  3FR3 A;  1NW2 A;  1QK8 A;  3WGD A;  4TN8 A;  2EIO A;  3QPM A;  3UVH A;  5JWQ B;  2HZE B;  4BWQ A;  2G0F A;  10GS A;  1S3A A;  1A8L A;  3ISO A;  4K0N A;  4NAX A;  4QL7 A;  5G31 A;  1DBY A;  3IV4 A;  3H8Q A;  3C73 A;  2A2S A;  3KD0 A;  4PQH A;  4EKZ A;  2YWN A;  4KB3 A;  4KAE A;  5DBQ A;  3M3M A;  1SD8 A;  2O8V B;  1KNG A;  1OKT A;  1HD2 A;  3E3E A;  5J9C A;  1GTU A;  1V57 A;  4KCE A;  1X9S B;  4POL A;  5ENU A;  5G2Z A;  1TI3 A;  2YJH A;  3LG6 A;  5LD0 A;  4E8H A;  4PNF A;  2H71 A;  3FY7 A;  3VWW A;  3GX0 A;  1JZR A;  4XRA A;  4PUR A;  1FHE A;  3ZVJ A;  2PMT A;  4MAB A;  2C80 A;  4ZL7 A;  3PR8 A;  2MZC A;  4OO4 A;  2H0H A;  5B8B A;  2AJQ B;  5LNK e;  2IFQ B;  1FB0 A;  1AC1 A;  4EE0 A;  1GSU A;  2NVL A;  3L4N A;  4BA7 A;  3GKX A;  1T8E B;  2GQL A;  1K0A A;  5DJM A;  4IEL A;  3P90 A;  4FH8 A;  2LJA A;  4XS4 B;  2HLS A;  2CVD A;  5ECL B;  4ECC A;  5HR0 A;  2H76 A;  1ZCP A;  4O5R A;  4G10 A;  4ZB6 A;  3E9J B;  2YOI A;  1OYJ A;  3EIN A;  4EVM A;  4IN0 A;  5A4W A;  5H5Q A;  5CRG A;  7GSS A;  1NSW A;  2PER A;  1GH2 A;  4ACS A;  3DWV A;  2FA4 A;  2YV7 A;  3FR9 A;  3HVV A;  5B6N A;  2FNO A;  3I6A A;  3VPT A;  2E2G A;  3F6F A;  3UBK A;  3TJK A;  2XBQ A;  4F9Z A;  1WPI A;  3TRX A;  1FOV A;  2VD0 A;  1LBK A;  4K7O A;  4MF5 A;  4HZ2 A;  2C3T A;  4EDZ A;  3HY2 A;  1T1V A;  3EYT A;  4PX1 A;  1Z7R A;  2X8C A;  1YF0 A;  1GNE A;  1YZX A;  3HZ8 A;  3KZQ A;  2IL3 A;  2CVK A;  2L6D A;  2IMI A;  1AUC A;  4HQZ A;  2GS3 A;  2CVB A;  3BBY A;  3EMX A;  3LYP A;  3TKP A;  2YWM A;  2JAC A;  2LRN A;  1XIY A;  2IMF A;  1TU8 A;  4GCI A;  4HQS A;  1GLP A;  1BG5 A;  5IPG A;  1O85 A;  1G7E A;  2TRX A;  3F4T A;  4EO3 A;  3D5J A;  3GA4 A;  4DSQ A;  3A2W A;  1M99 A;  4K9Z A;  2FWG A;  3Q19 A;  1G6W A;  1ABA A;  1SK1 A;  1JZD A;  1PL2 A;  3FZ9 A;  1BAY A;  5ID2 A;  2RLI A;  4D73 A;  2LJK A;  1MDJ A;  1A2M A;  1ZZY A;  4ULX A;  4EC0 A;  2FA8 A;  4PGT A;  3LWA A;  1WMJ A;  1A24 A;  3IA1 A;  2JAD A;  3KTL A;  2G2Q A;  2L5O A;  2DJ2 A;  4IQA A;  4EUY A;  2DIY A;  1GSS A;  5DQY A;  5HR1 A;  5B8A A;  2JZT A;  1ZYQ B;  4ILF A;  2BTO T;  2WRT A;  1WE0 A;  4OWY A;  2L4C A;  1XW5 A;  1E2Y A;  3GFK A;  1MD3 A;  3CXG A;  1A0F A;  5KN0 A;  1TW9 A;  1YF1 A;  2L5L A;  1UA5 A;  2OBI A;  3IK7 A;  3IHQ A;  3SBC A;  4TR0 A;  4MCU A;  3H79 A;  4WF5 A;  2VLV A;  4V1A p;  2CZ2 A;  3RDW A;  3G7Y A;  3QCP A;  4KGI A;  5KN1 A;  1U3I A;  3KMN A;  3M9J A;  4RI7 A;  2WFC A;  2WGR A;  2LTK A;  2R5G A;  1PMT A;  5F8B A;  3GKN A;  3PH9 A;  3GMF A;  4V2M A;  1BX9 A;  3N5O A;  4JRR A;  2L6C A;  3APO A;  1Z5Y E;  2WZ9 A;  3C1S A;  2PWJ A;  6GSU A;  3H93 A;  3LQ7 A;  1MTC A;  3HKR A;  3O3T A;  4O7H A;  22GS A;  5IMV A;  4MJA A;  1GTB A;  1Y6E A;  4IQ1 A;  1M2D A;  3KCM A;  3MWH A;  1WWJ A;  1QQ2 A;  5DAL B;  2VAF A;  2FD3 A;  3GIX A;  4GSN A;  4OFN A;  4CW9 A;  3KTB A;  4TVE A;  4OD7 A;  4OCF A;  5JWR B;  4P3Y B;  2MMO A;  4TKY A;  1R26 A;  3V1W A;  1PD2 1;  4F03 A;  1SKW B;  4RUV A;  4QL9 A;  2YZH A;  1R5A A;  2K8S A;  4POM A;  1B4Q A;  5D9X A;  3HD5 A;  1F6M C;  4OFT A;  2X99 A;  2DJ0 A;  2H1A A;  4WBR D;  1PA3 A;  1O7U A;  5GAP D;  1THX A;  1XFL A;  5ECM B;  2OE1 A;  1JZW A;  1PKZ A;  1VGL A;  2HRN A;  3QOU A;  5B7C A;  1QGV A;  2VCZ A;  1NHY A;  1TRS A;  4PQ1 A;  4GSS A;  2HZF A;  3CYN A;  3ME8 A;  3CMI A;  3P8W A;  5A4U A;  1YKC A;  1K0B A;  4XRD A;  4LL1 B;  2OAC A;  5H5R A;  3HYP A;  2WJU A;  4ECI A;  1JFU A;  4LL4 B;  4DSR A;  1VF3 A;  5DCG A;  3GKM A;  1XXU A;  1SYR A;  3PGT A;  3ZML A;  1YQ1 A;  1I9D A;  2M46 A;  3EU3 A;  3TOU A;  4PUA A;  2HSH A;  4TR3 A;  1GSQ A;  1R4W A;  5AN1 A;  5INY A;  3HDC A;  2XPD A;  2O7K A;  3DVW A;  1IYH A;  3G9B A;  1SL0 B;  4IVF A;  1Y25 A;  2YWI A;  4KSM A;  2Z9S A;  3VWV A;  2GQK A;  3W8J A;  3NIV A;  4F82 A;  4HU7 A;  1SK2 A;  2RM6 A;  4ZIL A;  3KH7 A;  3P7X A;  2CQ9 A;  1QMV A;  3ERF A;  3RPP A;  4JBB A;  2VCX A;  6GST A;  5ECR B;  3HJP A;  1HNB A;  1YY7 A;  2P31 A;  5KN2 A;  2OJL A;  1FVK A;  3QD9 A;  2JZS A;  2H73 A;  2L59 A;  1X5C A;  3NOF A;  1M7T A;  1K0C A;  3PIN A;  2VL9 A;  1THO A;  4GQF A;  5DQS A;  4BL7 A;  3VWX A;  3VFI A;  3EE2 A;  3C1R A;  4PXO A;  1XW9 A;  3WGE A;  2BJX A;  3I9V 2;  2EC4 A;  1AW9 A;  1H75 A;  3TGZ A;  5D9V A;  2HYX A;  4OCE A;  5J41 A;  1PX7 A;  1J08 A;  1GLQ A;  4F0B A;  5ECH B;  2LRT A;  1OAZ A;  2GGT A;  4XCS A;  4KW6 A;  2GT5 A;  1U88 A;  5HQP A;  1SD9 A;  4JU5 A;  5HR2 A;  1LJR A;  3L0H A;  3U5R E;  1FO5 A;  5E4W A;  5CRD A;  2DSA A;  2MBS A;  4PUF C;  3VI7 A;  3UVT A;  4MZB A;  2AV4 A;  2V6O A;  4N30 A;  4L8E A;  1I5G A;  4WEY A;  4BVY A;  1HNA A;  1N2A A;  4V2N A;  2X8G A;  2VM1 A;  4OMV A;  3OR5 A;  3GST A;  1OE7 A;  5EPF A;  2NTO A;  2GZP A;  5GZZ B;  5DDL A;  2JZR A;  4ZBD A;  4GF0 A;  3UAR A;  4MJB A;  1JLW A;  4NHZ A;  1XCC A;  5D73 A;  2YAN A;  2HI7 A;  4WET A;  3FZA A;  3GH9 A;  1Z9H A;  2R3X A;  4MLY A;  4MA9 A;  4I97 A;  2PN8 A;  1VF2 A;  2PVQ A;  3CSJ A;  2MYG A;  1AIU A;  3RPN A;  2B3S A;  5CRE A;  2B5X A;  4ECJ A;  2C3N A;  4XS1 A;  2CT6 A;  3GUR A;  2PU9 C;  3QFB C;  1TI1 A;  2F8F A;  4O92 A;  2IIY A;  2H1G A;  3I69 A;  1GP1 A;  3LXT A;  4YAP A;  1BED A;  4Z7X A;  4X0X A;  5ELG A;  2H19 A;  5EVO A;  3VI5 A;  4FO5 A;  3M8N A;  4N11 A;  2DMM A;  3A2X A;  2K9F A;  1OKD A;  4Q5R A;  3FK8 A;  2EIQ A;  1XZO A;  2MMA A;  4ID0 A;  4L5L A;  3EC3 A;  1V2A A;  4K6X A;  3TRQ A;  4EF0 A;  2H0G A;  2JL4 A;  2H72 A;  1HQO A;  20GS A;  4RQX A;  1Z6N A;  1ACV A;  2WUL A;  2GDR A;  2O85 A;  1EP7 A;  5AIS A;  1XVW A;  1GSY A;  1ZOF A;  3VWU A;  1YKA A;  1FW1 A;  2OE3 A;  2PPT A;  2FHE A;  1C72 A;  3S9F A;  2LQQ A;  3UBL A;  1GTI A;  3UAP A;  4KCA A;  2O89 A;  5ECI B;  1G0T A;  1SL2 B;  5ECQ B;  5CNW A;  3TUE A;  2H01 A;  5JCU A;  2DC5 A;  1BQ7 A;  2X8H A;  3F0I A;  3F3R A;  2VCQ A;  5HFI A;  4WR4 A;  14GS A;  3MDK A;  4IJI A;  2YPM A;  3ED3 A;  4F2I A;  2OA7 A;  2KP2 A;  3F8U A;  2YWO A;  3TJB A;  2H1B A;  4MZC A;  4PNG A;  3KXO A;  2X64 A;  1GUK A;  4GST A;  5ID2 B;  2IWT A;  3ERW A;  1M2B A;  3ZFB A;  4KA0 A;  2AYT A;  1F3B A;  4K7N A;  4FIW A;  4HS1 A;  2P5Q A;  3BOA A;  2E7P A;  1GUH A;  1X0R A;  1TU7 A;  5B6M A;  1FVJ A;  1G7O A;  3Q18 A;  3D22 A;  3ZRE A;  2GST A;  1K0M A;  3L78 A;  2C0G A;  2B5Y A;  4KSO A;  4Q5F A;  12GS A;  3UIW A;  4BPY A;  1XWG A;  6GSX A;  2ZUP A;  4DSS B;  4HI7 A;  3TOT A;  2HFD A;  3R2Q A;  5AIV A;  1T7P B;  3LGC A;  4MH2 A;  4NV5 A;  5JCW A;  2J23 A;  5AIX A;  2RUE A;  4MP4 A;  2H1D A;  3D4M A;  4HU9 A;  1X5D A;  3DEX A;  3VLN A;  3HVS A;  1PSQ A;  4ZBA A;  1QFN A;  1F37 A;  4ML1 A;  3D6I A;  1VRS D;  2MBT A;  2MMN A;  5ECS A;  3TJJ A;  1M9B A;  4J56 E;  1J9B A;  1ERT A;  5ECK B;  2A2R A;  2DJ1 A;  17GS A;  4KE3 A;  3FEU A;  1O8W A;  2K8V A;  3JCM L;  1DE1 A;  1GRX A;  2XC2 A;  4POB A;  1KBN A;  4MK3 A;  2GLR A;  3HHV A;  3WD6 A;  1XWA A;  1EZK A;  2TRC P;  1UN2 A;  4KH7 A;  5DJL A;  4AJ7 A;  3GHA A;  5G1K A;  2REM A;  4K8M A;  1O73 A;  2C0F A;  2P5R A;  1DE2 A;  4TR1 A;  4MZW A;  1AQW A;  16GS A;  1TRW A;  4FYC A;  1OC9 A;  1CQG A;  1SJ6 A;  4V2L A;  3D0Z A;  3WT2 A;  2XHF A;  2LNT A;  5A5K A;  2IPA A;  3EMP A;  3EVI A;  1TK0 B;  4K0G A;  3LOR A;  3Q74 A;  2EIR A;  3A2V A;  2CX4 A;  3IXR A;  2HSY A;  5FWG A;  1JZO A;  1K0O A;  2D2Z A;  2H6Z A;  2HRF A;  3GTU A;  2GQM A;  5D8I A;  1EEM A;  2V41 A;  3HA9 A;  18GS A;  4POK A;  4HDE A;  3F4S A;  4ML6 A;  3GRX A;  4G9H A;  1PKW A;  4OFM A;  2OKA A;  4WR5 A;  3KIJ A;  3M0F A;  1PN9 A;  3F63 A;  2E0Q A;  4JR6 A;  2KP1 A;  2F9S A;  4N0Z A;  1Q4J A;  3D4T A;  4WKW A;  1YJ6 A;  1SKR B;  3IC4 A;  4TOP A;  5G5E A;  1W89 A;  2NBS A;  2C0E A;  4HUA A;  1PRX A;  5FHI A;  1W4V A;  1EEJ A;  3IRA A;  1K3L A;  4NPB A;  2IMK A;  3GL3 A;  3MNG A;  2GSR A;  2M80 A;  4IP6 A;  3C7M A;  3LYK A;  2RUF A;  1N8J A;  1EWX A;  4XHM A;  1EV4 A;  3QFA C;  3TDG A;  2PBJ A;  4Q5Q A;  5KN3 A;  5CYY A;  1PQN A;  2QC7 A;  4MMM A;  4MF6 A;  2GVP A;  13GS A;  2P0G A;  4F0C A;  2LS5 A;  1T4Z A;  5J9B A;  4K2D A;  4E8E A;  3TKS E;  1IYI A;  1OC3 A;  1SYX A;  3KJY A;  2LEG A;  3GNJ A;  3CRU A;  5FT3 A;  5F07 A;  4NXI A;  4MDC A;  1TJD A;  2N5F A;  8GSS A;  3A3T A;  2CAQ A;  4CDO A;  2R2J A;  2WDU A;  1Z7P A;  3FKF A;  2AHE A;  3APQ A;  1B9X C;  3HJO A;  3GN3 A;  4YQV A;  2AB6 A;  3LJR A;  3KM6 A;  3H4K A;  3U6V A;  2GT6 A;  1ERW A;  3N9J A;  3P2A A;  1OC8 A;  3UOM A;  2BMX A;  9GSS A;  5IO2 A;  3DVX A;  4BVX A;  2H74 A;  2PGT A;  3EWL A;  4I6X A;  2FWH A;  4IGJ A;  6GSY A;  1R7H A;  1A2L A;  2DML A;  3ZTL A;  2IMD A;  4GQC A;  2LRC A;  1GSF A;  3CBU A;  3W8S A;  5HR3 A;  1JHB A;  4I8B A;  4WBJ A;  2FWF A;  1SJI A;  5IPH A;  1ZMA A;  4FYB A;  5CRW A;  1XOA A;  1K0D A;  1GTA A;  5F05 A;  2FY6 A;  1GWC A;  1H4O A;  2WCI A;  5IIZ A;  3IPZ A;  4TRX A;  1Q98 A;  1VF4 A;  2V1M A;  2VO4 A; 
#chains in the Genus database with same CATH topology
 1X5E A;  5ELA A;  1XBS A;  3IAS 2;  1WP0 A;  4CY8 A;  2H75 A;  2DIZ A;  4TXO A;  3FZ4 A;  4Q5N A;  3E0U A;  3CTG A;  2XBI A;  3HZ4 A;  4DVC A;  1JLV A;  4ZL9 A;  2YNX A;  1WOU A;  1GNW A;  2ON7 A;  3QAG A;  2I9H A;  3R3E A;  4YAV A;  1K3O A;  4BWS A;  3F6D A;  2QKE A;  2LV3 A;  5IM9 A;  3LXZ A;  4LMW A;  3CSH A;  1V9W A;  3F4R A;  3GL5 A;  1M9A A;  5L71 A;  3ZIJ A;  1XWB A;  4NWY A;  5DAK A;  2VD1 A;  4WF4 A;  2VCW A;  2VL2 C;  4ZB9 A;  4EL1 A;  1RQM A;  2I1U A;  4IHU A;  3ZZX A;  5C04 A;  2I4A A;  4OO5 A;  1F9M A;  1EV9 A;  1GUM A;  3QR6 A;  2E2M A;  1XW6 A;  1SJZ A;  2KLX A;  4I5Q A;  1EGO A;  2YJ7 A;  3L9V A;  1YEP A;  4MH3 A;  3TB2 A;  2F8A A;  1SL1 B;  5AGY A;  4BIK A;  1A0R P;  1F3A A;  4I2U A;  1M2A A;  3LSZ A;  4YQM A;  3IDV A;  3KMO A;  2VM2 A;  1KEB A;  1LU4 A;  5ECN B;  2DLX A;  4TXV A;  1O81 A;  2J9H A;  2M72 A;  1ERV A;  2ES7 A;  2VLT A;  4IP1 A;  3TKS A;  3C8E A;  3ME7 A;  2CZ3 A;  2GSQ A;  2HZE A;  3O6T A;  3MSZ A;  4N0V A;  1RK4 A;  2F3M A;  3NZN A;  2DJK A;  3A5W A;  5IQY A;  5J4U A;  1TXX A;  3VPQ A;  1O8X A;  2R4V A;  3RBT A;  3FRC A;  3IOS A;  1TRV A;  3GYK A;  3HVX A;  4J2F A;  3F9U A;  3RHB A;  4KDY A;  2DKI A;  3CTF A;  4N10 A;  4TW5 A;  2TIR A;  2YZU A;  2ZNM A;  4LA1 A;  5CRH A;  2IME A;  2LNS A;  2NDO A;  5DCH A;  1MD4 A;  2GSS A;  3EU4 A;  4ZXG A;  1YDK A;  4X43 A;  2HXK A;  3QAV A;  1SEN A;  3IE3 A;  2VL2 A;  1E6B A;  2VLU A;  4PQI A;  3GX8 A;  1MDI A;  2RM5 A;  3LEF A;  2VL3 A;  3M1G A;  4J57 E;  5D9T A;  5ABR A;  1B4P A;  2VIM A;  2IN3 A;  1K0N A;  3RAZ A;  3VK9 A;  1U87 A;  3C71 A;  6GSV A;  5J3R A;  1CQH A;  2IFQ A;  2CV4 A;  2CA8 A;  3O76 A;  1TK5 B;  1U6T A;  1SKS B;  1FB6 A;  1BYE A;  4K1F A;  1S3D A;  2A2P A;  2H8L A;  4L0U A;  3BCI A;  4XS4 A;  4D73 B;  4MPF A;  2L57 A;  5IMC A;  5DVB A;  4IKH A;  3TKQ A;  4HEA 2;  3FYG A;  3GV1 A;  1XWC A;  3HJM A;  4L0W A;  1AQX A;  2HT9 A;  2XPE A;  4MPG A;  1HNC A;  4FYU A;  5G1L A;  1G6Y A;  2ALB A;  2O87 A;  2MMZ A;  3ZIV A;  2I81 A;  2JU5 A;  2ON5 A;  3L9U A;  5CP1 A;  3DKS A;  1QUW A;  1ZGN A;  3L9S A;  1MDK A;  1O6J A;  5LCZ A;  4WXT A;  2R0P A;  5EY6 A;  3UJ1 A;  3Q6O A;  2IJY A;  4JED A;  3ZL5 A;  3KEB A;  5GAN D;  1RW1 A;  3IK9 A;  1V98 A;  3QMX A;  4NMU A;  2JSZ A;  5JWO B;  1B9Y C;  1ZL9 A;  1S3C A;  1X9W B;  2FGX A;  3UL3 A;  4MNN A;  6GSS A;  2DJJ A;  4AGS A;  2N5B A;  2C4J A;  3MAK A;  3US3 A;  4RI6 A;  1WJK A;  2NPB A;  1OE8 A;  1YEX A;  3KGK A;  4XIH A;  3ERG A;  1GUL A;  3KP9 A;  2R37 A;  3DRN A;  4TR1 B;  2R0C A;  1TK8 B;  4HOJ A;  2FWE A;  4AJ6 A;  1T4Y A;  2YN1 A;  1OC9 B;  2B1L A;  4MJC A;  1DUG A;  1WRY A;  4IW9 A;  1NM3 A;  4CHS A;  4LLR A;  5COH A;  2OE0 A;  5A4V A;  2RII A;  1K3Y A;  4GXZ A;  3FHK A;  2ZCT A;  4NV2 A;  1VF1 A;  3H1N A;  3GTU B;  1Z3E A;  2LQO A;  3DD3 A;  3GKK A;  1SK0 A;  4K7I A;  5IMZ A;  3DYR A;  3FR6 A;  1A2J A;  4LMV A;  4GRF A;  2R6K A;  4DSS A;  2AUV A;  19GS A;  1NHO A;  1X9M B;  2YV9 A;  2VOC A;  1ERU A;  1AXD A;  1EOG A;  1HYU A;  3RHC A;  4IBP A;  2PUK C;  1A8Y A;  2C1Y A;  1EP8 A;  4MJE A;  3VUR A;  5KOW A;  5HFG A;  1TTZ A;  1ML6 A;  6GSW A;  1ZYE A;  3AY8 A;  1ILO A;  2QA1 A;  3IBH A;  3LFL A;  4GLT A;  3GUS A;  2C3Q A;  2QSI A;  3TCO A;  1GL8 A;  2GTU A;  4HJ2 A;  2AAW A;  4V1A g;  5IMD A;  3GSS A;  5C00 A;  2VCT A;  5G30 A;  1PGT A;  3I43 A;  1Z6M A;  2B5E A;  1ON4 A;  4TR4 A;  3IAM 2;  2DJ3 A;  4KUN A;  4YQU A;  1URM A;  4ECB A;  2CAI A;  4DEJ A;  4EDY A;  5GSS A;  2H0I A;  1KTE A;  5D93 A;  1PL1 A;  4K5S A;  4RQR A;  4JE1 A;  1BJX A;  3IR4 A;  2B1K A;  2L4Q A;  2LUS A;  1B48 A;  5CO3 A;  3WYW A;  1XVQ A;  1WIK A;  1XOB A;  2B6M A;  1GSD A;  4EXJ A;  2LKU A;  3BJ5 A;  4ZBB A;  3DML A;  3WGX A;  2KUC A;  4G19 A;  3UMA A;  5H5S A;  3G7J A;  4MF7 A;  2F51 A;  2WS2 A;  2V32 A;  1F2E A;  3CQF A;  2C0D A;  11GS A;  3KP8 A;  4K5R A;  2H6Y A;  2WB9 A;  2HNL A;  3GH6 A;  5DAL A;  4ZIJ A;  1UC7 A;  3QDN A;  1EGR A;  3FZ5 A;  4I2T A;  5IOX A;  2OAD A;  2OBK A;  3TKR A;  3TRP A;  2V6K A;  4H86 A;  2K6V A;  5ECP B;  1PX6 A;  3EPT A;  3ZFL A;  3FW2 A;  5E59 A;  3ZRD A;  4BVX B;  3BCK A;  2KOK A;  3HXS A;  4X1U A;  5IO0 A;  1TOF A;  3TJF A;  2YP6 A;  2V2G A;  4KX4 A;  3ZMK A;  3TJG A;  4KDU A;  5F06 A;  5ECO B;  4IS0 A;  2C8U A;  1TRU A;  3CRT A;  3M9K A;  1ST9 A;  2QGV A;  4HZ4 A;  4AJ8 A;  2K18 A;  1DSB A;  2YCD A;  3WT1 A;  2LJR A;  2LST A;  1GSE A;  1MEK A;  5J5N A;  4NHW A;  1XPV A;  2GZZ A;  2FUG 2;  1TDI A;  1FG4 A;  1OVN A;  3D21 A;  2VUP A;  4O32 A;  3HCZ A;  2H30 A;  3ZVJ D;  4YH2 A;  1SU9 A;  4TXO B;  5IOW A;  2H70 A;  4O5Q A;  4G2E A;  2CX3 A;  3J7Y k;  3SWL A;  2GZY A;  3EUR A;  2H6X A;  2VCV A;  1V58 A;  3UEM A;  2B7K A;  1TKD B;  1V40 A;  2N5A A;  4HJM A;  4JR4 A;  2B7J A;  5IMA A;  1EOH A;  4L5O A;  3TKS C;  5JCG A;  4ZL8 A;  3J7Y b;  2DBC A;  1FAA A;  4JZQ A;  2FLS A;  1AAZ A;  3F3Q A;  1U3A A;  1USB A;  5DAK B;  5F0G A;  2I3Y A;  1A23 A;  3CSI A;  3DXB A;  4QQ7 A;  3DIE A;  5D96 A;  2JSY A;  2H66 A;  1B8X A;  1J0F A;  3ZLP A;  4KDX A;  4YKG A;  1XWK A;  2FCH A;  3QAW A;  4AF2 A;  1T00 A;  3APS A;  3KH9 A;  5EL8 A;  5G5F A;  4XTS A;  5CAX A;  4GWR A;  4IJ3 A;  3W6G A;  3BD2 A;  5KEJ A;  1TP9 A;  1R5P A;  1QXH A;  4ZB8 A;  1UVZ A;  5GST A;  5BRT A;  3G7I A;  5D9W A;  3K8N A;  2HE3 A;  4ISD A;  5HFK A;  2PVO C;  3ZYW A;  4GTU A;  1T3B A;  2A4V A;  3ZIT A;  5IMF A;  1AQV A;  2KHP A;  4XS6 A;  3DGQ A;  1M0U A;  4KND A;  3FR3 A;  1NW2 A;  1QK8 A;  3WGD A;  4TN8 A;  2EIO A;  3QPM A;  3UVH A;  5JWQ B;  2HZE B;  4BWQ A;  2G0F A;  10GS A;  1S3A A;  1A8L A;  3ISO A;  4K0N A;  4NAX A;  4QL7 A;  5G31 A;  1DBY A;  3IV4 A;  3H8Q A;  3C73 A;  2A2S A;  3KD0 A;  4PQH A;  1PN0 A;  4EKZ A;  2YWN A;  4KB3 A;  4KAE A;  5DBQ A;  3M3M A;  1SD8 A;  2O8V B;  1KNG A;  1OKT A;  1HD2 A;  3E3E A;  5J9C A;  1GTU A;  1V57 A;  4KCE A;  1X9S B;  4POL A;  5ENU A;  5G2Z A;  1TI3 A;  2YJH A;  3LG6 A;  5LD0 A;  4E8H A;  4PNF A;  2H71 A;  3FY7 A;  3VWW A;  3GX0 A;  1JZR A;  4XRA A;  4PUR A;  1FHE A;  3ZVJ A;  2PMT A;  4MAB A;  2C80 A;  4ZL7 A;  3PR8 A;  2MZC A;  4OO4 A;  2H0H A;  5B8B A;  1PFO A;  2AJQ B;  5LNK e;  2IFQ B;  1FB0 A;  1AC1 A;  4EE0 A;  1GSU A;  2NVL A;  3L4N A;  4BA7 A;  4CY6 A;  4KF9 A;  3GKX A;  1T8E B;  2GQL A;  1K0A A;  5DJM A;  1M3I A;  4IEL A;  3P90 A;  4FH8 A;  2LJA A;  4XS4 B;  2HLS A;  2CVD A;  5ECL B;  4X4J A;  4ECC A;  5HR0 A;  2H76 A;  1ZCP A;  4O5R A;  4G10 A;  4ZB6 A;  3E9J B;  2YOI A;  1OYJ A;  3EIN A;  4EVM A;  4IN0 A;  5A4W A;  5H5Q A;  5CRG A;  7GSS A;  1NSW A;  2PER A;  1GH2 A;  4ACS A;  2X4A A;  3DWV A;  2FA4 A;  2YV7 A;  3FR9 A;  3HVV A;  5B6N A;  2FNO A;  3I6A A;  3VPT A;  2E2G A;  1XG8 A;  3F6F A;  3UBK A;  3TJK A;  2XBQ A;  4F9Z A;  1WPI A;  3TRX A;  4ICY A;  1FOV A;  2VD0 A;  1LBK A;  4K7O A;  4MF5 A;  4HZ2 A;  2C3T A;  4EDZ A;  3HY2 A;  1T1V A;  3EYT A;  4PX1 A;  1Z7R A;  2X8C A;  1YF0 A;  1GNE A;  1YZX A;  3HZ8 A;  3KZQ A;  2IL3 A;  2CVK A;  2HRA A;  2L6D A;  2IMI A;  1AUC A;  4HQZ A;  2GS3 A;  2CVB A;  3BBY A;  3EMX A;  3LYP A;  4HSC X;  3TKP A;  2YWM A;  2JAC A;  2LRN A;  1XIY A;  2IMF A;  1TU8 A;  4GCI A;  4HQS A;  1GLP A;  1BG5 A;  5IPG A;  1O85 A;  1G7E A;  2TRX A;  3F4T A;  4EO3 A;  3D5J A;  3GA4 A;  4DSQ A;  3A2W A;  1M99 A;  4K9Z A;  2FWG A;  3Q19 A;  1G6W A;  1ABA A;  1SK1 A;  1JZD A;  1PL2 A;  3FZ9 A;  1BAY A;  5ID2 A;  2RLI A;  4D73 A;  4EIP A;  2LJK A;  1MDJ A;  1A2M A;  1ZZY A;  4ULX A;  4EC0 A;  2FA8 A;  4PGT A;  3LWA A;  1WMJ A;  1A24 A;  3IA1 A;  2JAD A;  3KTL A;  2G2Q A;  2L5O A;  2DJ2 A;  4IQA A;  4EUY A;  2DIY A;  1GSS A;  5DQY A;  5HR1 A;  5B8A A;  2JZT A;  1ZYQ B;  4ILF A;  2BTO T;  2WRT A;  1WE0 A;  4OWY A;  2L4C A;  1XW5 A;  1E2Y A;  3GFK A;  1MD3 A;  3CXG A;  1A0F A;  5KN0 A;  1TW9 A;  1YF1 A;  2L5L A;  1UA5 A;  2OBI A;  3IK7 A;  3IHQ A;  3SBC A;  4TR0 A;  4MCU A;  3H79 A;  4WF5 A;  2VLV A;  4V1A p;  2CZ2 A;  3RDW A;  3G7Y A;  3QCP A;  2HSM A;  4KGI A;  5KN1 A;  1U3I A;  3KMN A;  3M9J A;  4RI7 A;  2WFC A;  2WGR A;  2LTK A;  2R5G A;  1PMT A;  5F8B A;  3GKN A;  3PH9 A;  3GMF A;  4V2M A;  1BX9 A;  3N5O A;  3IC8 A;  4JRR A;  2L6C A;  3APO A;  1Z5Y E;  2WZ9 A;  3C1S A;  2PWJ A;  6GSU A;  3H93 A;  3LQ7 A;  1MTC A;  3HKR A;  3O3T A;  4O7H A;  22GS A;  5IMV A;  4MJA A;  1GTB A;  1Y6E A;  4IQ1 A;  1M2D A;  3KCM A;  3MWH A;  1WWJ A;  1QQ2 A;  5DAL B;  2VAF A;  2FD3 A;  3GIX A;  4GSN A;  4OFN A;  4CW9 A;  3KTB A;  4TVE A;  4OD7 A;  4OCF A;  5JWR B;  4P3Y B;  2MMO A;  4TKY A;  1R26 A;  4USS A;  3V1W A;  1PD2 1;  4F03 A;  1SKW B;  4RUV A;  4QL9 A;  2YZH A;  1R5A A;  2K8S A;  4POM A;  1B4Q A;  5D9X A;  3HD5 A;  1F6M C;  4OFT A;  2X99 A;  2DJ0 A;  2R0G A;  2H1A A;  4WBR D;  1PA3 A;  1O7U A;  5GAP D;  1THX A;  1XFL A;  5ECM B;  2OE1 A;  1JZW A;  1PKZ A;  1VGL A;  4PTS A;  2HRN A;  3QOU A;  5B7C A;  1QGV A;  2VCZ A;  1NHY A;  1TRS A;  4PQ1 A;  4GSS A;  2HZF A;  3CYN A;  3ME8 A;  3CMI A;  3P8W A;  5A4U A;  1YKC A;  1K0B A;  4XRD A;  4LL1 B;  2OAC A;  5H5R A;  3HYP A;  2WJU A;  4ECI A;  1JFU A;  4LL4 B;  4DSR A;  1VF3 A;  5DCG A;  3GKM A;  1XXU A;  1SYR A;  3PGT A;  3ZML A;  1YQ1 A;  1I9D A;  2M46 A;  3EU3 A;  3TOU A;  4PUA A;  2HSH A;  4TR3 A;  5BMU A;  1GSQ A;  1R4W A;  5AN1 A;  5INY A;  3HDC A;  2XPD A;  2O7K A;  3DVW A;  1IYH A;  4K2X A;  3G9B A;  1SL0 B;  4IVF A;  1Y25 A;  2A4H A;  2YWI A;  4KSM A;  2Z9S A;  3VWV A;  2GQK A;  3W8J A;  3NIV A;  4F82 A;  4HU7 A;  1SK2 A;  4YKF A;  2RM6 A;  4ZIL A;  3KH7 A;  3P7X A;  2CQ9 A;  1QMV A;  3ERF A;  1FOH A;  3RPP A;  2X49 A;  2VCX A;  4JBB A;  6GST A;  5ECR B;  3HJP A;  1HNB A;  1YY7 A;  2P31 A;  5KN2 A;  2OJL A;  1FVK A;  3QD9 A;  2JZS A;  2H73 A;  2L59 A;  1X5C A;  3NOF A;  1M7T A;  1K0C A;  3PIN A;  2VL9 A;  1THO A;  4GQF A;  5DQS A;  4BL7 A;  3VWX A;  3VFI A;  3EE2 A;  3C1R A;  4PXO A;  1XW9 A;  3WGE A;  2BJX A;  3I9V 2;  2EC4 A;  1AW9 A;  1H75 A;  3TGZ A;  5D9V A;  2HYX A;  4OCE A;  5J41 A;  1PX7 A;  1J08 A;  1GLQ A;  4F0B A;  5ECH B;  2LRT A;  1OAZ A;  2GGT A;  4XCS A;  4KW6 A;  2GT5 A;  1U88 A;  5HQP A;  1SD9 A;  4JU5 A;  5HR2 A;  1LJR A;  3L0H A;  3U5R E;  1FO5 A;  5E4W A;  5CRD A;  2DSA A;  2MBS A;  4PUF C;  3VI7 A;  3UVT A;  4MZB A;  2AV4 A;  2V6O A;  4N30 A;  4L8E A;  1I5G A;  4WEY A;  4BVY A;  1HNA A;  1N2A A;  4V2N A;  2X8G A;  2VM1 A;  4OMV A;  3OR5 A;  3GST A;  1OE7 A;  5EPF A;  2NTO A;  2GZP A;  5GZZ B;  5DDL A;  2JZR A;  4ZBD A;  4GF0 A;  3UAR A;  4Z2R A;  4MJB A;  1JLW A;  4NHZ A;  1XCC A;  5D73 A;  2YAN A;  2HI7 A;  4WET A;  3FZA A;  3GH9 A;  1Z9H A;  2R3X A;  4MLY A;  4MA9 A;  4I97 A;  2PN8 A;  1VF2 A;  2PVQ A;  3CSJ A;  2MYG A;  1AIU A;  3RPN A;  2B3S A;  5CRE A;  2B5X A;  4ECJ A;  2C3N A;  4XS1 A;  2CT6 A;  3GUR A;  2PU9 C;  3QFB C;  1TI1 A;  2F8F A;  4O92 A;  2IIY A;  2H1G A;  3I69 A;  1GP1 A;  3LXT A;  4YAP A;  1BED A;  4Z7X A;  4X0X A;  5ELG A;  2H19 A;  5EVO A;  4FQU A;  3VI5 A;  4FO5 A;  3M8N A;  4N11 A;  2DMM A;  3A2X A;  2K9F A;  1OKD A;  4Q5R A;  3FK8 A;  2EIQ A;  1XZO A;  2QA2 A;  2MMA A;  4ID0 A;  4L5L A;  3EC3 A;  1V2A A;  4K6X A;  3TRQ A;  4EF0 A;  4Z2T A;  2H0G A;  2JL4 A;  2H72 A;  1HQO A;  20GS A;  4RQX A;  4G0K A;  1Z6N A;  1ACV A;  2WUL A;  2GDR A;  2O85 A;  1EP7 A;  5AIS A;  1XVW A;  1GSY A;  1ZOF A;  4A5P A;  3VWU A;  4G0L A;  1ZYP A;  1YKA A;  1FW1 A;  2OE3 A;  2PPT A;  2FHE A;  1C72 A;  3S9F A;  2LQQ A;  3UBL A;  1GTI A;  3UAP A;  4KCA A;  2O89 A;  5ECI B;  1G0T A;  1SL2 B;  5ECQ B;  5CNW A;  3TUE A;  2H01 A;  5JCU A;  2DC5 A;  1BQ7 A;  2X8H A;  3F0I A;  3F3R A;  2VCQ A;  5HFI A;  4WR4 A;  14GS A;  3MDK A;  4IJI A;  2YPM A;  3ED3 A;  3A5I A;  4F2I A;  2OA7 A;  2KP2 A;  3F8U A;  2YWO A;  3TJB A;  2H1B A;  4MZC A;  4PNG A;  3KXO A;  2X64 A;  1GUK A;  4GST A;  5ID2 B;  2IWT A;  3ERW A;  1M2B A;  3ZFB A;  4KA0 A;  2AYT A;  1F3B A;  3LW9 A;  4K7N A;  4FIW A;  4HS1 A;  2P5Q A;  3BOA A;  2E7P A;  3FMW A;  1GUH A;  1X0R A;  1TU7 A;  5B6M A;  1FVJ A;  1G7O A;  3Q18 A;  3D22 A;  3ZRE A;  2GST A;  1K0M A;  3L78 A;  2C0G A;  2B5Y A;  4KSO A;  4Q5F A;  12GS A;  3UIW A;  4BPY A;  1XWG A;  6GSX A;  2ZUP A;  4DSS B;  4HI7 A;  3TOT A;  2HFD A;  3R2Q A;  5AIV A;  1T7P B;  3LGC A;  4MH2 A;  4NV5 A;  5JCW A;  2J23 A;  5AIX A;  2RUE A;  4MP4 A;  2H1D A;  3D4M A;  4HU9 A;  1X5D A;  3DEX A;  3MIX A;  3VLN A;  3HVS A;  5KOX A;  1PSQ A;  4ZBA A;  1QFN A;  1F37 A;  4ML1 A;  3D6I A;  1VRS D;  2MBT A;  2MMN A;  5ECS A;  3TJJ A;  1M9B A;  4J56 E;  1J9B A;  1ERT A;  5ECK B;  2A2R A;  2DJ1 A;  17GS A;  4KE3 A;  3FEU A;  1O8W A;  2K8V A;  3JCM L;  1DE1 A;  1GRX A;  2XC2 A;  4POB A;  1KBN A;  4MK3 A;  2GLR A;  3HHV A;  3WD6 A;  1XWA A;  1EZK A;  2TRC P;  1UN2 A;  1M3J A;  4KH7 A;  5DJL A;  4AJ7 A;  3GHA A;  1ZYN A;  5G1K A;  2REM A;  4K8M A;  1O73 A;  2C0F A;  2HRK A;  2P5R A;  1DE2 A;  4TR1 A;  4MZW A;  1AQW A;  16GS A;  1TRW A;  4FYC A;  3IHG A;  3MYD A;  1OC9 A;  1CQG A;  1SJ6 A;  4V2L A;  3D0Z A;  3WT2 A;  2XHF A;  2LNT A;  2UZ8 A;  5A5K A;  2IPA A;  3EMP A;  3EVI A;  1TK0 B;  4K0G A;  3LOR A;  3Q74 A;  2EIR A;  3A2V A;  2CX4 A;  3IXR A;  2HSY A;  5FWG A;  1JZO A;  1K0O A;  2D2Z A;  2H6Z A;  2HRF A;  3GTU A;  2GQM A;  5D8I A;  1EEM A;  2V41 A;  3HA9 A;  18GS A;  4POK A;  4HDE A;  3F4S A;  4ML6 A;  3GRX A;  4G9H A;  1PKW A;  2DKH A;  2OKA A;  4OFM A;  4WR5 A;  3KIJ A;  3M0F A;  1PN9 A;  3F63 A;  2E0Q A;  4JR6 A;  2KP1 A;  2F9S A;  4N0Z A;  1Q4J A;  3D4T A;  4WKW A;  4G0I A;  1YJ6 A;  1SKR B;  3IC4 A;  4TOP A;  5G5E A;  1W89 A;  2NBS A;  2C0E A;  4HUA A;  1PRX A;  5FHI A;  1W4V A;  1EEJ A;  3IRA A;  1K3L A;  4Z2U A;  3HVN A;  4NPB A;  3PPU A;  2IMK A;  3GL3 A;  3MNG A;  2GSR A;  2M80 A;  4IP6 A;  3C7M A;  3LYK A;  2RUF A;  1N8J A;  1EWX A;  4XHM A;  1EV4 A;  3QFA C;  3TDG A;  2PBJ A;  4Q5Q A;  5KN3 A;  5CYY A;  1PQN A;  2QC7 A;  4MMM A;  4MF6 A;  2GVP A;  13GS A;  2P0G A;  4F0C A;  2LS5 A;  1T4Z A;  5J9B A;  4K2D A;  4E8E A;  3TKS E;  1IYI A;  1OC3 A;  1SYX A;  3KJY A;  2LEG A;  3GNJ A;  3CRU A;  5FT3 A;  5F07 A;  4NXI A;  4MDC A;  1TJD A;  2N5F A;  8GSS A;  3A3T A;  2CAQ A;  4CDO A;  2R2J A;  2WDU A;  1Z7P A;  4BL7 B;  3FKF A;  2AHE A;  3APQ A;  1B9X C;  3HJO A;  3GN3 A;  4YQV A;  2AB6 A;  3LJR A;  3KM6 A;  3H4K A;  3U6V A;  2GT6 A;  1ERW A;  3N9J A;  4O5U A;  3P2A A;  1OC8 A;  3UOM A;  2BMX A;  9GSS A;  5IO2 A;  3DVX A;  4BVX A;  2H74 A;  2PGT A;  3EWL A;  4I6X A;  2FWH A;  4IGJ A;  6GSY A;  1R7H A;  1A2L A;  2DML A;  3ZTL A;  2IMD A;  1S3R A;  4GQC A;  2LRC A;  1GSF A;  3CBU A;  3W8S A;  5HR3 A;  1JHB A;  4I8B A;  4WBJ A;  2FWF A;  1SJI A;  5IPH A;  1ZMA A;  4FYB A;  5CRW A;  1XOA A;  4EIQ A;  1K0D A;  1GTA A;  5F05 A;  4BVY B;  2FY6 A;  1GWC A;  1H4O A;  2WCI A;  5IIZ A;  3IPZ A;  4TRX A;  1Q98 A;  1VF4 A;  2V1M A;  2VO4 A; 
#chains in the Genus database with same CATH homology
 1X5E A;  5ELA A;  1XBS A;  3IAS 2;  1WP0 A;  4CY8 A;  2H75 A;  2DIZ A;  4TXO A;  3FZ4 A;  4Q5N A;  3E0U A;  3CTG A;  2XBI A;  3HZ4 A;  4DVC A;  1JLV A;  4ZL9 A;  2YNX A;  1WOU A;  1GNW A;  2ON7 A;  3QAG A;  2I9H A;  3R3E A;  4YAV A;  1K3O A;  4BWS A;  3F6D A;  2QKE A;  2LV3 A;  5IM9 A;  3LXZ A;  4LMW A;  3CSH A;  1V9W A;  3F4R A;  3GL5 A;  1M9A A;  5L71 A;  3ZIJ A;  1XWB A;  4NWY A;  5DAK A;  2VD1 A;  4WF4 A;  2VCW A;  2VL2 C;  4ZB9 A;  4EL1 A;  1RQM A;  2I1U A;  4IHU A;  3ZZX A;  5C04 A;  2I4A A;  4OO5 A;  1F9M A;  1EV9 A;  1GUM A;  3QR6 A;  2E2M A;  1XW6 A;  1SJZ A;  2KLX A;  4I5Q A;  1EGO A;  2YJ7 A;  3L9V A;  1YEP A;  4MH3 A;  3TB2 A;  2F8A A;  1SL1 B;  5AGY A;  1A0R P;  1F3A A;  4I2U A;  1M2A A;  3LSZ A;  4YQM A;  3IDV A;  3KMO A;  2VM2 A;  1KEB A;  1LU4 A;  5ECN B;  2DLX A;  4TXV A;  1O81 A;  2J9H A;  2M72 A;  1ERV A;  2ES7 A;  2VLT A;  4IP1 A;  3TKS A;  3C8E A;  3ME7 A;  2CZ3 A;  2GSQ A;  2HZE A;  3O6T A;  3MSZ A;  4N0V A;  1RK4 A;  2F3M A;  3NZN A;  2DJK A;  3A5W A;  5IQY A;  5J4U A;  1TXX A;  3VPQ A;  1O8X A;  2R4V A;  3RBT A;  3FRC A;  3IOS A;  1TRV A;  3GYK A;  3HVX A;  4J2F A;  3F9U A;  3RHB A;  4KDY A;  2DKI A;  3CTF A;  4N10 A;  4TW5 A;  2TIR A;  2YZU A;  2ZNM A;  4LA1 A;  5CRH A;  2IME A;  2LNS A;  2NDO A;  5DCH A;  1MD4 A;  2GSS A;  3EU4 A;  4ZXG A;  1YDK A;  4X43 A;  2HXK A;  3QAV A;  1SEN A;  3IE3 A;  2VL2 A;  1E6B A;  2VLU A;  4PQI A;  3GX8 A;  1MDI A;  2RM5 A;  3LEF A;  2VL3 A;  3M1G A;  4J57 E;  5D9T A;  5ABR A;  1B4P A;  2VIM A;  2IN3 A;  1K0N A;  3RAZ A;  3VK9 A;  1U87 A;  3C71 A;  6GSV A;  5J3R A;  1CQH A;  2IFQ A;  2CV4 A;  2CA8 A;  3O76 A;  1TK5 B;  1U6T A;  1SKS B;  1FB6 A;  1BYE A;  4K1F A;  1S3D A;  2A2P A;  2H8L A;  4L0U A;  3BCI A;  4XS4 A;  4D73 B;  4MPF A;  2L57 A;  5IMC A;  5DVB A;  4IKH A;  3TKQ A;  4HEA 2;  3FYG A;  3GV1 A;  1XWC A;  3HJM A;  4L0W A;  1AQX A;  2HT9 A;  2XPE A;  4MPG A;  1HNC A;  4FYU A;  5G1L A;  1G6Y A;  2ALB A;  2O87 A;  2MMZ A;  3ZIV A;  2I81 A;  2JU5 A;  2ON5 A;  3L9U A;  5CP1 A;  3DKS A;  1QUW A;  1ZGN A;  3L9S A;  1MDK A;  1O6J A;  5LCZ A;  4WXT A;  2R0P A;  5EY6 A;  3UJ1 A;  3Q6O A;  2IJY A;  4JED A;  3ZL5 A;  3KEB A;  5GAN D;  1RW1 A;  3IK9 A;  1V98 A;  3QMX A;  4NMU A;  2JSZ A;  5JWO B;  1B9Y C;  1ZL9 A;  1S3C A;  1X9W B;  2FGX A;  3UL3 A;  4MNN A;  6GSS A;  2DJJ A;  4AGS A;  2N5B A;  2C4J A;  3MAK A;  3US3 A;  4RI6 A;  1WJK A;  2NPB A;  1OE8 A;  1YEX A;  3KGK A;  4XIH A;  3ERG A;  1GUL A;  3KP9 A;  2R37 A;  3DRN A;  4TR1 B;  2R0C A;  1TK8 B;  4HOJ A;  2FWE A;  4AJ6 A;  1T4Y A;  2YN1 A;  1OC9 B;  2B1L A;  4MJC A;  1DUG A;  1WRY A;  4IW9 A;  1NM3 A;  4CHS A;  4LLR A;  5COH A;  2OE0 A;  5A4V A;  2RII A;  1K3Y A;  4GXZ A;  3FHK A;  2ZCT A;  4NV2 A;  1VF1 A;  3H1N A;  3GTU B;  1Z3E A;  2LQO A;  3DD3 A;  3GKK A;  1SK0 A;  4K7I A;  5IMZ A;  3DYR A;  3FR6 A;  1A2J A;  4LMV A;  4GRF A;  2R6K A;  4DSS A;  2AUV A;  19GS A;  1NHO A;  1X9M B;  2YV9 A;  2VOC A;  1ERU A;  1AXD A;  1EOG A;  1HYU A;  3RHC A;  4IBP A;  2PUK C;  1A8Y A;  2C1Y A;  1EP8 A;  4MJE A;  3VUR A;  5KOW A;  5HFG A;  1TTZ A;  1ML6 A;  6GSW A;  1ZYE A;  3AY8 A;  1ILO A;  2QA1 A;  3IBH A;  3LFL A;  4GLT A;  3GUS A;  2C3Q A;  2QSI A;  3TCO A;  1GL8 A;  2GTU A;  4HJ2 A;  2AAW A;  4V1A g;  5IMD A;  3GSS A;  5C00 A;  2VCT A;  5G30 A;  1PGT A;  3I43 A;  1Z6M A;  2B5E A;  1ON4 A;  4TR4 A;  3IAM 2;  2DJ3 A;  4KUN A;  4YQU A;  1URM A;  4ECB A;  2CAI A;  4DEJ A;  4EDY A;  5GSS A;  2H0I A;  1KTE A;  5D93 A;  1PL1 A;  4K5S A;  4RQR A;  4JE1 A;  1BJX A;  3IR4 A;  2B1K A;  2L4Q A;  2LUS A;  1B48 A;  5CO3 A;  3WYW A;  1XVQ A;  1WIK A;  1XOB A;  2B6M A;  1GSD A;  4EXJ A;  2LKU A;  3BJ5 A;  4ZBB A;  3DML A;  3WGX A;  2KUC A;  4G19 A;  3UMA A;  5H5S A;  3G7J A;  4MF7 A;  2F51 A;  2WS2 A;  2V32 A;  1F2E A;  2C0D A;  11GS A;  3KP8 A;  4K5R A;  2H6Y A;  2WB9 A;  2HNL A;  3GH6 A;  5DAL A;  4ZIJ A;  1UC7 A;  3QDN A;  1EGR A;  3FZ5 A;  4I2T A;  5IOX A;  2OAD A;  2OBK A;  3TKR A;  3TRP A;  2V6K A;  4H86 A;  2K6V A;  5ECP B;  1PX6 A;  3EPT A;  3ZFL A;  3FW2 A;  5E59 A;  3ZRD A;  4BVX B;  3BCK A;  2KOK A;  3HXS A;  4X1U A;  5IO0 A;  1TOF A;  3TJF A;  2YP6 A;  2V2G A;  4KX4 A;  3ZMK A;  3TJG A;  4KDU A;  5F06 A;  5ECO B;  4IS0 A;  2C8U A;  1TRU A;  3CRT A;  3M9K A;  1ST9 A;  2QGV A;  4HZ4 A;  4AJ8 A;  2K18 A;  1DSB A;  2YCD A;  3WT1 A;  2LJR A;  2LST A;  1GSE A;  1MEK A;  5J5N A;  4NHW A;  1XPV A;  2GZZ A;  2FUG 2;  1TDI A;  1FG4 A;  1OVN A;  3D21 A;  2VUP A;  4O32 A;  3HCZ A;  2H30 A;  3ZVJ D;  4YH2 A;  1SU9 A;  4TXO B;  5IOW A;  2H70 A;  4O5Q A;  4G2E A;  2CX3 A;  3J7Y k;  3SWL A;  2GZY A;  3EUR A;  2H6X A;  2VCV A;  1V58 A;  3UEM A;  2B7K A;  1TKD B;  1V40 A;  2N5A A;  4HJM A;  4JR4 A;  2B7J A;  5IMA A;  1EOH A;  4L5O A;  3TKS C;  5JCG A;  4ZL8 A;  3J7Y b;  2DBC A;  1FAA A;  4JZQ A;  2FLS A;  1AAZ A;  3F3Q A;  1U3A A;  1USB A;  5DAK B;  5F0G A;  2I3Y A;  1A23 A;  3CSI A;  3DXB A;  4QQ7 A;  3DIE A;  5D96 A;  2JSY A;  2H66 A;  1B8X A;  1J0F A;  3ZLP A;  4KDX A;  4YKG A;  1XWK A;  2FCH A;  3QAW A;  4AF2 A;  1T00 A;  3APS A;  3KH9 A;  5EL8 A;  5G5F A;  4XTS A;  5CAX A;  4GWR A;  4IJ3 A;  3W6G A;  3BD2 A;  5KEJ A;  1TP9 A;  1R5P A;  1QXH A;  4ZB8 A;  1UVZ A;  5GST A;  5BRT A;  3G7I A;  5D9W A;  3K8N A;  2HE3 A;  4ISD A;  5HFK A;  2PVO C;  3ZYW A;  4GTU A;  1T3B A;  2A4V A;  3ZIT A;  5IMF A;  1AQV A;  2KHP A;  4XS6 A;  3DGQ A;  1M0U A;  4KND A;  3FR3 A;  1NW2 A;  1QK8 A;  3WGD A;  4TN8 A;  2EIO A;  3QPM A;  3UVH A;  5JWQ B;  2HZE B;  4BWQ A;  2G0F A;  10GS A;  1S3A A;  1A8L A;  3ISO A;  4K0N A;  4NAX A;  4QL7 A;  5G31 A;  1DBY A;  3IV4 A;  3H8Q A;  3C73 A;  2A2S A;  3KD0 A;  4PQH A;  1PN0 A;  4EKZ A;  2YWN A;  4KB3 A;  4KAE A;  5DBQ A;  3M3M A;  1SD8 A;  2O8V B;  1KNG A;  1OKT A;  1HD2 A;  3E3E A;  5J9C A;  1GTU A;  1V57 A;  4KCE A;  1X9S B;  4POL A;  5ENU A;  5G2Z A;  1TI3 A;  2YJH A;  3LG6 A;  5LD0 A;  4E8H A;  4PNF A;  2H71 A;  3FY7 A;  3VWW A;  3GX0 A;  1JZR A;  4XRA A;  4PUR A;  1FHE A;  3ZVJ A;  2PMT A;  4MAB A;  2C80 A;  4ZL7 A;  3PR8 A;  2MZC A;  4OO4 A;  2H0H A;  5B8B A;  2AJQ B;  5LNK e;  2IFQ B;  1FB0 A;  1AC1 A;  4EE0 A;  1GSU A;  2NVL A;  3L4N A;  4BA7 A;  4CY6 A;  4KF9 A;  3GKX A;  1T8E B;  2GQL A;  1K0A A;  5DJM A;  4IEL A;  3P90 A;  4FH8 A;  2LJA A;  4XS4 B;  2HLS A;  2CVD A;  5ECL B;  4X4J A;  4ECC A;  5HR0 A;  2H76 A;  1ZCP A;  4O5R A;  4G10 A;  4ZB6 A;  3E9J B;  2YOI A;  1OYJ A;  3EIN A;  4EVM A;  4IN0 A;  5A4W A;  5H5Q A;  5CRG A;  7GSS A;  1NSW A;  2PER A;  1GH2 A;  4ACS A;  2X4A A;  3DWV A;  2FA4 A;  2YV7 A;  3FR9 A;  3HVV A;  5B6N A;  2FNO A;  3I6A A;  3VPT A;  2E2G A;  3F6F A;  3UBK A;  3TJK A;  2XBQ A;  4F9Z A;  1WPI A;  3TRX A;  4ICY A;  1FOV A;  2VD0 A;  1LBK A;  4K7O A;  4MF5 A;  4HZ2 A;  2C3T A;  4EDZ A;  3HY2 A;  1T1V A;  3EYT A;  4PX1 A;  1Z7R A;  2X8C A;  1YF0 A;  1GNE A;  1YZX A;  3HZ8 A;  3KZQ A;  2IL3 A;  2CVK A;  2HRA A;  2L6D A;  2IMI A;  1AUC A;  4HQZ A;  2GS3 A;  2CVB A;  3BBY A;  3EMX A;  3LYP A;  3TKP A;  2YWM A;  2JAC A;  2LRN A;  1XIY A;  2IMF A;  1TU8 A;  4GCI A;  4HQS A;  1GLP A;  1BG5 A;  5IPG A;  1O85 A;  1G7E A;  2TRX A;  3F4T A;  4EO3 A;  3D5J A;  3GA4 A;  4DSQ A;  3A2W A;  1M99 A;  4K9Z A;  2FWG A;  3Q19 A;  1G6W A;  1ABA A;  1SK1 A;  1JZD A;  1PL2 A;  3FZ9 A;  1BAY A;  5ID2 A;  2RLI A;  4D73 A;  4EIP A;  2LJK A;  1MDJ A;  1A2M A;  1ZZY A;  4ULX A;  4EC0 A;  2FA8 A;  4PGT A;  3LWA A;  1WMJ A;  1A24 A;  3IA1 A;  2JAD A;  3KTL A;  2G2Q A;  2L5O A;  2DJ2 A;  4IQA A;  4EUY A;  2DIY A;  1GSS A;  5DQY A;  5HR1 A;  5B8A A;  2JZT A;  1ZYQ B;  4ILF A;  2BTO T;  2WRT A;  1WE0 A;  4OWY A;  2L4C A;  1XW5 A;  1E2Y A;  3GFK A;  1MD3 A;  3CXG A;  1A0F A;  5KN0 A;  1TW9 A;  1YF1 A;  2L5L A;  1UA5 A;  2OBI A;  3IK7 A;  3IHQ A;  3SBC A;  4TR0 A;  4MCU A;  3H79 A;  4WF5 A;  2VLV A;  4V1A p;  2CZ2 A;  3RDW A;  3G7Y A;  3QCP A;  2HSM A;  4KGI A;  5KN1 A;  1U3I A;  3KMN A;  3M9J A;  4RI7 A;  2WFC A;  2WGR A;  2LTK A;  2R5G A;  1PMT A;  5F8B A;  3GKN A;  3PH9 A;  3GMF A;  4V2M A;  1BX9 A;  3N5O A;  3IC8 A;  4JRR A;  2L6C A;  3APO A;  1Z5Y E;  2WZ9 A;  3C1S A;  2PWJ A;  6GSU A;  3H93 A;  3LQ7 A;  1MTC A;  3HKR A;  3O3T A;  4O7H A;  22GS A;  5IMV A;  4MJA A;  1GTB A;  1Y6E A;  4IQ1 A;  1M2D A;  3KCM A;  3MWH A;  1WWJ A;  1QQ2 A;  5DAL B;  2VAF A;  2FD3 A;  3GIX A;  4GSN A;  4OFN A;  4CW9 A;  3KTB A;  4TVE A;  4OD7 A;  4OCF A;  5JWR B;  4P3Y B;  2MMO A;  4TKY A;  1R26 A;  4USS A;  3V1W A;  1PD2 1;  4F03 A;  1SKW B;  4RUV A;  4QL9 A;  2YZH A;  1R5A A;  2K8S A;  4POM A;  1B4Q A;  5D9X A;  3HD5 A;  1F6M C;  4OFT A;  2X99 A;  2DJ0 A;  2R0G A;  2H1A A;  4WBR D;  1PA3 A;  1O7U A;  5GAP D;  1THX A;  1XFL A;  5ECM B;  2OE1 A;  1JZW A;  1PKZ A;  1VGL A;  4PTS A;  2HRN A;  3QOU A;  5B7C A;  1QGV A;  2VCZ A;  1NHY A;  1TRS A;  4PQ1 A;  4GSS A;  2HZF A;  3CYN A;  3ME8 A;  3CMI A;  3P8W A;  5A4U A;  1YKC A;  1K0B A;  4XRD A;  4LL1 B;  2OAC A;  5H5R A;  3HYP A;  2WJU A;  4ECI A;  1JFU A;  4LL4 B;  4DSR A;  1VF3 A;  5DCG A;  3GKM A;  1XXU A;  1SYR A;  3PGT A;  3ZML A;  1YQ1 A;  1I9D A;  2M46 A;  3EU3 A;  3TOU A;  4PUA A;  2HSH A;  4TR3 A;  5BMU A;  1GSQ A;  1R4W A;  5AN1 A;  5INY A;  3HDC A;  2XPD A;  2O7K A;  3DVW A;  1IYH A;  4K2X A;  3G9B A;  1SL0 B;  4IVF A;  1Y25 A;  2A4H A;  2YWI A;  4KSM A;  2Z9S A;  3VWV A;  2GQK A;  3W8J A;  3NIV A;  4F82 A;  4HU7 A;  1SK2 A;  4YKF A;  2RM6 A;  4ZIL A;  3KH7 A;  3P7X A;  2CQ9 A;  1QMV A;  3ERF A;  1FOH A;  3RPP A;  2X49 A;  2VCX A;  4JBB A;  6GST A;  5ECR B;  3HJP A;  1HNB A;  1YY7 A;  2P31 A;  5KN2 A;  2OJL A;  1FVK A;  3QD9 A;  2JZS A;  2H73 A;  2L59 A;  1X5C A;  3NOF A;  1M7T A;  1K0C A;  3PIN A;  2VL9 A;  1THO A;  4GQF A;  5DQS A;  4BL7 A;  3VWX A;  3VFI A;  3EE2 A;  3C1R A;  4PXO A;  1XW9 A;  3WGE A;  2BJX A;  3I9V 2;  2EC4 A;  1AW9 A;  1H75 A;  3TGZ A;  5D9V A;  2HYX A;  4OCE A;  5J41 A;  1PX7 A;  1J08 A;  1GLQ A;  4F0B A;  5ECH B;  2LRT A;  1OAZ A;  2GGT A;  4XCS A;  4KW6 A;  2GT5 A;  1U88 A;  5HQP A;  1SD9 A;  4JU5 A;  5HR2 A;  1LJR A;  3L0H A;  3U5R E;  1FO5 A;  5E4W A;  5CRD A;  2DSA A;  2MBS A;  4PUF C;  3VI7 A;  3UVT A;  4MZB A;  2AV4 A;  2V6O A;  4N30 A;  4L8E A;  1I5G A;  4WEY A;  4BVY A;  1HNA A;  1N2A A;  4V2N A;  2X8G A;  2VM1 A;  4OMV A;  3OR5 A;  3GST A;  1OE7 A;  5EPF A;  2NTO A;  2GZP A;  5GZZ B;  5DDL A;  2JZR A;  4ZBD A;  4GF0 A;  3UAR A;  4Z2R A;  4MJB A;  1JLW A;  4NHZ A;  1XCC A;  5D73 A;  2YAN A;  2HI7 A;  4WET A;  3FZA A;  3GH9 A;  1Z9H A;  2R3X A;  4MLY A;  4MA9 A;  4I97 A;  2PN8 A;  1VF2 A;  2PVQ A;  3CSJ A;  2MYG A;  1AIU A;  3RPN A;  2B3S A;  5CRE A;  2B5X A;  4ECJ A;  2C3N A;  4XS1 A;  2CT6 A;  3GUR A;  2PU9 C;  3QFB C;  1TI1 A;  2F8F A;  4O92 A;  2IIY A;  2H1G A;  3I69 A;  1GP1 A;  3LXT A;  4YAP A;  1BED A;  4Z7X A;  4X0X A;  5ELG A;  2H19 A;  5EVO A;  4FQU A;  3VI5 A;  4FO5 A;  3M8N A;  4N11 A;  2DMM A;  3A2X A;  2K9F A;  1OKD A;  4Q5R A;  3FK8 A;  2EIQ A;  1XZO A;  2QA2 A;  2MMA A;  4ID0 A;  4L5L A;  3EC3 A;  1V2A A;  4K6X A;  3TRQ A;  4EF0 A;  4Z2T A;  2H0G A;  2JL4 A;  2H72 A;  1HQO A;  20GS A;  4RQX A;  4G0K A;  1Z6N A;  1ACV A;  2WUL A;  2GDR A;  2O85 A;  1EP7 A;  5AIS A;  1XVW A;  1GSY A;  1ZOF A;  4A5P A;  3VWU A;  4G0L A;  1ZYP A;  1YKA A;  1FW1 A;  2OE3 A;  2PPT A;  2FHE A;  1C72 A;  3S9F A;  2LQQ A;  3UBL A;  1GTI A;  3UAP A;  4KCA A;  2O89 A;  5ECI B;  1G0T A;  1SL2 B;  5ECQ B;  5CNW A;  3TUE A;  2H01 A;  5JCU A;  2DC5 A;  1BQ7 A;  2X8H A;  3F0I A;  3F3R A;  2VCQ A;  5HFI A;  4WR4 A;  14GS A;  3MDK A;  4IJI A;  2YPM A;  3ED3 A;  3A5I A;  4F2I A;  2OA7 A;  2KP2 A;  3F8U A;  2YWO A;  3TJB A;  2H1B A;  4MZC A;  4PNG A;  3KXO A;  2X64 A;  1GUK A;  4GST A;  5ID2 B;  2IWT A;  3ERW A;  1M2B A;  3ZFB A;  4KA0 A;  2AYT A;  1F3B A;  3LW9 A;  4K7N A;  4FIW A;  4HS1 A;  2P5Q A;  3BOA A;  2E7P A;  3FMW A;  1GUH A;  1X0R A;  1TU7 A;  5B6M A;  1FVJ A;  1G7O A;  3Q18 A;  3D22 A;  3ZRE A;  2GST A;  1K0M A;  3L78 A;  2C0G A;  2B5Y A;  4KSO A;  4Q5F A;  12GS A;  3UIW A;  4BPY A;  1XWG A;  6GSX A;  2ZUP A;  4DSS B;  4HI7 A;  3TOT A;  2HFD A;  3R2Q A;  5AIV A;  1T7P B;  3LGC A;  4MH2 A;  4NV5 A;  5JCW A;  2J23 A;  5AIX A;  2RUE A;  4MP4 A;  2H1D A;  3D4M A;  4HU9 A;  1X5D A;  3DEX A;  3MIX A;  3VLN A;  3HVS A;  5KOX A;  1PSQ A;  4ZBA A;  1QFN A;  1F37 A;  4ML1 A;  3D6I A;  1VRS D;  2MBT A;  2MMN A;  5ECS A;  3TJJ A;  1M9B A;  4J56 E;  1J9B A;  1ERT A;  5ECK B;  2A2R A;  2DJ1 A;  17GS A;  4KE3 A;  3FEU A;  1O8W A;  2K8V A;  3JCM L;  1DE1 A;  1GRX A;  2XC2 A;  4POB A;  1KBN A;  4MK3 A;  2GLR A;  3HHV A;  3WD6 A;  1XWA A;  1EZK A;  2TRC P;  1UN2 A;  4KH7 A;  5DJL A;  4AJ7 A;  3GHA A;  1ZYN A;  5G1K A;  2REM A;  4K8M A;  1O73 A;  2C0F A;  2HRK A;  2P5R A;  1DE2 A;  4TR1 A;  4MZW A;  1AQW A;  16GS A;  1TRW A;  4FYC A;  3IHG A;  3MYD A;  1OC9 A;  1CQG A;  1SJ6 A;  4V2L A;  3D0Z A;  3WT2 A;  2XHF A;  2LNT A;  2UZ8 A;  5A5K A;  2IPA A;  3EMP A;  3EVI A;  1TK0 B;  4K0G A;  3LOR A;  3Q74 A;  2EIR A;  3A2V A;  2CX4 A;  3IXR A;  2HSY A;  5FWG A;  1JZO A;  1K0O A;  2D2Z A;  2H6Z A;  2HRF A;  3GTU A;  2GQM A;  5D8I A;  1EEM A;  2V41 A;  3HA9 A;  18GS A;  4POK A;  4HDE A;  3F4S A;  4ML6 A;  3GRX A;  4G9H A;  1PKW A;  2DKH A;  2OKA A;  4OFM A;  4WR5 A;  3KIJ A;  3M0F A;  1PN9 A;  3F63 A;  2E0Q A;  4JR6 A;  2KP1 A;  2F9S A;  4N0Z A;  1Q4J A;  3D4T A;  4WKW A;  4G0I A;  1YJ6 A;  1SKR B;  3IC4 A;  4TOP A;  5G5E A;  1W89 A;  2NBS A;  2C0E A;  4HUA A;  1PRX A;  5FHI A;  1W4V A;  1EEJ A;  3IRA A;  1K3L A;  4Z2U A;  4NPB A;  3PPU A;  2IMK A;  3GL3 A;  3MNG A;  2GSR A;  2M80 A;  4IP6 A;  3C7M A;  3LYK A;  2RUF A;  1N8J A;  1EWX A;  4XHM A;  1EV4 A;  3QFA C;  3TDG A;  2PBJ A;  4Q5Q A;  5KN3 A;  5CYY A;  1PQN A;  2QC7 A;  4MMM A;  4MF6 A;  2GVP A;  13GS A;  2P0G A;  4F0C A;  2LS5 A;  1T4Z A;  5J9B A;  4K2D A;  4E8E A;  3TKS E;  1IYI A;  1OC3 A;  1SYX A;  3KJY A;  2LEG A;  3GNJ A;  3CRU A;  5FT3 A;  5F07 A;  4NXI A;  4MDC A;  1TJD A;  2N5F A;  8GSS A;  3A3T A;  2CAQ A;  4CDO A;  2R2J A;  2WDU A;  1Z7P A;  4BL7 B;  3FKF A;  2AHE A;  3APQ A;  1B9X C;  3HJO A;  3GN3 A;  4YQV A;  2AB6 A;  3LJR A;  3KM6 A;  3H4K A;  3U6V A;  2GT6 A;  1ERW A;  3N9J A;  4O5U A;  3P2A A;  1OC8 A;  3UOM A;  2BMX A;  9GSS A;  5IO2 A;  3DVX A;  4BVX A;  2H74 A;  2PGT A;  3EWL A;  4I6X A;  2FWH A;  4IGJ A;  6GSY A;  1R7H A;  1A2L A;  2DML A;  3ZTL A;  2IMD A;  4GQC A;  2LRC A;  1GSF A;  3CBU A;  3W8S A;  5HR3 A;  1JHB A;  4I8B A;  4WBJ A;  2FWF A;  1SJI A;  5IPH A;  1ZMA A;  4FYB A;  5CRW A;  1XOA A;  4EIQ A;  1K0D A;  1GTA A;  5F05 A;  4BVY B;  2FY6 A;  1GWC A;  1H4O A;  2WCI A;  5IIZ A;  3IPZ A;  4TRX A;  1Q98 A;  1VF4 A;  2V1M A;  2VO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...