3L4NA

Crystal structure of yeast monothiol glutaredoxin grx6
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
113
structure length
113
Chain Sequence
b'FNVQKEYSLILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Monothiol glutaredoxin-6
publication title Structural and biochemical characterization of yeast monothiol glutaredoxin Grx6
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 40
structure length 113
sequence length 113
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l4nA00
2C4JA 2IMEA 5IMVA 1Z6NA 2K9FA 2JADA 2VLTA 1PN9A 4MH3A 5G31A 4Q5NA 3KGKA 1PGTA 2KP1A 3KJYA 3GSSA 1V2AA 2GDRA 1GLQA 4YQUA 2HZEB 4MJAA 6GSWA 2HNLA 2GLRA 2IIYA 13GSA 2YP6A 1USBA 2DJ0A 4PQIA 5CAXA 1R4WA 4F82A 5ECPB 2L4CA 3F9UA 1O85A 2XPEA 3TRXA 4Q5QA 5ECKB 3ZIVA 5DQSA 5C00A 3VWVA 3GKXA 3TJBA 4NAXA 2AJQB 3IE3A 1YKAA 4NPBA 2AUVA 4ZXGA 1YZXA 2C0FA 1VF1A 4WEYA 3QAWA 1J9BA 2VOCA 1HNBA 1M2DA 4EE0A 3IC4A 3BBYA 3MNGA 3QOUA 3QR6A 4O32A 5G5EA 4GRFA 2IFQB 1QXHA 2X8CA 4X1UA 4IQ1A 4ACSA 2B7JA 2LJRA 3QD9A 4K7NA 1GP1A 3NIVA 2L5LA 5ABRA 4HJMA 3IAM2 1JZWA 2OE0A 4N10A 3E0UA 1Z6MA 2H1AA 1EV4A 1GNWA 3EU3A 3BCIA 3MSZA 2FUG2 2L4QA 2V6OA 3GH6A 5IO2A 2ES7A 1V98A 1EP8A 1GSEA 2OBIA 3R2QA 3EINA 5D9VA 4I5QA 4IKHA 1MD3A 2I3YA 2I1UA 4E8EA 1GL8A 3APSA 3TJJA 5KN3A 4BA7A 1X9WB 2H01A 4HZ4A 3A5WA 3LXTA 2A4VA 2PMTA 3H79A 4WKWA 4OO5A 1T7PB 4K9ZA 3K8NA 4EUYA 1TI3A 4YQMA 3QAGA 4FO5A 4GWRA 3F4RA 5CRWA 2H75A 5B8BA 5G1LA 3DVXA 2H74A 3HZ4A 2GSQA 3C8EA 1J08A 3HA9A 5DBQA 5ELAA 2CAQA 2R6KA 3TKPA 1U3AA 5H5QA 3RHCA 3MWHA 2VCVA 4I8BA 2KOKA 2HT9A 3F3RA 2L59A 2H0IA 4POLA 2DIYA 1TK5B 3DXBA 5D93A 1PA3A 2CQ9A 2QKEA 1GSYA 1URMA 4BVYA 4ZB9A 5HFKA 3FHKA 1GUKA 2B5XA 3APQA 3UOMA 1AC1A 3TKSC 5GAND 3EURA 4L0UA 2VCWA 5D9XA 4L0WA 2DC5A 4ZB6A 3KTBA 3IOSA 2C3NA 3TOTA 5G30A 1T8EB 3FZAA 5CP1A 2H19A 5DALA 5B6MA 5ID2A 4I97A 2C3QA 3NOFA 1G6WA 3Q6OA 2LSTA 4KSOA 2XBIA 4X0XA 3P7XA 4PNGA 4PNFA 4POBA 4EO3A 3P2AA 3RBTA 2WGRA 1U87A 2B7KA 1PKWA 4MLYA 5IOXA 3J7Yk 1ABAA 3ISOA 2ZCTA 2LRTA 2R3XA 4ML6A 1SU9A 3HJOA 1NHYA 4TR3A 3VURA 2JSZA 4JBBA 2RM6A 1K0BA 4HU9A 4BVXA 2DJ3A 3D4MA 2FLSA 2YPMA 4PQHA 5CO3A 2DIZA 1R5PA 5H5SA 2C0GA 2AB6A 3TKQA 2J9HA 3F8UA 1Q98A 2X64A 3QFBC 4CW9A 1B4PA 4Z7XA 3U6VA 2TRCP 3A2VA 2PN8A 3DMLA 2MMAA 4WF4A 1B8XA 1GSSA 4FYUA 3ZL5A 2HRFA 3TRPA 1V9WA 1N8JA 3CRUA 2VL2C 1YDKA 4V2MA 1SENA 3F4TA 4K7OA 2VCZA 3IRAA 1ZYQB 4NV2A 4DVCA 1O73A 2VIMA 1RQMA 2FCHA 2J23A 5IPGA 4XHMA 3D21A 2VD0A 3RAZA 4QL9A 3ZMLA 1XCCA 3ZYWA 5B7CA 1T1VA 1NM3A 3HCZA 4LL1B 3W6GA 1KNGA 5H5RA 2H70A 2FWEA 3IK9A 1GTAA 3HVSA 2WULA 3FW2A 5ECMB 4HJ2A 4LLRA 2VM1A 5ECQB 1OYJA 3ME8A 1I9DA 3RPPA 2EIOA 2DJ1A 2V6KA 2PU9C 2GTUA 2GVPA 5HR0A 5B6NA 5C04A 1KTEA 4V1Ag 4OMVA 2OBKA 2DJKA 2B5YA 2KP2A 2FGXA 4NV5A 5J4UA 6GSYA 1M7TA 3RDWA 1AUCA 4JZQA 5FHIA 1ML6A 1TU7A 4ILFA 4OWYA 4HOJA 3ZVJD 4AJ7A 2GS3A 4OFTA 3A2XA 2MZCA 1JLVA 3KP8A 3TKRA 4IS0A 1CQHA 4IBPA 3SBCA 1ERUA 2VO4A 20GSA 4GSSA 2CV4A 5ECNB 2YZHA 4PUFC 1F3BA 2MMOA 1SL2B 4IP1A 3UARA 1EEMA 5CYYA 1F3AA 1ZCPA 2WDUA 4TR1A 2GT5A 1WP0A 4MZCA 5EL8A 1MD4A 2IMFA 5GZZB 2O8VB 1DUGA 2V41A 2YJHA 4KNDA 3HY2A 1K3YA 3PH9A 4RQXA 3RHBA 1WPIA 1K0OA 3J7Yb 4MP4A 2IWTA 3D0ZA 4POKA 4YH2A 3GRXA 4IJIA 5J41A 5IMCA 1PL1A 1GNEA 2YN1A 2H0GA 4ZBAA 4TN8A 4MZWA 1WMJA 4ZL8A 3TRQA 1QQ2A 1E6BA 2X8HA 2I9HA 3C73A 5CREA 2QSIA 3L78A 1EWXA 1XWCA 4KDYA 1CQGA 2E0QA 3KTLA 1B9XC 3H1NA 4GSNA 4EXJA 3IHQA 2NBSA 2HLSA 4IVFA 4TR4A 4NWYA 3EWLA 3GURA 1AQXA 1FO5A 1IYHA 3FR9A 3TKSA 2AAWA 4DSSB 2PUKC 1YEPA 3GX0A 1THXA 3N9JA 2PERA 5JCGA 3KD0A 3HZ8A 3US3A 2H8LA 1EV9A 3ZVJA 2P5RA 3VK9A 2LJAA 3VI7A 5ENUA 4O7HA 5IMDA 2M80A 5IQYA 1FHEA 3DIEA 1XWKA 3GKKA 4O5RA 4NXIA 4N11A 1G6YA 4BWQA 4ECCA 3L0HA 1R5AA 2JL4A 1SD9A 2JACA 3GUSA 1EZKA 4LA1A 3QAVA 4FIWA 2GSSA 3ZZXA 2DMMA 3DKSA 1Z5YE 1JHBA 4H86A 1XW6A 2B6MA 2TRXA 3HVVA 3GHAA 2OADA 1ERTA 1O81A 4RUVA 1TRWA 4JRRA 2XC2A 5F0GA 1M99A 3P8WA 1OC9A 2LJKA 5DVBA 4EC0A 3I43A 4ID0A 3ZMKA 5HQPA 1X5DA 4HZ2A 3APOA 4OFMA 2ZNMA 4DEJA 3ERGA 3TJGA 4MABA 1SD8A 4GLTA 1VF2A 2G0FA 1SL0B 1SKWB 2YWNA 1B9YC 3H8QA 2CVKA 2G2QA 2H30A 1Y6EA 2VL9A 2RIIA 1XW5A 3LFLA 4F03A 4V2NA 1Z3EA 5IPHA 4LMVA 4PX1A 3FY7A 2VCQA 1Z7RA 2ON7A 3HJMA 2HZFA 2RUEA 5ELGA 2XHFA 1OC8A 2A2RA 2F9SA 3KCMA 4KSMA 4GCIA 1B4QA 3QPMA 1V40A 1PX7A 4NHZA 4OCEA 2PVQA 1A0RP 5A4VA 5JWQB 1AIUA 3TOUA 2WS2A 3DD3A 1M9AA 1X0RA 4WR5A 2L57A 1XWBA 3FZ5A 4ZBBA 1YJ6A 2H66A 1EOHA 1RW1A 1BYEA 2GQMA 2YWOA 1XW9A 1OKDA 5IM9A 3PINA 3L9VA 4YQVA 2EIQA 2IMDA 1GTBA 1ILOA 2HSHA 1R26A 2PGTA 3FK8A 2CZ3A 2YJ7A 1LBKA 4IP6A 4XS4B 4EVMA 4KE3A 1T4YA 1GWCA 4PURA 3EE2A 2JZRA 3FEUA 4DSRA 2H73A 3U5RE 1ERWA 1XOBA 4D73A 1KEBA 4AJ6A 2Z9SA 4TR1B 3KXOA 2L5OA 3CRTA 2R4VA 4DSQA 1GUMA 1JZOA 5ECSA 9GSSA 2IJYA 2YCDA 1TDIA 2FNOA 5DQYA 3IA1A 2F8AA 4K8MA 3L9SA 1MTCA 4X43A 2ZUPA 1ON4A 3FR6A 1G7OA 4HUAA 5DCHA 1PKZA 4WBJA 4ZB8A 1J0FA 4IW9A 2YZUA 1SJ6A 3GNJA 4MH2A 3GFKA 5LD0A 1K0AA 3IAS2 1EOGA 1YF1A 1X5EA 3D22A 1S3CA 3GSTA 2B5EA 4KW6A 1SKSB 4LL4B 2N5BA 2GT6A 4G10A 3HHVA 1AAZA 2VL3A 19GSA 1SJZA 4IQAA 4XS6A 3KIJA 1X5CA 2JZSA 4N0VA 4HQSA 1GTUA 1UN2A 17GSA 3HXSA 4RI6A 3KH7A 1F37A 3WGEA 1VF4A 1AXDA 4BPYA 4MF5A 2XBQA 2ON5A 3EMPA 4Q5RA 1LU4A 1WJKA 1K0MA 1F6MC 3UBKA 1GULA 2N5AA 2VLVA 6GSTA 1DE2A 2EIRA 1TJDA 1M2BA 3LQ7A 3GTUB 1G0TA 1BJXA 3CYNA 5CRDA 4KB3A 1HD2A 1PX6A 2HXKA 4ZBDA 4ZL7A 4CDOA 2DSAA 2B1LA 2OA7A 1TI1A 1YQ1A 1WE0A 4O92A 5HR1A 1X9SB 1M2AA 2WJUA 3IXRA 4IHUA 2IL3A 1NHOA 3W8SA 2HZEA 3TDGA 4IN0A 1W4VA 3C1RA 4F2IA 1F9MA 4TVEA 4TXOA 4G2EA 3FZ4A 3M9KA 3GX8A 1QUWA 1JLWA 1QGVA 3VWWA 1UVZA 3C1SA 3DWVA 2D2ZA 4I6XA 5JWRB 1WIKA 2LRCA 3UIWA 1R7HA 1MDJA 4J2FA 1H4OA 4MK3A 2R2JA 1OVNA 1UC7A 3BOAA 2VM2A 2VD1A 5KN2A 3ZLPA 3OR5A 2C3TA 1TXXA 2LKUA 1NW2A 3UJ1A 4GF0A 4HI7A 3O6TA 3Q74A 2R37A 5L71A 3BJ5A 1JZRA 1O6JA 2O7KA 3GL3A 5J9BA 2LQOA 4ECIA 3CSJA 4POMA 2KHPA 3VFIA 1XBSA 2YWMA 1ZMAA 5AGYA 3GYKA 2AYTA 2IFQA 3WT1A 1TW9A 5CNWA 5EPFA 1GSQA 4WR4A 3GIXA 3GV1A 5KEJA 2E2MA 2K18A 2H6XA 3F6DA 2H71A 1BAYA 3UBLA 2MMZA 6GSXA 2RUFA 3BCKA 4HQZA 5JWOB 2CAIA 3HVXA 2WRTA 3KMOA 4ZILA 3UAPA 2LV3A 3M8NA 2O87A 5KN0A 5ECLB 5A4UA 1THOA 1PQNA 2LEGA 3KMNA 1A2LA 2IMKA 1O7UA 1N2AA 1K0DA 1XVQA 1JZDA 3VPQA 3TCOA 1FB6A 4IGJA 5J9CA 3HKRA 2OKAA 4TW5A 1XXUA 2JZTA 3F0IA 1LJRA 4HS1A 4EF0A 2AHEA 4K1FA 2YV9A 4PGTA 3KH9A 4KX4A 3A3TA 2GSRA 1OE7A 2FWGA 4JR6A 2C80A 4K6XA 4K0NA 3ED3A 4HU7A 2PBJA 2AV4A 3TJKA 1F2EA 4NMUA 3ERFA 4I2UA 2K8VA 2MBSA 5LNKe 4MA9A 3W8JA 1TU8A 3HD5A 5DAKA 1ZYEA 1ERVA 1GSUA 4ULXA 1U6TA 1BQ7A 2E7PA 1JFUA 2YANA 4RI7A 4D73B 4KA0A 4TR0A 1BX9A 3LWAA 4KDXA 2VUPA 3WD6A 1YEXA 1HQOA 5IOWA 1XPVA 1FAAA 2H1BA 4MJBA 2FHEA 2GZZA 5HFIA 3I9V2 3M1GA 1U3IA 2H1GA 3G7IA 3JCML 1SL1B 1XVWA 3D6IA 1K3LA 3G7YA 2CX3A 1HYUA 3VLNA 1K0NA 2PPTA 3ZFLA 3WGXA 1TOFA 1I5GA 4J57E 3CXGA 3TB2A 5HR2A 5FWGA 1O8WA 1PD21 4L5OA 1A23A 1PSQA 1XWGA 4XIHA 3LG6A 1YKCA 1FOVA 4ISDA 5DALB 1QFNA 3LSZA 5ID2B 4YAVA 2R5GA 2TIRA 2GSTA 3H4KA 1GH2A 1W89A 4HDEA 1XFLA 4KAEA 3MDKA 1WWJA 3UVHA 5EY6A 4XCSA 1B48A 1E2YA 5HFGA 4NHWA 4V2LA 3GA4A 3FZ9A 22GSA 2DJ2A 1SK1A 1V58A 3IPZA 5AN1A 2KLXA 2HYXA 3C71A 4MDCA 2P5QA 5IMFA 1EGRA 2F3MA 2EC4A 3UEMA 4GTUA 3KM6A 3ME7A 1TRUA 3P90A 4TXVA 2DBCA 2F51A 3TUEA 4YAPA 2H6ZA 4TXOB 1AQWA 2OE3A 2FA4A 4ZIJA 4OCFA 1MDIA 5CRGA 1GLPA 1GSDA 3C7MA 4K7IA 3ZTLA 3QFAC 5D73A 1AW9A 2PWJA 2M72A 4GQCA 5F05A 4OFNA 1GTIA 2HI7A 5GAPD 2GQKA 6GSSA 2CA8A 1PL2A 4P3YB 2VL2A 3F63A 3DEXA 1Z9HA 2JSYA 2CVDA 3QMXA 2P31A 5LCZA 2X99A 5J3RA 2I81A 5G5FA 2H72A 1VRSD 3KEBA 1O8XA 1PRXA 2DMLA 5GSTA 5INYA 3LGCA 2HSYA 2FWFA 2YV7A 4QL7A 2NVLA 1TK8B 2YNXA 2E2GA 4KUNA 5DDLA 1WOUA 1C72A 1XWAA 4JU5A 2IN3A 5FT3A 1AQVA 1SKRB 3LYKA 1GRXA 4EL1A 2OACA 1ZZYA 3ZITA 3CTFA 2L6DA 2B3SA 3UMAA 4HEA2 3CSHA 5IIZA 4MJEA 2IMIA 1EEJA 1ACVA 1A2JA 2FWHA 2IPAA 2VCXA 2CT6A 3I6AA 5GSSA 1MDKA 1GSFA 1EP7A 4RQRA 3GH9A 3GKMA 5ECHB 2KUCA 3KP9A 5F07A 1Q4JA 10GSA 1SYRA 2LTKA 1QMVA 4MF6A 1K3OA 1TP9A 1TRSA 4KCEA 2CZ2A 1GUHA 2WZ9A 5HR3A 4IELA 1SK0A 2V2GA 1H75A 3VWUA 1S3AA 3UL3A 1ST9A 2HFDA 3DVWA 3IDVA 3Q19A 3QDNA 4WXTA 6GSVA 2DLXA 1OAZA 3CBUA 5A4WA 3HJPA 2VLUA 3IBHA 1Z7PA 2OJLA 5AISA 5DAKB 5COHA 1SYXA 4BWSA 4N30A 3PGTA 5ECRB 2REMA 4XS1A 2DJJA 3MAKA 4F9ZA 18GSA 3D4TA 5JCWA 2YOIA 3E9JB 3LEFA 1OE8A 3O76A 4ECBA 1SJIA 3NZNA 4EDYA 2OE1A 2XPDA 1VF3A 3TKSE 3GL5A 1OC3A 2FA8A 1S3DA 2H1DA 3V1WA 5F06A 4GQFA 3LXZA 1TK0B 5A5KA 3QCPA 4EDZA 2H76A 3IR4A 4KH7A 2RM5A 1A8YA 3TGZA 4DSSA 4WBRD 3CMIA 3EYTA 5DJMA 3HDCA 4OO4A 3UVTA 2QC7A 1BEDA 3FYGA 1DE1A 3VPTA 4MMMA 2FY6A 5E59A 3GKNA 1ZL9A 1PMTA 3M3MA 12GSA 2HE3A 4GXZA 4LMWA 3KZQA 4I2TA 3VWXA 5B8AA 2YWIA 4K2DA 1DSBA 2K6VA 3Q18A 3HYPA 2I4AA 3GMFA 5F8BA 3L4NA 2BTOT 1FVJA 2M46A 2CX4A 2RLIA 5G2ZA 4XRAA 2N5FA 3EMXA 1HNAA 5G1KA 5DCGA 3G9BA 2O85A 2X8GA 4G19A 2WFCA 1M9BA 2V1MA 5J5NA 3ZFBA 2C1YA 4TOPA 3FRCA 4IJ3A 1A2MA 3S9FA 2FD3A 1OC9B 3G7JA 2C0DA 2MYGA 2NDOA 3A2WA 4N0ZA 3ZREA 3CSIA 4V1Ap 3H93A 3F6FA 5ECIB 3F4SA 5DJLA 1FW1A 3F3QA 1A8LA 5IO0A 4J56E 2VCTA 1VGLA 5D9TA 5EVOA 4G9HA 5D96A 1T3BA 2F8FA 3FKFA 1XIYA 4JE1A 4L8EA 4JR4A 3I69A 2BMXA 16GSA 2GQLA 2LUSA 1YF0A 2NTOA 4AJ8A 1K0CA 3N5OA 4EKZA 2MBTA 2PVOC 2VAFA 3WGDA 2LNTA 4E8HA 8GSSA 4ECJA 4JEDA 4AGSA 3EC3A 1ZGNA 2LS5A 4MZBA 3IV4A 1A24A 1YY7A 5AIVA 4MF7A 4PUAA 4MCUA 4MPFA 4K0GA 3O3TA 2LQQA 2K8SA 2ALBA 2C8UA 4MPGA 1RK4A 5AIXA 3M9JA 1SK2A 3WT2A 4KCAA 1T4ZA 4ML1A 2BJXA 2H6YA 1X9MB 1HNCA 2CVBA 4AF2A 2A2SA 4QQ7A 3ZRDA 4MJCA 4FH8A 3WYWA 4TKYA 4Q5FA 2GGTA 1V57A 4KGIA 4XS4A 3SWLA 5JCUA 1TTZA 1BG5A 1XZOA 1T00A 3BD2A 2H0HA 4XRDA 5ECOB 6GSUA 2NPBA 1FB0A 1NSWA 3EVIA 4FYCA 4BL7A 1MEKA 5D8IA 4KDUA 2O89A 4F0BA 3IK7A 3CTGA 4CHSA 2WB9A 3DYRA 2B1KA 3M0FA 3LJRA 3DGQA 7GSSA 3L9UA 2C0EA 4WF5A 1G7EA 14GSA 2P0GA 1ZOFA 5D9WA 1QK8A 4XTSA 2GZPA 5KN1A 1FG4A 4WETA 1XOAA 3D5JA 2V32A 3PR8A 1TKDB 1Y25A 4PQ1A 3AY8A 1EGOA 1A0FA 2LRNA 1TRVA 4GSTA 1U88A 2GZYA 5E4WA 4TRXA 3TJFA 4PXOA 2L6CA 2MMNA 3FR3A 3LYPA 1FVKA 1KBNA 5IMAA 3GN3A 5CRHA 4F0CA 3ZIJA 2LNSA 2WCIA 3DRNA 11GSA 3LORA 1DBYA 1WRYA 3RPNA 3E3EA 4ZL9A 2JU5A 5IMZA 3ERWA 4L5LA 4OD7A 3GTUA 2HRNA 3EU4A 2QGVA 1OKTA 1M0UA 1UA5A 3VI5A 1IYIA 4FYBA
chains in the Genus database with same CATH superfamily
2C4JA 2IMEA 5IMVA 1Z6NA 2K9FA 2JADA 2VLTA 1PN9A 4MH3A 5G31A 4Q5NA 3KGKA 1PGTA 2KP1A 3KJYA 3GSSA 1V2AA 2GDRA 1GLQA 4YQUA 2HZEB 4MJAA 6GSWA 2HNLA 2GLRA 2IIYA 13GSA 2YP6A 1USBA 3LW9A 1FOHA 2DJ0A 4PQIA 5CAXA 1R4WA 4F82A 5ECPB 2L4CA 3F9UA 1O85A 2XPEA 3TRXA 4Q5QA 5ECKB 3ZIVA 5DQSA 5C00A 3VWVA 3GKXA 3TJBA 4NAXA 2AJQB 3IE3A 1YKAA 4NPBA 2AUVA 4ZXGA 1YZXA 2C0FA 1VF1A 4WEYA 3QAWA 1J9BA 2VOCA 1HNBA 1M2DA 4EE0A 3IC4A 2R0PA 3BBYA 3MNGA 3QOUA 3QR6A 4O32A 5G5EA 4GRFA 2IFQB 1QXHA 2X8CA 4X1UA 4IQ1A 4ACSA 2B7JA 2LJRA 3QD9A 4K7NA 1GP1A 3NIVA 2L5LA 5ABRA 4HJMA 3IAM2 1JZWA 2OE0A 4N10A 3E0UA 1Z6MA 2H1AA 1EV4A 1GNWA 3EU3A 3BCIA 3MSZA 2FUG2 2L4QA 2V6OA 3GH6A 5IO2A 2ES7A 4PTSA 4Z2TA 1V98A 1EP8A 1GSEA 2OBIA 3R2QA 3EINA 5D9VA 4I5QA 4IKHA 1MD3A 2I3YA 2I1UA 4E8EA 1GL8A 3APSA 3TJJA 5KN3A 4BA7A 1X9WB 2H01A 4HZ4A 3A5WA 3LXTA 2A4VA 2PMTA 3H79A 4WKWA 4OO5A 1T7PB 4K9ZA 3K8NA 4EUYA 1TI3A 4YQMA 3QAGA 4FO5A 4GWRA 3F4RA 5CRWA 2H75A 5B8BA 5G1LA 3DVXA 2H74A 3HZ4A 2GSQA 3C8EA 1J08A 3HA9A 5DBQA 5ELAA 2CAQA 2R6KA 3TKPA 1U3AA 5H5QA 3RHCA 3MWHA 2VCVA 4I8BA 2KOKA 2HT9A 3F3RA 2L59A 2H0IA 4POLA 4CY6A 2DIYA 4BL7B 1TK5B 3DXBA 5D93A 1PA3A 2CQ9A 4FQUA 2QKEA 1GSYA 1URMA 4BVYA 4ZB9A 5HFKA 3FHKA 1GUKA 2B5XA 3APQA 3UOMA 1AC1A 3IHGA 3TKSC 5GAND 3EURA 4L0UA 2VCWA 5D9XA 4L0WA 2DC5A 4ZB6A 3KTBA 3IOSA 2C3NA 3TOTA 5G30A 1T8EB 3FZAA 5CP1A 2H19A 5DALA 5B6MA 5ID2A 4I97A 2C3QA 3NOFA 1G6WA 3Q6OA 2LSTA 4KSOA 2XBIA 4X0XA 3P7XA 4PNGA 4PNFA 4POBA 4EO3A 3P2AA 3RBTA 2WGRA 1U87A 2B7KA 1PKWA 4MLYA 5IOXA 3J7Yk 1ABAA 3ISOA 2ZCTA 2LRTA 2R3XA 4ML6A 1SU9A 3HJOA 1NHYA 4TR3A 3VURA 2JSZA 4JBBA 2RM6A 1K0BA 4HU9A 4BVXA 2DJ3A 3D4MA 2FLSA 2YPMA 4PQHA 5CO3A 2DIZA 1R5PA 5H5SA 2C0GA 2AB6A 3TKQA 2J9HA 3F8UA 1Q98A 2X64A 3QFBC 4CW9A 1B4PA 4Z7XA 3U6VA 2TRCP 3A2VA 2PN8A 3DMLA 2MMAA 4WF4A 1B8XA 1GSSA 4FYUA 3ZL5A 2HRFA 3TRPA 1V9WA 1N8JA 3CRUA 2VL2C 1YDKA 4V2MA 1SENA 3F4TA 4K7OA 2VCZA 3IRAA 1ZYQB 4NV2A 4DVCA 1O73A 2VIMA 1RQMA 2FCHA 2J23A 5IPGA 4Z2UA 4K5RA 4XHMA 3D21A 2VD0A 3RAZA 4QL9A 3ZMLA 1XCCA 3ZYWA 5B7CA 1T1VA 1NM3A 3HCZA 4LL1B 3W6GA 1KNGA 5H5RA 2HSMA 2H70A 2FWEA 3IK9A 1GTAA 3HVSA 2WULA 3FW2A 5ECMB 4HJ2A 4LLRA 2VM1A 5ECQB 1OYJA 3ME8A 1I9DA 3RPPA 2EIOA 2DJ1A 2V6KA 2PU9C 4G0IA 2GTUA 2GVPA 5HR0A 5B6NA 5C04A 1KTEA 4V1Ag 4OMVA 2OBKA 2DJKA 2B5YA 2KP2A 2FGXA 4NV5A 5J4UA 6GSYA 1M7TA 3RDWA 1AUCA 1ZYPA 1S3RA 4JZQA 2X4AA 5FHIA 1ML6A 1TU7A 4ILFA 4OWYA 4HOJA 3ZVJD 4AJ7A 2GS3A 4OFTA 3A2XA 2MZCA 1JLVA 3KP8A 3TKRA 4IS0A 1CQHA 4IBPA 3SBCA 1ERUA 2VO4A 20GSA 4GSSA 2CV4A 5ECNB 2YZHA 4PUFC 1F3BA 2A4HA 2MMOA 1SL2B 4IP1A 3UARA 1EEMA 5CYYA 1F3AA 1ZCPA 2WDUA 4TR1A 2GT5A 1WP0A 4MZCA 5EL8A 1MD4A 2IMFA 5GZZB 2O8VB 1DUGA 2V41A 2YJHA 4KNDA 3HY2A 1K3YA 3PH9A 4RQXA 3RHBA 1WPIA 1K0OA 3J7Yb 4MP4A 2IWTA 3D0ZA 4POKA 4YH2A 3GRXA 4IJIA 2QA2A 5J41A 5IMCA 1PL1A 1GNEA 2YN1A 2H0GA 4ZBAA 4TN8A 4MZWA 1WMJA 4ZL8A 3TRQA 4BVYB 1QQ2A 1E6BA 2X8HA 2I9HA 3C73A 5CREA 2QSIA 3L78A 1EWXA 1XWCA 2X49A 4KDYA 1CQGA 2E0QA 3KTLA 1B9XC 3H1NA 4GSNA 4EXJA 3IHQA 2NBSA 2HLSA 4IVFA 4TR4A 4NWYA 3EWLA 3GURA 1AQXA 1FO5A 1IYHA 3FR9A 3TKSA 2AAWA 4DSSB 2PUKC 1YEPA 3GX0A 1THXA 3N9JA 2PERA 5JCGA 3KD0A 3HZ8A 3US3A 2H8LA 1EV9A 3ZVJA 2P5RA 3VK9A 2LJAA 3VI7A 5ENUA 4O7HA 5IMDA 2M80A 5IQYA 1FHEA 3DIEA 1XWKA 3GKKA 4O5RA 4NXIA 4N11A 4HSCX 1G6YA 3CQFA 4BWQA 4ECCA 3L0HA 1R5AA 2JL4A 1SD9A 2JACA 3GUSA 1EZKA 4LA1A 3QAVA 4FIWA 2GSSA 3ZZXA 2DMMA 3DKSA 1Z5YE 1JHBA 4H86A 1XW6A 2B6MA 2TRXA 3HVVA 3GHAA 2OADA 1ERTA 1O81A 1PFOA 4RUVA 1TRWA 4JRRA 2XC2A 5F0GA 1M99A 3P8WA 1OC9A 2LJKA 5DVBA 4EC0A 3I43A 4ID0A 3ZMKA 5HQPA 1X5DA 4HZ2A 3APOA 4OFMA 2ZNMA 4DEJA 3ERGA 3TJGA 4MABA 1SD8A 4GLTA 1VF2A 2G0FA 1SL0B 1SKWB 2YWNA 1B9YC 3H8QA 2CVKA 2G2QA 2H30A 1Y6EA 2VL9A 2RIIA 1XW5A 3LFLA 4F03A 4V2NA 1Z3EA 5IPHA 4LMVA 4PX1A 3FY7A 3MYDA 2VCQA 1Z7RA 2ON7A 3HJMA 2HZFA 2RUEA 5ELGA 2XHFA 1OC8A 2A2RA 2F9SA 3KCMA 4KSMA 4GCIA 1B4QA 3QPMA 1V40A 1PX7A 4NHZA 4OCEA 2PVQA 1A0RP 5A4VA 5JWQB 1AIUA 3TOUA 2WS2A 3DD3A 1M9AA 1X0RA 4WR5A 5BRTA 2L57A 1XWBA 3FZ5A 4ZBBA 1YJ6A 2H66A 1EOHA 1RW1A 1BYEA 2GQMA 2YWOA 1XW9A 1OKDA 5IM9A 4ICYA 3PINA 3L9VA 4YQVA 2EIQA 2IMDA 1GTBA 1ILOA 2HSHA 1R26A 2PGTA 3FK8A 2CZ3A 2YJ7A 1LBKA 4IP6A 4XS4B 4EVMA 4KE3A 1T4YA 1GWCA 4PURA 3EE2A 2JZRA 3FEUA 4DSRA 2H73A 3U5RE 1ERWA 1XOBA 4D73A 1KEBA 4AJ6A 2Z9SA 4TR1B 3KXOA 2L5OA 3CRTA 2R4VA 4DSQA 1GUMA 1JZOA 5ECSA 9GSSA 2IJYA 2YCDA 1TDIA 2FNOA 5DQYA 3IA1A 2F8AA 4K8MA 3L9SA 1MTCA 4X43A 2ZUPA 1ON4A 3FR6A 1G7OA 4HUAA 5DCHA 1PKZA 4WBJA 4ZB8A 1J0FA 4IW9A 2YZUA 1SJ6A 3GNJA 4MH2A 3GFKA 5LD0A 1K0AA 3IAS2 1EOGA 1YF1A 1X5EA 3D22A 1S3CA 3GSTA 2B5EA 4KW6A 1SKSB 4LL4B 2N5BA 2GT6A 4G10A 3HHVA 1AAZA 2VL3A 19GSA 1SJZA 4IQAA 4XS6A 3KIJA 1X5CA 2JZSA 4N0VA 4HQSA 1GTUA 1UN2A 17GSA 3HXSA 4RI6A 4EIPA 3KH7A 1F37A 3WGEA 1VF4A 1AXDA 4BPYA 4MF5A 2XBQA 2ON5A 3EMPA 4Q5RA 1LU4A 1WJKA 1K0MA 1F6MC 3UBKA 1GULA 2N5AA 2VLVA 6GSTA 1DE2A 2EIRA 1TJDA 3LQ7A 1M2BA 3GTUB 1G0TA 1BJXA 3CYNA 5CRDA 4KB3A 1HD2A 1PX6A 2HXKA 4ZBDA 4ZL7A 4CDOA 2DSAA 1M3IA 2B1LA 2OA7A 1TI1A 1YQ1A 1WE0A 4O92A 4K2XA 2DKHA 5HR1A 1X9SB 1M2AA 2WJUA 3IXRA 4IHUA 2IL3A 4O5QA 1NHOA 3W8SA 2HZEA 3TDGA 4IN0A 1W4VA 3C1RA 4F2IA 1F9MA 4TVEA 4TXOA 4G2EA 3FZ4A 3M9KA 3GX8A 1QUWA 1JLWA 4CY8A 1QGVA 3A5IA 3VWWA 1UVZA 3C1SA 3DWVA 2D2ZA 4I6XA 5JWRB 1WIKA 2LRCA 3UIWA 1R7HA 1MDJA 4J2FA 1H4OA 4MK3A 2R2JA 1OVNA 1UC7A 3BOAA 2VM2A 2VD1A 5KN2A 3ZLPA 3OR5A 2C3TA 1TXXA 2LKUA 1NW2A 3UJ1A 4GF0A 4HI7A 3O6TA 3Q74A 2R37A 5L71A 3BJ5A 1JZRA 1O6JA 2O7KA 3GL3A 5J9BA 2LQOA 4ECIA 3CSJA 4POMA 2KHPA 3VFIA 1XBSA 2YWMA 1ZMAA 5AGYA 3GYKA 2AYTA 2IFQA 3WT1A 1TW9A 5CNWA 5EPFA 1GSQA 4WR4A 3GIXA 3GV1A 5KEJA 2E2MA 2K18A 2H6XA 3F6DA 1XG8A 2H71A 1BAYA 3UBLA 2MMZA 6GSXA 2RUFA 3BCKA 4HQZA 5JWOB 2CAIA 3HVXA 2WRTA 3KMOA 4ZILA 3UAPA 2LV3A 3M8NA 2O87A 5KN0A 5ECLB 5A4UA 1THOA 1PQNA 2LEGA 3KMNA 1A2LA 2IMKA 1O7UA 1N2AA 1K0DA 1XVQA 1JZDA 3VPQA 3TCOA 1FB6A 4IGJA 5J9CA 5KOWA 3HKRA 2OKAA 4TW5A 1XXUA 2JZTA 3F0IA 1LJRA 4HS1A 4EF0A 2AHEA 4K1FA 2YV9A 4PGTA 3KH9A 4KX4A 3A3TA 2GSRA 1OE7A 2FWGA 4JR6A 2C80A 4K6XA 4MNNA 5KOXA 4K0NA 3ED3A 4HU7A 2PBJA 2AV4A 1M3JA 1F2EA 3TJKA 4NMUA 3ERFA 4EIQA 4I2UA 2K8VA 2MBSA 5LNKe 4MA9A 3W8JA 1TU8A 3HD5A 5DAKA 1ZYEA 1ERVA 1GSUA 4ULXA 1U6TA 1BQ7A 2E7PA 1JFUA 2YANA 4RI7A 4D73B 4KA0A 4TR0A 1BX9A 3LWAA 4KDXA 2VUPA 3WD6A 1YEXA 1HQOA 5IOWA 1XPVA 1FAAA 2H1BA 4MJBA 2FHEA 2GZZA 5HFIA 3I9V2 3M1GA 1U3IA 2H1GA 2R0GA 3G7IA 3JCML 3IC8A 1SL1B 1XVWA 4G0LA 3D6IA 1K3LA 3G7YA 2CX3A 1HYUA 4USSA 3VLNA 1K0NA 2PPTA 3ZFLA 3WGXA 1TOFA 1I5GA 4J57E 3CXGA 3TB2A 5HR2A 5FWGA 1O8WA 1PD21 4L5OA 1A23A 1PSQA 1XWGA 4KF9A 4XIHA 3LG6A 1YKCA 1FOVA 4ISDA 5DALB 1QFNA 3LSZA 5ID2B 4YAVA 2R5GA 2TIRA 2GSTA 3H4KA 1GH2A 1W89A 4HDEA 1XFLA 4KAEA 3MDKA 1WWJA 3UVHA 5EY6A 4XCSA 1B48A 1E2YA 5HFGA 4NHWA 4V2LA 3GA4A 3FZ9A 22GSA 2DJ2A 1SK1A 1V58A 3IPZA 5AN1A 2KLXA 2HYXA 3C71A 4BVXB 4MDCA 2P5QA 5IMFA 1EGRA 2F3MA 2EC4A 3UEMA 4GTUA 4Z2RA 3KM6A 3ME7A 1TRUA 3P90A 4TXVA 2DBCA 2F51A 3TUEA 4YAPA 2H6ZA 4TXOB 1AQWA 2OE3A 2FA4A 4ZIJA 4OCFA 1MDIA 5CRGA 1GLPA 1GSDA 3C7MA 4K7IA 3ZTLA 3QFAC 5D73A 1AW9A 2PWJA 2M72A 4GQCA 5F05A 4OFNA 1GTIA 2HI7A 5GAPD 2GQKA 6GSSA 2CA8A 1PL2A 4P3YB 2VL2A 3F63A 3DEXA 1Z9HA 2JSYA 2CVDA 3QMXA 4O5UA 2P31A 5LCZA 2X99A 5J3RA 2I81A 5G5FA 2H72A 1VRSD 3KEBA 1O8XA 1PRXA 2DMLA 5GSTA 5INYA 3LGCA 2HSYA 2FWFA 2YV7A 4QL7A 2NVLA 1TK8B 2YNXA 2E2GA 4KUNA 5DDLA 1WOUA 3R3EA 1C72A 1XWAA 4JU5A 2IN3A 5FT3A 1AQVA 1SKRB 3LYKA 2DKIA 1GRXA 4EL1A 2OACA 1ZZYA 3ZITA 3CTFA 2L6DA 2B3SA 3UMAA 4HEA2 3CSHA 5IIZA 4MJEA 2IMIA 1EEJA 1ACVA 1A2JA 2FWHA 2IPAA 2VCXA 2CT6A 3EPTA 3I6AA 4A5PA 5GSSA 1MDKA 1GSFA 1EP7A 4RQRA 3GH9A 3GKMA 5ECHB 2KUCA 3KP9A 5F07A 1Q4JA 10GSA 1SYRA 2LTKA 1QMVA 4MF6A 1K3OA 1TP9A 1TRSA 4KCEA 2CZ2A 1GUHA 2WZ9A 5HR3A 4IELA 1SK0A 2V2GA 1H75A 3VWUA 1S3AA 3UL3A 3HVNA 1ST9A 2HFDA 3DVWA 3IDVA 3Q19A 3QDNA 4WXTA 6GSVA 2DLXA 1OAZA 3CBUA 5A4WA 3HJPA 2VLUA 3IBHA 1Z7PA 2OJLA 5AISA 5DAKB 5COHA 1SYXA 4BWSA 4N30A 3PGTA 5ECRB 2REMA 4XS1A 2DJJA 3MAKA 4F9ZA 3FMWA 18GSA 3D4TA 5JCWA 2YOIA 3E9JB 3LEFA 1OE8A 3O76A 4ECBA 1SJIA 3NZNA 4EDYA 2OE1A 2XPDA 1VF3A 3TKSE 3GL5A 1OC3A 2FA8A 1S3DA 2H1DA 3V1WA 5F06A 4GQFA 3LXZA 1TK0B 5A5KA 3QCPA 4EDZA 2H76A 3IR4A 4KH7A 2RM5A 1A8YA 3TGZA 4DSSA 4WBRD 3CMIA 3EYTA 5DJMA 3HDCA 4OO4A 3UVTA 2QC7A 1BEDA 3FYGA 1DE1A 2HRAA 3VPTA 4MMMA 2FY6A 4X4JA 5E59A 3GKNA 1ZL9A 1PMTA 3M3MA 12GSA 2HE3A 4GXZA 4LMWA 2A2PA 3KZQA 4I2TA 3VWXA 1ZYNA 5B8AA 2YWIA 4K2DA 1DSBA 4BIKA 2K6VA 3Q18A 3HYPA 2I4AA 3GMFA 5F8BA 3L4NA 2BTOT 1FVJA 2M46A 2CX4A 2RLIA 5G2ZA 4XRAA 2N5FA 3EMXA 1HNAA 5G1KA 5DCGA 3G9BA 2O85A 2X8GA 5BMUA 4G19A 2WFCA 1M9BA 2V1MA 5J5NA 3ZFBA 2C1YA 4TOPA 3FRCA 4IJ3A 1A2MA 3S9FA 2FD3A 1OC9B 3G7JA 2C0DA 2MYGA 2NDOA 3A2WA 4N0ZA 3ZREA 3CSIA 4V1Ap 3H93A 3F6FA 5ECIB 3F4SA 5DJLA 1FW1A 3F3QA 1A8LA 5IO0A 4J56E 2VCTA 1VGLA 5D9TA 5EVOA 4G9HA 5D96A 1T3BA 2F8FA 3FKFA 1XIYA 4JE1A 4L8EA 4JR4A 3I69A 2BMXA 16GSA 2GQLA 2LUSA 1YF0A 2NTOA 4AJ8A 1K0CA 3N5OA 4EKZA 2MBTA 2PVOC 2VAFA 3WGDA 2LNTA 4E8HA 8GSSA 4ECJA 4JEDA 4AGSA 3EC3A 1ZGNA 2LS5A 4MZBA 3IV4A 1A24A 1YY7A 5AIVA 4MF7A 4PUAA 4MCUA 4MPFA 2R0CA 4K0GA 3O3TA 2LQQA 2K8SA 4YKFA 2ALBA 2C8UA 4MPGA 1RK4A 5AIXA 3M9JA 1SK2A 3WT2A 4KCAA 1T4ZA 4ML1A 2BJXA 2H6YA 1X9MB 1HNCA 2CVBA 2QA1A 2A2SA 4QQ7A 4AF2A 3ZRDA 4MJCA 4FH8A 3WYWA 4TKYA 1PN0A 2UZ8A 4Q5FA 2GGTA 1V57A 4KGIA 4XS4A 3SWLA 5JCUA 1TTZA 1BG5A 3MIXA 1XZOA 1T00A 3BD2A 2H0HA 4XRDA 5ECOB 6GSUA 2NPBA 1FB0A 1NSWA 3EVIA 4FYCA 4BL7A 1MEKA 5D8IA 4KDUA 2O89A 4F0BA 3IK7A 3CTGA 3PPUA 4CHSA 2WB9A 3DYRA 2B1KA 3M0FA 3LJRA 3DGQA 7GSSA 4YKGA 3L9UA 2C0EA 4WF5A 1G7EA 14GSA 2P0GA 1ZOFA 2HRKA 5D9WA 1QK8A 4XTSA 2GZPA 5KN1A 1FG4A 4WETA 1XOAA 3D5JA 2V32A 3PR8A 1TKDB 1Y25A 4PQ1A 3AY8A 1EGOA 1A0FA 2LRNA 1TRVA 4GSTA 1U88A 2GZYA 5E4WA 4TRXA 3TJFA 4PXOA 4K5SA 2L6CA 2MMNA 3FR3A 3LYPA 1FVKA 1KBNA 5IMAA 3GN3A 5CRHA 4F0CA 3ZIJA 2LNSA 2WCIA 3DRNA 11GSA 3LORA 1DBYA 1WRYA 3RPNA 3E3EA 4ZL9A 2JU5A 5IMZA 3ERWA 4L5LA 4OD7A 3GTUA 2HRNA 3EU4A 2QGVA 1OKTA 1M0UA 1UA5A 3VI5A 1IYIA 4G0KA 4FYBA
chains in the Genus database with same CATH topology
2C4JA 2IMEA 5IMVA 1Z6NA 2K9FA 2JADA 2VLTA 1PN9A 4MH3A 5G31A 4Q5NA 3KGKA 1PGTA 2KP1A 3KJYA 3GSSA 1V2AA 2GDRA 1GLQA 4YQUA 2HZEB 4MJAA 6GSWA 2HNLA 2GLRA 2IIYA 13GSA 2YP6A 1USBA 3LW9A 1FOHA 2DJ0A 4PQIA 5CAXA 1R4WA 4F82A 5ECPB 2L4CA 3F9UA 1O85A 2XPEA 3TRXA 4Q5QA 5ECKB 3ZIVA 5DQSA 5C00A 3VWVA 3GKXA 3TJBA 4NAXA 2AJQB 3IE3A 1YKAA 4NPBA 2AUVA 4ZXGA 1YZXA 2C0FA 1VF1A 4WEYA 3QAWA 1J9BA 2VOCA 1HNBA 1M2DA 4EE0A 3IC4A 2R0PA 3BBYA 3MNGA 3QOUA 3QR6A 4O32A 5G5EA 4GRFA 2IFQB 1QXHA 2X8CA 4X1UA 4IQ1A 4ACSA 2B7JA 2LJRA 3QD9A 4K7NA 1GP1A 3NIVA 2L5LA 5ABRA 4HJMA 3IAM2 1JZWA 2OE0A 4N10A 3E0UA 1Z6MA 2H1AA 1EV4A 1GNWA 3EU3A 3BCIA 3MSZA 2FUG2 2L4QA 2V6OA 3GH6A 5IO2A 2ES7A 4PTSA 4Z2TA 1V98A 1EP8A 1GSEA 2OBIA 3R2QA 3EINA 5D9VA 4I5QA 4IKHA 1MD3A 2I3YA 2I1UA 4E8EA 1GL8A 3APSA 3TJJA 5KN3A 4BA7A 1X9WB 2H01A 4HZ4A 3A5WA 3LXTA 2A4VA 2PMTA 3H79A 4WKWA 4OO5A 1T7PB 4K9ZA 3K8NA 4EUYA 1TI3A 4YQMA 3QAGA 4FO5A 4GWRA 3F4RA 5CRWA 2H75A 5B8BA 5G1LA 3DVXA 2H74A 3HZ4A 2GSQA 3C8EA 1J08A 3HA9A 5DBQA 5ELAA 2CAQA 2R6KA 3TKPA 1U3AA 5H5QA 3RHCA 3MWHA 2VCVA 4I8BA 2KOKA 2HT9A 3F3RA 2L59A 2H0IA 4POLA 4CY6A 2DIYA 4BL7B 1TK5B 3DXBA 5D93A 1PA3A 2CQ9A 4FQUA 2QKEA 1GSYA 1URMA 4BVYA 4ZB9A 5HFKA 3FHKA 1GUKA 2B5XA 3APQA 3UOMA 1AC1A 3IHGA 3TKSC 5GAND 3EURA 4L0UA 2VCWA 5D9XA 4L0WA 2DC5A 4ZB6A 3KTBA 3IOSA 2C3NA 3TOTA 5G30A 1T8EB 3FZAA 5CP1A 2H19A 5DALA 5B6MA 5ID2A 4I97A 2C3QA 3NOFA 1G6WA 3Q6OA 2LSTA 4KSOA 2XBIA 4X0XA 3P7XA 4PNGA 4PNFA 4POBA 4EO3A 3P2AA 3RBTA 2WGRA 1U87A 2B7KA 1PKWA 4MLYA 5IOXA 3J7Yk 1ABAA 3ISOA 2ZCTA 2LRTA 2R3XA 4ML6A 1SU9A 3HJOA 1NHYA 4TR3A 3VURA 2JSZA 4JBBA 2RM6A 1K0BA 4HU9A 4BVXA 2DJ3A 3D4MA 2FLSA 2YPMA 4PQHA 5CO3A 2DIZA 1R5PA 5H5SA 2C0GA 2AB6A 3TKQA 2J9HA 3F8UA 1Q98A 2X64A 3QFBC 4CW9A 1B4PA 4Z7XA 3U6VA 2TRCP 3A2VA 2PN8A 3DMLA 2MMAA 4WF4A 1B8XA 1GSSA 4FYUA 3ZL5A 2HRFA 3TRPA 1V9WA 1N8JA 3CRUA 2VL2C 1YDKA 4V2MA 1SENA 3F4TA 4K7OA 2VCZA 3IRAA 1ZYQB 4NV2A 4DVCA 1O73A 2VIMA 1RQMA 2FCHA 2J23A 5IPGA 4Z2UA 4K5RA 4XHMA 3D21A 2VD0A 3RAZA 4QL9A 3ZMLA 1XCCA 3ZYWA 5B7CA 1T1VA 1NM3A 3HCZA 4LL1B 3W6GA 1KNGA 5H5RA 2HSMA 2H70A 2FWEA 3IK9A 1GTAA 3HVSA 2WULA 3FW2A 5ECMB 4HJ2A 4LLRA 2VM1A 5ECQB 1OYJA 3ME8A 1I9DA 3RPPA 2EIOA 2DJ1A 2V6KA 2PU9C 4G0IA 2GTUA 2GVPA 5HR0A 5B6NA 5C04A 1KTEA 4V1Ag 4OMVA 2OBKA 2DJKA 2B5YA 2KP2A 2FGXA 4NV5A 5J4UA 6GSYA 1M7TA 3RDWA 1AUCA 1ZYPA 4JZQA 2X4AA 5FHIA 1ML6A 1TU7A 4ILFA 4OWYA 4HOJA 3ZVJD 4AJ7A 2GS3A 4OFTA 3A2XA 2MZCA 1JLVA 3KP8A 3TKRA 4IS0A 1CQHA 4IBPA 3SBCA 1ERUA 2VO4A 20GSA 4GSSA 2CV4A 5ECNB 2YZHA 4PUFC 1F3BA 2A4HA 2MMOA 1SL2B 4IP1A 3UARA 1EEMA 5CYYA 1F3AA 1ZCPA 2WDUA 4TR1A 2GT5A 1WP0A 4MZCA 5EL8A 1MD4A 2IMFA 5GZZB 2O8VB 1DUGA 2V41A 2YJHA 4KNDA 3HY2A 1K3YA 3PH9A 4RQXA 3RHBA 1WPIA 1K0OA 3J7Yb 4MP4A 2IWTA 3D0ZA 4POKA 4YH2A 3GRXA 4IJIA 2QA2A 5J41A 5IMCA 1PL1A 1GNEA 2YN1A 2H0GA 4ZBAA 4TN8A 4MZWA 1WMJA 4ZL8A 3TRQA 4BVYB 1QQ2A 1E6BA 2X8HA 2I9HA 3C73A 5CREA 2QSIA 3L78A 1EWXA 1XWCA 2X49A 4KDYA 1CQGA 2E0QA 3KTLA 1B9XC 3H1NA 4GSNA 4EXJA 3IHQA 2NBSA 2HLSA 4IVFA 4TR4A 4NWYA 3EWLA 3GURA 1AQXA 1FO5A 1IYHA 3FR9A 3TKSA 2AAWA 4DSSB 2PUKC 1YEPA 3GX0A 1THXA 3N9JA 2PERA 5JCGA 3KD0A 3HZ8A 3US3A 2H8LA 1EV9A 3ZVJA 2P5RA 3VK9A 2LJAA 3VI7A 5ENUA 4O7HA 5IMDA 2M80A 5IQYA 1FHEA 3DIEA 1XWKA 3GKKA 4O5RA 4NXIA 4N11A 1G6YA 4BWQA 4ECCA 3L0HA 1R5AA 2JL4A 1SD9A 2JACA 3GUSA 1EZKA 4LA1A 3QAVA 4FIWA 2GSSA 3ZZXA 2DMMA 3DKSA 1Z5YE 1JHBA 4H86A 1XW6A 2B6MA 2TRXA 3HVVA 3GHAA 2OADA 1ERTA 1O81A 4RUVA 1TRWA 4JRRA 2XC2A 5F0GA 1M99A 3P8WA 1OC9A 2LJKA 5DVBA 4EC0A 3I43A 4ID0A 3ZMKA 5HQPA 1X5DA 4HZ2A 3APOA 4OFMA 2ZNMA 4DEJA 3ERGA 3TJGA 4MABA 1SD8A 4GLTA 1VF2A 2G0FA 1SL0B 1SKWB 2YWNA 1B9YC 3H8QA 2CVKA 2G2QA 2H30A 1Y6EA 2VL9A 2RIIA 1XW5A 3LFLA 4F03A 4V2NA 1Z3EA 5IPHA 4LMVA 4PX1A 3FY7A 3MYDA 2VCQA 1Z7RA 2ON7A 3HJMA 2HZFA 2RUEA 5ELGA 2XHFA 1OC8A 2A2RA 2F9SA 3KCMA 4KSMA 4GCIA 1B4QA 3QPMA 1V40A 1PX7A 4NHZA 4OCEA 2PVQA 1A0RP 5A4VA 5JWQB 1AIUA 3TOUA 2WS2A 3DD3A 1M9AA 1X0RA 4WR5A 5BRTA 2L57A 1XWBA 3FZ5A 4ZBBA 1YJ6A 2H66A 1EOHA 1RW1A 1BYEA 2GQMA 2YWOA 1XW9A 1OKDA 5IM9A 4ICYA 3PINA 3L9VA 4YQVA 2EIQA 2IMDA 1GTBA 1ILOA 2HSHA 1R26A 2PGTA 3FK8A 2CZ3A 2YJ7A 1LBKA 4IP6A 4XS4B 4EVMA 4KE3A 1T4YA 1GWCA 4PURA 3EE2A 2JZRA 3FEUA 4DSRA 2H73A 3U5RE 1ERWA 1XOBA 4D73A 1KEBA 4AJ6A 2Z9SA 4TR1B 3KXOA 2L5OA 3CRTA 2R4VA 4DSQA 1GUMA 1JZOA 5ECSA 9GSSA 2IJYA 2YCDA 1TDIA 2FNOA 5DQYA 3IA1A 2F8AA 4K8MA 3L9SA 1MTCA 4X43A 2ZUPA 1ON4A 3FR6A 1G7OA 4HUAA 5DCHA 1PKZA 4WBJA 4ZB8A 1J0FA 4IW9A 2YZUA 1SJ6A 3GNJA 4MH2A 3GFKA 5LD0A 1K0AA 3IAS2 1EOGA 1YF1A 1X5EA 3D22A 1S3CA 3GSTA 2B5EA 4KW6A 1SKSB 4LL4B 2N5BA 2GT6A 4G10A 3HHVA 1AAZA 2VL3A 19GSA 1SJZA 4IQAA 4XS6A 3KIJA 1X5CA 2JZSA 4N0VA 4HQSA 1GTUA 1UN2A 17GSA 3HXSA 4RI6A 4EIPA 3KH7A 1F37A 3WGEA 1VF4A 1AXDA 4BPYA 4MF5A 2XBQA 2ON5A 3EMPA 4Q5RA 1LU4A 1WJKA 1K0MA 1F6MC 3UBKA 1GULA 2N5AA 2VLVA 6GSTA 1DE2A 2EIRA 1TJDA 1M2BA 3LQ7A 3GTUB 1G0TA 1BJXA 3CYNA 5CRDA 4KB3A 1HD2A 1PX6A 2HXKA 4ZBDA 4ZL7A 4CDOA 2DSAA 2B1LA 2OA7A 1TI1A 1YQ1A 1WE0A 4O92A 4K2XA 2DKHA 5HR1A 1X9SB 1M2AA 2WJUA 3IXRA 4IHUA 2IL3A 4O5QA 1NHOA 3W8SA 2HZEA 3TDGA 4IN0A 1W4VA 3C1RA 4F2IA 1F9MA 4TVEA 4TXOA 4G2EA 3FZ4A 3M9KA 3GX8A 1QUWA 1JLWA 4CY8A 1QGVA 3A5IA 3VWWA 1UVZA 3C1SA 3DWVA 2D2ZA 4I6XA 5JWRB 1WIKA 2LRCA 3UIWA 1R7HA 1MDJA 4J2FA 1H4OA 4MK3A 2R2JA 1OVNA 1UC7A 3BOAA 2VM2A 2VD1A 5KN2A 3ZLPA 3OR5A 2C3TA 1TXXA 2LKUA 1NW2A 3UJ1A 4GF0A 4HI7A 3O6TA 3Q74A 2R37A 5L71A 3BJ5A 1JZRA 1O6JA 2O7KA 3GL3A 5J9BA 2LQOA 4ECIA 3CSJA 4POMA 2KHPA 3VFIA 1XBSA 2YWMA 1ZMAA 5AGYA 3GYKA 2AYTA 2IFQA 3WT1A 1TW9A 5CNWA 5EPFA 1GSQA 4WR4A 3GIXA 3GV1A 5KEJA 2E2MA 2K18A 2H6XA 3F6DA 2H71A 1BAYA 3UBLA 2MMZA 6GSXA 2RUFA 3BCKA 4HQZA 5JWOB 2CAIA 3HVXA 2WRTA 3KMOA 4ZILA 3UAPA 2LV3A 3M8NA 2O87A 5KN0A 5ECLB 5A4UA 1THOA 1PQNA 2LEGA 3KMNA 1A2LA 2IMKA 1O7UA 1N2AA 1K0DA 1XVQA 1JZDA 3VPQA 3TCOA 1FB6A 4IGJA 5J9CA 5KOWA 3HKRA 2OKAA 4TW5A 1XXUA 2JZTA 3F0IA 1LJRA 4HS1A 4EF0A 2AHEA 4K1FA 2YV9A 4PGTA 3KH9A 4KX4A 3A3TA 2GSRA 1OE7A 2FWGA 4JR6A 2C80A 4K6XA 4MNNA 5KOXA 4K0NA 3ED3A 4HU7A 2PBJA 2AV4A 3TJKA 1F2EA 4NMUA 3ERFA 4EIQA 4I2UA 2K8VA 2MBSA 5LNKe 4MA9A 3W8JA 1TU8A 3HD5A 5DAKA 1ZYEA 1ERVA 1GSUA 4ULXA 1U6TA 1BQ7A 2E7PA 1JFUA 2YANA 4RI7A 4D73B 4KA0A 4TR0A 1BX9A 3LWAA 4KDXA 2VUPA 3WD6A 1YEXA 1HQOA 5IOWA 1XPVA 1FAAA 2H1BA 4MJBA 2FHEA 2GZZA 5HFIA 3I9V2 3M1GA 1U3IA 2H1GA 2R0GA 3G7IA 3JCML 3IC8A 1SL1B 1XVWA 4G0LA 3D6IA 1K3LA 3G7YA 2CX3A 1HYUA 4USSA 3VLNA 1K0NA 2PPTA 3ZFLA 3WGXA 1TOFA 1I5GA 4J57E 3CXGA 3TB2A 5HR2A 5FWGA 1O8WA 1PD21 4L5OA 1A23A 1PSQA 1XWGA 4KF9A 4XIHA 3LG6A 1YKCA 1FOVA 4ISDA 5DALB 1QFNA 3LSZA 5ID2B 4YAVA 2R5GA 2TIRA 2GSTA 3H4KA 1GH2A 1W89A 4HDEA 1XFLA 4KAEA 3MDKA 1WWJA 3UVHA 5EY6A 4XCSA 1B48A 1E2YA 5HFGA 4NHWA 4V2LA 3GA4A 3FZ9A 22GSA 2DJ2A 1SK1A 1V58A 3IPZA 5AN1A 2KLXA 2HYXA 3C71A 4BVXB 4MDCA 2P5QA 5IMFA 1EGRA 2F3MA 2EC4A 3UEMA 4GTUA 4Z2RA 3KM6A 3ME7A 1TRUA 3P90A 4TXVA 2DBCA 2F51A 3TUEA 4YAPA 2H6ZA 4TXOB 1AQWA 2OE3A 2FA4A 4ZIJA 4OCFA 1MDIA 5CRGA 1GLPA 1GSDA 3C7MA 4K7IA 3ZTLA 3QFAC 5D73A 1AW9A 2PWJA 2M72A 4GQCA 5F05A 4OFNA 1GTIA 2HI7A 5GAPD 2GQKA 6GSSA 2CA8A 1PL2A 4P3YB 2VL2A 3F63A 3DEXA 1Z9HA 2JSYA 2CVDA 3QMXA 4O5UA 2P31A 5LCZA 2X99A 5J3RA 2I81A 5G5FA 2H72A 1VRSD 3KEBA 1O8XA 1PRXA 2DMLA 5GSTA 5INYA 3LGCA 2HSYA 2FWFA 2YV7A 4QL7A 2NVLA 1TK8B 2YNXA 2E2GA 4KUNA 5DDLA 1WOUA 3R3EA 1C72A 1XWAA 4JU5A 2IN3A 5FT3A 1AQVA 1SKRB 3LYKA 2DKIA 1GRXA 4EL1A 2OACA 1ZZYA 3ZITA 3CTFA 2L6DA 2B3SA 3UMAA 4HEA2 3CSHA 5IIZA 4MJEA 2IMIA 1EEJA 1ACVA 1A2JA 2FWHA 2IPAA 2VCXA 2CT6A 3EPTA 3I6AA 4A5PA 5GSSA 1MDKA 1GSFA 1EP7A 4RQRA 3GH9A 3GKMA 5ECHB 2KUCA 3KP9A 5F07A 1Q4JA 10GSA 1SYRA 2LTKA 1QMVA 4MF6A 1K3OA 1TP9A 1TRSA 4KCEA 2CZ2A 1GUHA 2WZ9A 5HR3A 4IELA 1SK0A 2V2GA 1H75A 3VWUA 1S3AA 3UL3A 1ST9A 2HFDA 3DVWA 3IDVA 3Q19A 3QDNA 4WXTA 6GSVA 2DLXA 1OAZA 3CBUA 5A4WA 3HJPA 2VLUA 3IBHA 1Z7PA 2OJLA 5AISA 5DAKB 5COHA 1SYXA 4BWSA 4N30A 3PGTA 5ECRB 2REMA 4XS1A 2DJJA 3MAKA 4F9ZA 3FMWA 18GSA 3D4TA 5JCWA 2YOIA 3E9JB 3LEFA 1OE8A 3O76A 4ECBA 1SJIA 3NZNA 4EDYA 2OE1A 2XPDA 1VF3A 3TKSE 3GL5A 1OC3A 2FA8A 1S3DA 2H1DA 3V1WA 5F06A 4GQFA 3LXZA 1TK0B 5A5KA 3QCPA 4EDZA 2H76A 3IR4A 4KH7A 2RM5A 1A8YA 3TGZA 4DSSA 4WBRD 3CMIA 3EYTA 5DJMA 3HDCA 4OO4A 3UVTA 2QC7A 1BEDA 3FYGA 1DE1A 2HRAA 3VPTA 4MMMA 2FY6A 4X4JA 5E59A 3GKNA 1ZL9A 1PMTA 3M3MA 12GSA 2HE3A 4GXZA 4LMWA 2A2PA 3KZQA 4I2TA 3VWXA 1ZYNA 5B8AA 2YWIA 4K2DA 1DSBA 2K6VA 3Q18A 3HYPA 2I4AA 3GMFA 5F8BA 3L4NA 2BTOT 1FVJA 2M46A 2CX4A 2RLIA 5G2ZA 4XRAA 2N5FA 3EMXA 1HNAA 5G1KA 5DCGA 3G9BA 2O85A 2X8GA 5BMUA 4G19A 2WFCA 1M9BA 2V1MA 5J5NA 3ZFBA 2C1YA 4TOPA 3FRCA 4IJ3A 1A2MA 3S9FA 2FD3A 1OC9B 3G7JA 2C0DA 2MYGA 2NDOA 3A2WA 4N0ZA 3ZREA 3CSIA 4V1Ap 3H93A 3F6FA 5ECIB 3F4SA 5DJLA 1FW1A 3F3QA 1A8LA 5IO0A 4J56E 2VCTA 1VGLA 5D9TA 5EVOA 4G9HA 5D96A 1T3BA 2F8FA 3FKFA 1XIYA 4JE1A 4L8EA 4JR4A 3I69A 2BMXA 16GSA 2GQLA 2LUSA 1YF0A 2NTOA 4AJ8A 1K0CA 3N5OA 4EKZA 2MBTA 2PVOC 2VAFA 3WGDA 2LNTA 4E8HA 8GSSA 4ECJA 4JEDA 4AGSA 3EC3A 1ZGNA 2LS5A 4MZBA 3IV4A 1A24A 1YY7A 5AIVA 4MF7A 4PUAA 4MCUA 4MPFA 2R0CA 4K0GA 3O3TA 2LQQA 2K8SA 4YKFA 2ALBA 2C8UA 4MPGA 1RK4A 5AIXA 3M9JA 1SK2A 3WT2A 4KCAA 1T4ZA 4ML1A 2BJXA 2H6YA 1X9MB 1HNCA 2CVBA 2QA1A 2A2SA 4QQ7A 4AF2A 3ZRDA 4MJCA 4FH8A 3WYWA 4TKYA 1PN0A 2UZ8A 4Q5FA 2GGTA 1V57A 4KGIA 4XS4A 3SWLA 5JCUA 1TTZA 1BG5A 3MIXA 1XZOA 1T00A 3BD2A 2H0HA 4XRDA 5ECOB 6GSUA 2NPBA 1FB0A 1NSWA 3EVIA 4FYCA 4BL7A 1MEKA 5D8IA 4KDUA 2O89A 4F0BA 3IK7A 3CTGA 3PPUA 4CHSA 2WB9A 3DYRA 2B1KA 3M0FA 3LJRA 3DGQA 7GSSA 4YKGA 3L9UA 2C0EA 4WF5A 1G7EA 14GSA 2P0GA 1ZOFA 2HRKA 5D9WA 1QK8A 4XTSA 2GZPA 5KN1A 1FG4A 4WETA 1XOAA 3D5JA 2V32A 3PR8A 1TKDB 1Y25A 4PQ1A 3AY8A 1EGOA 1A0FA 2LRNA 1TRVA 4GSTA 1U88A 2GZYA 5E4WA 4TRXA 3TJFA 4PXOA 4K5SA 2L6CA 2MMNA 3FR3A 3LYPA 1FVKA 1KBNA 5IMAA 3GN3A 5CRHA 4F0CA 3ZIJA 2LNSA 2WCIA 3DRNA 11GSA 3LORA 1DBYA 1WRYA 3RPNA 3E3EA 4ZL9A 2JU5A 5IMZA 3ERWA 4L5LA 4OD7A 3GTUA 2HRNA 3EU4A 2QGVA 1OKTA 1M0UA 1UA5A 3VI5A 1IYIA 4G0KA 4FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C4J A;  2IME A;  5IMV A;  1Z6N A;  2K9F A;  2JAD A;  2VLT A;  1PN9 A;  4MH3 A;  5G31 A;  4Q5N A;  3KGK A;  1PGT A;  2KP1 A;  3KJY A;  3GSS A;  1V2A A;  2GDR A;  1GLQ A;  4YQU A;  2HZE B;  4MJA A;  6GSW A;  2HNL A;  2GLR A;  2IIY A;  13GS A;  2YP6 A;  1USB A;  2DJ0 A;  4PQI A;  5CAX A;  1R4W A;  4F82 A;  5ECP B;  2L4C A;  3F9U A;  1O85 A;  2XPE A;  3TRX A;  4Q5Q A;  5ECK B;  3ZIV A;  5DQS A;  5C00 A;  3VWV A;  3GKX A;  3TJB A;  4NAX A;  2AJQ B;  3IE3 A;  1YKA A;  4NPB A;  2AUV A;  4ZXG A;  1YZX A;  2C0F A;  1VF1 A;  4WEY A;  3QAW A;  1J9B A;  2VOC A;  1HNB A;  1M2D A;  4EE0 A;  3IC4 A;  3BBY A;  3MNG A;  3QOU A;  3QR6 A;  4O32 A;  5G5E A;  4GRF A;  2IFQ B;  1QXH A;  2X8C A;  4X1U A;  4IQ1 A;  4ACS A;  2B7J A;  2LJR A;  3QD9 A;  4K7N A;  1GP1 A;  3NIV A;  2L5L A;  5ABR A;  4HJM A;  3IAM 2;  1JZW A;  2OE0 A;  4N10 A;  3E0U A;  1Z6M A;  2H1A A;  1EV4 A;  1GNW A;  3EU3 A;  3BCI A;  3MSZ A;  2FUG 2;  2L4Q A;  2V6O A;  3GH6 A;  5IO2 A;  2ES7 A;  1V98 A;  1EP8 A;  1GSE A;  2OBI A;  3R2Q A;  3EIN A;  5D9V A;  4I5Q A;  4IKH A;  1MD3 A;  2I3Y A;  2I1U A;  4E8E A;  1GL8 A;  3APS A;  3TJJ A;  5KN3 A;  4BA7 A;  1X9W B;  2H01 A;  4HZ4 A;  3A5W A;  3LXT A;  2A4V A;  2PMT A;  3H79 A;  4WKW A;  4OO5 A;  1T7P B;  4K9Z A;  3K8N A;  4EUY A;  1TI3 A;  4YQM A;  3QAG A;  4FO5 A;  4GWR A;  3F4R A;  5CRW A;  2H75 A;  5B8B A;  5G1L A;  3DVX A;  2H74 A;  3HZ4 A;  2GSQ A;  3C8E A;  1J08 A;  3HA9 A;  5DBQ A;  5ELA A;  2CAQ A;  2R6K A;  3TKP A;  1U3A A;  5H5Q A;  3RHC A;  3MWH A;  2VCV A;  4I8B A;  2KOK A;  2HT9 A;  3F3R A;  2L59 A;  2H0I A;  4POL A;  2DIY A;  1TK5 B;  3DXB A;  5D93 A;  1PA3 A;  2CQ9 A;  2QKE A;  1GSY A;  1URM A;  4BVY A;  4ZB9 A;  5HFK A;  3FHK A;  1GUK A;  2B5X A;  3APQ A;  3UOM A;  1AC1 A;  3TKS C;  5GAN D;  3EUR A;  4L0U A;  2VCW A;  5D9X A;  4L0W A;  2DC5 A;  4ZB6 A;  3KTB A;  3IOS A;  2C3N A;  3TOT A;  5G30 A;  1T8E B;  3FZA A;  5CP1 A;  2H19 A;  5DAL A;  5B6M A;  5ID2 A;  4I97 A;  2C3Q A;  3NOF A;  1G6W A;  3Q6O A;  2LST A;  4KSO A;  2XBI A;  4X0X A;  3P7X A;  4PNG A;  4PNF A;  4POB A;  4EO3 A;  3P2A A;  3RBT A;  2WGR A;  1U87 A;  2B7K A;  1PKW A;  4MLY A;  5IOX A;  3J7Y k;  1ABA A;  3ISO A;  2ZCT A;  2LRT A;  2R3X A;  4ML6 A;  1SU9 A;  3HJO A;  1NHY A;  4TR3 A;  3VUR A;  2JSZ A;  4JBB A;  2RM6 A;  1K0B A;  4HU9 A;  4BVX A;  2DJ3 A;  3D4M A;  2FLS A;  2YPM A;  4PQH A;  5CO3 A;  2DIZ A;  1R5P A;  5H5S A;  2C0G A;  2AB6 A;  3TKQ A;  2J9H A;  3F8U A;  1Q98 A;  2X64 A;  3QFB C;  4CW9 A;  1B4P A;  4Z7X A;  3U6V A;  2TRC P;  3A2V A;  2PN8 A;  3DML A;  2MMA A;  4WF4 A;  1B8X A;  1GSS A;  4FYU A;  3ZL5 A;  2HRF A;  3TRP A;  1V9W A;  1N8J A;  3CRU A;  2VL2 C;  1YDK A;  4V2M A;  1SEN A;  3F4T A;  4K7O A;  2VCZ A;  3IRA A;  1ZYQ B;  4NV2 A;  4DVC A;  1O73 A;  2VIM A;  1RQM A;  2FCH A;  2J23 A;  5IPG A;  4XHM A;  3D21 A;  2VD0 A;  3RAZ A;  4QL9 A;  3ZML A;  1XCC A;  3ZYW A;  5B7C A;  1T1V A;  1NM3 A;  3HCZ A;  4LL1 B;  3W6G A;  1KNG A;  5H5R A;  2H70 A;  2FWE A;  3IK9 A;  1GTA A;  3HVS A;  2WUL A;  3FW2 A;  5ECM B;  4HJ2 A;  4LLR A;  2VM1 A;  5ECQ B;  1OYJ A;  3ME8 A;  1I9D A;  3RPP A;  2EIO A;  2DJ1 A;  2V6K A;  2PU9 C;  2GTU A;  2GVP A;  5HR0 A;  5B6N A;  5C04 A;  1KTE A;  4V1A g;  4OMV A;  2OBK A;  2DJK A;  2B5Y A;  2KP2 A;  2FGX A;  4NV5 A;  5J4U A;  6GSY A;  1M7T A;  3RDW A;  1AUC A;  4JZQ A;  5FHI A;  1ML6 A;  1TU7 A;  4ILF A;  4OWY A;  4HOJ A;  3ZVJ D;  4AJ7 A;  2GS3 A;  4OFT A;  3A2X A;  2MZC A;  1JLV A;  3KP8 A;  3TKR A;  4IS0 A;  1CQH A;  4IBP A;  3SBC A;  1ERU A;  2VO4 A;  20GS A;  4GSS A;  2CV4 A;  5ECN B;  2YZH A;  4PUF C;  1F3B A;  2MMO A;  1SL2 B;  4IP1 A;  3UAR A;  1EEM A;  5CYY A;  1F3A A;  1ZCP A;  2WDU A;  4TR1 A;  2GT5 A;  1WP0 A;  4MZC A;  5EL8 A;  1MD4 A;  2IMF A;  5GZZ B;  2O8V B;  1DUG A;  2V41 A;  2YJH A;  4KND A;  3HY2 A;  1K3Y A;  3PH9 A;  4RQX A;  3RHB A;  1WPI A;  1K0O A;  3J7Y b;  4MP4 A;  2IWT A;  3D0Z A;  4POK A;  4YH2 A;  3GRX A;  4IJI A;  5J41 A;  5IMC A;  1PL1 A;  1GNE A;  2YN1 A;  2H0G A;  4ZBA A;  4TN8 A;  4MZW A;  1WMJ A;  4ZL8 A;  3TRQ A;  1QQ2 A;  1E6B A;  2X8H A;  2I9H A;  3C73 A;  5CRE A;  2QSI A;  3L78 A;  1EWX A;  1XWC A;  4KDY A;  1CQG A;  2E0Q A;  3KTL A;  1B9X C;  3H1N A;  4GSN A;  4EXJ A;  3IHQ A;  2NBS A;  2HLS A;  4IVF A;  4TR4 A;  4NWY A;  3EWL A;  3GUR A;  1AQX A;  1FO5 A;  1IYH A;  3FR9 A;  3TKS A;  2AAW A;  4DSS B;  2PUK C;  1YEP A;  3GX0 A;  1THX A;  3N9J A;  2PER A;  5JCG A;  3KD0 A;  3HZ8 A;  3US3 A;  2H8L A;  1EV9 A;  3ZVJ A;  2P5R A;  3VK9 A;  2LJA A;  3VI7 A;  5ENU A;  4O7H A;  5IMD A;  2M80 A;  5IQY A;  1FHE A;  3DIE A;  1XWK A;  3GKK A;  4O5R A;  4NXI A;  4N11 A;  1G6Y A;  4BWQ A;  4ECC A;  3L0H A;  1R5A A;  2JL4 A;  1SD9 A;  2JAC A;  3GUS A;  1EZK A;  4LA1 A;  3QAV A;  4FIW A;  2GSS A;  3ZZX A;  2DMM A;  3DKS A;  1Z5Y E;  1JHB A;  4H86 A;  1XW6 A;  2B6M A;  2TRX A;  3HVV A;  3GHA A;  2OAD A;  1ERT A;  1O81 A;  4RUV A;  1TRW A;  4JRR A;  2XC2 A;  5F0G A;  1M99 A;  3P8W A;  1OC9 A;  2LJK A;  5DVB A;  4EC0 A;  3I43 A;  4ID0 A;  3ZMK A;  5HQP A;  1X5D A;  4HZ2 A;  3APO A;  4OFM A;  2ZNM A;  4DEJ A;  3ERG A;  3TJG A;  4MAB A;  1SD8 A;  4GLT A;  1VF2 A;  2G0F A;  1SL0 B;  1SKW B;  2YWN A;  1B9Y C;  3H8Q A;  2CVK A;  2G2Q A;  2H30 A;  1Y6E A;  2VL9 A;  2RII A;  1XW5 A;  3LFL A;  4F03 A;  4V2N A;  1Z3E A;  5IPH A;  4LMV A;  4PX1 A;  3FY7 A;  2VCQ A;  1Z7R A;  2ON7 A;  3HJM A;  2HZF A;  2RUE A;  5ELG A;  2XHF A;  1OC8 A;  2A2R A;  2F9S A;  3KCM A;  4KSM A;  4GCI A;  1B4Q A;  3QPM A;  1V40 A;  1PX7 A;  4NHZ A;  4OCE A;  2PVQ A;  1A0R P;  5A4V A;  5JWQ B;  1AIU A;  3TOU A;  2WS2 A;  3DD3 A;  1M9A A;  1X0R A;  4WR5 A;  2L57 A;  1XWB A;  3FZ5 A;  4ZBB A;  1YJ6 A;  2H66 A;  1EOH A;  1RW1 A;  1BYE A;  2GQM A;  2YWO A;  1XW9 A;  1OKD A;  5IM9 A;  3PIN A;  3L9V A;  4YQV A;  2EIQ A;  2IMD A;  1GTB A;  1ILO A;  2HSH A;  1R26 A;  2PGT A;  3FK8 A;  2CZ3 A;  2YJ7 A;  1LBK A;  4IP6 A;  4XS4 B;  4EVM A;  4KE3 A;  1T4Y A;  1GWC A;  4PUR A;  3EE2 A;  2JZR A;  3FEU A;  4DSR A;  2H73 A;  3U5R E;  1ERW A;  1XOB A;  4D73 A;  1KEB A;  4AJ6 A;  2Z9S A;  4TR1 B;  3KXO A;  2L5O A;  3CRT A;  2R4V A;  4DSQ A;  1GUM A;  1JZO A;  5ECS A;  9GSS A;  2IJY A;  2YCD A;  1TDI A;  2FNO A;  5DQY A;  3IA1 A;  2F8A A;  4K8M A;  3L9S A;  1MTC A;  4X43 A;  2ZUP A;  1ON4 A;  3FR6 A;  1G7O A;  4HUA A;  5DCH A;  1PKZ A;  4WBJ A;  4ZB8 A;  1J0F A;  4IW9 A;  2YZU A;  1SJ6 A;  3GNJ A;  4MH2 A;  3GFK A;  5LD0 A;  1K0A A;  3IAS 2;  1EOG A;  1YF1 A;  1X5E A;  3D22 A;  1S3C A;  3GST A;  2B5E A;  4KW6 A;  1SKS B;  4LL4 B;  2N5B A;  2GT6 A;  4G10 A;  3HHV A;  1AAZ A;  2VL3 A;  19GS A;  1SJZ A;  4IQA A;  4XS6 A;  3KIJ A;  1X5C A;  2JZS A;  4N0V A;  4HQS A;  1GTU A;  1UN2 A;  17GS A;  3HXS A;  4RI6 A;  3KH7 A;  1F37 A;  3WGE A;  1VF4 A;  1AXD A;  4BPY A;  4MF5 A;  2XBQ A;  2ON5 A;  3EMP A;  4Q5R A;  1LU4 A;  1WJK A;  1K0M A;  1F6M C;  3UBK A;  1GUL A;  2N5A A;  2VLV A;  6GST A;  1DE2 A;  2EIR A;  1TJD A;  1M2B A;  3LQ7 A;  3GTU B;  1G0T A;  1BJX A;  3CYN A;  5CRD A;  4KB3 A;  1HD2 A;  1PX6 A;  2HXK A;  4ZBD A;  4ZL7 A;  4CDO A;  2DSA A;  2B1L A;  2OA7 A;  1TI1 A;  1YQ1 A;  1WE0 A;  4O92 A;  5HR1 A;  1X9S B;  1M2A A;  2WJU A;  3IXR A;  4IHU A;  2IL3 A;  1NHO A;  3W8S A;  2HZE A;  3TDG A;  4IN0 A;  1W4V A;  3C1R A;  4F2I A;  1F9M A;  4TVE A;  4TXO A;  4G2E A;  3FZ4 A;  3M9K A;  3GX8 A;  1QUW A;  1JLW A;  1QGV A;  3VWW A;  1UVZ A;  3C1S A;  3DWV A;  2D2Z A;  4I6X A;  5JWR B;  1WIK A;  2LRC A;  3UIW A;  1R7H A;  1MDJ A;  4J2F A;  1H4O A;  4MK3 A;  2R2J A;  1OVN A;  1UC7 A;  3BOA A;  2VM2 A;  2VD1 A;  5KN2 A;  3ZLP A;  3OR5 A;  2C3T A;  1TXX A;  2LKU A;  1NW2 A;  3UJ1 A;  4GF0 A;  4HI7 A;  3O6T A;  3Q74 A;  2R37 A;  5L71 A;  3BJ5 A;  1JZR A;  1O6J A;  2O7K A;  3GL3 A;  5J9B A;  2LQO A;  4ECI A;  3CSJ A;  4POM A;  2KHP A;  3VFI A;  1XBS A;  2YWM A;  1ZMA A;  5AGY A;  3GYK A;  2AYT A;  2IFQ A;  3WT1 A;  1TW9 A;  5CNW A;  5EPF A;  1GSQ A;  4WR4 A;  3GIX A;  3GV1 A;  5KEJ A;  2E2M A;  2K18 A;  2H6X A;  3F6D A;  2H71 A;  1BAY A;  3UBL A;  2MMZ A;  6GSX A;  2RUF A;  3BCK A;  4HQZ A;  5JWO B;  2CAI A;  3HVX A;  2WRT A;  3KMO A;  4ZIL A;  3UAP A;  2LV3 A;  3M8N A;  2O87 A;  5KN0 A;  5ECL B;  5A4U A;  1THO A;  1PQN A;  2LEG A;  3KMN A;  1A2L A;  2IMK A;  1O7U A;  1N2A A;  1K0D A;  1XVQ A;  1JZD A;  3VPQ A;  3TCO A;  1FB6 A;  4IGJ A;  5J9C A;  3HKR A;  2OKA A;  4TW5 A;  1XXU A;  2JZT A;  3F0I A;  1LJR A;  4HS1 A;  4EF0 A;  2AHE A;  4K1F A;  2YV9 A;  4PGT A;  3KH9 A;  4KX4 A;  3A3T A;  2GSR A;  1OE7 A;  2FWG A;  4JR6 A;  2C80 A;  4K6X A;  4K0N A;  3ED3 A;  4HU7 A;  2PBJ A;  2AV4 A;  3TJK A;  1F2E A;  4NMU A;  3ERF A;  4I2U A;  2K8V A;  2MBS A;  5LNK e;  4MA9 A;  3W8J A;  1TU8 A;  3HD5 A;  5DAK A;  1ZYE A;  1ERV A;  1GSU A;  4ULX A;  1U6T A;  1BQ7 A;  2E7P A;  1JFU A;  2YAN A;  4RI7 A;  4D73 B;  4KA0 A;  4TR0 A;  1BX9 A;  3LWA A;  4KDX A;  2VUP A;  3WD6 A;  1YEX A;  1HQO A;  5IOW A;  1XPV A;  1FAA A;  2H1B A;  4MJB A;  2FHE A;  2GZZ A;  5HFI A;  3I9V 2;  3M1G A;  1U3I A;  2H1G A;  3G7I A;  3JCM L;  1SL1 B;  1XVW A;  3D6I A;  1K3L A;  3G7Y A;  2CX3 A;  1HYU A;  3VLN A;  1K0N A;  2PPT A;  3ZFL A;  3WGX A;  1TOF A;  1I5G A;  4J57 E;  3CXG A;  3TB2 A;  5HR2 A;  5FWG A;  1O8W A;  1PD2 1;  4L5O A;  1A23 A;  1PSQ A;  1XWG A;  4XIH A;  3LG6 A;  1YKC A;  1FOV A;  4ISD A;  5DAL B;  1QFN A;  3LSZ A;  5ID2 B;  4YAV A;  2R5G A;  2TIR A;  2GST A;  3H4K A;  1GH2 A;  1W89 A;  4HDE A;  1XFL A;  4KAE A;  3MDK A;  1WWJ A;  3UVH A;  5EY6 A;  4XCS A;  1B48 A;  1E2Y A;  5HFG A;  4NHW A;  4V2L A;  3GA4 A;  3FZ9 A;  22GS A;  2DJ2 A;  1SK1 A;  1V58 A;  3IPZ A;  5AN1 A;  2KLX A;  2HYX A;  3C71 A;  4MDC A;  2P5Q A;  5IMF A;  1EGR A;  2F3M A;  2EC4 A;  3UEM A;  4GTU A;  3KM6 A;  3ME7 A;  1TRU A;  3P90 A;  4TXV A;  2DBC A;  2F51 A;  3TUE A;  4YAP A;  2H6Z A;  4TXO B;  1AQW A;  2OE3 A;  2FA4 A;  4ZIJ A;  4OCF A;  1MDI A;  5CRG A;  1GLP A;  1GSD A;  3C7M A;  4K7I A;  3ZTL A;  3QFA C;  5D73 A;  1AW9 A;  2PWJ A;  2M72 A;  4GQC A;  5F05 A;  4OFN A;  1GTI A;  2HI7 A;  5GAP D;  2GQK A;  6GSS A;  2CA8 A;  1PL2 A;  4P3Y B;  2VL2 A;  3F63 A;  3DEX A;  1Z9H A;  2JSY A;  2CVD A;  3QMX A;  2P31 A;  5LCZ A;  2X99 A;  5J3R A;  2I81 A;  5G5F A;  2H72 A;  1VRS D;  3KEB A;  1O8X A;  1PRX A;  2DML A;  5GST A;  5INY A;  3LGC A;  2HSY A;  2FWF A;  2YV7 A;  4QL7 A;  2NVL A;  1TK8 B;  2YNX A;  2E2G A;  4KUN A;  5DDL A;  1WOU A;  1C72 A;  1XWA A;  4JU5 A;  2IN3 A;  5FT3 A;  1AQV A;  1SKR B;  3LYK A;  1GRX A;  4EL1 A;  2OAC A;  1ZZY A;  3ZIT A;  3CTF A;  2L6D A;  2B3S A;  3UMA A;  4HEA 2;  3CSH A;  5IIZ A;  4MJE A;  2IMI A;  1EEJ A;  1ACV A;  1A2J A;  2FWH A;  2IPA A;  2VCX A;  2CT6 A;  3I6A A;  5GSS A;  1MDK A;  1GSF A;  1EP7 A;  4RQR A;  3GH9 A;  3GKM A;  5ECH B;  2KUC A;  3KP9 A;  5F07 A;  1Q4J A;  10GS A;  1SYR A;  2LTK A;  1QMV A;  4MF6 A;  1K3O A;  1TP9 A;  1TRS A;  4KCE A;  2CZ2 A;  1GUH A;  2WZ9 A;  5HR3 A;  4IEL A;  1SK0 A;  2V2G A;  1H75 A;  3VWU A;  1S3A A;  3UL3 A;  1ST9 A;  2HFD A;  3DVW A;  3IDV A;  3Q19 A;  3QDN A;  4WXT A;  6GSV A;  2DLX A;  1OAZ A;  3CBU A;  5A4W A;  3HJP A;  2VLU A;  3IBH A;  1Z7P A;  2OJL A;  5AIS A;  5DAK B;  5COH A;  1SYX A;  4BWS A;  4N30 A;  3PGT A;  5ECR B;  2REM A;  4XS1 A;  2DJJ A;  3MAK A;  4F9Z A;  18GS A;  3D4T A;  5JCW A;  2YOI A;  3E9J B;  3LEF A;  1OE8 A;  3O76 A;  4ECB A;  1SJI A;  3NZN A;  4EDY A;  2OE1 A;  2XPD A;  1VF3 A;  3TKS E;  3GL5 A;  1OC3 A;  2FA8 A;  1S3D A;  2H1D A;  3V1W A;  5F06 A;  4GQF A;  3LXZ A;  1TK0 B;  5A5K A;  3QCP A;  4EDZ A;  2H76 A;  3IR4 A;  4KH7 A;  2RM5 A;  1A8Y A;  3TGZ A;  4DSS A;  4WBR D;  3CMI A;  3EYT A;  5DJM A;  3HDC A;  4OO4 A;  3UVT A;  2QC7 A;  1BED A;  3FYG A;  1DE1 A;  3VPT A;  4MMM A;  2FY6 A;  5E59 A;  3GKN A;  1ZL9 A;  1PMT A;  3M3M A;  12GS A;  2HE3 A;  4GXZ A;  4LMW A;  3KZQ A;  4I2T A;  3VWX A;  5B8A A;  2YWI A;  4K2D A;  1DSB A;  2K6V A;  3Q18 A;  3HYP A;  2I4A A;  3GMF A;  5F8B A;  3L4N A;  2BTO T;  1FVJ A;  2M46 A;  2CX4 A;  2RLI A;  5G2Z A;  4XRA A;  2N5F A;  3EMX A;  1HNA A;  5G1K A;  5DCG A;  3G9B A;  2O85 A;  2X8G A;  4G19 A;  2WFC A;  1M9B A;  2V1M A;  5J5N A;  3ZFB A;  2C1Y A;  4TOP A;  3FRC A;  4IJ3 A;  1A2M A;  3S9F A;  2FD3 A;  1OC9 B;  3G7J A;  2C0D A;  2MYG A;  2NDO A;  3A2W A;  4N0Z A;  3ZRE A;  3CSI A;  4V1A p;  3H93 A;  3F6F A;  5ECI B;  3F4S A;  5DJL A;  1FW1 A;  3F3Q A;  1A8L A;  5IO0 A;  4J56 E;  2VCT A;  1VGL A;  5D9T A;  5EVO A;  4G9H A;  5D96 A;  1T3B A;  2F8F A;  3FKF A;  1XIY A;  4JE1 A;  4L8E A;  4JR4 A;  3I69 A;  2BMX A;  16GS A;  2GQL A;  2LUS A;  1YF0 A;  2NTO A;  4AJ8 A;  1K0C A;  3N5O A;  4EKZ A;  2MBT A;  2PVO C;  2VAF A;  3WGD A;  2LNT A;  4E8H A;  8GSS A;  4ECJ A;  4JED A;  4AGS A;  3EC3 A;  1ZGN A;  2LS5 A;  4MZB A;  3IV4 A;  1A24 A;  1YY7 A;  5AIV A;  4MF7 A;  4PUA A;  4MCU A;  4MPF A;  4K0G A;  3O3T A;  2LQQ A;  2K8S A;  2ALB A;  2C8U A;  4MPG A;  1RK4 A;  5AIX A;  3M9J A;  1SK2 A;  3WT2 A;  4KCA A;  1T4Z A;  4ML1 A;  2BJX A;  2H6Y A;  1X9M B;  1HNC A;  2CVB A;  4AF2 A;  2A2S A;  4QQ7 A;  3ZRD A;  4MJC A;  4FH8 A;  3WYW A;  4TKY A;  4Q5F A;  2GGT A;  1V57 A;  4KGI A;  4XS4 A;  3SWL A;  5JCU A;  1TTZ A;  1BG5 A;  1XZO A;  1T00 A;  3BD2 A;  2H0H A;  4XRD A;  5ECO B;  6GSU A;  2NPB A;  1FB0 A;  1NSW A;  3EVI A;  4FYC A;  4BL7 A;  1MEK A;  5D8I A;  4KDU A;  2O89 A;  4F0B A;  3IK7 A;  3CTG A;  4CHS A;  2WB9 A;  3DYR A;  2B1K A;  3M0F A;  3LJR A;  3DGQ A;  7GSS A;  3L9U A;  2C0E A;  4WF5 A;  1G7E A;  14GS A;  2P0G A;  1ZOF A;  5D9W A;  1QK8 A;  4XTS A;  2GZP A;  5KN1 A;  1FG4 A;  4WET A;  1XOA A;  3D5J A;  2V32 A;  3PR8 A;  1TKD B;  1Y25 A;  4PQ1 A;  3AY8 A;  1EGO A;  1A0F A;  2LRN A;  1TRV A;  4GST A;  1U88 A;  2GZY A;  5E4W A;  4TRX A;  3TJF A;  4PXO A;  2L6C A;  2MMN A;  3FR3 A;  3LYP A;  1FVK A;  1KBN A;  5IMA A;  3GN3 A;  5CRH A;  4F0C A;  3ZIJ A;  2LNS A;  2WCI A;  3DRN A;  11GS A;  3LOR A;  1DBY A;  1WRY A;  3RPN A;  3E3E A;  4ZL9 A;  2JU5 A;  5IMZ A;  3ERW A;  4L5L A;  4OD7 A;  3GTU A;  2HRN A;  3EU4 A;  2QGV A;  1OKT A;  1M0U A;  1UA5 A;  3VI5 A;  1IYI A;  4FYB A; 
#chains in the Genus database with same CATH topology
 2C4J A;  2IME A;  5IMV A;  1Z6N A;  2K9F A;  2JAD A;  2VLT A;  1PN9 A;  4MH3 A;  5G31 A;  4Q5N A;  3KGK A;  1PGT A;  2KP1 A;  3KJY A;  3GSS A;  1V2A A;  2GDR A;  1GLQ A;  4YQU A;  2HZE B;  4MJA A;  6GSW A;  2HNL A;  2GLR A;  2IIY A;  13GS A;  2YP6 A;  1USB A;  3LW9 A;  1FOH A;  2DJ0 A;  4PQI A;  5CAX A;  1R4W A;  4F82 A;  5ECP B;  2L4C A;  3F9U A;  1O85 A;  2XPE A;  3TRX A;  4Q5Q A;  5ECK B;  3ZIV A;  5DQS A;  5C00 A;  3VWV A;  3GKX A;  3TJB A;  4NAX A;  2AJQ B;  3IE3 A;  1YKA A;  4NPB A;  2AUV A;  4ZXG A;  1YZX A;  2C0F A;  1VF1 A;  4WEY A;  3QAW A;  1J9B A;  2VOC A;  1HNB A;  1M2D A;  4EE0 A;  3IC4 A;  2R0P A;  3BBY A;  3MNG A;  3QOU A;  3QR6 A;  4O32 A;  5G5E A;  4GRF A;  2IFQ B;  1QXH A;  2X8C A;  4X1U A;  4IQ1 A;  4ACS A;  2B7J A;  2LJR A;  3QD9 A;  4K7N A;  1GP1 A;  3NIV A;  2L5L A;  5ABR A;  4HJM A;  3IAM 2;  1JZW A;  2OE0 A;  4N10 A;  3E0U A;  1Z6M A;  2H1A A;  1EV4 A;  1GNW A;  3EU3 A;  3BCI A;  3MSZ A;  2FUG 2;  2L4Q A;  2V6O A;  3GH6 A;  5IO2 A;  2ES7 A;  4PTS A;  4Z2T A;  1V98 A;  1EP8 A;  1GSE A;  2OBI A;  3R2Q A;  3EIN A;  5D9V A;  4I5Q A;  4IKH A;  1MD3 A;  2I3Y A;  2I1U A;  4E8E A;  1GL8 A;  3APS A;  3TJJ A;  5KN3 A;  4BA7 A;  1X9W B;  2H01 A;  4HZ4 A;  3A5W A;  3LXT A;  2A4V A;  2PMT A;  3H79 A;  4WKW A;  4OO5 A;  1T7P B;  4K9Z A;  3K8N A;  4EUY A;  1TI3 A;  4YQM A;  3QAG A;  4FO5 A;  4GWR A;  3F4R A;  5CRW A;  2H75 A;  5B8B A;  5G1L A;  3DVX A;  2H74 A;  3HZ4 A;  2GSQ A;  3C8E A;  1J08 A;  3HA9 A;  5DBQ A;  5ELA A;  2CAQ A;  2R6K A;  3TKP A;  1U3A A;  5H5Q A;  3RHC A;  3MWH A;  2VCV A;  4I8B A;  2KOK A;  2HT9 A;  3F3R A;  2L59 A;  2H0I A;  4POL A;  4CY6 A;  2DIY A;  4BL7 B;  1TK5 B;  3DXB A;  5D93 A;  1PA3 A;  2CQ9 A;  4FQU A;  2QKE A;  1GSY A;  1URM A;  4BVY A;  4ZB9 A;  5HFK A;  3FHK A;  1GUK A;  2B5X A;  3APQ A;  3UOM A;  1AC1 A;  3IHG A;  3TKS C;  5GAN D;  3EUR A;  4L0U A;  2VCW A;  5D9X A;  4L0W A;  2DC5 A;  4ZB6 A;  3KTB A;  3IOS A;  2C3N A;  3TOT A;  5G30 A;  1T8E B;  3FZA A;  5CP1 A;  2H19 A;  5DAL A;  5B6M A;  5ID2 A;  4I97 A;  2C3Q A;  3NOF A;  1G6W A;  3Q6O A;  2LST A;  4KSO A;  2XBI A;  4X0X A;  3P7X A;  4PNG A;  4PNF A;  4POB A;  4EO3 A;  3P2A A;  3RBT A;  2WGR A;  1U87 A;  2B7K A;  1PKW A;  4MLY A;  5IOX A;  3J7Y k;  1ABA A;  3ISO A;  2ZCT A;  2LRT A;  2R3X A;  4ML6 A;  1SU9 A;  3HJO A;  1NHY A;  4TR3 A;  3VUR A;  2JSZ A;  4JBB A;  2RM6 A;  1K0B A;  4HU9 A;  4BVX A;  2DJ3 A;  3D4M A;  2FLS A;  2YPM A;  4PQH A;  5CO3 A;  2DIZ A;  1R5P A;  5H5S A;  2C0G A;  2AB6 A;  3TKQ A;  2J9H A;  3F8U A;  1Q98 A;  2X64 A;  3QFB C;  4CW9 A;  1B4P A;  4Z7X A;  3U6V A;  2TRC P;  3A2V A;  2PN8 A;  3DML A;  2MMA A;  4WF4 A;  1B8X A;  1GSS A;  4FYU A;  3ZL5 A;  2HRF A;  3TRP A;  1V9W A;  1N8J A;  3CRU A;  2VL2 C;  1YDK A;  4V2M A;  1SEN A;  3F4T A;  4K7O A;  2VCZ A;  3IRA A;  1ZYQ B;  4NV2 A;  4DVC A;  1O73 A;  2VIM A;  1RQM A;  2FCH A;  2J23 A;  5IPG A;  4Z2U A;  4K5R A;  4XHM A;  3D21 A;  2VD0 A;  3RAZ A;  4QL9 A;  3ZML A;  1XCC A;  3ZYW A;  5B7C A;  1T1V A;  1NM3 A;  3HCZ A;  4LL1 B;  3W6G A;  1KNG A;  5H5R A;  2HSM A;  2H70 A;  2FWE A;  3IK9 A;  1GTA A;  3HVS A;  2WUL A;  3FW2 A;  5ECM B;  4HJ2 A;  4LLR A;  2VM1 A;  5ECQ B;  1OYJ A;  3ME8 A;  1I9D A;  3RPP A;  2EIO A;  2DJ1 A;  2V6K A;  2PU9 C;  4G0I A;  2GTU A;  2GVP A;  5HR0 A;  5B6N A;  5C04 A;  1KTE A;  4V1A g;  4OMV A;  2OBK A;  2DJK A;  2B5Y A;  2KP2 A;  2FGX A;  4NV5 A;  5J4U A;  6GSY A;  1M7T A;  3RDW A;  1AUC A;  1ZYP A;  1S3R A;  4JZQ A;  2X4A A;  5FHI A;  1ML6 A;  1TU7 A;  4ILF A;  4OWY A;  4HOJ A;  3ZVJ D;  4AJ7 A;  2GS3 A;  4OFT A;  3A2X A;  2MZC A;  1JLV A;  3KP8 A;  3TKR A;  4IS0 A;  1CQH A;  4IBP A;  3SBC A;  1ERU A;  2VO4 A;  20GS A;  4GSS A;  2CV4 A;  5ECN B;  2YZH A;  4PUF C;  1F3B A;  2A4H A;  2MMO A;  1SL2 B;  4IP1 A;  3UAR A;  1EEM A;  5CYY A;  1F3A A;  1ZCP A;  2WDU A;  4TR1 A;  2GT5 A;  1WP0 A;  4MZC A;  5EL8 A;  1MD4 A;  2IMF A;  5GZZ B;  2O8V B;  1DUG A;  2V41 A;  2YJH A;  4KND A;  3HY2 A;  1K3Y A;  3PH9 A;  4RQX A;  3RHB A;  1WPI A;  1K0O A;  3J7Y b;  4MP4 A;  2IWT A;  3D0Z A;  4POK A;  4YH2 A;  3GRX A;  4IJI A;  2QA2 A;  5J41 A;  5IMC A;  1PL1 A;  1GNE A;  2YN1 A;  2H0G A;  4ZBA A;  4TN8 A;  4MZW A;  1WMJ A;  4ZL8 A;  3TRQ A;  4BVY B;  1QQ2 A;  1E6B A;  2X8H A;  2I9H A;  3C73 A;  5CRE A;  2QSI A;  3L78 A;  1EWX A;  1XWC A;  2X49 A;  4KDY A;  1CQG A;  2E0Q A;  3KTL A;  1B9X C;  3H1N A;  4GSN A;  4EXJ A;  3IHQ A;  2NBS A;  2HLS A;  4IVF A;  4TR4 A;  4NWY A;  3EWL A;  3GUR A;  1AQX A;  1FO5 A;  1IYH A;  3FR9 A;  3TKS A;  2AAW A;  4DSS B;  2PUK C;  1YEP A;  3GX0 A;  1THX A;  3N9J A;  2PER A;  5JCG A;  3KD0 A;  3HZ8 A;  3US3 A;  2H8L A;  1EV9 A;  3ZVJ A;  2P5R A;  3VK9 A;  2LJA A;  3VI7 A;  5ENU A;  4O7H A;  5IMD A;  2M80 A;  5IQY A;  1FHE A;  3DIE A;  1XWK A;  3GKK A;  4O5R A;  4NXI A;  4N11 A;  4HSC X;  1G6Y A;  3CQF A;  4BWQ A;  4ECC A;  3L0H A;  1R5A A;  2JL4 A;  1SD9 A;  2JAC A;  3GUS A;  1EZK A;  4LA1 A;  3QAV A;  4FIW A;  2GSS A;  3ZZX A;  2DMM A;  3DKS A;  1Z5Y E;  1JHB A;  4H86 A;  1XW6 A;  2B6M A;  2TRX A;  3HVV A;  3GHA A;  2OAD A;  1ERT A;  1O81 A;  1PFO A;  4RUV A;  1TRW A;  4JRR A;  2XC2 A;  5F0G A;  1M99 A;  3P8W A;  1OC9 A;  2LJK A;  5DVB A;  4EC0 A;  3I43 A;  4ID0 A;  3ZMK A;  5HQP A;  1X5D A;  4HZ2 A;  3APO A;  4OFM A;  2ZNM A;  4DEJ A;  3ERG A;  3TJG A;  4MAB A;  1SD8 A;  4GLT A;  1VF2 A;  2G0F A;  1SL0 B;  1SKW B;  2YWN A;  1B9Y C;  3H8Q A;  2CVK A;  2G2Q A;  2H30 A;  1Y6E A;  2VL9 A;  2RII A;  1XW5 A;  3LFL A;  4F03 A;  4V2N A;  1Z3E A;  5IPH A;  4LMV A;  4PX1 A;  3FY7 A;  3MYD A;  2VCQ A;  1Z7R A;  2ON7 A;  3HJM A;  2HZF A;  2RUE A;  5ELG A;  2XHF A;  1OC8 A;  2A2R A;  2F9S A;  3KCM A;  4KSM A;  4GCI A;  1B4Q A;  3QPM A;  1V40 A;  1PX7 A;  4NHZ A;  4OCE A;  2PVQ A;  1A0R P;  5A4V A;  5JWQ B;  1AIU A;  3TOU A;  2WS2 A;  3DD3 A;  1M9A A;  1X0R A;  4WR5 A;  5BRT A;  2L57 A;  1XWB A;  3FZ5 A;  4ZBB A;  1YJ6 A;  2H66 A;  1EOH A;  1RW1 A;  1BYE A;  2GQM A;  2YWO A;  1XW9 A;  1OKD A;  5IM9 A;  4ICY A;  3PIN A;  3L9V A;  4YQV A;  2EIQ A;  2IMD A;  1GTB A;  1ILO A;  2HSH A;  1R26 A;  2PGT A;  3FK8 A;  2CZ3 A;  2YJ7 A;  1LBK A;  4IP6 A;  4XS4 B;  4EVM A;  4KE3 A;  1T4Y A;  1GWC A;  4PUR A;  3EE2 A;  2JZR A;  3FEU A;  4DSR A;  2H73 A;  3U5R E;  1ERW A;  1XOB A;  4D73 A;  1KEB A;  4AJ6 A;  2Z9S A;  4TR1 B;  3KXO A;  2L5O A;  3CRT A;  2R4V A;  4DSQ A;  1GUM A;  1JZO A;  5ECS A;  9GSS A;  2IJY A;  2YCD A;  1TDI A;  2FNO A;  5DQY A;  3IA1 A;  2F8A A;  4K8M A;  3L9S A;  1MTC A;  4X43 A;  2ZUP A;  1ON4 A;  3FR6 A;  1G7O A;  4HUA A;  5DCH A;  1PKZ A;  4WBJ A;  4ZB8 A;  1J0F A;  4IW9 A;  2YZU A;  1SJ6 A;  3GNJ A;  4MH2 A;  3GFK A;  5LD0 A;  1K0A A;  3IAS 2;  1EOG A;  1YF1 A;  1X5E A;  3D22 A;  1S3C A;  3GST A;  2B5E A;  4KW6 A;  1SKS B;  4LL4 B;  2N5B A;  2GT6 A;  4G10 A;  3HHV A;  1AAZ A;  2VL3 A;  19GS A;  1SJZ A;  4IQA A;  4XS6 A;  3KIJ A;  1X5C A;  2JZS A;  4N0V A;  4HQS A;  1GTU A;  1UN2 A;  17GS A;  3HXS A;  4RI6 A;  4EIP A;  3KH7 A;  1F37 A;  3WGE A;  1VF4 A;  1AXD A;  4BPY A;  4MF5 A;  2XBQ A;  2ON5 A;  3EMP A;  4Q5R A;  1LU4 A;  1WJK A;  1K0M A;  1F6M C;  3UBK A;  1GUL A;  2N5A A;  2VLV A;  6GST A;  1DE2 A;  2EIR A;  1TJD A;  3LQ7 A;  1M2B A;  3GTU B;  1G0T A;  1BJX A;  3CYN A;  5CRD A;  4KB3 A;  1HD2 A;  1PX6 A;  2HXK A;  4ZBD A;  4ZL7 A;  4CDO A;  2DSA A;  1M3I A;  2B1L A;  2OA7 A;  1TI1 A;  1YQ1 A;  1WE0 A;  4O92 A;  4K2X A;  2DKH A;  5HR1 A;  1X9S B;  1M2A A;  2WJU A;  3IXR A;  4IHU A;  2IL3 A;  4O5Q A;  1NHO A;  3W8S A;  2HZE A;  3TDG A;  4IN0 A;  1W4V A;  3C1R A;  4F2I A;  1F9M A;  4TVE A;  4TXO A;  4G2E A;  3FZ4 A;  3M9K A;  3GX8 A;  1QUW A;  1JLW A;  4CY8 A;  1QGV A;  3A5I A;  3VWW A;  1UVZ A;  3C1S A;  3DWV A;  2D2Z A;  4I6X A;  5JWR B;  1WIK A;  2LRC A;  3UIW A;  1R7H A;  1MDJ A;  4J2F A;  1H4O A;  4MK3 A;  2R2J A;  1OVN A;  1UC7 A;  3BOA A;  2VM2 A;  2VD1 A;  5KN2 A;  3ZLP A;  3OR5 A;  2C3T A;  1TXX A;  2LKU A;  1NW2 A;  3UJ1 A;  4GF0 A;  4HI7 A;  3O6T A;  3Q74 A;  2R37 A;  5L71 A;  3BJ5 A;  1JZR A;  1O6J A;  2O7K A;  3GL3 A;  5J9B A;  2LQO A;  4ECI A;  3CSJ A;  4POM A;  2KHP A;  3VFI A;  1XBS A;  2YWM A;  1ZMA A;  5AGY A;  3GYK A;  2AYT A;  2IFQ A;  3WT1 A;  1TW9 A;  5CNW A;  5EPF A;  1GSQ A;  4WR4 A;  3GIX A;  3GV1 A;  5KEJ A;  2E2M A;  2K18 A;  2H6X A;  3F6D A;  1XG8 A;  2H71 A;  1BAY A;  3UBL A;  2MMZ A;  6GSX A;  2RUF A;  3BCK A;  4HQZ A;  5JWO B;  2CAI A;  3HVX A;  2WRT A;  3KMO A;  4ZIL A;  3UAP A;  2LV3 A;  3M8N A;  2O87 A;  5KN0 A;  5ECL B;  5A4U A;  1THO A;  1PQN A;  2LEG A;  3KMN A;  1A2L A;  2IMK A;  1O7U A;  1N2A A;  1K0D A;  1XVQ A;  1JZD A;  3VPQ A;  3TCO A;  1FB6 A;  4IGJ A;  5J9C A;  5KOW A;  3HKR A;  2OKA A;  4TW5 A;  1XXU A;  2JZT A;  3F0I A;  1LJR A;  4HS1 A;  4EF0 A;  2AHE A;  4K1F A;  2YV9 A;  4PGT A;  3KH9 A;  4KX4 A;  3A3T A;  2GSR A;  1OE7 A;  2FWG A;  4JR6 A;  2C80 A;  4K6X A;  4MNN A;  5KOX A;  4K0N A;  3ED3 A;  4HU7 A;  2PBJ A;  2AV4 A;  1M3J A;  1F2E A;  3TJK A;  4NMU A;  3ERF A;  4EIQ A;  4I2U A;  2K8V A;  2MBS A;  5LNK e;  4MA9 A;  3W8J A;  1TU8 A;  3HD5 A;  5DAK A;  1ZYE A;  1ERV A;  1GSU A;  4ULX A;  1U6T A;  1BQ7 A;  2E7P A;  1JFU A;  2YAN A;  4RI7 A;  4D73 B;  4KA0 A;  4TR0 A;  1BX9 A;  3LWA A;  4KDX A;  2VUP A;  3WD6 A;  1YEX A;  1HQO A;  5IOW A;  1XPV A;  1FAA A;  2H1B A;  4MJB A;  2FHE A;  2GZZ A;  5HFI A;  3I9V 2;  3M1G A;  1U3I A;  2H1G A;  2R0G A;  3G7I A;  3JCM L;  3IC8 A;  1SL1 B;  1XVW A;  4G0L A;  3D6I A;  1K3L A;  3G7Y A;  2CX3 A;  1HYU A;  4USS A;  3VLN A;  1K0N A;  2PPT A;  3ZFL A;  3WGX A;  1TOF A;  1I5G A;  4J57 E;  3CXG A;  3TB2 A;  5HR2 A;  5FWG A;  1O8W A;  1PD2 1;  4L5O A;  1A23 A;  1PSQ A;  1XWG A;  4KF9 A;  4XIH A;  3LG6 A;  1YKC A;  1FOV A;  4ISD A;  5DAL B;  1QFN A;  3LSZ A;  5ID2 B;  4YAV A;  2R5G A;  2TIR A;  2GST A;  3H4K A;  1GH2 A;  1W89 A;  4HDE A;  1XFL A;  4KAE A;  3MDK A;  1WWJ A;  3UVH A;  5EY6 A;  4XCS A;  1B48 A;  1E2Y A;  5HFG A;  4NHW A;  4V2L A;  3GA4 A;  3FZ9 A;  22GS A;  2DJ2 A;  1SK1 A;  1V58 A;  3IPZ A;  5AN1 A;  2KLX A;  2HYX A;  3C71 A;  4BVX B;  4MDC A;  2P5Q A;  5IMF A;  1EGR A;  2F3M A;  2EC4 A;  3UEM A;  4GTU A;  4Z2R A;  3KM6 A;  3ME7 A;  1TRU A;  3P90 A;  4TXV A;  2DBC A;  2F51 A;  3TUE A;  4YAP A;  2H6Z A;  4TXO B;  1AQW A;  2OE3 A;  2FA4 A;  4ZIJ A;  4OCF A;  1MDI A;  5CRG A;  1GLP A;  1GSD A;  3C7M A;  4K7I A;  3ZTL A;  3QFA C;  5D73 A;  1AW9 A;  2PWJ A;  2M72 A;  4GQC A;  5F05 A;  4OFN A;  1GTI A;  2HI7 A;  5GAP D;  2GQK A;  6GSS A;  2CA8 A;  1PL2 A;  4P3Y B;  2VL2 A;  3F63 A;  3DEX A;  1Z9H A;  2JSY A;  2CVD A;  3QMX A;  4O5U A;  2P31 A;  5LCZ A;  2X99 A;  5J3R A;  2I81 A;  5G5F A;  2H72 A;  1VRS D;  3KEB A;  1O8X A;  1PRX A;  2DML A;  5GST A;  5INY A;  3LGC A;  2HSY A;  2FWF A;  2YV7 A;  4QL7 A;  2NVL A;  1TK8 B;  2YNX A;  2E2G A;  4KUN A;  5DDL A;  1WOU A;  3R3E A;  1C72 A;  1XWA A;  4JU5 A;  2IN3 A;  5FT3 A;  1AQV A;  1SKR B;  3LYK A;  2DKI A;  1GRX A;  4EL1 A;  2OAC A;  1ZZY A;  3ZIT A;  3CTF A;  2L6D A;  2B3S A;  3UMA A;  4HEA 2;  3CSH A;  5IIZ A;  4MJE A;  2IMI A;  1EEJ A;  1ACV A;  1A2J A;  2FWH A;  2IPA A;  2VCX A;  2CT6 A;  3EPT A;  3I6A A;  4A5P A;  5GSS A;  1MDK A;  1GSF A;  1EP7 A;  4RQR A;  3GH9 A;  3GKM A;  5ECH B;  2KUC A;  3KP9 A;  5F07 A;  1Q4J A;  10GS A;  1SYR A;  2LTK A;  1QMV A;  4MF6 A;  1K3O A;  1TP9 A;  1TRS A;  4KCE A;  2CZ2 A;  1GUH A;  2WZ9 A;  5HR3 A;  4IEL A;  1SK0 A;  2V2G A;  1H75 A;  3VWU A;  1S3A A;  3UL3 A;  3HVN A;  1ST9 A;  2HFD A;  3DVW A;  3IDV A;  3Q19 A;  3QDN A;  4WXT A;  6GSV A;  2DLX A;  1OAZ A;  3CBU A;  5A4W A;  3HJP A;  2VLU A;  3IBH A;  1Z7P A;  2OJL A;  5AIS A;  5DAK B;  5COH A;  1SYX A;  4BWS A;  4N30 A;  3PGT A;  5ECR B;  2REM A;  4XS1 A;  2DJJ A;  3MAK A;  4F9Z A;  3FMW A;  18GS A;  3D4T A;  5JCW A;  2YOI A;  3E9J B;  3LEF A;  1OE8 A;  3O76 A;  4ECB A;  1SJI A;  3NZN A;  4EDY A;  2OE1 A;  2XPD A;  1VF3 A;  3TKS E;  3GL5 A;  1OC3 A;  2FA8 A;  1S3D A;  2H1D A;  3V1W A;  5F06 A;  4GQF A;  3LXZ A;  1TK0 B;  5A5K A;  3QCP A;  4EDZ A;  2H76 A;  3IR4 A;  4KH7 A;  2RM5 A;  1A8Y A;  3TGZ A;  4DSS A;  4WBR D;  3CMI A;  3EYT A;  5DJM A;  3HDC A;  4OO4 A;  3UVT A;  2QC7 A;  1BED A;  3FYG A;  1DE1 A;  2HRA A;  3VPT A;  4MMM A;  2FY6 A;  4X4J A;  5E59 A;  3GKN A;  1ZL9 A;  1PMT A;  3M3M A;  12GS A;  2HE3 A;  4GXZ A;  4LMW A;  2A2P A;  3KZQ A;  4I2T A;  3VWX A;  1ZYN A;  5B8A A;  2YWI A;  4K2D A;  1DSB A;  4BIK A;  2K6V A;  3Q18 A;  3HYP A;  2I4A A;  3GMF A;  5F8B A;  3L4N A;  2BTO T;  1FVJ A;  2M46 A;  2CX4 A;  2RLI A;  5G2Z A;  4XRA A;  2N5F A;  3EMX A;  1HNA A;  5G1K A;  5DCG A;  3G9B A;  2O85 A;  2X8G A;  5BMU A;  4G19 A;  2WFC A;  1M9B A;  2V1M A;  5J5N A;  3ZFB A;  2C1Y A;  4TOP A;  3FRC A;  4IJ3 A;  1A2M A;  3S9F A;  2FD3 A;  1OC9 B;  3G7J A;  2C0D A;  2MYG A;  2NDO A;  3A2W A;  4N0Z A;  3ZRE A;  3CSI A;  4V1A p;  3H93 A;  3F6F A;  5ECI B;  3F4S A;  5DJL A;  1FW1 A;  3F3Q A;  1A8L A;  5IO0 A;  4J56 E;  2VCT A;  1VGL A;  5D9T A;  5EVO A;  4G9H A;  5D96 A;  1T3B A;  2F8F A;  3FKF A;  1XIY A;  4JE1 A;  4L8E A;  4JR4 A;  3I69 A;  2BMX A;  16GS A;  2GQL A;  2LUS A;  1YF0 A;  2NTO A;  4AJ8 A;  1K0C A;  3N5O A;  4EKZ A;  2MBT A;  2PVO C;  2VAF A;  3WGD A;  2LNT A;  4E8H A;  8GSS A;  4ECJ A;  4JED A;  4AGS A;  3EC3 A;  1ZGN A;  2LS5 A;  4MZB A;  3IV4 A;  1A24 A;  1YY7 A;  5AIV A;  4MF7 A;  4PUA A;  4MCU A;  4MPF A;  2R0C A;  4K0G A;  3O3T A;  2LQQ A;  2K8S A;  4YKF A;  2ALB A;  2C8U A;  4MPG A;  1RK4 A;  5AIX A;  3M9J A;  1SK2 A;  3WT2 A;  4KCA A;  1T4Z A;  4ML1 A;  2BJX A;  2H6Y A;  1X9M B;  1HNC A;  2CVB A;  2QA1 A;  2A2S A;  4QQ7 A;  4AF2 A;  3ZRD A;  4MJC A;  4FH8 A;  3WYW A;  4TKY A;  1PN0 A;  2UZ8 A;  4Q5F A;  2GGT A;  1V57 A;  4KGI A;  4XS4 A;  3SWL A;  5JCU A;  1TTZ A;  1BG5 A;  3MIX A;  1XZO A;  1T00 A;  3BD2 A;  2H0H A;  4XRD A;  5ECO B;  6GSU A;  2NPB A;  1FB0 A;  1NSW A;  3EVI A;  4FYC A;  4BL7 A;  1MEK A;  5D8I A;  4KDU A;  2O89 A;  4F0B A;  3IK7 A;  3CTG A;  3PPU A;  4CHS A;  2WB9 A;  3DYR A;  2B1K A;  3M0F A;  3LJR A;  3DGQ A;  7GSS A;  4YKG A;  3L9U A;  2C0E A;  4WF5 A;  1G7E A;  14GS A;  2P0G A;  1ZOF A;  2HRK A;  5D9W A;  1QK8 A;  4XTS A;  2GZP A;  5KN1 A;  1FG4 A;  4WET A;  1XOA A;  3D5J A;  2V32 A;  3PR8 A;  1TKD B;  1Y25 A;  4PQ1 A;  3AY8 A;  1EGO A;  1A0F A;  2LRN A;  1TRV A;  4GST A;  1U88 A;  2GZY A;  5E4W A;  4TRX A;  3TJF A;  4PXO A;  4K5S A;  2L6C A;  2MMN A;  3FR3 A;  3LYP A;  1FVK A;  1KBN A;  5IMA A;  3GN3 A;  5CRH A;  4F0C A;  3ZIJ A;  2LNS A;  2WCI A;  3DRN A;  11GS A;  3LOR A;  1DBY A;  1WRY A;  3RPN A;  3E3E A;  4ZL9 A;  2JU5 A;  5IMZ A;  3ERW A;  4L5L A;  4OD7 A;  3GTU A;  2HRN A;  3EU4 A;  2QGV A;  1OKT A;  1M0U A;  1UA5 A;  3VI5 A;  1IYI A;  4G0K A;  4FYB A; 
#chains in the Genus database with same CATH homology
 2C4J A;  2IME A;  5IMV A;  1Z6N A;  2K9F A;  2JAD A;  2VLT A;  1PN9 A;  4MH3 A;  5G31 A;  4Q5N A;  3KGK A;  1PGT A;  2KP1 A;  3KJY A;  3GSS A;  1V2A A;  2GDR A;  1GLQ A;  4YQU A;  2HZE B;  4MJA A;  6GSW A;  2HNL A;  2GLR A;  2IIY A;  13GS A;  2YP6 A;  1USB A;  3LW9 A;  1FOH A;  2DJ0 A;  4PQI A;  5CAX A;  1R4W A;  4F82 A;  5ECP B;  2L4C A;  3F9U A;  1O85 A;  2XPE A;  3TRX A;  4Q5Q A;  5ECK B;  3ZIV A;  5DQS A;  5C00 A;  3VWV A;  3GKX A;  3TJB A;  4NAX A;  2AJQ B;  3IE3 A;  1YKA A;  4NPB A;  2AUV A;  4ZXG A;  1YZX A;  2C0F A;  1VF1 A;  4WEY A;  3QAW A;  1J9B A;  2VOC A;  1HNB A;  1M2D A;  4EE0 A;  3IC4 A;  2R0P A;  3BBY A;  3MNG A;  3QOU A;  3QR6 A;  4O32 A;  5G5E A;  4GRF A;  2IFQ B;  1QXH A;  2X8C A;  4X1U A;  4IQ1 A;  4ACS A;  2B7J A;  2LJR A;  3QD9 A;  4K7N A;  1GP1 A;  3NIV A;  2L5L A;  5ABR A;  4HJM A;  3IAM 2;  1JZW A;  2OE0 A;  4N10 A;  3E0U A;  1Z6M A;  2H1A A;  1EV4 A;  1GNW A;  3EU3 A;  3BCI A;  3MSZ A;  2FUG 2;  2L4Q A;  2V6O A;  3GH6 A;  5IO2 A;  2ES7 A;  4PTS A;  4Z2T A;  1V98 A;  1EP8 A;  1GSE A;  2OBI A;  3R2Q A;  3EIN A;  5D9V A;  4I5Q A;  4IKH A;  1MD3 A;  2I3Y A;  2I1U A;  4E8E A;  1GL8 A;  3APS A;  3TJJ A;  5KN3 A;  4BA7 A;  1X9W B;  2H01 A;  4HZ4 A;  3A5W A;  3LXT A;  2A4V A;  2PMT A;  3H79 A;  4WKW A;  4OO5 A;  1T7P B;  4K9Z A;  3K8N A;  4EUY A;  1TI3 A;  4YQM A;  3QAG A;  4FO5 A;  4GWR A;  3F4R A;  5CRW A;  2H75 A;  5B8B A;  5G1L A;  3DVX A;  2H74 A;  3HZ4 A;  2GSQ A;  3C8E A;  1J08 A;  3HA9 A;  5DBQ A;  5ELA A;  2CAQ A;  2R6K A;  3TKP A;  1U3A A;  5H5Q A;  3RHC A;  3MWH A;  2VCV A;  4I8B A;  2KOK A;  2HT9 A;  3F3R A;  2L59 A;  2H0I A;  4POL A;  4CY6 A;  2DIY A;  4BL7 B;  1TK5 B;  3DXB A;  5D93 A;  1PA3 A;  2CQ9 A;  4FQU A;  2QKE A;  1GSY A;  1URM A;  4BVY A;  4ZB9 A;  5HFK A;  3FHK A;  1GUK A;  2B5X A;  3APQ A;  3UOM A;  1AC1 A;  3IHG A;  3TKS C;  5GAN D;  3EUR A;  4L0U A;  2VCW A;  5D9X A;  4L0W A;  2DC5 A;  4ZB6 A;  3KTB A;  3IOS A;  2C3N A;  3TOT A;  5G30 A;  1T8E B;  3FZA A;  5CP1 A;  2H19 A;  5DAL A;  5B6M A;  5ID2 A;  4I97 A;  2C3Q A;  3NOF A;  1G6W A;  3Q6O A;  2LST A;  4KSO A;  2XBI A;  4X0X A;  3P7X A;  4PNG A;  4PNF A;  4POB A;  4EO3 A;  3P2A A;  3RBT A;  2WGR A;  1U87 A;  2B7K A;  1PKW A;  4MLY A;  5IOX A;  3J7Y k;  1ABA A;  3ISO A;  2ZCT A;  2LRT A;  2R3X A;  4ML6 A;  1SU9 A;  3HJO A;  1NHY A;  4TR3 A;  3VUR A;  2JSZ A;  4JBB A;  2RM6 A;  1K0B A;  4HU9 A;  4BVX A;  2DJ3 A;  3D4M A;  2FLS A;  2YPM A;  4PQH A;  5CO3 A;  2DIZ A;  1R5P A;  5H5S A;  2C0G A;  2AB6 A;  3TKQ A;  2J9H A;  3F8U A;  1Q98 A;  2X64 A;  3QFB C;  4CW9 A;  1B4P A;  4Z7X A;  3U6V A;  2TRC P;  3A2V A;  2PN8 A;  3DML A;  2MMA A;  4WF4 A;  1B8X A;  1GSS A;  4FYU A;  3ZL5 A;  2HRF A;  3TRP A;  1V9W A;  1N8J A;  3CRU A;  2VL2 C;  1YDK A;  4V2M A;  1SEN A;  3F4T A;  4K7O A;  2VCZ A;  3IRA A;  1ZYQ B;  4NV2 A;  4DVC A;  1O73 A;  2VIM A;  1RQM A;  2FCH A;  2J23 A;  5IPG A;  4Z2U A;  4K5R A;  4XHM A;  3D21 A;  2VD0 A;  3RAZ A;  4QL9 A;  3ZML A;  1XCC A;  3ZYW A;  5B7C A;  1T1V A;  1NM3 A;  3HCZ A;  4LL1 B;  3W6G A;  1KNG A;  5H5R A;  2HSM A;  2H70 A;  2FWE A;  3IK9 A;  1GTA A;  3HVS A;  2WUL A;  3FW2 A;  5ECM B;  4HJ2 A;  4LLR A;  2VM1 A;  5ECQ B;  1OYJ A;  3ME8 A;  1I9D A;  3RPP A;  2EIO A;  2DJ1 A;  2V6K A;  2PU9 C;  4G0I A;  2GTU A;  2GVP A;  5HR0 A;  5B6N A;  5C04 A;  1KTE A;  4V1A g;  4OMV A;  2OBK A;  2DJK A;  2B5Y A;  2KP2 A;  2FGX A;  4NV5 A;  5J4U A;  6GSY A;  1M7T A;  3RDW A;  1AUC A;  1ZYP A;  4JZQ A;  2X4A A;  5FHI A;  1ML6 A;  1TU7 A;  4ILF A;  4OWY A;  4HOJ A;  3ZVJ D;  4AJ7 A;  2GS3 A;  4OFT A;  3A2X A;  2MZC A;  1JLV A;  3KP8 A;  3TKR A;  4IS0 A;  1CQH A;  4IBP A;  3SBC A;  1ERU A;  2VO4 A;  20GS A;  4GSS A;  2CV4 A;  5ECN B;  2YZH A;  4PUF C;  1F3B A;  2A4H A;  2MMO A;  1SL2 B;  4IP1 A;  3UAR A;  1EEM A;  5CYY A;  1F3A A;  1ZCP A;  2WDU A;  4TR1 A;  2GT5 A;  1WP0 A;  4MZC A;  5EL8 A;  1MD4 A;  2IMF A;  5GZZ B;  2O8V B;  1DUG A;  2V41 A;  2YJH A;  4KND A;  3HY2 A;  1K3Y A;  3PH9 A;  4RQX A;  3RHB A;  1WPI A;  1K0O A;  3J7Y b;  4MP4 A;  2IWT A;  3D0Z A;  4POK A;  4YH2 A;  3GRX A;  4IJI A;  2QA2 A;  5J41 A;  5IMC A;  1PL1 A;  1GNE A;  2YN1 A;  2H0G A;  4ZBA A;  4TN8 A;  4MZW A;  1WMJ A;  4ZL8 A;  3TRQ A;  4BVY B;  1QQ2 A;  1E6B A;  2X8H A;  2I9H A;  3C73 A;  5CRE A;  2QSI A;  3L78 A;  1EWX A;  1XWC A;  2X49 A;  4KDY A;  1CQG A;  2E0Q A;  3KTL A;  1B9X C;  3H1N A;  4GSN A;  4EXJ A;  3IHQ A;  2NBS A;  2HLS A;  4IVF A;  4TR4 A;  4NWY A;  3EWL A;  3GUR A;  1AQX A;  1FO5 A;  1IYH A;  3FR9 A;  3TKS A;  2AAW A;  4DSS B;  2PUK C;  1YEP A;  3GX0 A;  1THX A;  3N9J A;  2PER A;  5JCG A;  3KD0 A;  3HZ8 A;  3US3 A;  2H8L A;  1EV9 A;  3ZVJ A;  2P5R A;  3VK9 A;  2LJA A;  3VI7 A;  5ENU A;  4O7H A;  5IMD A;  2M80 A;  5IQY A;  1FHE A;  3DIE A;  1XWK A;  3GKK A;  4O5R A;  4NXI A;  4N11 A;  1G6Y A;  4BWQ A;  4ECC A;  3L0H A;  1R5A A;  2JL4 A;  1SD9 A;  2JAC A;  3GUS A;  1EZK A;  4LA1 A;  3QAV A;  4FIW A;  2GSS A;  3ZZX A;  2DMM A;  3DKS A;  1Z5Y E;  1JHB A;  4H86 A;  1XW6 A;  2B6M A;  2TRX A;  3HVV A;  3GHA A;  2OAD A;  1ERT A;  1O81 A;  4RUV A;  1TRW A;  4JRR A;  2XC2 A;  5F0G A;  1M99 A;  3P8W A;  1OC9 A;  2LJK A;  5DVB A;  4EC0 A;  3I43 A;  4ID0 A;  3ZMK A;  5HQP A;  1X5D A;  4HZ2 A;  3APO A;  4OFM A;  2ZNM A;  4DEJ A;  3ERG A;  3TJG A;  4MAB A;  1SD8 A;  4GLT A;  1VF2 A;  2G0F A;  1SL0 B;  1SKW B;  2YWN A;  1B9Y C;  3H8Q A;  2CVK A;  2G2Q A;  2H30 A;  1Y6E A;  2VL9 A;  2RII A;  1XW5 A;  3LFL A;  4F03 A;  4V2N A;  1Z3E A;  5IPH A;  4LMV A;  4PX1 A;  3FY7 A;  3MYD A;  2VCQ A;  1Z7R A;  2ON7 A;  3HJM A;  2HZF A;  2RUE A;  5ELG A;  2XHF A;  1OC8 A;  2A2R A;  2F9S A;  3KCM A;  4KSM A;  4GCI A;  1B4Q A;  3QPM A;  1V40 A;  1PX7 A;  4NHZ A;  4OCE A;  2PVQ A;  1A0R P;  5A4V A;  5JWQ B;  1AIU A;  3TOU A;  2WS2 A;  3DD3 A;  1M9A A;  1X0R A;  4WR5 A;  5BRT A;  2L57 A;  1XWB A;  3FZ5 A;  4ZBB A;  1YJ6 A;  2H66 A;  1EOH A;  1RW1 A;  1BYE A;  2GQM A;  2YWO A;  1XW9 A;  1OKD A;  5IM9 A;  4ICY A;  3PIN A;  3L9V A;  4YQV A;  2EIQ A;  2IMD A;  1GTB A;  1ILO A;  2HSH A;  1R26 A;  2PGT A;  3FK8 A;  2CZ3 A;  2YJ7 A;  1LBK A;  4IP6 A;  4XS4 B;  4EVM A;  4KE3 A;  1T4Y A;  1GWC A;  4PUR A;  3EE2 A;  2JZR A;  3FEU A;  4DSR A;  2H73 A;  3U5R E;  1ERW A;  1XOB A;  4D73 A;  1KEB A;  4AJ6 A;  2Z9S A;  4TR1 B;  3KXO A;  2L5O A;  3CRT A;  2R4V A;  4DSQ A;  1GUM A;  1JZO A;  5ECS A;  9GSS A;  2IJY A;  2YCD A;  1TDI A;  2FNO A;  5DQY A;  3IA1 A;  2F8A A;  4K8M A;  3L9S A;  1MTC A;  4X43 A;  2ZUP A;  1ON4 A;  3FR6 A;  1G7O A;  4HUA A;  5DCH A;  1PKZ A;  4WBJ A;  4ZB8 A;  1J0F A;  4IW9 A;  2YZU A;  1SJ6 A;  3GNJ A;  4MH2 A;  3GFK A;  5LD0 A;  1K0A A;  3IAS 2;  1EOG A;  1YF1 A;  1X5E A;  3D22 A;  1S3C A;  3GST A;  2B5E A;  4KW6 A;  1SKS B;  4LL4 B;  2N5B A;  2GT6 A;  4G10 A;  3HHV A;  1AAZ A;  2VL3 A;  19GS A;  1SJZ A;  4IQA A;  4XS6 A;  3KIJ A;  1X5C A;  2JZS A;  4N0V A;  4HQS A;  1GTU A;  1UN2 A;  17GS A;  3HXS A;  4RI6 A;  4EIP A;  3KH7 A;  1F37 A;  3WGE A;  1VF4 A;  1AXD A;  4BPY A;  4MF5 A;  2XBQ A;  2ON5 A;  3EMP A;  4Q5R A;  1LU4 A;  1WJK A;  1K0M A;  1F6M C;  3UBK A;  1GUL A;  2N5A A;  2VLV A;  6GST A;  1DE2 A;  2EIR A;  1TJD A;  1M2B A;  3LQ7 A;  3GTU B;  1G0T A;  1BJX A;  3CYN A;  5CRD A;  4KB3 A;  1HD2 A;  1PX6 A;  2HXK A;  4ZBD A;  4ZL7 A;  4CDO A;  2DSA A;  2B1L A;  2OA7 A;  1TI1 A;  1YQ1 A;  1WE0 A;  4O92 A;  4K2X A;  2DKH A;  5HR1 A;  1X9S B;  1M2A A;  2WJU A;  3IXR A;  4IHU A;  2IL3 A;  4O5Q A;  1NHO A;  3W8S A;  2HZE A;  3TDG A;  4IN0 A;  1W4V A;  3C1R A;  4F2I A;  1F9M A;  4TVE A;  4TXO A;  4G2E A;  3FZ4 A;  3M9K A;  3GX8 A;  1QUW A;  1JLW A;  4CY8 A;  1QGV A;  3A5I A;  3VWW A;  1UVZ A;  3C1S A;  3DWV A;  2D2Z A;  4I6X A;  5JWR B;  1WIK A;  2LRC A;  3UIW A;  1R7H A;  1MDJ A;  4J2F A;  1H4O A;  4MK3 A;  2R2J A;  1OVN A;  1UC7 A;  3BOA A;  2VM2 A;  2VD1 A;  5KN2 A;  3ZLP A;  3OR5 A;  2C3T A;  1TXX A;  2LKU A;  1NW2 A;  3UJ1 A;  4GF0 A;  4HI7 A;  3O6T A;  3Q74 A;  2R37 A;  5L71 A;  3BJ5 A;  1JZR A;  1O6J A;  2O7K A;  3GL3 A;  5J9B A;  2LQO A;  4ECI A;  3CSJ A;  4POM A;  2KHP A;  3VFI A;  1XBS A;  2YWM A;  1ZMA A;  5AGY A;  3GYK A;  2AYT A;  2IFQ A;  3WT1 A;  1TW9 A;  5CNW A;  5EPF A;  1GSQ A;  4WR4 A;  3GIX A;  3GV1 A;  5KEJ A;  2E2M A;  2K18 A;  2H6X A;  3F6D A;  2H71 A;  1BAY A;  3UBL A;  2MMZ A;  6GSX A;  2RUF A;  3BCK A;  4HQZ A;  5JWO B;  2CAI A;  3HVX A;  2WRT A;  3KMO A;  4ZIL A;  3UAP A;  2LV3 A;  3M8N A;  2O87 A;  5KN0 A;  5ECL B;  5A4U A;  1THO A;  1PQN A;  2LEG A;  3KMN A;  1A2L A;  2IMK A;  1O7U A;  1N2A A;  1K0D A;  1XVQ A;  1JZD A;  3VPQ A;  3TCO A;  1FB6 A;  4IGJ A;  5J9C A;  5KOW A;  3HKR A;  2OKA A;  4TW5 A;  1XXU A;  2JZT A;  3F0I A;  1LJR A;  4HS1 A;  4EF0 A;  2AHE A;  4K1F A;  2YV9 A;  4PGT A;  3KH9 A;  4KX4 A;  3A3T A;  2GSR A;  1OE7 A;  2FWG A;  4JR6 A;  2C80 A;  4K6X A;  4MNN A;  5KOX A;  4K0N A;  3ED3 A;  4HU7 A;  2PBJ A;  2AV4 A;  3TJK A;  1F2E A;  4NMU A;  3ERF A;  4EIQ A;  4I2U A;  2K8V A;  2MBS A;  5LNK e;  4MA9 A;  3W8J A;  1TU8 A;  3HD5 A;  5DAK A;  1ZYE A;  1ERV A;  1GSU A;  4ULX A;  1U6T A;  1BQ7 A;  2E7P A;  1JFU A;  2YAN A;  4RI7 A;  4D73 B;  4KA0 A;  4TR0 A;  1BX9 A;  3LWA A;  4KDX A;  2VUP A;  3WD6 A;  1YEX A;  1HQO A;  5IOW A;  1XPV A;  1FAA A;  2H1B A;  4MJB A;  2FHE A;  2GZZ A;  5HFI A;  3I9V 2;  3M1G A;  1U3I A;  2H1G A;  2R0G A;  3G7I A;  3JCM L;  3IC8 A;  1SL1 B;  1XVW A;  4G0L A;  3D6I A;  1K3L A;  3G7Y A;  2CX3 A;  1HYU A;  4USS A;  3VLN A;  1K0N A;  2PPT A;  3ZFL A;  3WGX A;  1TOF A;  1I5G A;  4J57 E;  3CXG A;  3TB2 A;  5HR2 A;  5FWG A;  1O8W A;  1PD2 1;  4L5O A;  1A23 A;  1PSQ A;  1XWG A;  4KF9 A;  4XIH A;  3LG6 A;  1YKC A;  1FOV A;  4ISD A;  5DAL B;  1QFN A;  3LSZ A;  5ID2 B;  4YAV A;  2R5G A;  2TIR A;  2GST A;  3H4K A;  1GH2 A;  1W89 A;  4HDE A;  1XFL A;  4KAE A;  3MDK A;  1WWJ A;  3UVH A;  5EY6 A;  4XCS A;  1B48 A;  1E2Y A;  5HFG A;  4NHW A;  4V2L A;  3GA4 A;  3FZ9 A;  22GS A;  2DJ2 A;  1SK1 A;  1V58 A;  3IPZ A;  5AN1 A;  2KLX A;  2HYX A;  3C71 A;  4BVX B;  4MDC A;  2P5Q A;  5IMF A;  1EGR A;  2F3M A;  2EC4 A;  3UEM A;  4GTU A;  4Z2R A;  3KM6 A;  3ME7 A;  1TRU A;  3P90 A;  4TXV A;  2DBC A;  2F51 A;  3TUE A;  4YAP A;  2H6Z A;  4TXO B;  1AQW A;  2OE3 A;  2FA4 A;  4ZIJ A;  4OCF A;  1MDI A;  5CRG A;  1GLP A;  1GSD A;  3C7M A;  4K7I A;  3ZTL A;  3QFA C;  5D73 A;  1AW9 A;  2PWJ A;  2M72 A;  4GQC A;  5F05 A;  4OFN A;  1GTI A;  2HI7 A;  5GAP D;  2GQK A;  6GSS A;  2CA8 A;  1PL2 A;  4P3Y B;  2VL2 A;  3F63 A;  3DEX A;  1Z9H A;  2JSY A;  2CVD A;  3QMX A;  4O5U A;  2P31 A;  5LCZ A;  2X99 A;  5J3R A;  2I81 A;  5G5F A;  2H72 A;  1VRS D;  3KEB A;  1O8X A;  1PRX A;  2DML A;  5GST A;  5INY A;  3LGC A;  2HSY A;  2FWF A;  2YV7 A;  4QL7 A;  2NVL A;  1TK8 B;  2YNX A;  2E2G A;  4KUN A;  5DDL A;  1WOU A;  3R3E A;  1C72 A;  1XWA A;  4JU5 A;  2IN3 A;  5FT3 A;  1AQV A;  1SKR B;  3LYK A;  2DKI A;  1GRX A;  4EL1 A;  2OAC A;  1ZZY A;  3ZIT A;  3CTF A;  2L6D A;  2B3S A;  3UMA A;  4HEA 2;  3CSH A;  5IIZ A;  4MJE A;  2IMI A;  1EEJ A;  1ACV A;  1A2J A;  2FWH A;  2IPA A;  2VCX A;  2CT6 A;  3EPT A;  3I6A A;  4A5P A;  5GSS A;  1MDK A;  1GSF A;  1EP7 A;  4RQR A;  3GH9 A;  3GKM A;  5ECH B;  2KUC A;  3KP9 A;  5F07 A;  1Q4J A;  10GS A;  1SYR A;  2LTK A;  1QMV A;  4MF6 A;  1K3O A;  1TP9 A;  1TRS A;  4KCE A;  2CZ2 A;  1GUH A;  2WZ9 A;  5HR3 A;  4IEL A;  1SK0 A;  2V2G A;  1H75 A;  3VWU A;  1S3A A;  3UL3 A;  1ST9 A;  2HFD A;  3DVW A;  3IDV A;  3Q19 A;  3QDN A;  4WXT A;  6GSV A;  2DLX A;  1OAZ A;  3CBU A;  5A4W A;  3HJP A;  2VLU A;  3IBH A;  1Z7P A;  2OJL A;  5AIS A;  5DAK B;  5COH A;  1SYX A;  4BWS A;  4N30 A;  3PGT A;  5ECR B;  2REM A;  4XS1 A;  2DJJ A;  3MAK A;  4F9Z A;  3FMW A;  18GS A;  3D4T A;  5JCW A;  2YOI A;  3E9J B;  3LEF A;  1OE8 A;  3O76 A;  4ECB A;  1SJI A;  3NZN A;  4EDY A;  2OE1 A;  2XPD A;  1VF3 A;  3TKS E;  3GL5 A;  1OC3 A;  2FA8 A;  1S3D A;  2H1D A;  3V1W A;  5F06 A;  4GQF A;  3LXZ A;  1TK0 B;  5A5K A;  3QCP A;  4EDZ A;  2H76 A;  3IR4 A;  4KH7 A;  2RM5 A;  1A8Y A;  3TGZ A;  4DSS A;  4WBR D;  3CMI A;  3EYT A;  5DJM A;  3HDC A;  4OO4 A;  3UVT A;  2QC7 A;  1BED A;  3FYG A;  1DE1 A;  2HRA A;  3VPT A;  4MMM A;  2FY6 A;  4X4J A;  5E59 A;  3GKN A;  1ZL9 A;  1PMT A;  3M3M A;  12GS A;  2HE3 A;  4GXZ A;  4LMW A;  2A2P A;  3KZQ A;  4I2T A;  3VWX A;  1ZYN A;  5B8A A;  2YWI A;  4K2D A;  1DSB A;  2K6V A;  3Q18 A;  3HYP A;  2I4A A;  3GMF A;  5F8B A;  3L4N A;  2BTO T;  1FVJ A;  2M46 A;  2CX4 A;  2RLI A;  5G2Z A;  4XRA A;  2N5F A;  3EMX A;  1HNA A;  5G1K A;  5DCG A;  3G9B A;  2O85 A;  2X8G A;  5BMU A;  4G19 A;  2WFC A;  1M9B A;  2V1M A;  5J5N A;  3ZFB A;  2C1Y A;  4TOP A;  3FRC A;  4IJ3 A;  1A2M A;  3S9F A;  2FD3 A;  1OC9 B;  3G7J A;  2C0D A;  2MYG A;  2NDO A;  3A2W A;  4N0Z A;  3ZRE A;  3CSI A;  4V1A p;  3H93 A;  3F6F A;  5ECI B;  3F4S A;  5DJL A;  1FW1 A;  3F3Q A;  1A8L A;  5IO0 A;  4J56 E;  2VCT A;  1VGL A;  5D9T A;  5EVO A;  4G9H A;  5D96 A;  1T3B A;  2F8F A;  3FKF A;  1XIY A;  4JE1 A;  4L8E A;  4JR4 A;  3I69 A;  2BMX A;  16GS A;  2GQL A;  2LUS A;  1YF0 A;  2NTO A;  4AJ8 A;  1K0C A;  3N5O A;  4EKZ A;  2MBT A;  2PVO C;  2VAF A;  3WGD A;  2LNT A;  4E8H A;  8GSS A;  4ECJ A;  4JED A;  4AGS A;  3EC3 A;  1ZGN A;  2LS5 A;  4MZB A;  3IV4 A;  1A24 A;  1YY7 A;  5AIV A;  4MF7 A;  4PUA A;  4MCU A;  4MPF A;  2R0C A;  4K0G A;  3O3T A;  2LQQ A;  2K8S A;  4YKF A;  2ALB A;  2C8U A;  4MPG A;  1RK4 A;  5AIX A;  3M9J A;  1SK2 A;  3WT2 A;  4KCA A;  1T4Z A;  4ML1 A;  2BJX A;  2H6Y A;  1X9M B;  1HNC A;  2CVB A;  2QA1 A;  2A2S A;  4QQ7 A;  4AF2 A;  3ZRD A;  4MJC A;  4FH8 A;  3WYW A;  4TKY A;  1PN0 A;  2UZ8 A;  4Q5F A;  2GGT A;  1V57 A;  4KGI A;  4XS4 A;  3SWL A;  5JCU A;  1TTZ A;  1BG5 A;  3MIX A;  1XZO A;  1T00 A;  3BD2 A;  2H0H A;  4XRD A;  5ECO B;  6GSU A;  2NPB A;  1FB0 A;  1NSW A;  3EVI A;  4FYC A;  4BL7 A;  1MEK A;  5D8I A;  4KDU A;  2O89 A;  4F0B A;  3IK7 A;  3CTG A;  3PPU A;  4CHS A;  2WB9 A;  3DYR A;  2B1K A;  3M0F A;  3LJR A;  3DGQ A;  7GSS A;  4YKG A;  3L9U A;  2C0E A;  4WF5 A;  1G7E A;  14GS A;  2P0G A;  1ZOF A;  2HRK A;  5D9W A;  1QK8 A;  4XTS A;  2GZP A;  5KN1 A;  1FG4 A;  4WET A;  1XOA A;  3D5J A;  2V32 A;  3PR8 A;  1TKD B;  1Y25 A;  4PQ1 A;  3AY8 A;  1EGO A;  1A0F A;  2LRN A;  1TRV A;  4GST A;  1U88 A;  2GZY A;  5E4W A;  4TRX A;  3TJF A;  4PXO A;  4K5S A;  2L6C A;  2MMN A;  3FR3 A;  3LYP A;  1FVK A;  1KBN A;  5IMA A;  3GN3 A;  5CRH A;  4F0C A;  3ZIJ A;  2LNS A;  2WCI A;  3DRN A;  11GS A;  3LOR A;  1DBY A;  1WRY A;  3RPN A;  3E3E A;  4ZL9 A;  2JU5 A;  5IMZ A;  3ERW A;  4L5L A;  4OD7 A;  3GTU A;  2HRN A;  3EU4 A;  2QGV A;  1OKT A;  1M0U A;  1UA5 A;  3VI5 A;  1IYI A;  4G0K A;  4FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...