3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
2J78A 3WNLA 1DWIM 2XIIA 3VMNA 5FIPA 3WDRA 5E09A 1EOMA 1HJXA 1E55A 1OD0A 4K68A 1EO7A 4M1RA 3EDEA 4LQ1A 4LXFA 3ZMRA 2VZVA 4HMCA 1P6WA 2X2JA 3IANA 1PE31 1TR1A 2V3DA 4AZIA 1NOFA 4U5IA 3GH5A 4D6CA 2EEXA 3T0BA 4M80A 3HG3A 1V0MA 2QPUA 1JNEA 1ZB5A 2VZTA 4UQCA 1W9BM 3THCA 3HZ3A 1UR2A 1ESWA 5HXMA 2PWFA 2J7FA 2WHLA 2F61A 3VD9A 3EJTA 1SR0A 4QP0A 4AD5A 3ALFA 3AQUA 1B3XA 3VDHA 1XCWA 4QLJA 3W6LA 4MAZA 2WHMA 4NRSA 1B90A 4DO6A 2F2HA 2VZUA 1CENA 1BG9A 3ZSSA 3NDZA 1XYZA 3W27A 4D6FA 3WQ6A 3OZOA 1XV8A 2DSKA 4EAMA 3VIJA 1R87A 1E4NA 3AIRA 5I24A 3K1DA 4CU6A 3F5LA 3GYCA 3WY1A 3NIYA 2D3LA 4KRUA 4UNIA 3CV5A 2VUYA 5I2UA 3BCDA 3MSDA 2XVLA 3WF4A 3G6MA 1VJSA 3RCNA 2D20A 5D9MA 3RM9A 1BSIA 1H2JA 5A2AA 3CC1A 4UQEA 1V3MA 3ARSA 2GFTA 2OYLA 1UKTA 1Q6CA 3ARVA 1HP4A 3MV11 4IPNB 3BAXA 4MPKA 1IZJA 1HTYA 3POCA 2GDUA 2ZX7A 3WUBA 2WC7A 4EANA 4DUXA 1HKMA 1XHGA 1JNDA 4H8HA 5A6KA 1W3JA 3WH5A 1J0KA 3IJ7A 1R7OA 2Q8XA 4D6EA 3WKZA 3UG5A 3LPOA 2RGLA 4OZOA 3VU2A 1GQIA 2WMHA 2OW6A 1CGXA 1E1EA 3W82A 2E8ZA 3BLPX 4JFSA 3WIJA 2XVPA 1PIGA 3BAKA 1YHTA 1B9ZA 3T08A 2VCAA 2WKGA 3N13A 5E1QA 3VIFA 5BYWA 1C91A 4DWSC 3SCSA 1F4AA 1CGYA 3N1AA 3WY2A 3VSVA 3SUWA 1UHVA 4U33A 1LWJA 1EXPA 3WQ8A 1JZ6A 1QVBA 3A23A 1R86A 1OINA 4W87A 5IDIA 2YDRA 1E4MM 4AC1X 1E15A 5I0DA 3N18A 2DPEA 5DT5A 3NJ3A 3W38A 4BQ5A 1PJ9A 1UD6A 3KLLA 4GO9A 1UKOA 3VDBA 1WPCA 3BAJA 2WBKA 4LYQA 1BYCA 2F1BA 2WVUA 2ZUMA 1W1VA 2PC8A 1CLXA 2CBIA 4MNKA 5BCAA 2EBNA 1XRVA 4M29A 4CKQA 3GBDA 3GXIA 1GOOA 1G01A 1JAEA 3UEQA 1EHAA 1E9LA 1PSPA 1ZBVA 4D6DA 3IAQA 1LG2A 1C92A 2JEPA 3PZUA 5HOSA 4J3UA 4C7GA 3SIMA 4UTFA 2AAAA 1I75A 4J3XA 4Z2JA 2BVYA 5GNYA 2WLZA 1QI5A 3BLKA 1KCLA 4AD0A 2GK1B 1Z32X 3ZQ9A 4H41A 5C8BB 4WJXA 3MUAA 1E6XM 3TTYA 4PSRA 4HU0A 1GCYA 4OIFA 5I6SA 2D0HA 2ZICA 2DQXA 3VIMA 1FH8A 1CLVA 2WVVA 4JZ5A 4AEEA 2J7BA 1XD0A 5FD0A 1JXJA 1KTBA 1MXGA 5ABFA 4E8CA 1NP0A 1K9EA 1KTCA 1ZJAA 3VIGA 3M46A 3S6TA 2XGIA 1UH2A 1D7FA 2UY5A 1WZLA 1OSEA 3N17A 1MXDA 1WDRA 1SZNA 3DHPA 2A3EA 4NF7A 2WPGA 4GI8A 2X09A 1MWOA 1US2A 1KCKA 2E8YA 1XCXA 4UOZA 3EJQA 2WHKA 2YL5A 2E4TA 3CGTA 3BMWA 2J8FA 1GNXA 5D9NA 2WVSA 5FCZA 1JF5A 2BY3A 2EABA 4AY1A 4GO8A 3WF3A 1XSKA 5A1AA 4Y7EA 1L0PA 3GXTA 3W0KA 3IAPA 1CGVA 1UD2A 3TONA 4GZIA 3KLKA 3WQVA 3SCUA 4HP5A 5TD4A 4Z2KA 1Q6DA 3L2MA 1ZJBA 1KBBA 4B9YA 1DP0A 3BVTA 1JD9A 1PCPA 2EPMX 4NZFA 3VMPA 3W6MA 1BGGA 3ZR6A 1HKKA 2E40A 1CXFA 2YKKA 3SUSA 3VILA 1TVPA 1WZMA 1V02E 3KL0A 4ML4A 1DWJM 3BUIA 3WQWA 5CGTA 1LLOA 3MMDA 2XIBA 1EQPA 3UETA 4PMDA 3SCOA 1H11A 4HOWA 3VUPA 3OLEA 2GDVA 2YOCA 3DX2A 1U33A 3WEZA 1HJQA 1TA3A 1UZ1A 2VX7A 1V0NA 4U2ZA 2O92A 5AY7A 4U2YA 3T0AA 2YBUA 2YL8A 3OGVA 4QAWA 2FHFA 3I3BA 1TQSA 3SCPA 4W7VA 3ZM8A 3CIVA 1HNYA 2XWEA 3WY3A 4W85A 1D2KA 2WCAA 3DHUA 2YBTA 4UFJA 4WIWA 3U5UA 4ACZB 3DDFA 2CYGA 1CBGA 4URIA 2FDMA 4AD1A 1W2PA 3AIVA 5A8NA 2VOTA 1CDGA 1OIFA 1ISYA 2O9PA 5A8MA 1CXIA 5JBDA 3WD0A 1UWTA 1UWUA 1OGBA 5CLWA 3K8KA 4HZ6A 2W4XA 2GUYA 5M3WA 2VT0A 1EQCA 1M01A 3ZSTA 1HJVA 3ARWA 4HA4A 2W67A 1JDCA 3UESA 3CBWA 2EADA 5CSYA 1T0OA 1LWHA 1DHKA 3VGBA 2E0PA 1J0IA 1WAWA 3ZT5A 3WDPP 1NARA 3AMKA 1E56A 2ZX9A 3EYPA 3CHCA 4W93A 5HNNA 2WBGA 2CHNA 4DM1A 3EDKA 5IHSA 2J7DA 4AD4A 2YIHA 1VFFA 3TTSA 2DSWA 1VEMA 2YJQA 1ODUA 3AYRA 1HN1A 5EBAA 1CEOA 5BXSA 4LYRA 2YDSA 4DM2A 2CPUA 1OD8A 3CUIA 4MDOA 1N82A 1NWTA 3AMCA 1UOKA 2VNCA 4C7DA 1HL8A 1CXKA 1A47A 2VRKA 3PTQA 3WF2A 1QW9A 1QNRA 1MFVA 1VB9A 1GVIA 3TTOA 1WB0A 1OGSA 1O6IA 2XM1A 3CZJA 1TZ7A 1UD8A 3PZOA 3K8LA 1BTCA 2E9LA 2ZXDA 3F4VA 4TVDA 5LA2A 2VO5A 1RP8A 3T2QA 3D4ZA 2CEQA 3ARXA 3IK2A 1ISVA 1M03A 3D52A 4GXPA 4V2XA 3FAWA 1UA3A 3BUPA 4UQBA 1UD3A 1WE5A 1HXJA 3GXPA 1RP9A 1U30A 2NSXA 3VINA 2A3HA 3KEHA 3VGEA 5HDRA 4NZJA 2XN0A 2CERA 5A8QA 2BY2A 2D1ZA 3BUDA 2JF6A 4Z2GA 2Y24A 1QHZA 3AXXA 3F5JA 4J3TA 4D71A 3AZTA 4NRRA 5AYBA 3D4YA 3QHMA 3ZT7A 4W86A 1CWYA 2VQTA 4FMVA 3N9KA 1IZKA 1FFRA 1I1XA 4Q22A 3L4XA 4PEEA 4FF5A 2ALWA 3K8MA 1SFSA 4CU8A 1FP9A 5E6ZA 3WUFA 1B3ZA 3AIQA 1W3HA 3K4DA 2F7QA 2XYLA 1J0ZA 4OOUA 3EJPA 3SUVA 3FNDA 3H55A 1JDDA 1ISWA 1TVNA 2WANA 3TP4A 2WZEA 4WLCA 1BVNP 1OT2A 3OGSA 3MSGA 1QBBA 2J4GA 2Z1SA 3U7BA 1QI3A 1E3XA 4X9YA 4AEFA 4Q7NA 2FGLA 4MDPA 4B16A 1XSJA 4J28A 1HKJA 4W8LA 3W24A 1KQYA 1EGZA 4PRWA 1I1WA 3VX1A 3AZSA 1LL4A 4AWEA 1W2VA 4UZSA 1H5VA 1E9TA 3VD3A 2EO7A 3PZIA 1QW8A 3E1F1 5DMYA 3VO0A 4JAWA 2VI0A 4ZENA 4JHOA 4P7NA 4CVWA 2C0HA 3HU7A 2CBJA 1XGZA 1DWAM 4MB5A 4JFWA 4F9DA 3A47A 3D51A 2XHYA 4OGZA 2J62A 1M04A 4XB3A 3BSGA 4MJ2A 3A5VA 2D2OA 3BAIA 1B31A 4OUEA 3VIKA 1JZ7A 3EJUA 1ZBWA 2G3MA 2WC4A 1HJSA 2ZUVA 3RJYA 1E71M 4L4OA 1LL6A 1V6UA 1OGGA 4M24A 3CHDA 3CZLA 1HJUA 1J10A 1PX8A 2AMGA 1V3JA 1Q6GA 4YHEA 4QLLA 1H1NA 3HJEA 3L4WA 2RGMA 3RM8A 3GXNA 3PBGA 2XVNA 3WBAA 1AQMA 3WEMA 3WNPA 1UYQA 1FHDA 5BRQA 4AMWA 2OWXA 1B1YA 3SCWA 3GDBA 2CHOA 3OB8A 3MI6A 1Q6EA 1NWSA 3CLWA 1PBGA 2A3BA 5GQBA 4NSBA 1FH9A 4BS0A 2J47A 1E43A 4TX8A 2EACA 1JZ4A 3L4VA 4AIEA 2WZIA 3N15A 9CGTA 1B3YA 3QOMA 2CESA 4TOQA 2CKSA 2CNCA 3WNNA 1F4HA 1NM9A 3VNZA 2XPKA 1MQPA 3GH4A 2OYMA 4B9ZA 2C7FA 5I3DA 3CZSA 3F5KA 3RPMA 3SCVA 4WKFA 2PF0A 4E8DA 3WMBA 4TX6A 4DUWA 2J7GA 2XSAA 2ZE0A 1QX1A 5FL1A 2GSJA 1GVYA 4M8UA 4OBSA 5EB8A 1CECA 4OKDA 2VQUA 2DSUA 5JBEA 1HI7A 1BPLB 3VIHA 3VM5A 3B9EA 1NOUA 2UWFA 4PCTA 1VIWA 3QHOA 4PBGA 4ZXLA 4YHGA 3WY4A 1JG9A 1RPKA 2ZXAA 3IJ9A 2GK1A 3CZGA 4GKLA 3AHYA 4CGTA 1K9DA 3WDJA 1W91A 3CZNA 1GJWA 2W61A 3VKKA 5BXPA 1R7AA 2B31A 3D5HA 1QI0A 1GORA 4UQDA 1UR4A 4B15A 3GNPA 3DC0A 3FN9A 3MMUA 1BYAA 4D1JA 1E6ZA 2JEQA 4UQAA 2EJ1A 1UD4A 4CCDA 4Z2IA 1WZAA 3PZVA 2IXUA 4LGXA 2DH2A 4WKHA 4PMZA 3VGDA 4J7RA 3SCQA 2G3NA 1E5NA 5JIPA 4JKMA 1NP2A 3EMCA 2DGAA 5A94A 3EMQA 1JYNA 1C8QA 1V6YA 4N0RA 1KGWA 1E40A 1J11A 4MNLA 5CQ1A 3NYDA 1BF2A 5AYIA 1VFMA 3VIPA 5M03A 1BG4A 1UZ4A 4KGJA 4MNJA 4GPNA 1PX3A 3W81A 3VGHA 3AMLA 3LPPA 1B0IA 3ZR5A 3QR3A 3AHXA 3U57A 3CH9A 3FY1A 1AQHA 1E6PA 3MANA 2HISA 1MW1A 3S2CA 3VX0A 1CXLA 2VURA 2PSPA 1CXHA 1QNPA 2QMJA 1FFQA 3N04A 3ARZA 1BYBA 4DO4A 2G4FA 2Y8VA 2FYVA 5IFPA 4DUVA 3OLIA 3T09A 3W28A 2JIEA 1UD5A 4N42A 3A21A 3KL3A 2D23A 2WWCA 2WC3A 3AHTA 4P7OA 3AROA 3SUUA 1KQZA 1H0IA 1OIMA 3GTNA 4W7UA 3VPLA 2G41A 1KR0A 1GJUA 4BQ4A 2PBOA 4R5EA 3EDDA 4PMNA 2V38A 2DSZA 3WNKA 2X8RA 5BROA 2JIWA 1KXVA 1OBAA 3PZNA 2D0FA 2DT1A 3HG5A 4MADA 2Y8KA 1BFNA 1GHSA 1HIZA 4GI6A 1LF1A 3WELA 1NH6A 2FHBA 1R46A 4ACZA 4B3LA 3W29A 4UZUA 3ARTA 4ACYA 2XSBA 4MJ4A 1H41A 1MW2A 4Z2HA 4PTWA 3CZKA 2J25A 4FNUA 3O9NA 2FE0A 1H3GA 4ZE4A 4FLRA 4P8XA 5AC4A 1HXKA 1XH2A 2GJXA 4W5ZA 5F7UA 4AXNA 3WQ5A 2CITA 1WKYA 4IPLA 3U5YA 1XH0A 3RDKA 2F18A 3LRKA 3GH7A 3CUJA 2EPNA 4TTGA 4LYPA 2WMGA 5DT7A 1C7TA 5ABGA 4IUGA 3WH9A 4HOZA 3AJ7A 1RH9A 1J18A 5LA0A 3N12A 2YFOA 4PMXA 4GI9A 3NDYA 4LPCA 1JYVA 1PS3A 3ZT6A 3LX9A 5HBFA 4CN6A 1JFXA 4F79A 4JKLA 3PTKA 1V6VA 2VL4A 2Z1KA 2VR4A 3WH8A 2VJXA 2O9OA 4V28A 5GPRA 4CD5A 3CZEA 2TAAA 1TQVA 4B3KA 4JL2A 4FLOA 5D9PA 1UA7A 4CD8A 1SMAA 3BMVA 1UG6A 2EPKX 1UQYA 3M7SA 2WW5A 2CBVA 3OG2A 4PMRA 2VRQA 4J27A 1K9TA 1W9DM 3BXWA 3BSHA 5LYRA 3IJ8A 1ITXA 4PMYA 1TG7A 5BRPA 1LJYA 2XFFA 5IFTA 2BY1A 1PIFA 2WAGA 4RE4A 1XSIA 5HPOA 4ZE5A 1U2YA 2W62A 1BQCA 1C90A 3M07A 3IGUA 1OB0A 1ITCA 2OLHA 2GJXB 3JUGA 4OOZA 1A3HA 3OA5A 1R75A 3DX4A 3CZ8A 4UCFA 2YFNA 3WENA 3UCQA 4H8UA 4FNSA 2VCBA 2IUZA 1G5AA 2WMIB 1D3CA 3KL5A 5M5DA 2WMKA 4XUYA 2DDXA 2Y5EA 3L4YA 4WKAA 5JIWA 2XG9A 1HL9A 1HF6A 1X6NA 3WSUA 2DH3A 2VZSA 4HZ8A 2CETA 1V3IA 4UFLA 4FNRA 3GNRA 5IXEA 4EK7A 1KXHA 3T2PA 4KGLA 4L4PA 4C7FA 1UQZA 1K6AA 4D6GA 4CD4A 1CIUA 2XVGA 2ZX8A 1V0KA 2ZUTA 2X2YA 2YL6A 3S5YA 4BQ2A 3GBEA 2WVTA 1OM0A 1QBAA 4UOJA 2A3AA 2WNWA 1EOKA 1EHNA 4MB4A 4W89A 1B2YA 2OW7A 4IISA 1OCQA 3WNMA 2PWGA 3DECA 3KZSA 1TE1A 3AICA 5I78A 3WDHA 1PEZA 4WSJA 2Y4SA 3AMGA 4F8XA 5CGMA 2UY3A 4P8WA 3WBEA 5BWFA 1EA9C 2F7OA 1MQRA 2YL9A 1E6RA 2XGBA 4AZCA 2V5CA 4RE3A 3WFZA 2X05A 1B3VA 4FK9A 5CG0A 5GNXA 1TUXA 4XV0A 1GOWA 1JIBA 4E2OA 3ARUA 1TQTA 3W25A 3GXMA 4ATWA 1PZ2A 4A4AA 2PWEA 1QNSA 1LL7A 1MW3A 1TQUA 1UWQA 3OIHA 1O7DC 3ARQA 3CTTA 4KH2A 1B30A 5A6BD 1VEPA 1KGXA 2FGZA 5AC5A 2BVTA 1E6SM 3UERA 4AD3A 1UH3A 4CN4A 3AS2A 4UFMA 4AZHA 1PX4A 1M53A 4H2CA 2EXOA 1R85A 1CXEA 1US3A 2WB5A 2O9RA 2W63A 3AHVA 3A4AA 2ZXBA 4QCEA 1C8YA 2XJ7A 4FLSA 3O2LA 2EQDA 1C93A 1E73M 1ZBKA 1QWUA 3AIBA 1VF8A 3DYPA 1BGAA 1LQ0A 1JYXA 2WCSA 3H54A 1ISXA 3LPGA 3A4WA 4V27A 1W9UA 7CGTA 3VDAA 3EMZA 4S3JA 1ODZA 2X1IA 1DTUA 2ZUWA 2OSXA 5FL0A 3WH6A 2OYKA 3SCRA 4W84A 4U3AA 3VGGA 2VTFA 2OWCA 4JHZA 4GZJA 2DIEA 1W3KA 2BV9A 1JXKA 4AZCB 6A3HA 3PN8A 2FH8A 3DYMA 4BA0A 2ZIDA 2PWDA 1UH4A 1H4PA 1IV8A 4M56A 3PZGA 3L4UA 4HZ7A 4JCLA 3WUGA 2FHCA 3TV8A 2J77A 1W9PA 1V02A 3DYOA 1GHRA 6TAAA 3A22A 3GNOA 1JL8A 2JFEX 2MANA 1X6LA 3FW6A 4WK9A 4XZBA 4D6JA 4TVUA 7A3HA 1Y7VA 3MMWA 2WWDA 2VRJA 1H0GA 3BC9A 3LXCA 1KBKA 8CGTA 5A95A 4XZWA 4D6HA 1WDQA 1KWKA 1JZ5A 1IT0A 3A4XA 2UY2A 3EDFA 2V3GA 3T2OA 5ABEA 3FHAA 1YQ2A 1HT6A 1ECEA 1NOWA 3I3EA 3RILA 3RIKA 2ZX6A 4E4PA 2GVYA 2DEPA 2BHUA 5ABHA 2J7HA 1GOMA 1HVXA 5E6YA 3ZO9A 3O6AA 3KWXA 3LPFA 2CCRA 5CPSA 4AD2A 4TUFA 5DO8A 1SMDA 2DSVA 3GXFA 3FXYA 4AZBA 1E6NA 1UR0A 3VD4A 3W37A 2J75A 3WFLA 4GZEA 1W9VA 3MUZ1 2V3FA 5I23A 3WD3A 4HPGA 2V5DA 3SCNA 5EMYA 3W26A 4CUCA 1EH9A 1W3LA 2QHAA 4AIOA 1VBUA 5A6BA 3HG2A 1GQLA 1R33A 2XTKA 5D8WA 2WHJA 3VD5A 3APGA 2GJPA 1HKIA 3SEPA 4AZGA 4ATDA 2YLAA 2DT3A 4DWSD 4HU8A 3K4AA 3VSUA 3AI0A 1UR1A 1V03A 5KEZA 1G94A 2ZXQA 1JFHA 2PB1A 1C8XA 1HP5A 4CCCA 1FHLA 5E0FA 2BNJA 3UR8A 1L8NA 3PZTA 2WSPA 3AS0A 3AIWA 5E9AA 1E72M 4QLKA 3ARPA 1W32A 1QNOA 5CLTA 3RMEA 4X0NA 3HMCA 3K46A 3WL1A 4EE9A 5EFFA 3CO4A 3J7HA 1KB3A 2DT2A 1CGTA 1NWUA 3BVWA 4CVUA 3AISA 2VC9A 1V6XA 1MW0A 2YA1A 1GQKA 1V0LA 4D6IA 1EO5A 4HA3A 4M81A 3KE0A 1CTNA 3B9AA 3AYSA 3GXDA 2ZX5A 1JZ2A 1PS2A 3PZ9A 1ZU8A 5I79A 3RO8A 3M6DA 1G1YA 4HA1A 1GONA 5CZKA 5JBFA 1X1NA 2J8GA 1C3FA 2C8NA 3L4ZA 2D0GA 3N11A 2XWDA 5D9OA 4MNMA 1QWNA 1WDPA 1JYWA 2QLYA 1TCMA 4NZCA 1EIBA 1KXQA 2YDQA 3OGRA 4RE2A 2AOSA 4JFTA 3UG4A 4PYSA 3FAXA 3ZIZA 2ZUSA 3GM8A 2X2IA 4U5KA 2ZWYA 5A2CA 1KFWA 3WF0A 3VVGA 3ZJKA 3UG3A 5A6JA 1VJZA 3VIIA 1H49A 1BHGA 2J74A 1KXTA 5DEZA 4AZ7A 3BAWA 3ARYA 3MUY1 1V3LA 4NX0A 3WD2A 1VFOA 1JAKA 3WH7A 2G8ZA 4PN2A 3U7VA 2XM2A 1W1YA 4JCMA 3MKKA 4KWUA 1UUQA 5CXPA 1TFVA 4PTVA 4M82A 2WSKA 1DWGM 2W66A 1VBRA 1UKSA 4WF7A 3CHFA 1HVQA 4JKKA 3II1A 4J3VA 4KMQA 4MTVA 4A3YA 2WMFA 1MYRA 4PMQA 5I77A 2ZWZA 3QGVA 5A8OA 1CGUA 3MO4A 1NWRA 1JD7A 3CPUA 4F9JA 4PCSA 1QOXA 2O9TA 3WQ4A 1R47A 2ZOXA 3L4TA 4QDMA 3I3DA 1HWWA 5DFAA 4TXEA 1CGWA 4U31A 2BXYA 4JFVA 2HVMA 1JZ3A 4AYSA 1AMYA 1QHOA 1WZKA 2VX4A 4P8VA 3W53A 2E9MA 3VMOA 1ZBCA 2NW0A 3VOCA 2G3IA 1H09A 1GZJA 3WD1A 4HPHA 1MQQA 4DWSA 4DO5A 2X2HA 1MFUA 1J01A 4JIEA 4BQ3A 5ECUA 4R27A 4OJYA 4JFUA 4MAVA 4X0VA 4PTMA 1C7SA 1E0VA 2VR5A 3NSNA 1B3WA 4ATLA 1LG1A 2UY4A 3WDQA 1AVAA 3AHZA 2XUCA 4MB1A 4UFHA 5E0CA 1KGUA 5E70A 4PMOA 3MUIA 1J0YA 3RJXA 3PZQA 1EDTA 4OBRA 2ZUUA 3MS8A 2JALA 3WEOA 1JDAA 4PMVA 4HOXA 5A8PA 2PI6A 2ZUNA 4WSKA 4UR9A 1AQ0A 1VEOA 1QPKA 3BGAA 4LX4A 3D50A 2A3CA 2W92A 2VZOA 1E5JA 2QF8A 2VCCA 1TQWA 4J3WA 2WMIA 4MB3A 2J7CA 1W9XA 3SURA 1XH1A 2CBUA 3S5ZA 2D22A 3CUFA 4ZFMA 1UR8A 4BCEA 4TVCA 2J79A 4W7WA 5A6LA 5A6AA 2QPSA 1W1TA 4YPJA 3QHNA 4UOQA 4PMUA 2BFGA 3VNYA 4P7RA 2BHZA 1GUVA 4H8VA 3AXIA 4GINA 3LRLA 2V3EA 2F8QA 1VFUA 3NCOA 4DWSB 4P7LA 1PPIA 1FH7A 1PAMA 2W5FA 2WLYA 3NSMA 4YN5A 3AXHA 1WNOA 2EAEA 4KRTA 1JGIA 3OZPA 4QCFA 2CIPA 3OLGA 2XN2A 1RD6A 4HMDA 2D24A 3TTQA 5D8ZA 2WVVB 1XC6A 2D73A 2D3NA 3ZOAA 3WN6A 1E1FA 3CHEA 5ABFB 2GJRA 4S3KA 4AW7A 3VTRA 3ALGA 1OT1A 4HMEA 5C71A 3LRMA 1CZ1A 4AMXA 2VVNA 4BZYA 2Y2WA 3WL0A 2VX6A 2CXGA 3EDJA 1WO2A 2WK2A 4UFIA 2YA0A 1J0JA 4FNPA 3ZJ6A 4W8BA 1WDSA 1DWHM 2IGTA 1M7XA 1HJWA 4QFUA 5D4YA 4AMCA 1O7AA 5DF0A 3AFBA 2EPLX 3WUEA 1SYTA 2JF7A 1DEDA 2XFRA 4TTUA 1S46A 1XYFA 1JI1A 5GNZA 3SCTA 4CU7A 2E9BA 1BAGA 1UR9A 2PWHA 3BLBA 3VIOA 2OSWA 1WCGA 2QMKA 3OBAA 2BXZA 5CSUA 1PZ3A 3RM4A 1CNVA 4GIAA 3BVXA 2YLLA 1R34A 5LA1A 1V6WA 4FNTA 4F66A 4CCEA 1Q6FA 3H53A 1VRXA 5IHRA 4AISA 4UQ9A 3LMYA 3B8SA 3VSTA 1QI2A 4PUEA 4EKJA 5BXRA 1ZL1A 1K9FA 3AS3A 1CPUA 2BVDA 3T0DA 1ZS2A 1MVYA 3AS1A 4W88A 3POHA 3EJSA 2NT0A 4AZ6A 2JE8A 2XFYA 2EPOA 1TA3B 2OSYA 3ZJ7A 4W8AA 2VMFA 5A6MA 1KR1A 5CPTA 3HG4A 1V08A 4D72A 3CMJA 2QV4A 3VM7A 3GZAA 1JF6A 4IM4A 1NQ6A 1R8LA 3VD7A 3CUGA 1OWQA 2WYSA 3CUHA 4CN1A 3UR7A 2VX5A 1CYGA 3FHQA 4PTXA 3ECQA 1UWRA 2BS9A 3B9DA 3WDIA 1GOKA 1FP8A 2DT0A 3LXAA 5FOOA 3EBVA 3AIEA 4NXKA 2NT1A 3L2LA 1E3ZA 3BVVA 4PSPA 4HTYA 3THDA 3A24A 4D1IA 2F7RA 1QI4A 1FA2A 3WF1A 3PHAA 1GPFA 2WXDM 3TA9A 1EDGA 3LXBA 2VVSA 1V3HA 3DX3A 4XX6A 1ISZA 1BYDA 1UWIA 4JL1A 4Z2LA 3WMSA 3BH4A 2G3JA 3AOFA 1QHPA 2BHYA 3WMCA 3MV01 3ZJ8A 4NXSA 1GOQA 1E0XA 1EDQA 3BUQA 4P7QA 2WKLA 4CD6A 2YA2A 3BAYA 4PUDA 3NUKA 3QOKA 4RL3A 5JUVA 1Q4NX 5EFDA 1E4IA 4H7VA 5A6SA 4BF7A 3BCFA 4FNQA 1J12A 1FOBA 1G0CA 3D3AA 1E4LA 1HX0A 2PBGA 4U3CA 2X0YA 1V3KA 7TAAA 1JZ8A 3BVUA 5BXTA 4J3SA 4FLQA 4H04A 3WD4A 3ARRA 1UKQA 2IXVA 5M17A 1VENA 5CPQA 4UFKA 3CMGA 4AZ5A 2OWWA 5FKYA 3AIUA 2DIJA 1VAHA 3OLDA 3WNOA 1GW1A 3VDCA 3HN3A 3MU7A 3NSXA 1J0HA 4NI3A 3A6OA 4ZEPA 1W1PA 1QNQA 3SUTA 5C70A 5I5RA 1KWGA 1BLIA 2X0HA 1E0WA 4AIUA 3DX1A 1GOIA 2WM0A 3AZRA 3DDGA 3W4RA 2XN1A 1DWFM 5KZ6A 1UWSA 2J7EA 4P8UA 2BY0A 1G9HA 4GQRA 2CKRA 2ESCA 4W5UA 1XD1A 5HPCA 4ZXOA 2FH6A 3TOPA 3A3HA 4GQQA 8A3HA 3G6LA 1WP6A 2E3ZA 1TMQA 1J9YA 3DX0A 1UKPA 5A69A 3AMDA 2WMJA 4A3HA 5A3HA 3VGFA 5A2BA 1JI2A 3PZMA 6CGTA 1GQJA 1E6QM 3BUBA 1E70M 2F1AA 2XVKA 3PTMA 4CD7A 2W91A 2WCGA 2F7PA 3EJRA 5CJ5A 4AYGA 2WZHA 1UASA 1BVZA
chains in the Genus database with same CATH superfamily
3MBEB 2ENPA 2MMXA 1JMXA 1O9ZA 5E09A 4NPYB 4XTRD 4K68A 4JHWL 3NN8A 5FFOA 3FRPG 4YUEH 4HEPA 4WFHE 4PFHA 2QPFA 5JO5A 2IKGA 1EZWA 3RMJA 1AJZA 3BKML 3CD4A 2BK8A 3WTWA 1JNEA 3VXQA 1GC1H 5HXMA 2RA1A 4GRWE 4QP0A 4ZFCA 3RWDA 4C5ZA 4MXWH 3G5WA 3O6LH 5LAXA 3DV6B 3W9ZA 5CEWA 1QR1B 4M7LL 3VE7A 2IAMB 1M6JA 2Z27A 3JU2A 4LGSB 1VFAB 2J8UE 3WY1A 3CV5A 4TNWF 4OLUL 4CDHA 2NUPA 5BRZB 4O19A 4FR6A 2RBLA 2WIMA 5JHDA 3LN5A 2GFTA 1NC4B 3IVKA 3S3CB 1RU9H 1W37A 4APXB 5KVMC 1XIBA 5DJAB 1Z42A 1F4WL 3IMUA 2AQPA 1PKNA 4N87A 1JNDA 1W3JA 4AJYV 3APCA 3KDMB 5K9OA 1TFPA 4FFZL 4FXTA 4UDTB 5DO2D 3WIIH 1A5SA 1IVTA 3UJJH 4XNZC 4TXVB 3MLPA 3K6NA 2Q71A 1BBDH 5DJXA 3T4YB 1Y5WA 5D33A 1BX2A 1EBPA 3RZCC 4DJFA 4ZAKD 4MRCA 4GAYB 3IVTA 3IRSA 1L9PA 1SXBA 5BCAA 4GEIA 4OKVB 2JKLA 4YCOA 4KAQL 3NPXA 2F8XC 1HHGB 2IPTH 3GBDA 4UTAA 1GOOA 3WMPA 1E9LA 1ZBVA 1RY8A 1MWAH 4ZVJA 3CUPB 1C92A 2XQBL 3Q5YA 4KKAD 1QHQA 4X6FA 1SJDA 2N7BA 3BLKA 1TOXA 1HAWA 4QE4A 4IW4C 4PSRA 3KD4A 2CWNA 3RVVC 3FB6B 3E2HB 2EICA 4PJ7A 5B39A 4XBPA 3Q1SL 2J7BA 3FT3A 1TSIA 1DQMH 1KTDB 4TKWA 3I75A 4JIIX 4PLJC 3TC7A 5JHLH 2AKZA 1NFDB 1I8AA 2XGIA 4NASA 1UH2A 1BVOA 2DYPA 3PNUA 1YJDC 4FFWD 5AL8A 1LO5A 5FO9A 4A63A 1RVFL 2VXQA 1KCKA 2E8YA 4EOUA 1A4JB 3RU8H 2W0LA 5CH9A 4B4FA 5M94B 3JV4A 3TONA 1GOXA 3KLKA 3RTQA 4O00A 1JNHA 5I8OH 4KZCA 5MERA 5IROD 3E1ZA 3STPA 1M6UA 3A4DA 4EI5D 4MASA 2XHNA 3KYKL 4EXBA 1OX4B 3DWTA 3WXWL 4OQTL 5D2LE 3NAAL 1O4UA 2R0LL 2FO4A 4E9VA 1JPFB 4PB9H 3C08L 1FDJA 1OL0A 4L23A 1DVSA 3QQ4B 3NZUA 3EB3A 1FE8H 2VLJD 1FNEB 3GJFK 1MLCA 1S5HB 3ILPB 4HALA 1SDDA 5KANG 1H63A 1AANA 3IXAA 7TIMA 3OKKA 1IT7A 4LEXH 3C12A 3TX4A 4AXWA 1TVLA 3MCKA 1RULL 3TR9A 5IJCC 2N56A 3W1MA 1RJCA 3T8MA 1DHKA 4DLFA 3OJMB 1S7UA 1WAAA 1Q8MA 1BQHG 1VSCA 3WDPP 1YECL 5K3VA 3DIVA 3CHCA 5HNNA 3FFOA 1FUYA 3JWNC 3G5EA 4PJ9D 1CEOA 2VDMH 4AC7C 3BZJA 4MDOA 4KT2A 3PTQA 1KFEA 1HI6A 4PR4A 1EEYB 4XC3L 4JX4A 1F18A 4LVBA 3OJ2C 3FH8A 3D4ZA 2BC4A 3MODL 1UD3A 2XKSA 3AQXA 7PAZA 3HFYA 3W7HA 2CKBH 3EYSH 4MJMA 3CN2A 2BVEA 2AGJH 4Q9QL 1P7TA 1ZT1A 3FX4A 3GTHA 4GIOA 1YEFH 3P54A 3L9BA 2QTVA 3L3KA 1R4XA 1CICB 5C0GB 5DT1L 2BMBA 1YNLH 5LUMA 1Z1WA 1FVCB 3QZPA 1EJVC 3MLUL 5FUCE 3FNDA 4YHIB 4Q56A 4LSVH 3CH0A 3RIFK 2WZAA 1SPQA 1PZBA 2UWEB 2WXLA 2NTFA 3WD5H 2A74B 2WW8A 3A3WA 4QTHA 3W24A 1KLUA 1M9SA 2QT3A 5E8NA 4PJGB 3O4OB 1SW7A 4BDVA 3ARED 4K3JL 4UZSA 5SV3A 1H8SA 3HZYA 3LXUX 3V4UL 1MCPH 3MP3A 4CSZA 4JTQA 3PAVA 2H1PL 1R3QA 4XVSL 4TX9A 5KUMA 1N55A 2NUXA 4KFOA 5T1JA 5HDBF 5D1XB 4IU2A 3RVTD 4DP9X 2OMXA 2D2OA 2QYGA 4GUJA 3QRFM 5LJYH 4K2UH 1ZAGA 1ENUA 2IBBA 4KKRA 2G3XA 1V6UA 2Q20A 4RE0A 2AMGA 1V3JA 4QLLA 1MCOL 5KYXA 4OZFA 3DLQR 1COBA 2WXNA 3AITA 2C79A 4D3CL 3MI6A 4YLQT 4NSBA 3ZWTA 3MRPA 3FSUA 4LPXA 2WZIA 4FOUA 2CESA 3MO1A 4HUMB 1IU1A 1F4HA 5I8EB 2CJUH 1NQKA 3ILDA 3RWIB 3SPJA 3F5KA 5EU3A 3UP8A 5DSCA 3H2PA 3OKEB 4E8DA 5FJJA 4GAGH 1CFBA 1R1CA 3L1EA 1LUCA 2BWGA 2VQUA 3QQDA 1E67A 5EKYA 3C5JA 3H23A 2PMQA 2E25A 1XR9B 2FDSA 1PZAA 3QDJA 3G22A 4WJKB 1I3VA 4CGTA 1W91A 4GY4A 3VZZA 2KDGA 1E9PA 3GNPA 3TDFA 4X80H 1X38A 2FIQA 2OODA 1UD4A 1A25A 2NXIA 1IEBB 3DZ1A 4UBPC 2R4RH 4WTZG 3OMAB 4XMVA 2G3NA 4BRJA 3BLLA 4YU1A 3IJHB 1SXSA 4K3DL 3KS6A 1TWDA 3WNIA 1YBQA 1EWHA 2LU5A 2LFGA 3ZDZB 5L8KB 3FT2B 1R3HA 1W3IA 2G5BB 4JZNA 3QUZC 1JWUA 1QMUA 5CBIA 4MNJA 3FQNA 4P59H 2BSCA 5BVPL 2JQZA 4XGZB 3QR3A 4YHML 1R5VB 1MW1A 3FTZA 1EJOH 1G7LA 4J5NA 1T0MB 5EN2B 2GFBB 2Q6ZA 4JDYA 4JTFA 4OZGE 1SY6A 4MNGB 1OB1A 2E9WA 3MCNA 1I2RA 4UT7H 1TTCA 1BF8A 5D1QE 3O63A 3LIZA 1F58L 2IDCA 1HXMB 1U8OB 4JW3A 1BFNA 2VDGA 4F9LA 4XCYA 4B3LA 1NUDA 3C2SA 2EXYC 3UPMA 2VGBA 1LEIA 1NL0H 1JV2B 2P5EB 4ACYA 3TBVB 2V33A 1K5WA 4BH7B 5CGYC 1H3GA 4X5PA 4XNMA 1PD1A 2CNYA 5LG1A 4DBDA 2C0AA 3QUXA 4N6QA 4PJ5D 2WMGA 4PFEA 5DT7A 1EHKB 4L4TB 3WH9A 3VXUE 1J5IA 2P80A 5AVHA 3ELQA 3BJSA 4PMXA 3CFDB 4GI9A 1T04A 3NDYA 2OMNA 5TE4H 3MMEA 5DMLA 2XG4B 4WNQB 3IB4A 4B2DA 3PTKA 4JG1L 4EUPB 3QHFL 4I9TA 1PY9A 3N44F 2WJZA 3CZFA 4A2GA 1ZE3C 4WO4C 1SMAA 3BMVA 1KM4A 3M7SA 1NWOA 4KOCA 4FG6D 5I1LB 3HLKA 3L7FA 3MREB 5IFTA 4LP5A 2X40A 4GSQA 4G1EA 2CLKA 2ZRZA 3WIHA 5IMKA 3RAJL 1U8LA 1ITCA 2BCKA 1A0CA 1E7VA 1U2HA 3QUYB 4UCFA 3UTQB 3MTRA 4MDJA 2HPTA 4AMAA 4GP4B 1G5AA 3CFKB 3PGDA 1O5XA 1WWCA 3MRRB 5I6MA 3TJXA 1D7DA 3Q6FB 5IHWA 3VXPA 4ZSOE 4CVZA 3MJ7A 3ZKQD 3WSUA 3ULVL 3IS1X 1VCFA 2SEBB 5FJUA 2FK9A 2WQXA 3SCMA 2ESVB 2Z91B 2RHGA 4X8JB 1MFDL 2RCSL 5DR5L 1V0KA 1UM6L 5CEZL 1RJQA 4BQ2A 5D5MB 5DQ9A 3GDKA 2PP0A 2HFGL 3RZWA 1DVUA 4LQFH 1H5BA 2D4DA 4M6VA 3SPVA 4U1MB 3BP5A 9XIAA 3DRTA 3ECVA 3AMGA 5HDQL 3WFCH 2H32A 5BWFA 1I45A 2YL9A 1E6RA 5ETUB 4RE3A 5C9ZA 1KN2H 1YPZA 4DEUA 5GNXA 3PUCA 4N2YA 4XV0A 1GOWA 3LERA 3TH2T 4O02L 4A4AA 1JGEB 4WRHA 3EYOA 3U0WH 5T1LA 1P5VA 4OLZH 3CTTA 1KGXA 1KBLA 4N3TA 1KRCC 5SWQA 4X61A 4AD3A 2ILLA 3AS2A 3C60D 1XMEB 2GIYA 2P24A 5HQMA 1LO2L 3QWRD 1ECZA 3PWNB 4KQ4L 2OPJA 4XZIA 2ZXBA 3RIAK 5HYSA 3TS8A 4IFKB 4XBJA 1C93A 4HDIB 3OZYA 4CNTA 5JYLA 1MG2C 1FVPA 1QBML 2X9ZA 4ZX5A 4DYKA 4B5TA 3KPRA 1KACB 1Q13A 3NVTA 1R0AL 3VDAA 3IWPA 4N0CC 4NHVA 1N6UA 5AOJA 3V9EA 3KYAA 5IQNA 3P2DA 3KLQA 4KX8A 2RIKA 6A3HA 3NQGA 5E94A 5EOCL 3KDNA 1ID2A 1UH4A 1IV8A 1IQWL 3RFRA 4PL2A 3EYQD 2D9QB 4JQIL 2WNKA 2HLFC 3CFEA 1YRRA 2HN7A 1Y7VA 5DHVA 2NX5A 4U0RC 3BC9A 5IQ7L 3V52H 2I26N 3NZQA 3WKMH 3FRUA 4OV6F 4W4OA 4ENLA 5F3FA 5ABEA 1MVUA 1K4DB 2OMTA 2WWKT 3S37L 3E12A 4M5TA 4ZMGA 5CBAB 3FCSB 4NKOA 3ZE2F 3MRKB 4L2YA 3T0XA 5IBTL 5J6HB 5KVDH 1OSYA 2J2ZA 4N0YH 5DMIL 5DO8A 2DSVA 3GWQA 1PEWA 2ITDA 2C9SA 3U1SH 3UGUA 2VR8A 4V1DD 2RH9A 3O9WD 1EH9A 3PB0A 3HKZA 4ICMA 2QHAA 1R33A 2HFEB 3J27A 3ZE0B 1N68A 3SEPA 3TLQA 4K5OA 2HSIA 3W7LA 3DOSA 2A6KB 3GSNA 3NO1A 1HOCA 2VD8A 4CCCA 5E0FA 3CYJA 3MRNB 3AIWA 1ZSXA 5F4SA 5AZ2H 4EDWH 1DFBH 3NCBB 4JO2L 3GLCA 1AS6A 1KTRL 2YA1A 1TTAA 2WBJD 3SBWC 5I3KA 2J57A 4OUIA 1M57B 1UUOA 1XKYA 1GONA 5AZ1A 1X1NA 4GY0A 2O72A 3FPXA 3GDCA 1MELA 1WDPA 3SGJC 3U1QA 2AOSA 5G2NA 3H9SB 3ZZSA 1M4KA 4MZ8A 5E4IA 1IQDB 4ES8A 1RQEA 4JFDD 5D72L 1GPWA 1UXWB 3GBLA 4O8AA 1YYAA 1AGBB 3O8XB 1Q9OB 1BHGA 4EIZC 3T1GA 4NUQA 5J8LA 1MCIA 1IBZA 2IQ9H 2ZXGA 2WLIB 2YD6A 3PFMA 2ATMA 4YL2A 1EGJA 2BOLA 1C5BH 3UBPC 5CNHA 1BIIB 4P23D 3B9KD 5JIMA 1SBSH 3K13A 5REQA 4JO1H 3W75A 3HW7A 3QCUH 3CHQA 1JFQL 1UCBL 4LSUH 3C8FA 1D9KC 4CNIA 2BB0A 5GZNA 4OLXL 4ZXBC 4DO5A 1CS6A 1MCLA 3S36H 2PWUA 2Q8BL 2H2PC 3V1PA 2DQCL 4Q4QA 2RD0A 1Q6OA 2NXYB 3US9A 3IDJA 4RXFA 1BYNA 4PMOA 2N0MA 1EDTA 1RXOB 1V8HA 2IBZX 2VLJE 3FQ4A 2O5YH 1UJ3B 2ADYA 1XSOA 2CALA 3V0TA 3GG1A 3H0TB 3T2NH 2AQVA 1RPXA 1I85C 3FB7A 4XZUB 1POJA 2E76C 2CBUA 1ZHNB 1Y6MR 1GHFL 1E27A 4EUPH 3QZWA 4YPJA 2PDLA 4P2QD 4WWNA 5F9OL 3L08A 3GMPB 5DS1A 2WLJA 3S1WA 2W65A 1OCZB 1X7TA 3W87A 2Y89A 2W5FA 4YN5A 3TN0C 2PE4A 4JTRA 3VNMA 1MLBA 4BRVA 3RPBA 2J72A 1SJVA 1LTDA 5KITA 4MJIA 4GRLA 2VL5A 2FJGA 1NFKA 3PWUB 1GZHC 1QSFA 1UOLA 4G8FB 4FXKB 5KTLA 3QYQA 4XWUA 2H8ZA 2OCJA 2JB6A 2XFRA 3BYYA 1XYFA 4MUZA 1BAGA 5CO1A 1ORQB 3O2DH 2P10A 4WXYA 3OBAA 2GITB 5CSUA 2EKCA 1GYUA 2HRHA 3QIUA 4GIAA 4MVBC 2CLLA 1V6WA 2E6QA 4CCEA 2CZVA 1TJMA 2VKXA 3VSTA 3OJDB 1HH9A 3MBWA 3P77B 1TETL 3UAFA 3WKNA 3UXIA 3KOYA 3ZVVA 2DPKA 4AZ6A 4L3FA 1UOZA 2HUEA 2W6RA 1XZWA 5T5NG 3KCWA 3NZSA 3ZW3A 2FEJA 4YHKL 2QV4A 1JF6A 5PTDA 3LUTA 2YD5A 3X1EA 4ZOAA 2WINA 3L3OB 3OVGA 1YNTA 2BS9A 3PABB 3B9DA 2V30A 3OKDA 3DMMC 1FN4B 4ZTOL 4KRPD 3UPBA 3N1MC 4RUBA 2YRZA 3SYQA 5L8JB 2WLHA 3TAKA 3FVDA 4L8SC 1Y8BA 2VVSA 3EFOA 4K15A 4E0RB 1MDRA 4Z2LA 3DVIA 5T3XE 4DK5A 3Q2DA 5B80A 1MNNA 1WYJA 3ZRCC 2F74A 3QOKA 1PS9A 3GPEA 3W1UA 1PZCA 4EOWL 2PPEA 3WJJA 1LM8V 1D5RA 3IPBA 3BVUA 3ABMB 3CSFA 4AC2A 4I9XA 4HVXA 1YTKA 4ZMPA 1UUNA 1RZGA 4AUJA 1IGYA 3R13A 4M8QA 1KWGA 3DX1A 3DDGA 1OAXL 2CKRA 2IKIA 2IBGA 4NN7C 3TOPA 1LHZA 2NXZB 4R7VA 3G6LA 1ILSA 1RUKL 5A2BA 4JDBA 6CGTA 1HL4A 2D4FA 4AIZB 3P61A 3QZAA 2NY5H 5HDBE 4OJDH 2W91A 2ZG3A 4ODHL 4AYGA 2CRZA 4U6VL 3QG6A 1SRDA 5F7WC 3NSYA 1E55A 4JAMA 3QIWA 3OGCB 3TW6A 2AZUA 4LU5H 1P6WA 4JFOB 5DRIA 2ZA3A 4MTMA 5J6GA 4XBEH 2I07B 3RDTD 1S39A 5AZ0A 3T0BA 1GW6A 4NZ1A 5E2UL 4IOSA 4LB3A 3E2QA 4Y8DC 3O0FA 4LIQH 1W1B1 1W9BM 1FZMB 3I6GB 2NXGA 2J4WH 4S3EA 1MCJA 1IBHA 5HYQB 1G7PB 3GLAA 3VD9A 1HSBA 4BI7A 4HS3B 3EX3A 4UT9H 2HRPH 1AXTL 1A3RL 5GS1C 2BNRA 2DDQL 2X0WA 3VAEA 2OULB 1UBSA 3OZMA 3F7RA 5I24A 8PAZA 5IV2B 4YYCA 3MZNA 2Q8AH 1OVDA 1JXDA 1CC3A 3MXVH 2C9VA 1ZSHA 5MEQA 3DHJA 3OKOB 4A1RA 3OVUB 3QULB 3IGXA 1TIUA 2EEBA 1M65A 4WV1B 1AR1C 1UKTA 4WFHD 1D6EA 2BVUA 3OKMA 3DUUA 2ZCZA 4ZYKB 1KEGL 5LCVA 4O17A 4LLDB 2ZX7A 1Q6RA 1J93A 5CR1A 1R7OA 4Z7UF 1YTEA 2JV6A 2WMHA 3NZ8B 3BAKA 3W00A 3BXNA 5E1QA 1FUNA 3EJYD 4GG8B 4JS7A 1LBLA 3VSVA 2IQTA 4J4PC 4HH9B 5HMFA 3UPCA 1K6WA 1IM9A 2DQ6A 2A83B 2X4UA 1UP0A 2ETWA 3PDOB 1UKOA 4P06A 2POTA 1W1VA 4ZB0A 2AABH 4HYVA 1LTXA 3WMQA 4ZUUA 5TE6H 3GXIA 2KLRA 1EHAA 3F65A 4Z76A 4US5A 4KQ3H 2VGFA 1DO6A 3G5VB 3U2SA 1ZD6A 4C6KA 4PJ5E 4TQTA 5BMFH 1RK1B 3P0YH 4WJXA 1ITBB 1G7MB 1FZOA 2QZQA 1GGOA 4XAKD 3L3HB 1HK6A 3WS3B 3PBYA 4AEEA 3QXVA 4FE9A 1Y0LB 2RDWA 5HI3D 3B1UA 3I6KB 4G70B 3QY8A 3L68A 3GJEA 1WGVA 3DETD 2OXHB 2WWNA 5GZOA 1EEQA 1B4EA 1ZHAA 5JXEA 1DXFA 2X09A 3NPSB 1NMCC 2UY6A 3U6RB 2PO6C 1AA1B 2WB7A 2WVSA 5D9NA 2AQRA 1E4XL 5LKNA 2R1KA 4AVFA 1SZGA 3W07A 4REQB 3OZ9L 3QZEA 4JGUA 5TD4A 5LB1A 2VP8A 3TEZA 3L4CA 2DBLL 1SZEA 2BGSA 4Y16C 1IEIA 3PV7A 5DGQA 1Z48A 1KELH 4UYQA 2WSQA 4BQ8A 4Y5YA 2HJLA 4WU7B 3BUIA 3TQ0A 3OLEA 2GDVA 4G9DA 3V16A 2ICES 2FZMA 5DHEA 3T0AA 4ETYA 2IPWA 4R2GD 3BO9A 5TDPB 3QRBA 1QK0A 3NGBB 2BOEX 5CN1A 2ICWI 3RWCA 4R3UA 3APYA 4JPQA 2VN7A 4QHUA 1SEBB 4F93B 3IXTB 1CVSC 4MAUH 4URIA 3GFZA 1W2PA 4LC6A 1ISYA 3HCVB 1NJJA 3WD0A 3B5GA 3MA9L 5EBWB 2GUYA 5IBLD 4MKVA 1SUJA 2EYTA 3SN4A 3R06B 4EBQL 1JDCA 4K71B 1JUFB 1G6RH 3F3HA 3CL8A 1F86A 3ZT5A 2P4AB 3EYPA 2XZAL 4DX3A 3PJSA 3WFHA 1JGLL 4K7FB 4RZ6A 3IJEA 4LYRA 1W1IE 3GLZA 2J9ZA 2D7MA 4YDKL 1N82A 3V4PL 3MLZL 2XTLA 2VRKA 2P52A 5CZRA 4F7MA 3X3GH 3NABL 3DFOA 3ESOA 1HH6B 4UNLA 1OAUH 4H0HB 3W7OA 1TO5A 1RP8A 2DD8H 2BW5A 3N50A 1GYCA 3BISA 1ZCCA 2AXGB 1U30A 2NSXA 2ZUYA 4YMPA 1ACYL 5IQOA 2R1YA 2XN0A 1IGIH 1IILE 6XIAA 1UQSB 3BUDA 1IFRA 5H8DA 1B0WA 2DAVA 4NZUH 4A7SA 2NW2B 1FIEA 1ZQ5A 4CGUB 2X4OB 4IOFC 4HQQH 1CK0L 4CU8A 2VLLB 1EMTL 3FGCB 5LN8A 1HNGA 4Y2DA 3M8OL 4BWTA 3EAUA 4GJJA 3O6ML 4UF7C 2OMZA 3H55A 4XOEA 1EDYA 3S5OA 1YMMA 1R3JB 1FG2A 5D2NC 3BE7A 4OLYL 4X9YA 2ALAA 1P0BA 4KV5F 1VGKB 1CZ8H 4IIQA 4FZEL 3IGSA 1F1AA 2FWOB 2BVOB 2QJNA 5F89A 2OTDA 4V1DE 1IWBA 2GEQA 4Q58C 4ZFZA 1ONQA 1CL7L 4P9MH 3TWCL 3S5LA 3NFNB 2K4WA 4B5WA 5EV7A 1P6AB 3C5ZD 4DTGH 1HFUA 4Y1AB 1FYTA 3MLYH 4BGLA 2C9AA 4JFWA 4PJ7F 1KM1A 2PDCA 2Q7AA 2XHYA 3MACL 5CIPB 4OIIH 1OG6A 3KW8A 3ZE2E 1M2OA 5FDWA 3EJUA 1ZBWA 3M6YA 1N7MH 1AO7B 3T65B 3NMEA 4FQQB 3FFDA 1Z9SA 4ZDHA 3NXFA 5AAMA 1MRCH 1YYCA 3B3IB 3DBXA 4DZHA 2DWDB 3PF3A 5IHUL 1PSCA 1HHIA 2HVJB 1J86A 4BELD 1PW3A 3U46B 1FHDA 2QZ5A 3CU7A 3HG1A 3Q2NA 5EU6E 4DKEH 2CDGA 5IFAL 1JWSA 5INCA 1B4RA 1IIHA 5FHBH 4A05A 4AL8C 2EACA 3KFTA 1JZ4A 3V6ZA 2JIXA 3N15A 2DQHL 4HG4J 5DS2A 5C9KA 4JFDE 4XVOA 2RQEA 1WXJA 3MV9B 2ZOWA 3RPIA 5GRYA 3DVGB 3F6IA 3QEQB 2HNHA 4PVBA 3CT2A 5B4MD 3GVWA 2FZ3A 1RBLA 5D7JD 3M7WA 2BBFA 3TJHC 3GZ3A 2V2WA 1A3ZA 4OT7A 1JG9A 3DGDA 4MA8L 4KIRA 4BXVA 5EC2A 3VGAB 2HVKB 1ZGLB 2B31A 3TCSA 5E23A 4DNLA 5I17A 2HT4C 1X5IA 4PREA 1FL6B 3C5SA 4L56A 3U2ZA 4A22A 3E02A 1NGWB 4AQAB 3W1TA 1WAAF 1U4EA 3VGDA 4PUNA 1IR1A 3VG9C 1JYNA 3E2SA 1V6YA 1MI5A 4K5LA 2HH0H 3ITVA 2BP8B 4NILA 4X4YB 1O5RA 4L29A 5I6LA 3N25A 3QCTL 2WJDA 3WNJA 3ZDXF 1E4XI 1T22B 2FEDD 1I8KA 3VGHA 3TC3A 3PL6A 4TLKA 2R2CA 6FABL 1KCVL 2YGOA 1OX5A 3VX0A 1CXLA 4HD9A 1A7OL 4ONGH 2QCEA 2Z34A 4Y8EA 1FFQA 3LH9A 5TFSL 1KB5A 4MJ6A 4ORMA 4K9EC 5I19H 2QJGA 2FJKA 2MNRA 3NZGA 5M2FX 5BS0D 3KRZA 4JD4A 2AJSL 3VRIA 1YC7A 3QXUA 3EDDA 2V38A 4EKXA 4IG2B 5CILH 4K8RC 4OM0H 3OB0K 3Q7JA 4FQXD 1LP9F 3MLTA 3PQYB 5JXAL 4K23L 2SFPA 4P5MA 2KX9A 1SFDA 2V17H 4N2CA 3VWJA 4L9LA 3WQFA 4B3EA 3SAZA 3I68A 3O9NA 1B2WL 3HC3H 4WKZB 4N90D 4W5ZA 5F7UA 4OB5H 1RI8A 5AW5B 2QT6A 1EJUC 4IPLA 5EF3A 5GSRB 4FJZA 1FWGC 3SDYH 5BMWA 3CUJA 4TTGA 2Q7YA 4LYPA 5EMLA 1AGEB 3CJJA 3NFPA 4HOZA 3TLLA 2FEEL 1OAKL 1N12A 4UUJB 2D7TL 5HBFA 3SOBH 43C9A 5EEVA 3PUEA 3AG3B 1OGPA 3NQFA 2O6PA 4HPYL 1E4KC 4HG4K 1UG6A 4YSEA 3UEZA 1A1NB 1U91B 4J27A 3NQEA 5D96B 1MREL 1W6LA 3DXAB 5LIWX 1X4YA 3CUZA 4DJDA 1V4YA 4FTDA 4HUUB 5AECA 4NWUH 4YSOA 3LKPB 2E7DA 1OE2A 1KV3A 4DW2L 5H8MA 3UCQA 1RJLB 2XX1A 4XOAA 2DQJL 3IIXA 3KL5A 2WMKA 3WXVL 3APDA 2ATKB 5HHME 1IAKB 1EVTC 3QYCA 3NP4A 2C1PA 3ECWA 5D7EA 3EFDH 3VB8A 2X16A 2CETA 4EPDC 2Z26A 4FNRA 1X9LA 4QR6A 1YEIL 1XGQA 2QAFA 2X0VA 3PSWA 5E8PA 1PDZA 5KANI 3GBEA 1LWRA 4O1CA 3CV2A 3IDXH 2AV1A 4LVOB 2E09A 1I2NA 1N5AA 4WI2A 1EHNA 4MB4A 3GUFA 1CCWB 2ZD0A 2V82A 3CQPA 3MJMA 3CXFA 3ZY7A 4B4HA 4C1KA 1NBZB 3L12A 5DCBA 4QRUA 4GYFA 4U4IA 4S1DC 4E2OA 4C5YA 1OAQL 4ZS7L 2Z8VC 4WU5B 3GRBA 3Q0HA 4E9RA 5IB1B 3WTSA 4JB9L 5IUCA 4NI6A 2XICA 3RFZC 2Y6SC 3M9YA 4XPBL 2W0FA 3E9TA 5D6CA 3ZYIA 4IMDA 5GS0D 3LS4H 4JO3L 5TDOB 2CKBB 4XCCH 3VWKC 5DJ2B 4DF0A 4QYOA 1XLGA 3BDXA 2XJ7A 2ADJB 1G9ML 5ALBH 3D47A 4ECNA 1R3LB 4GUHA 4HIJB 3QAQA 3LHPH 3VOHA 4HIQA 3WH6A 3L95B 2OYKA 3SN6N 1VFBB 2OWCA 4X6DF 1MJ7L 3DGGB 4WY0A 1ZAJA 4S2CA 4RRPA 3UJIL 4L64A 2NY4D 2FHCA 4HIXH 4R88A 2EEAA 2ORBL 3EWWA 1KZYA 5B22A 4XZBA 5CIPH 4TVUA 3H42H 1V55B 5EGRA 2C3XA 2E3VA 3GMRA 4D6HA 1EP1A 1KLFB 1IT0A 2UY2A 4JM2B 3WLJA 3EDFA 4ZMWA 3WQGA 4FI6A 5EUKA 3RIKA 3B8WA 3I7SA 2VDPH 5J6SA 1EEZA 5H37H 4EF8A 1E8YA 3ARGC 3TBCA 5E1AB 1CD1A 1QKZH 1ZIBA 1H8LA 3MUZ1 1UM4H 5EMYA 2OCZA 2HKHH 5IESL 2CWRA 1K7EA 5JOFA 1NANI 2XV6B 3HB3B 5D71H 5B1JA 3CLFH 2DT3A 2A1WH 4G9PA 2ZXQA 2ICWJ 3AM8A 5I30L 4KKCD 5AB0A 1BLNA 4G7FA 4BFOA 4X7EC 2K9UA 4X6CA 4X0KB 5DURB 1R0MA 4U3XA 4UTIA 5ESQA 4I1RA 4YFEA 2JGYA 3LZFH 3V6BR 2EIKB 3KVMA 5BZXA 3KPMA 4TIMA 1KRMA 4UU9A 1TO3A 1C3FA 3L4ZA 3N11A 2MUCA 3MRDB 4LALA 3U36B 2YS4A 4MNMA 4M7JL 4Z7UE 3UCRA 4BM7A 1TCMA 1N64H 4N6EA 1S7WB 4A6YA 1E9OB 4CC4C 1BEYL 1TZ9A 4LEFA 4HIEB 4QEEA 2Z7UA 2QDDA 1IIGA 1JGVL 5CJOL 3HN5A 3WF0A 4XAKE 4OFCA 5LNGA 3SY1A 4NC1C 4QY8B 4AZ7A 1DSFL 4DLMA 1W0YT 5KS9A 4YPGB 4XNUL 4TNVF 3WH7A 3UBXG 5C8JB 3OKLB 4DP4X 4KWUA 5E1HB 4D8OA 3PBVA 3ET9F 1XDLA 3EKLA 2ADIA 1VBRA 4JKKA 4DGIH 1T2QH 1HGWA 2Y63A 4RAVB 5A8OA 2FEEI 1TKWA 4F2ME 2O9TA 1YPZF 3I3DA 4HCRH 3MVTA 1UZGA 2ZBTA 3I4KA 2P7TA 1OF2B 5BXFA 2AV7B 2G3IA 3T3MF 4QS5A 2NVDA 4JIEA 3ETBJ 5T33H 3F7VA 4LJ3A 4JFUA 1XG4A 5HJGA 4AQEA 1FVEB 1O94A 5BWAA 1KG0A 4PMFA 3LZOA 3N2MA 4R4BB 3G9AB 2CGZA 3WK1A 1D5IL 5KSUB 4B9PA 2MQGA 3KYOA 1BVLB 1KULA 3RJXA 4E42A 3B9NA 3MS8A 4G5ZL 1YPIA 4KQ0A 4H8WC 4UR9A 3TYDA 1JPSH 1NGZA 1SFTA 4PRAA 3VXMB 4I3SL 3PNWA 4H19A 1O68A 2OVLA 2ZOKB 1S2UA 1F3DJ 5T1LD 2LT9A 1LLWA 2NY2B 4JRLA 4FTVE 4TRPH 2FCBA 5DJZA 4DVRH 3P3BA 2KQNA 4FP8H 2XISA 2H45A 5D2XA 1KIRB 2XN2A 1ZAHA 3ALWA 1CGSL 4F7EB 5I6XB 1XLEA 5KVFH 1GTEA 4DK3A 4K73A 1A4MA 3JYBA 2ERJB 3H4HA 4AW7A 2E5DA 3IV3A 5KJRL 4WZ9A 3G0XA 2ZWSA 1QU4A 2GJ6B 1P7QB 3LY6A 3L0KA 1V10A 5CZXD 5LIKX 5KYYB 4XHQA 1OD7A 3NT0A 3MV8B 1UR9A 2OSWA 2JKTM 1CFSB 1G9NL 3ZL2A 4P9HC 3SZKC 5IHLB 4JRYA 3LMYA 1WICA 5C0AB 4PRBB 5BXRA 1IKOP 2WLKA 5LSMA 3TBSB 3GBNL 3CSYB 1JR1A 1BM7A 3ZR4A 3A6CL 2VMFA 1HKVA 3HG4A 1ZPUA 3WK0A 4ZFOA 2HX7A 5ITFA 5JHDE 3CUGA 2Y7EA 3RE0A 1OWQA 4F1SA 5BW7A 2I27N 3SDXB 1RSCA 2ZNXA 4JLRA 5C6WH 2H3DA 3D4CA 4QOKB 3CVHH 1K8YA 5HQLA 2EDQA 3L2LA 3T9PA 3SFKA 5E2VH 5J1TC 2Z25A 4B7IA 1L6XA 3TA9A 3K2KA 1KLZA 2R29H 1DVFC 4IGBB 2RQ8A 4Q2ZA 1A1OB 2BVQA 5GS2H 2BHYA 2WKLA 4CD6A 4HFUL 1B57A 2XTSA 3BAYA 4QTIL 4LOEA 5IB2B 1EERB 5F7HA 1O6SB 5I3GA 3X13B 4UV7H 2PBGA 4NJAL 2F7FA 4R26L 3WD4A 4LRNL 4DIXA 4NAMA 4LS1A 1UZDA 1Z6JT 2JKPA 2GVJA 4KV5E 3B4YA 3QHTC 2G0WA 3QFJB 5L9DH 1E0WA 1QRNB 2Q5BA 2XN1A 1DWFM 2DY3A 2QUNA 5DYOB 1Y0EA 2E56A 4L48A 4JREB 1Z3RA 4OV5A 1BFVH 1UKPA 4HK3J 3CDCA 4PJBF 2XSKA 3UP6A 4BWLC 3O6FB 3BKCL 5T3XD 1QFUH 3BUBA 3TKFA 4PJ7E 4GXUM 3EJRA 5F1IA 4D8PB 2EILB 3W5MA 1A64A 4GUCA 5IB4B 3U2OA 2XIIA 2G2NA 2AP2A 2KKQA 3OBEA 3L3IB 1X5JA 3IANA 1O75A 4NU7A 1VCBC 3IN0A 2WSYA 3GH5A 3W11C 3FCPA 2HXAA 5ABAA 3ZTDC 1O6TA 1WJ3A 2V5YA 3FB8A 3QPXL 1K6QH 3VXRA 5GS0L 1ZANH 2JKXA 3ZQXA 3RF9A 1GGIH 3PLYA 4XP9H 1HNFA 3CZUB 1FWRA 1FORL 2WJ7A 2WXGA 5LBSA 1YEKH 3VIJA 1AL7A 4MMZB 1RFDL 2NUTB 2YMOA 2VR9A 4KJYB 4OJFH 1JHLH 3OGOE 1IGFH 4TUJB 1EGMA 3KR3L 4XAWL 3QRHA 1B4KA 3BAXA 1BECA 1IZJA 2WB1A 2Z0BA 3ZL1A 4XI5D 5AWNL 2YRBA 4C54A 4UM8A 3P62A 2Y7LA 2FZBA 1RK6A 3LOTA 3ASWA 4XO8A 1GZPA 1UJQA 1GQIA 1WISA 3TN3A 5HHOB 5IR1A 4M1CD 5BS0E 1CT5A 5ICXA 5DUPH 1QAWA 4LRIA 4NGHL 4QIUA 1WAAE 3SUWA 4F1ZA 2HSAA 5KSBA 3NQ7A 1K3IA 1EJRC 1OPOA 2KI6A 4EEEA 4DHLA 3G1RA 1XXXA 5FEBA 1OO2A 4X98A 2DPEA 2IXQB 5F7FA 2FL5B 1NAMA 3VDBA 2QSCH 3L9RB 2PDWA 3ZDXE 3CN1A 4YZFF 4HS8H 4QRPD 1X96A 4N90E 1S3KL 7FABL 2WJEA 1X5GA 3R25A 1PXGA 4OBTA 1QI5A 2J5LC 4ZNEA 1I9IL 2QJJA 4QSHA 1OF6A 4YHLH 3NZPA 5EY5A 1TZIB 3QNFA 3MRGA 5LN4A 1W72L 4UQIM 1J87A 1JXJA 3CO8A 1X7SA 3QNZB 3HNVL 5FFLA 3GF8A 1LP9E 1X5XA 1ZVSA 3FQTB 3QIBD 1OQFA 1TV3A 3EGDB 2J6VA 4KESA 4K3EH 4GI8A 2NY0D 3T78A 4IBVA 5ADPH 1QWKA 1D2PA 4XBMA 3B0XA 3WF3A 4Y7EA 1HXYB 1K72A 5ANMB 3HE6D 4CJ1A 4K07A 4XTDA 5FF6B 1Q6DA 1WDWA 3SGGA 1V7MH 2VXVH 4DNMA 5AUMA 1KJ2H 4G5AA 2A6IA 2IALA 2XH4A 1Z2KA 3S9DB 1AIFB 3AU6A 4RSVA 1QPRA 5T26A 3F4WA 3Q5TA 2GJZB 5MEPB 1MCDA 3BHBA 2VX7A 1UFUA 4U2ZA 3VC5A 1OQXA 4XN2A 3OQ8A 4FNLH 1XIHA 1OE1A 1G43A 2IIJA 2WQPA 3L3GA 4GYKA 1QSEB 2ZOLB 3RJOA 1TQSA 4HCGA 1BXBA 5HNRA 1XVSA 2OEMA 1W8OA 2XWEA 4W85A 3WY3A 1KBWA 4X9GA 4AGMA 5AAPA 1AD1A 4R7OA 2H26B 1OWRM 1V27A 4K38A 4XMXA 4ZQTA 2BS8A 3HUJA 4M3KB 3SSZA 1UWUA 2YDAA 4HZ6A 3WCZA 4DP1X 3B2UD 4E4FA 4N6RA 3PWGA 1CBVL 4FOKA 2B5IC 3US0A 1N6QL 3LEVH 3CBWA 4TVPH 5ECGA 3O3DA 4GXWA 4Z78A 3JXAA 1D5ZA 3COOA 1WZ1H 3QFDA 1E56A 5CLYA 1UW9A 2CHNA 4RX4D 4LSRL 4ODBD 2YXXA 1U3HB 1F6AA 2VMJA 2DIBA 5J57B 1PKOA 3QI9C 2W9EH 4YDLB 4Z7OB 1U9KA 1QW9A 4HLJA 5DLMH 3D4GA 1DE4A 1O6IA 2X4NB 2DQDH 1Q6QA 3ESVF 4ODUA 4FG4A 1BVKB 3ARDD 4LHQB 3L5WB 4Y9EA 4PCFA 3SHSA 3UXDA 3WO8A 4V2XA 4Y4KA 3GVVA 3HIZA 3GO1H 4P4KA 3QDJE 3KEHA 1TE6A 3LKSA 1URLA 1RURH 3N2BA 1IEAA 4KY2A 4OVXA 4J3OF 4DWDA 3N9KA 1T7YA 4C4KO 3GR7A 3DX8B 3CC5A 3MBEA 2BNRD 4DQAA 4LEOA 5DXYA 3OODA 5I76B 5IMOB 1SFSA 4KHTL 4NPYA 3QZNA 2WKJA 5EO0B 4WGKA 3G6JF 5ALCL 3GDRA 5FI8A 2PXYD 1BYOA 4UQ3A 2FMNA 5FHAH 1F3XA 3WQDA 2FQFA 1LJMA 1MCWW 4OZHF 4MWAB 1XSJA 3F2CA 4JS3A 3SDAC 4NN6B 8XIAA 3H7LA 1KQYA 4N2HA 1QNZL 4X6DE 4AQ1A 4X9IA 4UILL 4M03A 5TJWK 2NWRA 3M41A 4E38A 2WD0A 1AH3A 2VFHA 5DMYA 3DV6A 3X17A 1QR1A 5C07B 2VI0A 3P6LA 5DK2B 2Q09A 1RLBA 4OCSL 2IAMA 3KAOA 1XH3A 1VFAA 1AD9B 2ADAA 1FWAC 2XCMC 1HC1A 1U8PB 4NO0D 1IM9D 3BSGA 4AYEC 1P6CA 5BRZA 3B05A 3KTSA 2PRHA 2ZONA 4MCYA 1NCHA 2NNCA 4BH8B 3EJJX 1SJAA 4APXA 3UZZA 5DJAA 1A7RH 4GBXC 1K4CB 4DGUA 4QJ5B 3S6CA 2VDNH 4F7TB 4GY7A 5IHZB 4US5D 5AW0B 2X1SA 3KDMA 3NEEA 4IIEA 1EF3A 2CHOA 5IF0B 4OCWL 5D2TA 1HCVA 1OY3B 1KYOJ 4LB8A 4GA8A 1Y07A 1E43A 3L4VA 3J2PA 2B7DT 4LU0A 2AVFA 2K70A 3T4YA 1NFGA 1K2DB 4GAYA 3H4WA 1GCFA 5I3DA 3BG5A 3QY7A 3TM6A 3SE3C 2GB2A 1KBGL 4NPJA 4OKVA 2PF0A 2Q01A 2ZE0A 3FTGB 1HHGA 1L9TA 2AQ3A 5EB8A 4WK4B 4GMSH 3K91A 5JBEA 4RNIA 3CUPA 4QXUL 2E7LA 3E8UH 3VM5A 4PCTA 1IEXA 2C15A 4JTGA 4XZNX 5EU6D 1K9DA 4P48A 4RZCA 5T3XL 3VKKA 4UMSA 1QI0A 3FB6A 5C0DB 2MCMA 1L6PA 1ZS8B 4ELDA 1KTDA 2DU2A 4GKOA 3QSTA 4MMYB 5I71B 4OJEH 2ASHA 4P2RA 4R84A 5AYXA 1C5CH 4YMZA 3MCYA 3GB7B 4Q0XL 1I8UA 3IU4L 3EMCA 2FVKA 2W60B 1C5DA 3SKJL 1KGWA 5JIKA 3TF7C 2C9XA 4BSVB 4GKNA 1BF2A 5LHFA 3L1GA 3EO1B 1A4JA 5LDUA 3P40A 3S6DA 1WUNT 3CV6A 1BYPA 1T7XA 3GUWA 3MANA 2FB3A 2WXHA 2VFIA 4JFZH 1A21A 1YPZE 4S0TD 1OX4A 3V5HA 2A79A 5ITBL 2JELL 4MSWB 1PLGL 3T3ME 1TTFA 1JPFA 4G43B 4RJEA 2VLRB 5FGCB 3AHTA 2PR4L 5KTEL 2VDKL 4ZQRA 1PNCA 3GTNA 4W7UA 3V3WA 3QQ4A 1KR0A 1CT8B 4JMXA 1FNEA 4QGCA 3CK0H 2NPLX 3FA5A 1S5HA 3ILPA 4IX0A 3ARFD 4L0YA 1IE4A 3FTXA 3MFFB 3B2VH 3R5EA 4UZUA 3IFNH 3P9LB 5ES4B 1FBIH 5BV7B 1WCBA 3OW1A 1SN2A 4FLRA 3P4LA 4F92B 3QW3A 3GD6A 4TYUA 3MLSH 4FB7A 5C0BB 5E6IC 5GRUH 2QVFB 2HUHA 1E9YB 1GK8A 5CC7A 3S1GA 4Z0BH 4K36A 5LA0A 3C87A 1MG3C 1INEL 1BJ8A 1WT5A 2VEMA 4MS8D 1WRFA 3BKJH 1KYOK 2VL4A 1OYBA 3OVPA 2LLLA 1R30A 4OGYH 3WN5B 3BH9B 5AC7A 3O3RA 1IX2A 2OL3L 3MP5A 4XRCB 4Y96A 1EEYA 1GIGH 3W7IA 1LK2B 4YJZL 1W9DM 5C0IB 2LAAA 3MUGB 3W7MA 3N2CA 4FFYH 1F8TH 3CS2A 1A3HA 3UXAA 5I1IH 4WJEA 1I7UB 5HWJA 3S3GA 2Y61A 1N10A 2Y2TA 1GGBH 1X5MA 4M93B 1X6NA 1CICA 4MIMA 4PLOB 3U9UB 1RZKH 5IFJB 4L6DA 1ZLVH 4RZ5A 1FVCA 1K6AA 4LCWD 5FYJH 3NK4A 4YHIA 3S5YA 3BSZH 2QQ6A 4ZS6C 2UWEA 4LARL 1T7WA 1JCXA 3W2JA 3QUGA 5EB9A 1G6RB 2MTAA 3LSCA 2OW7A 1V7YA 2A74A 4N9GB 3CVCA 3WNMA 1SXNA 3QG7L 3Q8AA 5CGMA 4PJGA 4UTTA 1RK5A 4OZFG 1EBHA 4IXHA 4DESA 4FA8A 2XGBA 2V5CA 1JVKA 4AY8A 4NOFA 1OP3H 4HBQA 1LL7A 2VSCA 1XGRB 3RPKA 3OC5A 3ARQA 5HHMD 3VE9A 1OC5A 2UZIH 2R0KH 1MHEB 2L04A 5D1XA 5C2BH 2YB4A 2DQFB 1HTIA 4BCXA 2V67A 4PBEA 4AZHA 4RA0C 1XB6A 3EOYG 2ZYHA 3ABRA 1E9IA 4OD2B 3ZKNC 1VPXA 3DSFL 3QEGL 4HKXB 1ZTVA 2EQDA 1FDLH 4Z3JA 3LTPA 3I10A 4H88L 2VDLH 1I8JA 1OVZA 1VS1A 2W38A 4J2XA 1JXKA 3N43B 5IY5B 3DYMA 3PAZA 1VBJA 2PWDA 3CPGA 5LGXA 4LEEA 5D05A 1V02A 3EOBB 3QXAB 3PY2A 1GKPA 5I8EA 2FBJL 4PJBE 3C6LB 5B7YA 1TT6A 1TKKA 2E1WA 3RWIA 2XXMB 1QO3B 2VZ3A 4PC8A 2GGIA 3MKVA 2YPKB 2C3HA 5F3HB 1QRQA 5CMAB 1HT6A 1OCBA 4GXUN 3TO2B 1CI5A 1SW0A 3TT3H 5HBBA 4O58L 1EA0A 1FHUA 4KMTH 1HFBA 5CPSA 3P3RA 1XR9A 4H44C 1M42A 1MHHB 3W37A 1GVRA 4AVNA 4C6JA 4LCRA 3SCNA 5EUOF 2EVGA 2XTKA 1TO4A 4JE0A 1KPVA 4Y4FA 1X5AA 4DFIA 5DHYA 4QEGA 2FX7L 3J07A 1WAPA 4ZMTA 1DE5A 2P1FA 4OT1L 3ASNB 5K39B 4DY1A 3W7CA 1PY4A 3C8NA 5BNKA 2OX4A 4R7DB 5C92A 3FT2A 1BWKA 2FZ8A 2HT3D 5HMSA 3ARPA 2PEVA 1QNOA 4UTUA 4XGZA 5C55A 1R5VA 1OTTD 1QSFE 4JFQB 1T0MA 5EN2A 4D6IA 2GFBA 3LZPA 1TLMA 1WVZA 3B9AA 3W01A 3KNBB 4BD4A 2ZX5A 5DD1L 5MI0C 4L1GA 5I79A 2DICA 4MNGA 4QRPE 1EL3A 4IMEA 1UWAA 2C8NA 1NCAL 1VZIA 3UG4A 5MHSD 4E41B 2NLIA 1VD6A 4YS1A 3VVGA 2J6WA 3BZ5A 2EKGA 3Q6GL 4ICXA 4JY4B 3UC0H 1FJ1A 1JV2A 2P5EA 2ZUQC 1NZRA 3TBVA 4BH7A 4JZJC 3FQWB 1E28B 1DQLH 3MKKA 3M5YA 2ZTJA 4FO4A 4C6NA 3BO8B 4DJDD 3TASA 3MKCA 2G0KA 3NACL 1SJCA 1T2XA 4YZFE 2ODOA 4L4TA 3GEWB 2GDQA 3CQHA 5KWYC 1A8ZA 3WTUA 3RKPA 4BSWB 3CFDA 1RZIB 1TMCB 1AY1H 1HWWA 2XG4A 4WNQA 3THUA 5E00B 4XXWA 1VPYA 4EUPA 5ID0B 3MC5A 5I1CH 3STLB 4N0FB 4A8RA 4MBRA 2ZZ1A 3KOXA 4DPCX 4MS6A 4XUGA 2YAOA 3BQUD 3OXSB 5BV7H 5I1LA 3GC5A 2X6BA 3DCPA 1I82A 3LDBB 4OFQA 3NO3A 4HC1H 3MREA 3MUIA 1Q90A 1HHJB 3VJ6A 5CJXA 3NOIA 3GKZA 1JZEA 4XX1E 2ROYA 3QUYA 2KQMA 4JDEA 3UTQA 3SBRA 1DZBA 4AKOA 4H40A 4R97B 2WZ5A 1H9VA 1N59B 4A7GF 3CFKA 4M1GH 1MCHA 4OI7A 1K7FA 1PZUB 3O6CA 4KCWA 2B0SL 2TMDA 2SEBA 2OZTA 1YDPB 2V9TA 3LNMA 2R2BB 1XR8B 5C6PB 4M7LT 4X8JA 3TU9A 4JGMA 3RB7A 1SU5A 4DWSB 4AX3A 1L6YA 4P7LA 4PJDB 2WLYA 5D5MA 1JGIA 3VCCA 3OLGA 5HYSG 3FFCA 2ZP8A 1ZXKA 5C0RL 2VLKB 1XC6A 5F7DB 3NJJA 3MRIA 5CZ0A 3WN6A 2APSA 3MLXH 5ETUA 1CZ1A 4AMXA 3G18A 4BZ1H 2BNQD 4NAQA 2NMSA 1KJ3L 1F97A 1JGEA 1HJWA 1A2YB 5FF0A 3PBWA 3VIOA 1T1XB 3I50L 3FTSA 2ZAGA 4N9CA 1H7RA 4UINH 3DFYA 2CBOA 4JYFA 4FTVD 2IH8A 5CD5C 3PXJA 3PWNA 5ELIA 3P0VL 2Y07L 4IFKA 3TSMA 4HDIA 4LAQH 3U9PH 2F53B 2BNRE 1BEXA 4HWEL 1ZL1A 1O6VA 4MA3B 3RTLA 4AVOA 3FIGA 5L9FA 1TA3B 4X6CF 2A6NA 5B38B 4PS4L 1NIEA 3QV6A 2IFFL 3CB3A 3V7MA 2WYSA 3R1GH 4AUUA 3S1UA 4NZRL 1GOKA 3O41B 3NCJL 4IBUA 2WNNA 5DC4B 2YPVH 2OQLA 4X7CC 5IMMB 4E9WA 1QI4A 1HZHL 2GQ8A 1CE1L 1U42A 1I1AC 4O10A 4FIQA 4O0QA 4X7SL 1K4DA 3AOFA 3G0SA 4O0ZA 3TVMB 3FUEA 1YQVH 4Y2OA 2FYYB 3MRKA 1XU6A 4HK5A 3NUKA 5AAWC 4HCHA 3G6JE 3CBKB 4KPLA 1ZLPA 4X8GA 1S7XB 2YQ2A 5EIVA 1IFGA 4U3CA 2ZWNA 3U30C 3ARRA 1N3NA 4OZHE 1U0QA 1CLYH 2Y7MA 4WCYL 5JHDD 3FXGA 1MJ8L 1AE6H 1MOEA 2HFEA 5J3HC 1ADWA 5E7FA 5D32A 1QEXA 3DI1A 4IP7A 4Y5XC 2A6KA 2XRAL 5I1HH 2X89A 1NCIA 3RX3A 1GY1A 3MRNA 4M02A 4MJZA 2Z2AA 3EKGA 2EE0A 2F1AA 1R3VA 5CJ5A 2DUZA 1OD9A 2VM9A 2PCFB 3VMNA 3M1ZA 3QARA 1GEQA 2BFVH 3FO0L 4DJFD 4OGXL 3VXSB 1FL3B 3S1XA 1UA6L 2BM3A 2I32A 1EZVY 1YO4A 1MPAL 4WUKL 2VDPB 5LBVA 4DN4L 1YE6A 2ADFH 1ZB5A 4UQCA 3H9SA 1IQDA 2J7FA 1T66D 1CFVL 4IOIB 2WWKO 4AD5A 3T0EA 1AGBA 3O8XA 4WTQA 4LOFA 1Q9OA 2WHMA 4DO6A 3LNPA 1TB3A 2JJUA 5E99H 4DGWC 4JNXA 3BDBA 2O93L 1L6FA 4CU6A 4Q9RL 4WDXA 2AKRB 3F5LA 4EPSA 1JGUH 2GBUA 4OD3H 1BM3H 1IAIM 1S78D 2DLEA 2DYPD 5A2AA 1MXSA 3U4FA 2PTZA 4ADGA 3U25A 4G6KL 1FWDC 2WC7A 3OMZA 4AYMC 2ZC1A 3GEFA 3WH5A 1J0KA 3IDIB 4Z7NF 3B2MA 4OECA 3RTQD 2RGLA 1TQBC 2OW6A 1GMEA 4M9OA 3W82A 2E8ZA 1IKFH 3WBDA 3AACA 1YHTA 3F8UB 1H60A 4KVCL 1S1RA 5C0QA 2NW3B 4Q6IC 2P9RA 1E0TA 4Z9KB 3I6RA 3QORA 1UJ3A 3EUDA 3QFGA 1SLUA 3RG6A 1OANA 1WPCA 3MOBL 5EOCJ 4G1KA 4MXQC 4XZUA 3RCMA 3LAFA 2XBTA 1ZHNA 4FI8A 3HFTA 3ARBA 3EZJB 1W31A 3KEDA 4O16A 5T5FL 1KGJA 4C6OA 3GMPA 4UTFA 4TNWK 5DDHB 4GNJA 4AD0A 2GK1B 3ESNA 5C8BB 2N0KA 2HTMA 3UBXI 1AG0A 5D1ZB 5HHVH 1AACA 1YMYA 4LASL 1F90L 3PWUA 2R91A 1DJWA 1AQFA 4PW9A 5AFDA 2Q3OA 4G8FA 4FXKA 2I7SA 1TENA 3BGMB 1XPYA 3GD1C 4AM0B 3W7RA 4GMTH 3IWUA 1ORQA 1DV7A 3AWOA 3GXTA 5AC6A 3S4SB 3K6SB 3CQIA 3H24A 1PAZA 3L3JA 4B9YA 1ID5I 3P3YA 3QQ9D 4XR8C 4K2SA 4XX5A 1AP2B 4HGWB 4NNAA 2FLIA 2E40A 3OJDA 3VILA 3V0IA 5DJYB 4C83B 2ICEC 4MCNA 1HZYA 4ERSL 4LCWE 2D9CA 4N2GA 1FYTE 3WEZA 4PP2A 5BO1L 1ONEA 3G24A 3LHZA 4XX1G 2B81A 2KZKA 1Z44A 1HNYA 4O2FB 1KF9B 3U5UA 2PODA 3V8CA 3TSBA 3L3OA 1X7QB 5MKGB 1FN4A 4AYFB 1DO5A 2WNXA 2XU9A 2CGYA 5E2WH 5LXGH 4O52A 4R7JA 3CQFA 4RH4A 4LK4A 2MEJB 4UBDD 1YY8B 3ES6A 3UBHA 5FM5O 3KYMA 3A12A 3F2DA 4HA4A 4L61A 4YDIL 3VGBA 4OCRL 1WAWA 3O3AB 3Q8CA 4CRPA 3NQAA 4YSUA 3S88L 5C2XA 5A16B 2YQ3A 3TNMB 3MU3A 4OVUA 5T1KA 5JDSB 1OG0A 5EF0A 3C2VA 4Y9GA 1AXSB 1KFGA 3FJNA 4F8OA 4DI8A 3V5FA 3QFEA 2L4OA 4GYPA 1OT4A 2V7HA 1TYEB 4PY8I 5KW9H 2Y5JA 4HT3A 5L2JA 3INUL 3K8LA 4HZLB 3GPSA 3ZGHA 4TVDA 4LCCC 5TQ2H 2B14A 3D52A 1CG9B 4K6AA 3ZN6A 4KBXA 2Z7WA 3GY1A 4QXWA 2JF6A 5DY3A 4AIZA 3VXOB 1GJPA 4EZKA 1O7SA 3ZT7A 1CWYA 4FMVA 3LD8B 3ZL4H 5JPNB 1UM5H 1UUMA 3CVHB 4ML9A 5JW3H 3IU3B 5E6ZA 3AIQA 5KSBF 1W3HA 3OGCA 1AYRA 1YEHH 1K3UA 2B0MA 5LXEA 1FPTH 2O1AA 2WANA 4OY9A 2I16A 2I07A 2DL9A 1T7ZA 4QQ3A 3QV8A 4QHNB 1P4LB 3NFUA 1FZMA 1UVQB 1THCA 4HUVB 4J3ZA 1I1WA 5HYQA 1G7PA 4K94L 4KXZH 1XG3A 4Y2NA 3IF1B 2HKFL 4RFEB 3QDJD 1SSDA 3V4BA 4J3OG 2GSMB 2EO7A 1M7JA 3ZXWA 3MPGA 3IYLW 1JNNH 5IV2A 3QQNA 2CBJA 3T8XB 2VYOA 1GA2A 2WSRA 3DX6B 1TPEA 3QULA 4HPNA 3WMLA 4XP6H 4QHPA 5DS8B 1QR7A 4YJ5A 2CUMA 4M5PA 4WV1A 3L67A 3MUCA 3S98A 3VI4B 1WBXB 4M19A 2YUWA 1QVOB 1BJ1J 2L0DA 3KCJA 4Q8TA 4LLDA 5G4WA 2IGFL 7REQB 3HJEA 2Y3AA 4Y9MA 1EZ2A 3ZTCC 3KWVA 1AZBA 1EANA 4P57B 2HAZA 3HHSB 1S9VB 5EUOE 5I2IB 4U1GB 1TQCC 3NZ8A 4N4PA 3GDBA 1XRSA 3WLIA 2EDWA 1TU2A 1R38A 2A3BA 4GG8A 2GJLA 4XVUC 2DQEL 5G4EA 4I77L 5KVGE 5FO8A 5MHSE 4XODA 1B3YA 1XLLA 2CKSA