3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
1WZLA 2EEXA 3L2MA 1OBAA 2OSWA 2VCBA 4U5IA 1GOIA 2YL6A 3OLDA 2WCAA 2ZX8A 4MAZA 1V0NA 4AZIA 4MNJA 2FGZA 2VC9A 3U5YA 4D6FA 1E56A 2ZWYA 4V27A 5I24A 4AZ5A 4PYSA 1VJZA 4W8AA 3CIVA 1P6WA 1BVNP 1DWFM 2VRQA 3D4ZA 1HJXA 5D9MA 1H5VA 3T2QA 1R7AA 4JL1A 2WNWA 2XFYA 2ZUNA 2VR4A 1D7FA 2EPLX 5A8OA 3AJ7A 4M8UA 1CLVA 2NT0A 4NXSA 4Q22A 1T0OA 2DT0A 3B9AA 1JD9A 1HN1A 3WF4A 4PMRA 2GVYA 3NUKA 2XVKA 1J18A 2HVMA 2DQXA 1LF1A 3ARRA 3CUFA 1E6SM 1R85A 4NZFA 1PX4A 4E8CA 1B1YA 1KFWA 4TOQA 1UWUA 5CJ5A 3NYDA 1WKYA 2XFFA 1C8YA 1QX1A 3DYPA 3MSGA 3BC9A 3ZJKA 1MFUA 1V3IA 1UD6A 7A3HA 4ATDA 2D0HA 1RH9A 3M07A 3K1DA 1KCKA 2D73A 4H7VA 4BA0A 4JFWA 3WQWA 1TQUA 4WKHA 3IGUA 1ZJAA 1GOMA 3ZT5A 2G8ZA 1AQ0A 1ITXA 5HNNA 4HZ8A 2BY1A 1JD7A 3TV8A 3B8SA 4BQ3A 4D1JA 3VSVA 4W7VA 2XM2A 4B15A 3VINA 1PS3A 1ZBVA 4BS0A 4EKJA 4PUEA 3GH4A 5KEZA 1XRVA 3ZQ9A 1E1FA 1NWTA 2PWDA 4JL2A 1QI3A 5CXPA 2WMHA 3BVWA 2OYLA 3L4WA 1HKIA 1WCGA 3AZSA 8A3HA 1XSIA 3N12A 2TAAA 3WY2A 1ZBKA 4LPCA 1VEOA 3FN9A 1EGZA 1X6NA 1R86A 3WN6A 2WVSA 3ZJ6A 4MADA 3VPLA 4CD7A 3OLEA 3SCRA 1RP9A 1UH3A 4D6CA 4AD1A 2XSBA 4A3HA 2BHYA 4PRWA 4BQ5A 4M56A 3L4VA 1VFUA 1E6RA 2VI0A 1U30A 2XVLA 4PTVA 1QPKA 2VZUA 1W32A 4UOZA 4AZCA 3WBEA 2NW0A 4AEEA 1KBBA 3SIMA 3AMGA 1UASA 1JXKA 3L4ZA 1FA2A 1MW3A 1CXIA 2E9LA 3FHAA 3MSDA 5M17A 2G3IA 2VCAA 2JF6A 1LG1A 2BXZA 1E4LA 1FHLA 1MXDA 4EK7A 2V38A 2YDSA 3WUGA 1CXEA 1DEDA 2VR5A 2J4GA 2EPMX 3D50A 2VQTA 3EMCA 4W5ZA 3VIPA 3EBVA 1TUXA 2BY2A 3ZIZA 1D3CA 1NOUA 2YA1A 1HX0A 1XH2A 1O6IA 4TUFA 3VIOA 3WD0A 1W9XA 2WWCA 4P8XA 3HU7A 2XN1A 3EDEA 3ZSSA 4AIEA 3W26A 1J11A 2FHBA 3CHEA 1EHNA 4R27A 4UQDA 1V0MA 5BWFA 2ZXBA 3RJYA 3VIMA 1KGUA 4W93A 2WB5A 3A4WA 4UZSA 2EBNA 2VZSA 5CQ1A 3RO8A 4C7FA 3S6TA 2Y4SA 2J75A 5E0CA 3ARSA 5JIPA 2WCSA 3VNZA 1MW1A 2YFOA 2Z1KA 2A3CA 1JXJA 1KQZA 3W38A 1UZ1A 2FGLA 4PSRA 1E72M 1V6XA 3OA5A 1JFHA 4UQ9A 4BZYA 5JBEA 1UZ4A 2X8RA 4FLSA 2E8YA 3MMUA 2WVUA 3SUVA 4AISA 3VD9A 2F61A 1ISVA 4NSBA 4DUWA 2B31A 1QNSA 2WANA 2O9RA 1WDSA 3DHUA 3W24A 4F8XA 3ZOAA 3EDFA 5A6KA 2DSKA 4NI3A 2E9MA 3WL0A 5CGTA 4CVWA 3VGEA 1B3VA 2EAEA 2X0HA 1CENA 3KE0A 1F4HA 4U33A 4XB3A 4FNPA 3N13A 3NIYA 1CIUA 3H54A 2VURA 5CLTA 1LL4A 4TX6A 2Y5EA 3VGBA 3SEPA 1HXJA 2IXVA 1PJ9A 2GK1B 1Y7VA 3VIJA 4GI9A 5A8QA 3N17A 1YQ2A 3M6DA 1CWYA 1GPFA 2ZXDA 1H49A 1X1NA 4MTVA 4CUCA 4UFHA 1V0KA 4NZCA 1OIFA 3AQUA 2J78A 3EJPA 2VZTA 3EDDA 3GXFA 1A3HA 2WHJA 1XV8A 2ZICA 4XV0A 4J3TA 1XD0A 1D2KA 3QHOA 3QGVA 3MKKA 1BF2A 4LX4A 4RE4A 1E70M 1NOWA 3AHVA 3AXIA 5E6ZA 1F4AA 4QFUA 1QWNA 5EMYA 5D9OA 1YHTA 1PIGA 4MB5A 1H0GA 1GONA 4D6EA 4E8DA 2OYKA 3HG4A 4AZCB 4LQ1A 5D8ZA 4A4AA 1FH9A 3KLLA 1XGZA 1UA7A 3GM8A 5C70A 3WNLA 2QF8A 2WZIA 4KGJA 3AISA 1C8XA 2DGAA 5A6BA 5FD0A 1IV8A 8CGTA 3GZAA 1UKSA 2VTFA 2UY3A 4W88A 4QAWA 2ZWZA 3HG5A 1NWRA 4AZBA 3HN3A 2GDUA 1KGWA 1JAEA 1HWWA 3BVUA 1W1YA 4PMXA 3GXIA 2D24A 1J0KA 1ITCA 1JZ5A 1CTNA 5D8WA 4ACZA 1BG9A 5IHSA 5JBDA 2XVNA 1UWSA 3RDKA 2GSJA 2PBGA 3BLPX 2BFGA 3GH5A 3DX0A 3WSUA 1B90A 3CMGA 5GPRA 4OJYA 4EE9A 4B16A 4MDPA 4X0VA 4CU8A 1O7AA 1H09A 1CYGA 1FFQA 1ZJBA 2OLHA 5DT5A 1KWKA 5GNXA 3POHA 4GI8A 3BGAA 4LYQA 5I6SA 3CBWA 1E55A 4W87A 1EQPA 1UD8A 5BRPA 3UR8A 1E15A 4KRUA 1OM0A 3M7SA 4PMDA 3WEOA 1CEOA 1E40A 4JKKA 4FNQA 4MJ4A 3CHFA 3VIKA 5BXSA 3BUPA 3UG4A 4OOUA 1PZ2A 3WMSA 2JF7A 1V3LA 4HMEA 5DEZA 4LYRA 2JE8A 3GXDA 4AZHA 3PHAA 3EJUA 1NH6A 3PZGA 3W27A 3TTSA 2XIBA 1V3HA 2QPUA 2D23A 3GXPA 4H04A 2DT1A 1CGTA 1JYNA 4JIEA 4UR9A 3HZ3A 4FMVA 1CGXA 2IUZA 1B30A 4AIOA 1KWGA 3AS1A 1M04A 2WSPA 1XYFA 2DPEA 3L4YA 4GO9A 4UOQA 2XSAA 1M53A 3AMKA 3BMVA 5DFAA 3WFLA 1KXTA 1OB0A 4NZJA 3PTQA 4D6JA 3D52A 1W2PA 3II1A 4PMZA 3A5VA 4JKMA 3FAWA 3ECQA 2QLYA 3N11A 2WVVA 1NP0A 4HA1A 4AD0A 3D4YA 1VAHA 3BLBA 2EADA 1V3JA 2DT2A 3WENA 1LWJA 2F7PA 3MANA 3D51A 5F7UA 2CHOA 2J25A 5AY7A 4M80A 1FOBA 3S5YA 4EAMA 4FNTA 1GOQA 2W4XA 5ABFA 2XG9A 1WZKA 1TQTA 3CUJA 5FIPA 2PI6A 2G41A 4AYGA 5D9PA 1ISYA 4PMVA 2QMJA 4OZOA 4P8WA 3H55A 2XGIA 2OWWA 2XN0A 3VO0A 2G4FA 2WLZA 4WSJA 3BUBA 1RP8A 2CKRA 1NOFA 5DO8A 1W3KA 2QV4A 5E0FA 1TFVA 2J8FA 1UR1A 5EFDA 1O7DC 1R75A 3BUQA 4U2YA 1UQYA 2V3GA 1HVXA 4DO5A 4UCFA 1V3KA 1WPCA 1PE31 4CCDA 1WNOA 1NWSA 1W91A 3SUWA 2WKLA 2YBUA 5A8NA 3TP4A 4FLOA 1JG9A 3QHMA 1Q6DA 3WH7A 2F18A 2GFTA 5E1QA 1B3XA 1KCLA 3WQ6A 3BLKA 3IK2A 2VQUA 3EJRA 3WDRA 1U33A 4PTMA 4FNUA 3GNPA 3ALGA 3VNYA 1C90A 1J0ZA 3LPOA 4MB4A 1C8QA 1CGVA 4CD6A 2BHUA 5CPTA 1Q4NX 5I79A 2VL4A 4OKDA 3THCA 4UFMA 1K6AA 4MNKA 2V5CA 3LRKA 2CKSA 2F8QA 4WKAA 3O2LA 5CG0A 1GOWA 4CU6A 4WF7A 1A47A 1JZ7A 3VIIA 1VF8A 2WVTA 3GXNA 5E9AA 3SCNA 3VIFA 3AROA 1BYCA 4F66A 1E0XA 3F5LA 2BVDA 1J0JA 3AIRA 1UR9A 4YN5A 2YDRA 3N04A 4BQ2A 2ZE0A 4HU8A 1M01A 3PZUA 2DSVA 4M82A 1JF5A 1QHPA 1GCYA 3GNRA 1GQKA 3IJ8A 2OWXA 2F1BA 1E6XM 3BCFA 1GQJA 1QBAA 1ODZA 1M7XA 3WUBA 4B3KA 1PCPA 4DUVA 1IZJA 4UQAA 2WVVB 2OWCA 1QI4A 2EPOA 2FH8A 2YKKA 1UWTA 4QCEA 1ISWA 5IDIA 3S5ZA 1KGXA 1CXHA 1OGBA 3MUZ1 5AYIA 3PZVA 3SCVA 3DX1A 3TA9A 1B2YA 2CERA 3IJ7A 2XUCA 1PX8A 1TG7A 3RM8A 4TTUA 2ZXQA 3BMWA 1US2A 1W1TA 3BAWA 2G3MA 2VVSA 1BYAA 3D3AA 2WHLA 1TMQA 4GIAA 3TTOA 1M03A 1GUVA 1GQLA 2PWFA 2X0YA 1NARA 1UKOA 2A3AA 3AIWA 1R87A 4L4OA 4W8BA 1E4MM 1H0IA 3WY3A 1CXKA 4FLQA 1G94A 3WDHA 2YLLA 2BY3A 1QI5A 4W7WA 4P7OA 2PWGA 2OSXA 4J28A 2VCCA 4WK9A 5A6BD 3WQVA 4UFLA 2WBGA 1CDGA 5LA2A 2PWHA 3K4AA 3CH9A 1EH9A 4DO6A 1E5JA 2J7FA 5AC5A 5I78A 3TONA 4GQQA 1EXPA 1KXHA 1TQVA 4S3JA 2CIPA 4D72A 3OLIA 2O9PA 2W67A 4UQCA 5BXRA 4GQRA 3WH6A 3GXMA 3CTTA 1H4PA 3MV01 4P7RA 3WNNA 2F7RA 1UQZA 4Z2GA 3WD4A 3LXBA 1HJUA 1V03A 1U2YA 1X6LA 2WM0A 3OGVA 3CUHA 4Z2JA 1HKJA 3A23A 2OSYA 1ZU8A 1BLIA 3ZO9A 3CHCA 1LWHA 4HPGA 4B9ZA 4PMQA 3UCQA 2PF0A 2EO7A 3AICA 2D3LA 4AZ6A 2X2HA 4D6HA 3K8KA 1G1YA 1LG2A 4GI6A 1AQHA 4NRRA 3ARVA 5BXPA 1V6WA 3AIVA 2YLAA 4JCLA 3PZNA 5M3WA 2BV9A 2W61A 3LPGA 2AAAA 3VGDA 2BS9A 5A8PA 3A22A 2XWEA 2RGLA 5ABEA 3L4XA 3AIBA 4AMCA 2VX5A 3AMLA 2XVGA 2PBOA 5LYRA 1EDTA 2EABA 4W7UA 3KEHA 3WNPA 4XX6A 1XCWA 1W9UA 1HVQA 3AYRA 4JKLA 3EYPA 3VD7A 1B31A 3CUIA 1VIWA 1WE5A 2QMKA 1OT2A 2O9OA 4HOWA 3T08A 1DP0A 2FDMA 1JYWA 3IAPA 1I1XA 4PCTA 1HJSA 2J7BA 2PB1A 1OSEA 2DH2A 2EXOA 3U7BA 4FNRA 2EACA 3AOFA 1UYQA 4PN2A 4U2ZA 3CPUA 2YFNA 1J01A 1GVIA 3NSMA 3ARYA 2Y2WA 2CBUA 1UKQA 3VDHA 1HL8A 5CPQA 5AC4A 1V6YA 2JEQA 1H1NA 3WUEA 3KZSA 1B3WA 1ESWA 3W28A 1E3XA 1UH4A 3U7VA 1HI7A 4HOXA 1B0IA 2CPUA 1TE1A 2JEPA 1BFNA 2ZX6A 4A3YA 2X2YA 3VSTA 1H2JA 2D2OA 3ARXA 2W5FA 3PN8A 2C8NA 1UHVA 4DM2A 4CKQA 1H11A 3CO4A 5LA0A 2XHYA 1QNQA 3A24A 2X2IA 4H8VA 2MANA 3VSUA 2ZUTA 1WDQA 1J0HA 2VUYA 1CPUA 3ZT7A 1QOXA 3WF2A 3OB8A 4AZ7A 3WNKA 4DWSC 4EANA 3VDAA 5IFPA 3VD5A 2JFEX 3EDJA 3VU2A 2YL5A 4ZE5A 1JZ4A 1Z32X 3AHXA 2J7HA 3F4VA 1KTBA 5CGMA 1OT1A 3CZEA 3APGA 4MPKA 3N18A 1V02A 5GNYA 1VEMA 3BAXA 3BVVA 4AZGA 5GQBA 1VJSA 1CGWA 4ATLA 3SUTA 2AMGA 4CVUA 1ISXA 3VMPA 1TZ7A 1V6VA 1FP9A 3SCPA 3WQ8A 3SCUA 1V02E 3GH7A 2WK2A 3CHDA 2CNCA 1E6ZA 2Y8VA 2FH6A 3ZR5A 1VB9A 1JIBA 5IHRA 1R47A 4CN1A 1WZAA 3A4AA 4S3KA 4D71A 4JFUA 1W3JA 3MS8A 2Y8KA 4AIUA 3AMCA 5C8BB 3HG2A 4NX0A 1V0LA 4Q7NA 4M1RA 2D22A 4Z2HA 1E1EA 5HPCA 2VNCA 2WYSA 1Q6CA 2J47A 3AS3A 1JDDA 5I77A 1LJYA 2WWDA 3VD4A 4HZ6A 1OGGA 3WNMA 1CZ1A 3PZQA 4GXPA 5BRQA 3VDBA 3W6LA 3BCDA 1J0YA 4XUYA 4FLRA 2WW5A 2VX6A 3I3BA 1ZL1A 5DT7A 3HJEA 4TVCA 3T0DA 4H8HA 1XYZA 2WZHA 1C92A 4H2CA 1GOKA 1HP5A 3M46A 4IUGA 3JUGA 2VMFA 2ESCA 1ODUA 2F2HA 2FHFA 1UH2A 4AMXA 4CN4A 3SCWA 1MFVA 1PZ3A 1L8NA 3WELA 2NSXA 3OIHA 1GORA 3OBAA 3SUSA 3L4UA 2G3JA 4DM1A 1QW9A 3LPFA 1BG4A 3SUUA 1ZS2A 1JAKA 3VX1A 2BVYA 1RPKA 4JFSA 2EJ1A 3AIQA 4D1IA 4PMYA 4UFIA 3A3HA 5HXMA 1PBGA 3WD3A 1EDQA 2VZVA 2D0FA 4J27A 3PZTA 1BGAA 2J62A 4KRTA 3W82A 2OW7A 5I5RA 4TVUA 2J8GA 1VENA 3ALFA 3A47A 3KLKA 2CCRA 2XYLA 2ZX5A 1B3YA 4AD2A 1C91A 4CCEA 1HNYA 3OGRA 1FFRA 3WL1A 4MJ2A 1PEZA 4NXKA 1H3GA 3VD3A 4AD4A 3NDZA 4U31A 2BVTA 3UETA 4F9DA 4AMWA 3DX2A 1UWIA 5JBFA 4JFTA 2AOSA 1KR1A 3WD2A 3CZLA 2PC8A 4R5EA 1MQQA 5A6JA 1QW8A 1EQCA 1LLOA 3GTNA 1R7OA 3LX9A 2ZUWA 2WLYA 4TX8A 2XTKA 3VIGA 4PTXA 3WDPP 3PZMA 1PPIA 2WMIA 3U5UA 4K68A 1TVNA 2WAGA 1S46A 4M29A 4X0NA 1EIBA 3RILA 4GKLA 1GJWA 5I23A 4HA3A 1OD8A 2OYMA 2YIHA 4V28A 4CGTA 2CYGA 1MW2A 3SCSA 4YPJA 4YHEA 4HA4A 5FL1A 4PUDA 2VVNA 1GHRA 1E4NA 3TTQA 3CZGA 4U3CA 2CBIA 3MU7A 3NCOA 4D6GA 1E9TA 1BAGA 2WMJA 2WXDM 2YL8A 9CGTA 1DWAM 2CEQA 1XSKA 4UFJA 3ZSTA 1G01A 3A4XA 3AMDA 3N9KA 3L4TA 2YOCA 2O92A 4ACZB 4TTGA 4LXFA 1TQWA 4QLLA 1JDCA 1V6UA 2D20A 1I1WA 4B9YA 5EB8A 4W5UA 3WF3A 1B3ZA 3ARZA 5IXEA 2CHNA 3BVTA 3SCTA 4ATWA 1HT6A 3K8MA 2JIWA 1E71M 1XH0A 4QCFA 4Z2KA 3T2PA 4TXEA 3W4RA 2VZOA 4BQ4A 3OG2A 3AHZA 4FF5A 3WF0A 5A2AA 1K9EA 4NF7A 4UNIA 1N82A 5E09A 2E3ZA 3VMNA 1JNDA 4WJXA 1UKTA 2V5DA 3I3DA 7TAAA 3W37A 3N15A 3PTMA 4J7RA 1C7SA 1PAMA 3VOCA 5FL0A 2Z1SA 1PX3A 4GZJA 2ZIDA 1UWQA 3WQ4A 1WP6A 4IISA 3UESA 3RM9A 5A2CA 1IZKA 3WEZA 3ARWA 3DDGA 4Y7EA 1E6QM 2GJRA 3ARTA 1WO2A 2EPNA 3QOKA 2E4TA 2IGTA 4PCSA 1QI0A 1BQCA 4ZXOA 3W81A 1VEPA 1JL8A 1TCMA 3VM7A 3WNOA 2A3HA 1TA3A 3VUPA 2J7DA 3CZNA 5TD4A 3VVGA 3AFBA 3RMEA 1SMDA 2DSWA 7CGTA 1SZNA 1EO7A 1E6NA 4HP5A 3QOMA 2CXGA 1UR2A 3HMCA 3I3EA 4C7DA 4HMCA 2GJPA 2E40A 3K46A 2F1AA 5I3DA 1JZ2A 2C7FA 4DWSA 2WZEA 3N1AA 3UG5A 1BVZA 1UWRA 2WCGA 2ZUVA 4D6IA 5BCAA 4KH2A 2QHAA 4QDMA 4AW7A 1GNXA 1QNPA 1XSJA 2XVPA 1K9DA 1W3HA 1QI2A 1UD2A 3FNDA 5FKYA 1QBBA 1CBGA 1PSPA 2WMIB 1FH7A 4PMOA 3OZOA 4CD5A 1OGSA 4BF7A 1BHGA 3B9DA 2ZUUA 4V2XA 3WQ5A 4W85A 5ABFB 4GINA 1XD1A 4UOJA 3WIJA 2DSZA 1SYTA 4F9JA 1HL9A 1CGYA 1C3FA 3HG3A 2XM1A 3W25A 1E43A 5A6SA 1JDAA 4MB1A 5A1AA 1C93A 1I75A 3OZPA 1CNVA 3WBAA 2WC7A 3EDKA 1E5NA 3WY1A 1EO5A 1W9DM 2ALWA 1GQIA 1OIMA 1JZ3A 5JIWA 5A2BA 4NRSA 4OIFA 3CZJA 4J3WA 1J10A 1UKPA 2UY5A 4BCEA 1E4IA 3AZTA 1R34A 1SMAA 1GOOA 4JHZA 4QP0A 5AYBA 4AWEA 3THDA 2G3NA 1JZ8A 1LL6A 1TVPA 4CD8A 4RL3A 1MQPA 2PWEA 3KL5A 4PSPA 3AI0A 3CLWA 1JFXA 4F79A 2YDQA 5DMYA 5FCZA 3WKZA 2V3EA 1SFSA 3AXHA 3T0AA 1JF6A 2CESA 1JI1A 3NJ3A 3ZJ7A 3UG3A 2GK1A 3F5KA 4XZWA 4MAVA 1HTYA 2CETA 2JIEA 2Y24A 4MNMA 4KMQA 4P7NA 4U5KA 4GO8A 1PS2A 3TTYA 1UOKA 2GJXA 4W84A 1HJWA 1JI2A 2E0PA 2X1IA 4OBRA 3RM4A 1UR8A 3NSNA 1MWOA 2F7QA 4OUEA 1XC6A 3H53A 2VRJA 1BGGA 5JUVA 2XGBA 3F5JA 5D4YA 3EMZA 1GHSA 1BTCA 1HJQA 3BUIA 5E70A 1B9ZA 3W29A 1AQMA 1J9YA 1NQ6A 1TA3B 1ZBCA 2WPGA 1UUQA 4GPNA 1MW0A 3DX4A 4N42A 4PMNA 1Q6EA 3WH8A 2OW6A 3AS0A 3LMYA 1K9FA 1W9VA 4P7QA 2E9BA 1R8LA 1G9HA 3AYSA 5A3HA 1WAWA 5DF0A 2JALA 3EJSA 3VDCA 4HPHA 4LYPA 4DWSB 2V3FA 1QVBA 4MDOA 3BH4A 1JNEA 1AVAA 3SURA 5A69A 4DO4A 2XN2A 3WEMA 1C7TA 4AD3A 5HOSA 4QLJA 2WC4A 3J7HA 2QPSA 2X05A 3AIUA 3MUIA 4AYSA 4ML4A 5EBAA 5CSUA 5HBFA 2WKGA 5A6MA 3QHNA 4AD5A 4QLKA 4AEFA 1EDGA 1E3ZA 4E2OA 3UR7A 2DDXA 1FH8A 4PMUA 4WSKA 3K8LA 1MYRA 2UWFA 3B9EA 3CZ8A 3CUGA 4FK9A 5ABHA 1QHZA 4HMDA 5CPSA 3VILA 3WH5A 1UD5A 3WMCA 1KTCA 3WFZA 1NP2A 2Q8XA 3ZR6A 2C0HA 1XH1A 2J77A 1KBKA 1W2VA 5CZKA 3W6MA 3BSGA 2WBKA 4ACYA 2WHKA 3K4DA 3MO4A 2CITA 4M24A 2DH3A 1PIFA 3QR3A 1JYXA 2DEPA 3AIEA 3ARPA 5HPOA 1J0IA 3MMDA 4DUXA 2J7CA 5A8MA 4CD4A 1VBUA 4JFVA 3VIHA 1VRXA 3VX0A 4M81A 4U3AA 3NSXA 3EJQA 3DDFA 3VGFA 1KXQA 1CGUA 1DWJM 4P8VA 3PZIA 4JHOA 1E9LA 4ZXLA 3AZRA 3PBGA 3TOPA 1K9TA 2DSUA 3RPMA 2VOTA 1GW1A 1W9BM 3CZKA 4XZBA 2RGMA 4FNSA 2ZXAA 4ZEPA 5CSYA 3MUY1 3W53A 2W63A 3FY1A 1QNRA 3GNOA 1EHAA 3G6LA 2GJXB 4RE2A 5KZ6A 3DC0A 3T0BA 1UD4A 1US3A 1DWIM 5BYWA 4ZFMA 1DWGM 3SCOA 3CMJA 1XCXA 4KGLA 1W9PA 3A21A 4GZEA 3U57A 3RIKA 1G0CA 3KL0A 4AY1A 2EPKX 1BSIA 3AHTA 4OBSA 1JGIA 1BYDA 2D3NA 3FW6A 3VKKA 3AHYA 4N0RA 4IPLA 1E6PA 2YL9A 1EA9C 4GZIA 5M03A 1CLXA 5C71A 3WUFA 1WDRA 3O9NA 3DHPA 2ZUMA 3G6MA 1WDPA 3MMWA 1DHKA 1HXKA 4J3VA 4W86A 1DTUA 5A95A 1QHOA 2CBJA 3A6OA 2IXUA 4WKFA 2VO5A 4L4PA 2ZX9A 3FAXA 2W62A 3BAJA 5HDRA 3ZM8A 3KL3A 3PTKA 5ECUA 4Z2IA 5FOOA 1GJUA 1CECA 1GVYA 2GUYA 2VRKA 5M5DA 5I0DA 1ECEA 2XWDA 3IANA 5BXTA 1E0WA 1EOMA 2WMGA 2FE0A 1NM9A 1BYBA 3FXYA 5GNZA 1G5AA 4IM4A 5D9NA 4H8UA 2DIEA 1KQYA 4MNLA 3WY4A 2WMKA 1EOKA 1GZJA 1QNOA 6TAAA 4JCMA 3BUDA 2VX4A 4P7LA 1DWHM 3LXCA 2VJXA 4DWSD 3ZMRA 3DX3A 1VFMA 4J3SA 4OGZA 1UG6A 3ARQA 4X9YA 4ZE4A 3FHQA 1E0VA 3GXTA 1VBRA 3EMQA 5A6AA 1HIZA 2D1ZA 2J7EA 3WDQA 1FHDA 3BAYA 4UQEA 3W0KA 2XJ7A 1BPLB 3WDIA 4HTYA 1MVYA 3BAKA 1VFFA 1UA3A 3D5HA 3LRMA 5LA1A 2W91A 2V3DA 2EQDA 1L0PA 1HKKA 4JAWA 3T2OA 1SR0A 1UR0A 3BVXA 2J74A 4IPNB 5BROA 1MQRA 4WLCA 1V08A 3DYOA 3MUAA 1W1VA 2GDVA 3PZ9A 2FHCA 1ZBWA 3RJXA 6A3HA 1UR4A 4W8LA 1CXLA 2BHZA 3LRLA 1TQSA 3PZOA 2CBVA 3MI6A 3ZJ8A 4UZUA 1HP4A 4HOZA 2HISA 1R46A 4W89A 1CXFA 5CLWA 3CC1A 2XFRA 1KXVA 1VFOA 3CV5A 2VT0A 1J12A 2W66A 3WF1A 3CGTA 2O9TA 4UTFA 4URIA 2X2JA 4HZ7A 3GYCA 3T09A 1HKMA 3LXAA 4YHGA 2WSKA 1LL7A 3BSHA 2VX7A 1W3LA 1JZ6A 1Q6FA 2UY2A 4CU7A 3OGSA 1ISZA 4UQBA 4PBGA 2BY0A 1OINA 4CCCA 3WD1A 4HU0A 3GBEA 3IJ9A 2BNJA 2XPKA 1MXGA 1Q6GA 2A3BA 4Z2LA 1AMYA 5E6YA 2F7OA 1H41A 1WZMA 2PSPA 1XHGA 3AXXA 3VMOA 2ZOXA 2BXYA 1TR1A 1IT0A 3CZSA 2J79A 2WMFA 2YA2A 1OD0A 2FYVA 2D0GA 1W1PA 3AS2A 1KB3A 1ZB5A 5I2UA 1E73M 6CGTA 2ZX7A 2E8ZA 4C7GA 2WHMA 3GBDA 3UERA 3MV11 3POCA 1NWUA 3WDJA 1WB0A 4OOZA 4E4PA 3IAQA 4J3UA 4PTWA 1UD3A 5A94A 4AC1X 2UY4A 4TVDA 3WMBA 2XIIA 2DIJA 4LGXA 1JYVA 2YJQA 4RE3A 3GDBA 3NDYA 4D6DA 3KWXA 1R33A 4AXNA 3L2LA 3ZT6A 3SCQA 3ARUA 3E1F1 4P8UA 2W92A 2WC3A 5A6LA 2X09A 5ABGA 5IFTA 3EJTA 4J3XA 3BAIA 1HF6A 1LQ0A 4ZENA 3UEQA 5EFFA 2J7GA 3VGHA 2ZUSA 3VTRA 4B3LA 3O6AA 3S2CA 4MB3A 2A3EA 3OLGA 2YBTA 4H41A 1OCQA 2YA0A 2DT3A 3RCNA 3DYMA 4KWUA 4CN6A 4JZ5A 4UFKA 1QWUA 1HJVA 3DECA 1RD6A 1FP8A 1V3MA 1KR0A 3LPPA 1OWQA 3VGGA 3VM5A 3BXWA 2NT1A 3WH9A 4WIWA 4PEEA
chains in the Genus database with same CATH superfamily
3G7TA 1YY9D 3MGTB 5C5YA 2MQ0A 4EX4A 3VVWA 2AJXH 1XHHA 5HYQB 4V27A 3L0GA 1DQQA 4XO4A 3MSRA 3OA3A 3LBMA 1ZLSL 1NAML 2QT6A 2QSCL 3PWVB 4PI0A 4HNUA 4R83A 3T4AA 2QULA 1HN1A 3WF4A 4OFQA 1G7QB 1EDHA 4QTHA 1ZENA 1PGRB 4KY1L 1FCUA 5E6IB 1ZMYA 3ESOA 4K36A 1SDAB 4A37A 4TQ8A 1FWRA 4A04A 4XCNA 4ATDA 3M07A 5KJRL 2V0TA 4DN3L 4JFWA 3L2IA 3P9LA 5C07D 1OLZA 3GNMH 4UQIM 2AKMA 3FCBA 4O52A 2YZ5A 3C6LD 1FDLH 5D7JC 3UJJL 1PWLA 1I9JL 4Z7OF 2X1PA 1I8IB 5KEZA 3WNJA 2Y06H 1E1FA 1E0UA 5FO7B 3B43A 2IAAC 4DGYL 3L4WA 5CJMA 3B2MA 8A3HA 2PMZA 2XSKA 3QDMD 3V7MA 3IIZA 3HR6A 2RKXA 2VLKA 3U9PL 4HSAC 3C08H 3DX6A 5K9KA 5EOCH 2GGHA 2PCFB 2XT1B 2XQYK 4ZSTA 1OT4A 2BHYA 4PRWA 3OV6A 4F40A 2F15A 4WGVB 2ATPA 4AZCA 1JXKA 4QY8A 5EHFA 4PJ7F 3V1HA 3U4EA 3A6BH 1FTXA 3RY6C 1JPHA 1NMAH 3QSKB 4NKCA 1B0WA 3NEHA 3LHVA 3AVEA 4W5ZA 1R38A 3FB7B 1QD0A 4TSCL 3VIOA 4P8XA 5FLVA 1EFXD 5GGSA 4UQDA 2PGWA 4GAFB 4ZQRA 2CCVA 3MREB 2Y4SA 4I4WA 3F7VA 5IQ9A 4XCEB 2Z4QB 4E3VA 1FX6A 3PU7A 1OYAA 5HHXL 4XWOD 1JFHA 1G6VK 1DEEB 1PKLA 3AG4B 4GQPH 3N19B 4Q52A 4H20H 4FTVA 4HJIA 2F61A 3S35L 1ISVA 3CPLB 2B31A 3ECBA 2FRGP 3DHUA 2LE9A 1W5NA 4UTTC 3KGSA 1S8DB 1OGAA 3IFOB 2V5YA 3NGBB 3O2VL 2VURA 1CFNA 4DPPA 4TX6A 3HUJF 4JKWA 3KCPB 4US5D 4G7RB 1XR8A 3FQUB 5JMOC 1X9QA 2GUUA 4CUCA 1Z3GH 5MHSE 4IQLA 1KTDB 4FCAA 2Y7MA 3EO0A 1QFUL 5CKGA 4XV0A 3PWGA 3BLFA 2VEMA 1BXNA 3FYYA 4OCNC 3AG1B 4OLWH 5LAPA 1VADB 4WWKC 2H32B 2FJFB 3G5ZB 1H19A 3CCHA 1QWNA 1H0GA 3U1SH 1SJDA 1V7AA 1UA7A 4K5PA 2WZIA 2G5BB 5F1UA 2MOVA 1WD8A 2XN9E 1SU5A 4ODHH 1NWRA 4AZBA 4IJCA 5BU6A 1W1YA 2HE8A 5EU3B 2PTTA 2CJSA 3L9BA 4Z8FL 3P3TA 4OV5A 4APXA 2GSJA 3GH5A 4N2DA 3V4UL 3CMGA 4J4PC 5D1QC 1CYGA 4JW3A 4P2VA 3CJJA 3U4AA 3IJSA 4MZ2A 5EDSA 3D3VA 1E8WA 3MUGB 2CG9X 4CVZA 5B7FA 1CQKA 5KZMA 1I0DA 4E4UA 3JZYA 2AXHA 2OA9A 3URBA 3VIKA 4QXIA 1V3LA 1NAKH 3HS8A 5TF1H 1T20B 4KKAD 1S7XA 1HG3A 1NH6A 3QIUA 4ZOCA 1YEEL 3CUPB 1KIUA 4H04A 3BVJA 2VGBA 3JR2A 4UR9A 4WDWA 1YEDA 1BVWA 4G9DA 5T1LA 4F8PA 5BQDA 4P2QD 3QIBB 1OB0A 5JW3L 2WQDA 2XXCB 3E9TA 3FAWA 2VDNH 4P5MA 1BZDA 1NP0A 4EUPB 2BK8A 2L7JA 3BLBA 3ZBMA 2WPBA 3G04A 1IGWA 3L6FA 1YTKA 1I8LA 2IO5A 4Y5VA 3C09B 2XN9B 4TVPL 2N0KA 3QXUA 3QA3A 5ABFA 3GIPA 2E74C 4JO4L 1F3JB 3PP3H 1IGMH 4NKIH 2G4FA 3QQWA 4BWWA 5JHMA 3OZ9H 1H5YA 2J8FA 3TA3C 2IH9A 5LNEA 3WN5C 5D9SA 5JYLA 3RNQB 2XJLA 3A5FA 1XP3A 3KLQA 2YD0A 2GY5A 4G8IA 3H85A 3VWKC 1PF3A 3O11B 3H9HA 4Y9GA 3VFUB 3BIBX 3INUH 1J9RA 2BP3A 3TBSB 4MJMA 3V0UA 3E6HA 1PZ5B 4EIVA 2ESVB 3WTXA 5DURB 3LPOA 1BWKA 1YNKL 4U0QB 3EYOB 1HL5A 3VFNA 5FYKE 1K3ZA 3ZE2B 1TV7A 2CD0A 4XNQB 1M7DA 2J2ZA 4ZO8A 1GOWA 4A6GA 3AROA 3LMJH 3UWUA 4TLSA 1XF1A 1POKA 5EU5A 4I2XB 1RPXA 3O9WB 3U2CA 2XETA 1CDBA 3ABQA 4APQD 3SE4A 3GKZA 4P3CL 3IUIA 4M1CC 5SWZB 2WLIA 5JIIA 1IZJA 4ANUA 3HPJB 2YKKA 1GT8A 5KETA 1IARB 4UAOB 1PKMA 3ML8A 3DX1A 4RWYL 3GNXA 3BWAA 3W7NA 3TCEA 1VKFA 4Z7OE 3S36H 4DH2A 4R4NC 4M5YL 3SJ3A 4HIXL 1A5KC 5ESVB 2PWFA 3LERA 3WFDH 2WKJA 2R9RA 1CWVA 4QDGA 5KVDE 4H40A 1ZLEA 4TNFA 3LSOA 1UTDA 5A6BD 4LRSA 1TPXC 5EC2A 1M7OA 1OE3A 5I02A 5FHAH 3U2OA 5EUKB 4FJYA 4MRCA 5IQOA 4OD1H 1J1OH 3L67A 5DVMA 3R1ZA 2CZEA 2CIPA 3HE6C 2F7RA 4OM0H 3NQCA 4KH9A 5HJ3B 3RUGB 5AYZA 3WLLA 1UB6B 5E08L 4XO6A 4TUOB 3LQAC 3CBRA 4FA3A 3MBXH 1NGYB 3QHTC 1KM0A 3C87A 3V0HA 1TWSA 1T80A 4GI6A 3P73A 1O9WA 3TC6A 5BO0D 4X6EA 1GZPB 4N4PA 2VYRE 2QAFA 1EBPA 3U79A 3QBUA 5D6CA 1VLIA 3M1OA 1A7BA 2EEAA 4JHMA 4Y9FA 2EDHA 3V0VA 2FCBA 3WO4B 4NQCE 3US1A 4HYVA 1TKWA 1OGTB 1XCWA 3GK8L 1J87A 2AEIT 3QUMA 4Z7OB 4CQDA 3QLDA 3HUJE 3X1GA 5J06A 4JYEA 4PYHA 3TN5A 3EGXA 3E9AA 5DO2C 2CFFA 4B5WA 2CW6A 3DFTA 4I7VA 5A6TC 2IGLA 1HQRA 2DH2A 1FCGA 4FNRA 3SFKA 5EB9A 3K2IA 1SFDA 4G6MH 1R17A 4WO4D 2X7WA 2Q10A 2LHAA 1TPC1 4FALA 4EDWL 1A1OA 2HPTA 1F18A 3CIAA 2AXFA 3R7QA 1S1RA 2JEPA 4HDIB 1TT6A 4FHJA 4A3YA 3JV0A 2X2YA 4XBPB 1D9KA 4DZHA 4YGVB 4P5TC 2C8NA 1TZ9A 1IBDA 2FBJH 3CO4A 2WBWB 3Q5OA 4UTAA 4RSYA 3HFMH 2VKWA 1T04A 5K39B 3IFNL 1G6RA 4DWSC 4B5TA 1HNGA 3EXTA 3EZ8A 2XCMC 5DRCA 2NXZC 3P9WB 4LVAA 5D55A 4KBXA 3VFGH 5GIRA 4AZGA 3BGJA 3SY0B 5L4JA 4HJGB 3VMPA 5C0QA 1X5LA 1MVUB 3WV0A 3GH7A 2CNCA 3V6OA 1ZT1B 4LU0A 1E6ZA 3ZTNL 1IQDA 3L3KA 4JRXA 1N3NB 4HIHA 3LCGA 4XTRD 3HUJB 1AXSA 2XV3A 3L45A 4ZSOA 2EXTA 4U6YB 3H42L 4BE5A 3F58L 1SGKA 4OZFH 2PPCA 3B7YA 1LJYA 1XPYA 3R8HA 4GXPA 4NENB 1HQ4B 5JW4R 1J0YA 5DY3A 4Y4HA 2E5EA 1E42A 4H8HA 3OW1A 4XXCC 4UYPA 4ODVL 1GG0A 3V1PA 3F7YA 4I3SL 2OZ0A 1BIIB 4LSSH 1ZP4A 2R6OA 4PMYA 2VGLM 3NA9H 1YEGH 1W5MA 3C6CA 4J27A 1TETL 5ID0B 3BP4A 1VENA 4IKIA 3KCOA 3BRDA 3BD4A 4NHVA 4WFGD 2CLMA 3JTSB 4IMFA 4JDEA 3PFRA 1S5MA 3ZXAC 1CB2A 1INDL 1AI1H 4I0PD 1J8HD 2NRDA 3TFKC 3EOOA 4Y2OA 1YMMD 4UTHA 4F7CA 1BJ8A 4L3CA 4GA8A 2DWXA 4MA1C 4NU7A 5JO5B 3QXVA 1T7ZA 1IQWH 2JGQA 1OAXL 4NHUA 3S4SG 3KBEA 2ZOTA 4AQ8A 1ZGLP 1ANUA 1S46A 2IH1B 4WVXA 1W8OA 1MHHB 1MJ8H 1LUCA 3MNVA 1RXOB 4YPJA 1F3RB 5FL1A 3PJXA 4J3OH 1BBDH 3DRQB 5AVZB 3SKJH 1N4XH 3IV8A 5K9DA 2QPEB 5J5EA 3MU7A 2AJZB 5E8EB 2XWBB 7PAZA 2L3BA 2O92A 2EIZA 1T22B 4B9YA 1DUYB 2QDWA 3L7EB 2Y3AA 1XCQA 5EWIL 4YS1A 4Z9KB 3VG9B 3GMLB 1G9MH 1U6AH 2GSIB 1Z9NA 5F9DC 4NQSA 4UNIA 2VABA 1DKWA 1KC7A 3SADA 3RJOA 4KX7A 5LNRA 3M0IA 3DSFL 2MPVA 4A68A 4EZKA 4JQIA 3O16A 3P3SA 4KZEH 1ZEAH 3I6SA 1B0GB 1RAKA 4HT1L 2G3XA 1TYGA 3W87A 2A74A 2IGTA 4M1DH 2FZNA 2I1OA 1G0DA 2R39A 1FL3B 2HPOA 1EEYA 3VVGA 4E9LA 5IFHL 4OJFL 1DVFA 1EAJA 2VZ1A 4BINA 4XBJA 1N5AA 4KKPA 4QWWC 4PS3A 1P0NA 1F76A 5B39B 4O1FA 2I5YH 4YXGA 3VH8G 1K9DA 3E0FA 3SGKC 4IDJH 1DBTA 4XO8A 3LGDA 5I6OA 3QR1A 3TESA 3TYUA 1MIEH 2EUVA 1ZHNB 4LSRH 2Y5QA 1AY1H 3UA4A 3FO2B 1YDPA 3W25A 4N2KA 1DQML 4A1RA 2VR6A 4GRWF 4CBZA 3BZDA 1RSYA 2VP8A 4KKCD 3H3KA 5DWUL 4AWEA 2EYSB 1MY5A 4QOKE 3KPMB 2YKLL 1EEPA 5BUAA 4RDQF 4C4BA 4HS3A 4V1XA 3PG8A 2ZVIA 3LQAH 3L95B 4PJ9C 3ZJ7A 3VXNB 4JTSA 1S7SB 3TQKA 3FO9B 1AZCA 2A6DB 5KMYA 2YPLD 1ETJA 4JRLA 4FEMA 5I00A 4K8EA 2YSTA 2J7LA 2NY1D 3Q5TA 1VHPA 3VA8A 5JXQA 3P0XA 3BD3A 4JFFD 4LY8A 1AGFA 3T77A 1SY6L 3G1AA 5J11B 4XMPH 4AF0A 4YDIL 4BCXA 1HIML 4WUUD 1BTCA 1W54A 3BG5A 4GGHA 3JQOB 2QGCA 3SIKA 1CFTA 2B20A 4JTHA 5D6DC 1PYWA 4L3EE 2W9DH 2J5LB 2E27H 4JRYD 2AQWA 3DX9B 4HQQL 4ZXBC 1P1ZA 4HZAA 4QLJA 3EXJA 2BB0A 4U3SA 2VXTL 5HBFA 4KRNA 1DXFA 1YE6A 2AJYL 3WQFA 3PR2A 1XMWA 2FEJA 2DQHH 2CNZA 1I7TB 1BQRA 5E99L 2ZA2A 3NZQA 1P0DA 5DHVB 4PBFA 2QJIA 4OFPA 4UILL 3RAJH 2ICEB 4BKLA 3QEUB 3K6DA 5ICYA 1UOZA 4QOKB 4ACYA 3TJ4A 1TTIA 3V75A 3QIWB 1JYXA 3OF6D 3AIEA 2NQDA 2H41A 1EJ8A 3JUZA 3UYRH 1RUML 3IU3A 3CH1B 4GIOA 2MQ3A 2BIQA 4N2YA 3R7RA 3NFNA 4DJDD 3QMTA 2DW6A 3TOPA 1U1UA 2AK4E 4CSZA 3UACA 1U58A 1DXIA 2W63A 1IGTA 3TO4B 1H62A 4PTTB 2FPTA 1I1AB 4UTLA 3NCJH 5HI3D 5DGQA 1HAUA 4R2GC 5LIWX 3FFCE 2WGNB 3MRRB 4TLUA 1HO4A 4GZIA 4X4XB 1G7MA 1JGVL 5C71A 4ZAKD 3VE0B 4W9HC 3BUVA 3MMWA 1W72L 4G7VL 2OSLB 3SE8H 2Q7YA 3IDJA 1KPVA 1GJUA 1L9PA 4LF3A 1MAJA 2OMYB 1R3WA 2P5WA 3IANA 3HE7B 4WY7L 2DIEA 2B2XH 3L21A 4MNLA 12E8H 3BUDA 2PXYC 5JR1L 2XTJE 1S3KL 3QDGB 4FFWC 1ZD6A 1U8CB 2OXHA 4E8GA 2UZ9A 1TPFA 3KXFD 4M9OA 3TROA 1TJGL 5IVOA 5KSAD 1P0KA 3ZR4A 3WDQA 4N9OB 3BAYA 5T9BG 3ERPA 1V4YA 2X44D 5JHLH 1HQTA 1UA3A 2HPIA 2WM1A 3BPWA 1L0PA 3VYPA 4GAGL 3WGUB 1HZHH 4YQXH 2QDDA 3LV6A 5IZ7A 3STCA 3KG5A 2DYPA 1V6TA 2AK4B 3RJXA 1FRBA 3WIIL 2VRAA 1BA9A 3ZJ8A 1NCDH 3QUYA 3B8TA 5TK2A 2VT0A 2F53D 2G2PA 2QNEA 1VPOL 4WUKL 2VDPB 3RVUC 1HKMA 3N2BA 3FFCB 5JXEA 3X12A 2C18A 5HHPA 3LZFL 4QRUA 5DD5H 2GSHA 2DM4A 1SQ7A 3TT1L 4OE7A 4N20A 3SDDD 1X5ZA 4PI2A 1JUBA 3TZVD 3EWBX 2VITA 1TSHA 5CCHE 3BKYL 8FABA 2JTYA 2LU7A 2HXUA 1AHWA 1TTFA 3U83A 3L3GB 2FYVA 2CM5A 2D0GA 3NO3A 1ZB5A 1E73M 2E8ZA 4AVNA 2WQPA 2ZSVA 4QUOA 1RCXB 3KEDA 3DMMB 4Q7BA 2XTJB 1WB0A 2EVGA 5IEKB 1M6OA 4TVDA 3NDOA 3MKCA 2PPEA 3VFRB 1E28A 3UZZA 1NBYA 5I8CB 3ZT6A 3ZTCC 2O0TA 3V0SA 4FMFA 4ZMYA 2IPKB 3BVDB 2HKFL 5DI8A 5IFTA 3ASOB 3EHBB 3DG6A 4J40A 4BFGA 2WXMA 3D18B 3PWJA 2O6FA 5F96H 2P5ED 1A3WA 1CLCA 3C86A 1BX2A 3IRDA 3OLGA 1NDWA 4HKZA 3CN0A 2NY5C 4UFKA 4PVMA 4PEKA 5ISZB 3FVDA 2HROA 4HWBA 3M5YA 1QW7A 3GSNA 1QABA 4XPBH 2DJUA 5D7IE 2CKBB 4MKTA 4CJ0A 3HBZA 4CC4A 2YL6A 4MNJA 4GRWE 4AEHL 5LCVL 2HK0A 1SMOA 1SOXA 3LXUX 2XIQA 1QOKA 3D0LA 1ZKAA 2Y1HA 3MJ8A 2PU0A 1HJXA 4KJYB 1Q8MA 1MWAH 1WKFA 5FW7A 4LSBA 4IRSB 4LRNL 5HDWA 3CFBB 4WHDA 2DT0A 5H8PA 1EVTC 3HC3L 5I1GH 3OHXB 3CQJA 2HVMA 4LVGA 2OPJA 3ARRA 5JIKA 4GJJA 4MG4A 1AYOA 3PLYA 2F7IA 3HVNA 2LW3A 4GI4A 5CJ5A 2EVFA 4JPKH 3M64A 4P4RB 2XFFA 3BC9A 1EJVC 4MAYA 3FUJA 1UD6A 4MLSA 4XHQA 1KEGH 3QQ3A 3TF7C 3ZZQA 5T5FH 4Y16C 5DRZA 4JY5H 1TQUA 1ZJAA 3M8OL 1S7QA 4ACTA 3LSCA 4U1MA 3O3EB 4POCA 4TNVF 2VWEC 1E9ZB 5C2BL 1I8UA 4YLQT 4C6MA 2YMTA 2QUTA 4Z42C 4PRPB 4DKFH 3WNIA 4Q9BA 1VEOA 1EGZA 1MKFA 3EJYC 5D7IB 3OLEA 3V7AE 2QHRL 4BQ5A 4G7YL 4J4KA 4NUMA 5F2LA 3GFXA 4GRWB 1ZGLM 2VFIA 5HYEA 3D4GA 1ZS8B 4R9OA 1P5VA 4WO0A 3MO1B 4B3ZA 4CSSA 4N0CD 2Y7DA 4IMLB 2C7UA 3GUGA 1BECA 4MJID 2EPMX 3WXVH 1VGKB 4FKKA 4L0ZA 5IVXB 5I73B 1GEQA 1AO7D 5KVFH 2HAZA 1X5MA 1UACH 2I16A 4WI6A 1F2XK 4AIBA 3MLTA 5D4HA 3QMRA 1ECQA 2WB5A 1RURH 4XAWL 4C7FA 4LLVA 1WUEA 3VNZA 1AG0A 4R5XA 5JOPD 5KZCB 1U8QA 1NGZB 4HH8A 1T5AA 3WEBA 3LQGA 1UOWA 4UQ9A 1BGXL 2JIXA 1CF8L 4XNMA 3SIZA 2HVBA 3O7UA 1UXSB 1JPEA 4GABA 4NASA 3EDFA 4JN2A 3P9MA 5CGTA 3NCWA 1A53A 3UFIA 2GVJA 5MEPA 3X2QB 3TFBA 2XRAL 4JPIA 1U8OB 4L05A 5GGRB 2TRYA 1HXJA 5H8MA 2IXVA 2KS0A 1PLAA 1Z3RA 1KXQE 4ZFFA 3BH8A 4JGUA 4U4IA 2H6OA 1GPFA 2H7WA 3MNZA 3O0RH 2B0MA 3NZGA 5D1ZA 4N25A 4KRMB 1Q9OA 1KLFA 4XPFH 3QHOA 3GLEA 1JNJA 1M68A 2ANUA 4KKBC 1H8OA 4PJGF 2VDMH 5EMYA 4MXWH 4JGJA 2A9ML 2I69A 2OYKA 4FKHA 1BMWA 4LVFA 4OF8A 4PY7A 2F1EA 4PWGA 1P4IH 4R26L 4GUCA 4N6FA 4KHTL 5L88H 1ILUA 2V69A 5C0IB 3GBNH 3WJLC 2F58L 4JO8A 3E0VA 5G2WA 1U3HB 2NUPA 4UU9A 2ZYRA 3OR6B 3QP3A 1SN0A 1I7UA 1OC6A 3PBUA 4ERAA 3L3DB 1P7HL 3F6LA 5HGAB 3MRFA 4B16A 3QXAA 4MA3B 3BEVB 5HYJD 4UM8A 4N26A 4QIUA 4WDIB 4P2RE 4XPTH 1DSFH 3MJ7B 1G7JA 1WX0A 1EZUA 3TYDA 1Z9OA 2J1KA 2JK5A 3HR5A 3GHEH 4JKKA 3CHFA 2Z0UA 3GK0A 3GXDA 1OCWH 3QDJE 4JRFA 4I6KA 5AZ2L 1OG0A 2QPUA 1AKJD 4MJ6A 2XZCH 3SY6A 3B40A 3MJ9A 3ULUL 5AOUA 1B30A 1GGBH 3V9CA 1W1ZA 2R2HB 3TTEA 2DQEH 1Z5LA 3LEVH 2BWGA 1YYCA 1JPFB 4NZUL 1LROA 4X4YB 1NAL1 2RH9A 3CFJB 4UQ3B 4S3FA 4GSDL 4JZJC 4RFEA 2J25A 2J6EL 3RGBA 1CDYA 1TDQA 3NG3A 4PZVA 3C60C 4FNTA 2NV2A 2EDYA 5ITFB 2D7TH 4Z3IA 3V4VL 4G7QB 1OTTC 3H55A 3LZPA 4O9HH 3NJLA 2XN0A 4EN3A 2EG8A 3RJQB 4A39A 2OKTA 3BEWA 1FFNB 1UT9A 2FJGA 4IT1A 3F65A 4UMAA 4DZ5A 2G96A 1IM9A 3UTTE 4H26A 3L5AA 4P9MH 5A8NA 5LN4A 3V4PA 5G5DA 1KBGL 5HJLA 2CMRH 2CGZA 3IK2A 3UGEA 3WDRA 4O58H 5BW6A 4POUB 3HS0B 5MERA 4MB4A 1MUJA 2E1DA 4D9RD 3QDJB 2P24B 2V7HB 3SJVE 2CKSA 1C16B 4NZTL 4WEBH 1WBZA 2WVTA 3GXNA 4ETYA 1Z8AA 1SYSB 4TPRL 3F5LA 1RCQA 3MXVH 1IT8A 1UR9A 2WBXA 4XMLH 2ZE0A 4Y4KA 3O6DA 4JRWA 2DSVA 4HK0A 4JEJA 1NDVA 1QHPA 1GYWA 2AI0H 1OPGL 3K6OA 1O5RA 4JYDA 5MP6H 2XISA 1WA3A 2EGZA 4HISA 2ATMA 1ODZA 4ZX3A 3MQIA 4DUVA 4C4UA 1HW6A 5J1SC 1NICA 3EKGA 4Z7VA 3PJNA 5JOEA 4UINH 2A4EA 4O02A 5DFVC 3OZYA 3SCVA 1XLMA 5CU9A 4DBDA 1TZZA 1W1B1 1OP5H 3RLVA 3SGJA 3PJSA 3FU6A 4QHUA 5I2IB 3UTTB 4LOUD 4FLQA 3MCKB 5EOQL 2M2DA 3TJHD 1Q0XL 1LP9F 1JPMA 1JPSH 4JO5A 1S7TB 4GK8A 3HV8A 5D09A 5EMMA 4G1EB 3GSXB 2Z1VA 3EFOB 4P46B 3VKJA 3CH9A 2D2CC 2AJVH 1T7YA 1N5YL 3RVTC 4DO6A 3MC5A 2J7FA 3TONA 4G43B 4G8GB 2O9PA 4PWHA 3SJVB 2W60A 2GG1A 4TNEA 2DQDL 2NUTA 3AT8A 3OX8A 4LBRA 3MA8A 1A1MA 2W0UA 1V03A 1P7QB 4GRMB 3GU2A 3TC7A 4F3FB 1IO4C 4GY7A 2YXXA 5JIQA 3CHCA 3V8OA 1MCHA 5T3ZL 4QSFA 4K1WA 4WGHA 4O2FB 4D6HA 3ZTJG 1HI6B 4LEXH 4AHQA 5A7EA 4WNQB 3UBXB 1XPGA 5BXPA 2W61A 1CICC 2ZRVA 3EPNA 4BK8A 4HKXB 1YEKL 5ABEA 3N4FA 3GU9A 5KTLA 2ORBH 2WV8A 3QW4B 2NVDA 3ZYOA 3C4UA 1DL7L 5HHOA 5E1HB 5JORA 2VLMD 3BW9A 4XNYL 5F3BB 4S1QL 1WFOA 2I27N 1OT2A 1WFNA 3GJEB 4LOVA 2HT3D 3QXDB 3T08A 4GG8A 1Q9KB 2Z93A 3QQNA 4HIJB 4TTDC 4UTKA 2R0ZH 2VXQA 5GGUB 1T5XB 4S3GA 5DJ8A 2W9MA 3RZCA 3CDGB 4PJGE 1SBSL 2JEQA 1FHNA 1ESWA 1E3XA 2CPUA 5BVJA 3GB6A 2BRQA 3THML 2KLSA 3VSTA 4XP5L 3PN8A 1XF4A 2HJFA 1A7PL 3IFLH 1FZMA 4Z6AT 2FTAA 1D3GA 4ZTEA 1KCRH 5TGBB 5F9JB 4OKVB 1J0HA 2R2BA 4LSDA 5FA3B 3RU8X 5ACMA 3V79C 1FG2A 3EDJA 4NOBA 1JZ4A 1X97A 2A0NA 2J7HA 3CZEA 1NGPH 4H1LH 2O61A 3ZLHA 4RQQA 3V5KB 3TLRA 2AK1L 1MAMH 3L5IA 1EO8H 1OCOB 1OAKH 1TVHA 3X3GH 2O7QA 5IB2A 1TZ7A 4DP9X 1TTGA 4R7WA 4NNPL 5I3IA 5J12B 5LGHH 3RVVC 2J9ZA 1R47A 3ALWA 5CINH 1VJIA 2Q76A 3SDAD 3STEA 2OFQA 5C8BB 2ICSA 2J4WL 3ARDD 4K5NA 3LTYA 3ARGB 3D85B 4ES9A 3KYNB 4OJDH 3WHE0 3TWCH 1YADA 4JZNB 4AZ8A 3W6LA 2OZNA 3O6KL 4FL4B 2HXTA 4OGAD 43CAA 1TTCA 2ACQA 3SI9A 3CDFA 1A5FL 1JV2A 2VXSH 3NTYA 3HNSL 3BANA 1AYRA 2IAND 2I60L 2J9YA 2DQIL 5I3FA 2QVNA 4LUSA 1SVCP 5C0ND 1DVZA 2FZ3B 4BK4A 4YIWA 4PJBF 3FJ4A 2Q2LA 2X7LA 3ABMB 2ZX5A 4TSAL 5HNRA 4Q6IA 3NZRA 3I2CH 4GW4B 3EYUH 1YECH 5DK0B 5CUSH 2AMUA 5FYJD 3FRPA 5JBFA 4JFTA 1S7RB 5IMLA 4R5EA 1SBBA 1NC4D 2QADC 4B9JA 4OGXL 3E02A 3N9RA 1FBAA 4PTXA 2WMIA 5E6SB 4YVPA 1GJWA 2WQXA 1S7UA 4P3WA 3DJSA 5DVLA 1TWZA 5I23A 1KELH 4N2HA 2NLIA 1DLFL 4CGTA 4P2OA 5DJXA 5G4HC 1I1YB 4NM8H 1T41A 4I5XA 5G4EA 1KN2H 9CGTA 3BJLA 2GHWB 1C12B 5CGQA 1DQDH 3UMTA 2VAJA 4XQ6A 2E5CA 3F2LA 2CHNA 2ATKA 2DQMA 1XCTB 4XXWC 4NQDE 1E9YB 4YEFA 3C6EA 1XRFA 2E9IA 1K9EA 3FEMA 5C7XL 3TCXA 2FYYA 4WJXA 2AGKA 2YZ1A 7TAAA 3B04A 4LJ3A 2PSNA 3P40A 1DIOA 4J7RA 2DQWA 3ZVIA 5IQ7H 1TLKA 2WLJA 3FOLB 5D7JB 2BZNA 4L29B 2UY6A 3QOKA 1XIWC 1U42A 2G0KA 5E2TH 1OXYA 3GVVA 1KBIA 3U2IA 1NFPA 5DXXA 2GVLA 4Y9OA 1OK8A 2XPYA 4NQ1A 1BXXA 2Z65C 3M1ZA 4EP8C 5DHXB 5FKPA 2I17A 4M48H 2APBA 1GCFA 1SFTA 3K46A 3G1RA 4FOUA 1OFBA 3B7TA 2DYSB 3Q2LA 4X9IA 4ZD3L 2WSYA 2BVWA 2VL5B 1LP9E 3FO0H 2V6AA 4ZQCA 4DWDA 4IL2A 3SDXA 4BF7A 1EBAA 3OC5A 4LL4A 5F1NB 4P5RA 3EKCA 3N4EA 2ZP0T 1JDAA 4MB1A 4LKXB 1BVKB 1C93A 1B3OA 1WFIA 4TOYL 2BOCB 2IGFL 4Y2DA 4ZMVA 4NZ8A 4ZSUA 4MS6A 1SZEA 4HN8A 5HHME 3SRDA 1FHUA 2ITCA 4NQDB 1AS7A 1KFCA 4OQTL 1KYDA 3RKDD 4BWLC 1ZWIA 3FCPA 1WZ1L 1UJ3A 5D1QE 3T3PF 3OMIB 3ECVA 2EIJB 3GDTA 1I3RA 2V3EA 4A35A 3PGDB 4UDUB 2DN7A 4JUTA 3SN1A 4DK5A 1RBLA 3TYAA 3CQ0A 1A3LL 3B34A 5FB8B 3CVIH 3T8QA 2FWLB 1R5IB 1C08B 4I8DA 3FS9A 3W11D 4M8QA 1XC6A 2WD0A 2VRJA 4JFXA 5JUVA 4UBDC 1CI3M 3HOJA 1L5GA 3BI9X 4U3HA 3EPOA 1KBJA 1VYRA 4HPYH 2XICA 4HJUA 1URLA 5F1VA 5E0KA 3NCYS 1GKEA 2VLRA 4WWKB 3A0OA 4BXVA 5C0BA 2OOFA 3H2PA 4OZ4B 4L4JA 4LK4A 1GW0A 4ZMGA 3S5SA 2NXGA 3TNMA 5DD6B 2WYZA 2R0LH 3TLQA 1UZ6F 4G9FA 4IBSA 3C0QA 3NQMA 4BWTA 3BZ4B 4XC1L 1VYSX 3DFHA 3HNTH 2P3YA 5B7EA 5ABHA 3WH5A 1AGCA 2Q8XA 5ICUA 5KYUB 3PWUA 2BZ7A 3U46A 2MPAH 2B1HL 3GUWA 2SEBB 2HTKD 1RZ8B 4JANA 2XZ7A 6REQB 4D8PB 5D1QB 4I9WD 5DVKA 3GPSA 2B14A 4MWAC 4ISVA 3WJMB 2FECI 4P8VA 4D94A 4LCUB 4IBLT 3DOPA 2ENQA 2V5MA 1R6WA 1U8NA 4NN5B 1U8PB 1KW1A 3NBNA 1AH1A 1P7KA 2GSGA 1DWIM 4ZFMA 5GJPA 4FFTA 2VN6A 3TIEB 5TFSH 1IEVA 2DWYA 1DQWA 1RKRA 3TIMA 3WJXA 3C6SA 2OTUB 4NKMB 1UVQB 2ZE3A 5CEZH 4XMVA 3W1LA 4S1SH 4W4QA 3DO7B 5C07A 1G6CA 2H8PA 2B9AA 1XRTA 3TNOA 3C6LA 5FOOA 3BVNA 1XGQA 1K8IB 2MOQA 1R5WA 2Q86A 4G3YL 3WIHA 4LIQE 1F8TH 4OJAA 3G5WA 2XKNB 1QNOA 4BKSC 4P7LA 3QDMA 4NQUA 4Q8QA 5JZ7D 4J8RA 3K1GA 3TA3B 4XCFL 3UJTL 1UURA 1IIIA 2DOCA 3SDYH 2LLLA 2AQ1A 1QP1A 3KPRD 3SCMC 1WA2X 3CK0H 4ZMTA 2VJ0A 3VWKB 1MFCL 1JCLA 1VS1A 3MA7B 2DFAA 2H6PA 5GGTA 3VI2A 3KOWA 4WLCA 1A9EB 3MB9A 3VAVA 5SWSD 3NJJA 4M7TA 3T0EC 4WY0B 1H1ZA 4PGCB 2HP4A 4HOZA 1FNLA 1V10A 2BBFA 4FQQB 1EFXA 3G5XB 3CIWA 2F5BL 4TV5A 3W22A 1U8MB 2X70A 3G3MA 5FM4A 3QEQE 1MI5D 1ONRA 1J5TA 2R4SH 1PLCA 3TH3T 4CCCA 1VACA 3CFUA 3L5JA 1RZ7H 1KYOJ 3OJMB 2INZA 3BL3A 4Q9QH 2YGPA 2E4FA 3P4OB 4MQTB 5IFJB 1VRSA 4G6KL 1OAUH 4P5KB 1MCSA 1OD0A 3AS2A 4AVJA 4CLMA 4X7SH 4US5A 2PP1A 1KJMA 1PHQA 3QRGL 4AL8L 5C3TA 1C5DA 3IAQA 4FQ2L 4PTWA 1UD3A 2NX1A 1XYLA 2IALA 4Q4MA 2WXPA 3PDDA 4JNMA 3KWXA 3UPWA 1HO1A 4ZMXA 4UB0H 4J3OC 4P8UA 2WC3A 4NQVA 3CLEH 1FNSL 3PUEA 4H6RA 2J7GA 5I26A 5D4QA 1NDMB 1TPXB 2YBTA 1ORQA 5CJOH 3VKBA 4M61B 4JZ5A 5KWYC 3JTTA 5IB3B 1QWUA 1QEWB 4DZ8B 3WFEH 2NY2B 1G9MC 3HE6B 4RIRB 4LLQA 3UJIL 1IBGH 3K0WA 3TL5A 4XKMA 4JPWL 3CYVA 3M16A 5FESA 1KENH 5T26A 2WCAA 4POZD 1S3RA 4RPQA 5HHNA 1E56A 2VC2L 2ZWYA 3TN0C 1AR1C 5IB4A 1MCPH 2YBGA 2OR9H 4NUGL 3AM8C 2Z2UA 3PS7A 3L5XH 1D7FA 1M2VB 4HUUB 2XWRA 1CLVA 3T3PE 1TJ1A 5H2BA 1YC8A 5DLML 2ZKHL 1K8CA 1YJDH 3M17A 1KFWA 2P42B 3VOHA 3QEZA 2H1LM 4GC3A 2VXUL 1FE8H 4S0SD 1FVDB 3V3WA 3MA9H 2DICA 4X7FC 3QN3A 1FNGB 3L1EA 2DLIA 5J3HC 5CWSA 2GFBB 1JN6A 4PIRF 3EO1A 4HUNB 1ETA1 4P2QA 3TV8A 2R23A 2XM2A 4PJ7E 2X4NA 3VQLA 2XNAA 2JB6A 3ILPA 1MCWW 2PWDA 3QUZD 1HCYA 4HNOA 3K71B 1QTWA 5HHVL 5TTRA 1P1XA 2LTQB 4ZFCA 1AGDA 3KYMB 2W0FA 1OW0A 1PDKB 5J1AB 5JNYB 1VCFA 3VPLA 3L1OL 3OJVC 4D6CA 2R59A 3PPFA 3WTWA 1J93A 1KB5L 1UZ6E 4JPVL 1XGUA 4XP1H 1FWCC 1VFUA 1N12A 5EZPA 1U30A 3BPOB 1IEQA 1AOZA 2YRLA 4G70B 4M6NL 1N67A 2Q5BA 4QXGL 3D87B 3UYCA 2NZIA 5DZNA 4U6XA 2COVD 1QZ1A 5I0YA 2QGYA 3T3PB 2AAVA 3IGAA 5AFDA 4EXAA 5I75B 4TUFA 4PGLA 5GJTL 1J11A 1TITA 3A4WA 1QJWA 1FNEB 4MMYA 1FL6B 3VI4A 5I8EB 4XTIA 2NYYC 4GKSA 1UZ4A 1WH0A 3B0VC 4XPHH 2WANA 1S2EA 4U0RC 2O9RA 1Q7QA 2R51A 1P84J 1QEXA 4APQA 1UT1A 4JREB 4PJ7B 4XC3L 5KANG 5CLTA 2Y5EA 5ICZB 1DIEA 4LYKA 1ZANH 5DD0H 5A8QA 1I9IL 4RA0C 3VFPA 1K70A 4OB5H 4LL1A 2ICWJ 2PP9A 1IAKA 1PTAA 3CWHA 2QYGA 5G2HA 5HDQH 4L9LA 1CC3A 4MY8A 3T8LA 1NOWA 3AHVA 3AXIA 5I1JH 3JWNG 5E8DH 4RZCB 3EWDA 1QT1A 1GONA 3SQBB 1X8CA 4KVCH 2JELH 5F1IB 3WK1A 1A65A 1D6VH 1QUPA 5A6BA 3UAJC 2Z7KA 4ORZC 3C5ZD 3NFUA 4NQCB 1OGPA 2AQNA 5AG9A 3WLSA 3D9AH 5DN1A 1ZSDA 3F7PC 1CL7L 4B9PA 2D24A 4ACZA 1T21A 4HS8L 3M88A 3KVKA 4DJFC 4ONVA 2BH0A 4QHLA 1RFDL 1IAIL 5TQLA 4IKKA 2RTTA 1H7PA 1HS6A 1SJEB 3GRWA 3UR8A 1KNOB 2PYEE 1JHLH 3VXSA 5F0PB 1K2DB 3M7SA 1CEOA 5CIPB 1QK0A 3RY5A 3O3AA 1KJ2A 5ADPL 1CYXA 4K23H 5CILL 1U8HB 1RERA 1EEQA 5DHDA 4Y0GA 4C58B 1GKOA 4HUMB 5E8OB 4MZ1A 1IMHC 4J1UB 1XBYA 3W2LA 2CHWA 1A6ZB 2QCDA 2X0WA 1IUZA 3F04A 1K02A 5F3HA 3II1A 4O1DA 1UOLA 1NDTA 2R0WL 3V0EA 3T1GA 4OLXL 3TBWA 3PGFL 4UQ2B 3GB7B 4WO4A 1FOBA 3GY1A 3KCJA 4X50A 4HFWA 3QR0A 4L8BB 3TBTA 3DIFB 4AEIH 4PRBB 4UNUA 1VHNA 2HT2D 1Q6RA 4H3DA 5EDXA 1NIDA 1RP8A 1TIMA 3MROB 2KZBA 4X6FB 3T8VA 1UROA 3BUQA 2Y0FA 2ICWI 4H88L 2DB8A 1ITQA 5AKVA 1WNOA 1W91A 3B37A 4N0YH 4PWEA 2XWTB 4Z7AA 1DN0A 5CP7A 1PKYA 3ROOA 2PYEB 4FAAB 3EJRA 2ZKWA 2AZAA 3Q1SH 2B3RA 3NQGA 5KVFE 4ZQPA 1LMIA 4QAMB 3VXTB 4RRPA 2XU9A 2WYHA 4D0CB 1JZEA 1NBZB 2NY3B 4LEBA 4YJZL 3N29A 4E42A 2QUMA 3QK0A 2NX5D 1XGRA 2E9GA 4YVXA 2GQ8A 2A6LA 4XZHA 3OKEA 4IBYA 1F8MA 4PJHA 1R3KB 1O94A 3ZLQC 2ALDA 4WTZA 1NCCH 2J8UA 1RHCA 1DBAL 4B3KA 1KXTB 4JE4B 1BYNA 3EZJB 1S2TA 2KC0A 3F6JA 1CXHA 2V9QA 4JDTL 3HC0A 3TA9A 4TNWF 4YHLH 4OLUH 5I74C 3D06A 4UIMA 4EOWH 4QKTA 4O4WA 1F4WH 3BP6A 5HWJA 2H1PL 1TMQA 4GIAA 4P49A 5BMFL 3NZ8B 1E4MM 4G1NA 2NW2A 2PLJA 3WL9A 3VXMD 2G75A 2UX6A 2BTMA 2CZ5A 4DLFA 3CFTA 2X1RA 4YTSA 1OP3H 4P7OA 4I0PA 1J8HA 3R7MA 4PB3A 5JPNA 3GSVB 1YMMA 2CHZA 4JKPL 3SPVA 3WQVA 2WBGA 4OLVH 3MCNA 1CFMA 1FCVA 3W71A 3HEIB 4BK9A 3RDJA 4LRIA 1JNHB 2P8LA 4KROC 3BZFA 3HMXL 3L3IB 3QNFA 5HQLA 2Q01A 4KUCD 4L9DA 5AW2B 2F8IA 1S7WA 5A3IC 3PPHA 1FKXA 2W80C 3RI5K 1EAQA 1GVSA 3QH3B 3KPPB 2P1YA 3UCQA 4CL7A 2FEDC 1AA1B 2BS8A 4PW4A 4K37A 5CZ0A 3ZXWA 4UBPC 5FGRA 4HCHA 5I0ZA 2ATSA 1TR9A 3RLGA 3VFVB 1OCCB 2AABL 1RIHH 4R2GB 1BQHA 2RGLA 3TZFA 4AMCA 4ESKA 1OZMA 3DFNA 1EZ2A 4WDXA 4W7UA 1QFPA 1TJIH 5DVNA 3KBHE 1TXKA 4P5SA 2H0JA 1OLLA 1ZTXH 4FULA 1OK0A 1IC1A 2CRYA 3NACL 3ZL2A 3L0NA 3IAPA 3R94A 3D30A 1KCSH 4N0UE 5AYXA 1HKLL 3ZVVA 3Q06A 3K2GA 2YFNA 2P43B 3AZUA 2VISA 2PDPA 2ZSWA 2AV7A 3L54A 4DAFA 3WSQH 5AZEL 5FEPA 1YE4A 2VGGA 4AENB 4CEXC 3WHE1 3H7BB 1DBML 3IBEA 3INOA 4KZ0A 2C3VB 4GCXA 4Z18A 3O2DL 1AD0A 4JYFA 1BEYL 3QO0B 2MANA 4EBQL 5I16A 1FO0B 3L66A 4RGND 3OB8A 4HG4J 2HG5B 2IG2H 4MFDA 1D5IH 5IJCC 1IGCH 3UYPB 3V8CA 1R19A 5L8LB 4BYHA 2X3CA 3BAXA 2Z31D 5E8PB 3OAUL 4NJ9L 3WKQA 2Q0ZX 4L3EB 3S9IA 1W0VB 2FH6A 4LWWA 3MHFA 3S5OA 1MOEA 4IDLA 4QI3A 1T4WA 3HZMB 3WBYA 2YPLA 4XE5B 4BEIA 2CO7A 4XNBA 4M1RA 2EYTA 3TCLA 2B15A 2WQVA 3EGSB 5FV2A 4CA4A 4EDXB 1GTNA 4JFFA 2WO4A 3BCDA 3DJRA 2DQTL 4O2EB 4WUUA 5TE6L 2OXGA 3RDTC 1S7VA 2ESCA 2TODA 1EK3A 3IWUA 4QDWA 4WQ6A 4XNZC 1GORA 3SUSA 1B4TA 4XMTA 2ABAA 1U8LB 5HXMA 5FYKL 3VXOB 4JRYA 3MRCA 1GJPA 2J62A 1XINA 3DV4B 4KRLB 3KLKA 1HWGB 2CCRA 1FJ1B 2VWEE 3SKMB 2V17L 4HK3N 5T1DH 3BGFC 3K6SA 5EBMB 1GZHA 2NY4D 4JJ5A 4JTUA 3IGSA 3YPIA 4ZB5A 1A5SA 2KZ1B 1R7OA 3R06B 4QCIB 3GZPA 4CMHB 4K68A 4M29A 3DRTB 3KM8A 4AUUA 4FG6D 1XZWA 3UABA 4FZEH 6FABH 4TV6A 3NVQA 3OF6A 3HKZA 1IXNA 4LHUD 3IGFA 3CC5B 5L6YH 4HA4A 2N0MA 4L8SC 4NZ3A 3TVMA 3C8DA 3FQWB 1TUFA 2PDNA 1AXTL 2RCSH 4BFAA 4YGAB 1AD1A 4DJDA 3H6AA 3A4XA 5MHBA 3QWNA 3QEGH 1JZIA 4P23C 1TJRA 1ULVA 3IPBA 4JNZA 1T5WB 2AXJA 2CLFA 4L1XA 1KCZA 3CZFB 5ANME 1TU2A 2EKSB 1MRFH 2OMVA 1I1FB 4U6TA 3RFZA 1KPRA 1Z2KA 4MMZC 3OODA 3KYAA 2BWDA 1YPXA 3ATZA 5HUOA 2EH7H 2TSBA 3EOEA 4WV1A 4WKZA 4Y16B 2OEJA 3T7VA 3IDYC 4LKCB 4KI5F 4ZAKA 2I9LA 1G7LA 1CE1H 2AITA 1XF3A 3RM9A 5A2CA 5C9XA 3UTPD 3KTXA 3MRJB 1E6QM 3KPQB 2AVGA 2HJPA 2JI2A 5FF6A 5A2KH 1DFBL 1VEPA 2WQ8A 2H2PD 5J56B 2Y2YA 3IUDA 2I7SA 5IM7B 3NEOA 1PFCA 1JVKA 5J1TC 4I9TA 3CX2A 3D69B 2A0LD 3PDOA 3G6DH 2FBRA 2ZQ0A 1MREL 1XH3B 1U93A 4OM1L 3KXFA 4RXGA 2VW7A 3IIOA 5KSAA 4DEPB 1E4WL 2J88H 2XWXA 4O5LH 2QPFA 5XIAA 1SR9A 2X10A 5HHQB 4ZS6D 1IEXA 1J48A 2VHLA 1AJ7H 1GTEA 5I9QC 5K93A 5FW8A 4OUUB 2A4ZA 3EDKA 5EO1B 4PUUA 5CG7A 3C5QA 1E7VA 2R2EB 3KOFA 1XXDC 4OIFA 1R24B 3QUKA 3WK3A 4ZMQA 2F53A 5ANMB 1A49A 3BKMH 3CVHB 4TKWA 4N2LA 5FYLL 2JNZA 4TSBL 1WC7B 4U1KA 3W0WD 2PDLA 3D3FA 5F7AA 4XAFA 2X5PA 4RMWA 1RUQL 1MI3A 3H26A 3OJDA 3GTFA 3UZXA 3SDDA 1J1PL 3FO1A 4O51A 3CXHK 4GPVA 1H60A 4BM7A 1JI2A 1KC5L 2CALA 4OBRA 3IJHB 4JAMB 3LIZH 5CC3A 2DWTA 2E56A 2HRPH 4P5UA 4J1OA 3HHSB 2NZ9C 1NQ6A 4ZX6A 3FGCA 3Q37A 1EEXA 3HPAA 4RX4D 4PRHE 5D72H 1F11A 4RISH 1N2RA 4MF4A 2F54E 1D8CA 3FSUA 2V3FA 1ZCRA 1MCIA 3KNBA 5I1IH 2JJUA 2VDQH 2XN2A 3WLBB 1DHPA 3WYZA 4HJ0C 2WNNA 1KRBC 1A4KA 1IBHA 2VDHA 3KPNA 5EBAA 2P5EA 2V5KA 5CSUA 2VR2A 3Q3GB 4DK6A 5A6MA 4M9PA 4AD5A 5GGVY 1E3ZA 3AY2A 4D0DA 4J2MA 4TL5A 1QYGL 5F21B 3SY1A 1WEJL 2OEKA 5CPSA 3VILA 1O1HA 3VE9A 1KTCA 1NP2A 3RWEA 1PSKH 1XLDA 1XH1A 1TZGH 1RULH 4M3PA 1KIRB 1RZJL 2PDMA 1EAPB 1ONWA 5DJ2A 5I1LA 4JFVA 1CFQA 2Q20A 3FKUS 4IH3A 2OL3A 5EN2B 1EUUA 4CVXA 4NCDA 1L7IH 2CC0A 3PAYA 4X5RA 4K9EL 3FY1A 3WE6B 3QRFM 3N40F 2HWGA 3VCLA 3AU6A 1UD4A 1YYLL 2XWJB 5AVQB 4RFOL 1LE9B 4UTIA 2YCIX 3CMJA 1XCXA 3NSDA 4UT7H 2WSQA 2NQ5A 5AOIA 2EPKX 1P5UC 4JQ4A 4P0DA 4GMSH 3V6FB 3NK3A 2D3NA 3LUTA 1N0XL 4UUJA 4PTUB 4PRHB 4HLEA 1E2WA 3O4OC 2F54B 4PWKA 2O4QA 3IF1A 1IIKA 4K8RD 2PDWA 7FABL 5IHHA 3PANA 4ZTPH 2E68A 3QXTA 1S3TC 4DNLA 1FRGH 1QNZH 2CDFA 4N2IA 3DX5A 4H8WL 4QRRE 2YPKA 4XP9H 5TDPB 3RWCB 4IRJD 4DY1A 1EZLA 2BWQA 1KQYA 4PU2A 2HMID 1DQLH 4XNXH 1SGJA 4NNYA 3LB6D 5C0DA 2YO3A 5FO9A 1ASPA 5FGBA 1F4XH 5JQ6H 1YAIA 3LKOB 4XD5A 2VUKA 3QWRD 2P28B 4NKDB 5DMIH 5I6XC 4FMKA 1OF2B 5HPMA 5LA1A 4R0LA 4O4YH 1SYVA 3MLYH 4ZR8A 1SXZA 5TPWH 2CZDA 2FHCA 4NKQB 4MJIA 4M03A 2P49B 5A6IA 3CQKA 3KBWA 3OKMB 2ENSA 1WBJA 1AO7A 1KTRL 5A7BA 4IRZH 4Z0SA 1JVNA 5AW8B 3HPLB 5T1KD 3R6IA 4KTYA 2J8TA 2O9TA 2BZDA 4N86A 3RU8H 4HZ7A 1Q94A 4P9HH 1ACXA 5HI5C 2P8CA 5TNVA 4QT5B 5ESQA 3SRFA 2VX7A 3ATEA 1WDAA 1Q6FA 2VIRA 2HYMA 1DUZB 2CH8A 5J8LA 1MFEL 1OTUD 5CCKL 2F7OA 4Q9CA 5AB2A 2EDQA 4D9QE 3R25A 2WMFA 4LDCA 1X5AA 4LNRA 4U49A 2B7PA 1S5IH 4HF5H 4QRRB 1TLMA 4ODWA 4ECLA 4OW6A 4C7GA 3SDCB 4XO3A 4G8EA 4MCZA 4GMTL 1MCRA 3K91A 3WDJA 4OOZA 4E4PA 4NHCL 2BNRD 4LOCA 4OSUL 1UP2A 2P8MA 1GVEA 5CJNA 1XZ0A 1BF6A 4K9JA 1BFOB 1R33A 4P2RB 4P4KC 3WLIA 4OCYL 2CIKB 2Q8AH 3ONCA 4X0KB 3ZZ1A 1LQ2A 1PNCA 3VRIB 1Q7ZA 2DBLL 4MD0A 1CMOA 5REQB 3VGHA 5FFGA 4OZIA 3JV4B 3QO1A 4H41A 2YA0A 3U6RA 3RCNA 1HJVA 3DECA 3P0VL 3V0JA 2C1GA 1RPQA 3Q6GL 4KEMA 1ONQB 1QUNA 1FSKC 4LFHG 1DOSA 1OFDA 3GJFA 5I6KA 3I6LE 4UTCA 4KRZA 2YAMA 4MDJA 5IFAL 3HFFA 4U5IA 4E3TA 4QHNB 3NAVA 2ZX8A 1X5HA 4MAZA 5CZSA 2PEVA 5HYJA 1TQJA 4PYSA 5BZXA 2C16A 4NN7C 2KQMA 4GWEA 3STZB 3ULVL 5DC2A 3T2QA 4Z3EA 15C8H 3MXWH 1CICB 2BCMA 1KT2B 3Q67A 1OALA 3AU0A 5I66B 2Z6JA 1SLVA 5GS0D 3QZOA 1R85A 1WBXA 1EIXA 1OL0A 2W95A 3R58A 2NNCA 4KMTL 1UWUA 5LNWA 2BINA 3S5LA 3W1TA 3V5HA 4H8NA 1AKJA 4K15A 3O4LE 3DYPA 3RVXD 1AAJA 1YAZA 1YUKB 4P59H 3ZJKA 2QV2A 3NCMA 4OZGF 1XIIA 5C7VA 3X3FL 4NT6B 4BFKA 1LBMA 4K2UL 1II4E 3IGUA 5D8JH 1RQ5A 3FB8A 1ZTVA 1A6WH 4IOTA 4M5PA 4ZNEE 4CW1B 2FTWA 1AZVA 1PS3A 2XQBL 2YDAA 2VE6B 1NWTA 5DT1L 1XLEA 5K4ZA 2GGGA 2ZFAA 3AT9A 1I60A 3TBVA 2CZFA 2E5BA 3KWVA 4AWUA 1JZJA 2XSBA 5D2NC 1BVOA 4O15A 2OZ4L 2BFVL 1HEZB 2RB8A 2VDPL 3S96B 4PTVA 1ZLPA 2Z0IA 3N14A 5EG6C 1KBBA 5CEYA 1UASA 1IM3B 1RIVL 4Z78A 2C3GA 3Q44A 1IGFL 3FHAA 1EPXA 2OR2A 2VCAA 2HT4C 4CGUB 5ANHA 3PCYA 2XZ9A 1X7IA 4PJ8D 5ILTL 2BNUA 2CO4A 3GSOA 4B5EA 4JM4H 3K81A 1LEGB 5IHZA 5KYWA 4KI5C 4ENLA 4YHKH 3HG1D 1ORSB 4XAYA 1XDLA 4JQIH 5LVEA 3NQ7A 4MGGA 4XXDA 3CHEA 3TBYB 4JGMA 3RWHA 1U92A 3RO8A 2VZSA 3M7OA 2YMXL 3VW3H 4A2EA 1MW1A 2A3CA 5H35A 1XQKA 3LEPA 4NI8A 3ZTJH 1V6XA 5DZAA 1E9QB 3CB3A 4LSQH 5F97E 1VKXB 3Q45A 3GDKA 4TMBA 3PWLB 2R0KL 4NSBA 1EBGA 3FU3A 2A5UA 1OY0A 1PZCA 4H4IA 4HCIA 2EUXA 3MWAA 3P81A 3BSZA 2HKHL 3N9GH 5DC9B 1LL4A 1H6EA 2FIQA 3EGDB 3B6SB 5K1VA 3QBTB 3MBEC 3MRPA 2D7OA 5CD3A 4DYJA 4PJIF 1QSFD 2FQEA 3T4CA 4UWMA 4YUEH 2NNAA 1XQ4A 3SO7A 1XD0A 3W7QA 2CKBL 4MJ5B 4LX4A 4NUJB 4LVEA 4IOFD 3I6RA 5C9JA 4H0HB 4PY8J 3H0TB 4MB5A 2NQCA 2HXAA 3BT2H 1PKQA 4EE2A 1Q1JH 4J3OF 3LVTA 2W65B 4K7YA 1C8XA 3CL6A 2UX7A 3HJ0A 4F7MA 2QADB 5C0RL 2UZXB 4RGOH 1A0CA 1R9YA 3HN8A 4XZ9A 2YQ3A 3DETC 5BO1L 5D8WA 4OI9A 4PJXA 2CWXA 5IHSA 4PGBA 3VI3A 2H5UA 1LDPL 1R2SA 2G4GA 4X0VA 5DYFA 2VDNB 3MOBH 4FQIH 3DK0A 4QIRA 5TQ2L 3KPSD 4PJGB 1BZ8A 3UTOA 1OWWA 1TPUA 1FYTA 2JXMA 1TELA 3IMVA 5IROD 2Q7NA 3FTWA 3UY7A 1YNQA 1V3HA 5T8IA 2VMJA 3OOQA 4YXLH 5F1SA 1FN4A 4DKAA 4QGYA 4ONOA 2UWEA 3QPQD 1RI8A 2IXQA 1XIWB 5K69A 3DOHA 5IGXH 2KI6A 3MV8E 3PTQA 1IBBA 4HEME 1W2PA 4FFYA 5AVSB 2TSAA 1AE6L 3T1FA 5EEWA 4ZVJA 1UB3A 2V2XA 5KVEH 1OF8A 2OQLA 4OQVA 4HUWB 2K4WA 2W4XA 1T1XA 4RVBA 4WEEA 1NFDF 1K4GA 5ERWB 2BOBA 4YFLI 4MZIA 1ZV5A 3NN8A 3HRPA 4XTDA 1W3KA 2QV4A 2TRHA 3ZDZF 1S9XA 1JDEA 4I87A 4G1MB 1SPDA 3COTA 2V2DA 4DO5A 3FH7A 1U3ZA 4QF1A 5IBLD 2EDRA 1AJ2A 1G69A 3MLVL 5FEXA 4JDBA 1Q0YL 3NDYE 3WQ6A 1FWHC 2J57A 3NQVA 2PO6C 5GRZA 1TPWA 1RUPH 5KN5B 3AYTA 3R11A 3LRKA 3FYOA 4D3CL 4MWAE 5FUCC 4BKTC 4OY9A 1PBYA 2E6PA 5EF3A 4F58L 1QCWA 3HW7A 5H94A 3SDAA 2WMPA 1QPQA 2R4RH 5CU5A 4LUJA 1M7UA 5HUPA 1EJFA 1ZZMA 3QHFL 2A9NH 4OZGE 1QI4A 4F5CA 1FH5H 2F8XC 5LXGH 3B1TA 4MIMA 1MCDA 2CERA 2JKJA 1XF2B 4HSOA 7TIMA 3Q6FB 4TTUA 2IANA 2NR6C 4GUOA 2KPWA 4LAKA 1EEUA 3V0AC 4BV1A 2UZIH 1M03A 4Y9CA 4E9YA 5J0BA 2ISDA 4BRVA 3QJFB 2G3ZA 1R0AL 4NGHL 2UBPC 5CN2A 1OOAA 4AFYA 4ECNA 2FUQA 2VCCA