3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
b'NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
1W9UA 4AZHA 1QNSA 4BCEA 2WMJA 4ATLA 1CXKA 2YL6A 4FNUA 2J75A 2VCBA 3WUGA 4DO4A 3BLPX 4JHOA 4OKDA 3RM4A 1C7SA 3AIBA 1GPFA 2D1ZA 1KGUA 1KR0A 2OSYA 3AS3A 3D4YA 1K6AA 4ZXOA 1VJZA 2EBNA 3B9AA 3SCOA 3WF3A 1E6NA 1GQIA 4HPGA 4IPLA 1GQKA 4Z2IA 1V6WA 1EOMA 3OBAA 3DX4A 5A8OA 4J28A 2XTKA 5FKYA 4UFJA 1X6NA 2J7CA 4PMNA 1E4MM 1UKTA 1HKIA 1JZ2A 1VB9A 6A3HA 2J7HA 1XGZA 4NZJA 1OCQA 3EBVA 3LXCA 2YA0A 2VZOA 3L2LA 2F7RA 4Z2LA 1JDCA 3BUQA 2QF8A 1HWWA 4A3YA 5I77A 5E0FA 2Y4SA 2YJQA 2DT2A 4OBSA 4Q22A 1V0LA 4Z2HA 1DWAM 2WW5A 4TOQA 3AMKA 1JD9A 1WZAA 1XCWA 1V0MA 4M82A 2DSWA 1TR1A 2BVTA 4XUYA 3ZMRA 1R87A 1NOWA 5E0CA 1CWYA 5D8ZA 2PWEA 4DO6A 4TVCA 2HVMA 4AEFA 4YHEA 1LWJA 1SFSA 2VVSA 2WCSA 3WF1A 1WDPA 3BXWA 3CUIA 4M1RA 3ZR6A 1M01A 2F1AA 3TOPA 2VVNA 1JXKA 2FGLA 3IAQA 5GPRA 2VO5A 2CHOA 5A1AA 1DHKA 4AZ6A 4EKJA 1NOFA 1H49A 2G3IA 3GH7A 2W66A 2YFOA 3LMYA 1PJ9A 2VRKA 2BY3A 3TTOA 2VL4A 1LG1A 3WEMA 2X2YA 4AZCB 2D73A 3AXHA 4DO5A 3RJYA 1W3KA 4CVUA 1ZU8A 4AZ7A 3SIMA 4PTXA 5C8BB 4W8BA 3MU7A 1ZBKA 4FLQA 1O7DC 3ZJ7A 1UD3A 3PTKA 1J0KA 1QBAA 2XSAA 3VINA 3AIRA 4V2XA 4QP0A 2YIHA 1U30A 1H2JA 1MFVA 3ZT6A 4UOZA 1RPKA 2CHNA 3H54A 1CECA 4AD3A 5GNXA 2WKGA 4YPJA 1FH8A 3CZSA 3BVXA 4AD2A 1V6UA 3WY4A 1FFRA 1GVIA 1NP0A 1C93A 2DQXA 1DTUA 1QNPA 1BQCA 4Z2KA 3A47A 1OIFA 4HA4A 3DC0A 1TA3B 4JCLA 2XN2A 4D71A 3DX1A 2VMFA 1LWHA 2VRQA 4TTGA 3VSVA 3T2PA 3MMDA 2JF7A 3LRLA 2WMKA 2WSKA 5JBFA 2QHAA 3TP4A 4AISA 3LPOA 3CBWA 4QDMA 4M56A 4YN5A 3A22A 2PWHA 1OGBA 3BMWA 3WDRA 3OIHA 3W6LA 1JYWA 4NXKA 3N18A 3T0DA 3AXIA 3G6MA 2W61A 2BY1A 1HI7A 4GQQA 1HT6A 4GO8A 5I6SA 3RM9A 1XSKA 3WUFA 1HJSA 2BS9A 3VX1A 3A6OA 1WCGA 1B2YA 3F5JA 3IGUA 4PCTA 2OW7A 3AIUA 2X2JA 3VNYA 3BMVA 1VJSA 3LX9A 4ACYA 4FLOA 4ZEPA 4PTWA 1FH9A 3FHQA 1BLIA 1CXIA 3ARRA 1AVAA 3LRKA 1QNOA 1JZ6A 4CN1A 4M24A 4PRWA 1MW3A 4UOJA 3CUGA 3WNOA 5HBFA 1CLXA 3GNOA 4MNKA 4BQ4A 3BUDA 4KRTA 1BVNP 3AHXA 3SUVA 3OGSA 3ALFA 3WDPP 1FFQA 1OWQA 2VOTA 2XVPA 1BF2A 1RD6A 4HOZA 3HJEA 3OG2A 4DWSC 1MQQA 4WKHA 3L4YA 1JIBA 1E0VA 3K1DA 4PMUA 1BPLB 1GZJA 1XH2A 5LA2A 4DUWA 4KMQA 2OW6A 2OSWA 2E8YA 3WDJA 4D6FA 4JAWA 3BAYA 4U3CA 5CZKA 1H1NA 4PMQA 1PIFA 4FNRA 1UR9A 3WQ6A 1BAGA 4DM2A 4GINA 1UHVA 3AOFA 4UR9A 2ZUVA 1C8YA 1VF8A 2OYMA 3U5UA 3L4VA 3L4WA 1FP9A 3AZSA 2BY0A 1KTCA 4AMXA 4JFVA 4HOWA 3CUJA 1V03A 3VX0A 3EYPA 1UD5A 3AZRA 6CGTA 4PMRA 3ZO9A 4GZEA 1ITCA 3CV5A 2W4XA 1EIBA 2E3ZA 2OWWA 5LA1A 1H09A 1J0JA 1HNYA 3BAIA 3MO4A 4D6IA 2YL8A 1UR4A 1HJWA 2G4FA 2FHFA 5IHSA 1PS2A 2CITA 1ODUA 3UEQA 2GUYA 3B8SA 3L4ZA 5CSUA 4IPNB 1TVNA 3BSGA 3KLKA 5HXMA 2VR5A 1R7AA 5A8PA 3WF4A 2ZXQA 4ML4A 4PUEA 4JKLA 5HOSA 4E2OA 4E8DA 4D6HA 1JF6A 4Q7NA 1EO5A 2GVYA 4CCCA 4UTFA 1K9DA 3EJRA 4P8XA 4B16A 4AWEA 3MUY1 4J27A 2E0PA 4BA0A 4MNLA 3B9DA 5M17A 2EEXA 1TMQA 4PMXA 3O2LA 3OLGA 1O6IA 1C8XA 1GQLA 1SMDA 1Q6DA 3PZGA 1E3ZA 1B30A 3VGBA 3SUTA 2X0YA 1I1XA 1HP5A 5A6SA 3A4AA 2F7QA 4CUCA 5ECUA 3WL0A 1W2PA 2C0HA 1E40A 1DWGM 1OT1A 3WSUA 4AZIA 3EJSA 4CCEA 1D2KA 3I3BA 1ZBCA 4S3KA 5I3DA 3L4TA 4LX4A 3WH7A 1W9BM 3OGRA 1R46A 1GHSA 5FL1A 2E4TA 3SCUA 3CUHA 2CKSA 4TXEA 3GNPA 2J7FA 5M3WA 5EMYA 3WDQA 2VURA 2Y24A 3QOMA 1J18A 2YBUA 2XN1A 4MNMA 1J0YA 4ZE4A 2VRJA 2ZIDA 5GNYA 3ZJ8A 3GM8A 4HTYA 3L4XA 4TTUA 2E9LA 1KBBA 1CNVA 2EPMX 5LYRA 3ARZA 4LYQA 2D3NA 1EH9A 2V5DA 3TA9A 1PPIA 2QPSA 1W3LA 4NI3A 3DX3A 4U2YA 3SCWA 1B3YA 1OSEA 3WUBA 2ZX5A 3ARYA 3WDHA 3I3DA 1JZ4A 3VIGA 3VIHA 4BS0A 5A69A 3AYRA 4TUFA 5DEZA 4JL2A 2WBKA 2FH8A 4CN4A 4B9YA 5EB8A 3ALGA 2XJ7A 3NJ3A 3KZSA 2ZUMA 5A6KA 1OINA 3WQ8A 3MSGA 2FGZA 4BQ3A 1W9XA 1QPKA 3WDIA 4AD5A 3SUUA 1B1YA 3ARSA 3PZUA 1CGXA 3N11A 3GH5A 4XZBA 1PZ3A 1M04A 1KGXA 2DSKA 1UA7A 2CBUA 2WPGA 2VC9A 1W9DM 1E4LA 4UFHA 5A6AA 1M53A 2C8NA 4M80A 1EDQA 1JNEA 3W24A 1V3IA 4E4PA 5A95A 1BYDA 1N82A 1QHZA 2DT0A 4PMOA 4YHGA 3MSDA 2VQTA 1V08A 3E1F1 2F7PA 1OT2A 2V3FA 3ARUA 3MUAA 3WBAA 2EABA 1W3JA 3W6MA 2ALWA 1ISVA 2PBOA 4LPCA 1GORA 2JE8A 4QFUA 4HOXA 3VIFA 4UFLA 1US3A 1LL4A 3CPUA 2J62A 3VO0A 5A6BA 4XV0A 1MWOA 3MMWA 1LJYA 3EDDA 4AZCA 5IDIA 1KXQA 1HJUA 4PMVA 3AHTA 1V6YA 3AS2A 1QBBA 1RH9A 4NZCA 4UOQA 2WXDM 1J9YA 2VZUA 2BHZA 4WSKA 2J79A 1WZMA 2WMGA 4J3XA 1XRVA 4D72A 4V28A 2YFNA 4PEEA 4AD1A 4UQCA 1OD8A 2WNWA 3DDGA 5FIPA 4GIAA 3CLWA 5GNZA 1E55A 3SCPA 3A21A 2CPUA 3ARXA 2F2HA 1ECEA 3VGHA 5DMYA 4HMCA 3DHUA 4W5UA 4TVDA 2Y2WA 4TVUA 2ZXDA 1JF5A 4LQ1A 3MUZ1 3S6TA 1TA3A 5BWFA 1VENA 2NT0A 4MDPA 1E71M 1WE5A 3WY1A 3W25A 4AMCA 3W0KA 1L8NA 1CXEA 2J7EA 1CXFA 3WNKA 3RILA 1QI4A 3W28A 4C7FA 4JFWA 4P7QA 1MXGA 1HVQA 1E72M 2O9PA 2BVDA 1G5AA 3IAPA 4GI6A 1JXJA 4OGZA 3AS1A 3K4DA 2G3NA 1BTCA 3SURA 5JBEA 3CZGA 1VEMA 3GXFA 4U3AA 2WVTA 3BVTA 4JKKA 2XIIA 4J3TA 4EAMA 2OYKA 2O9TA 3OZOA 4W87A 3N1AA 4FNTA 2B31A 4H7VA 4W86A 3CHFA 3BC9A 1MQRA 1GQJA 1VFFA 1UWRA 1BG9A 3WEOA 3ARQA 1DWJM 4WKFA 2PF0A 3VDBA 3ZT7A 1MFUA 2BV9A 2RGMA 3GBEA 4HZ8A 3BAXA 5IFTA 5EFFA 2GDVA 2EACA 3ZM8A 1Q6CA 5A2CA 3D4ZA 3WELA 3F5LA 2PC8A 3WY3A 3D51A 4LYRA 1H41A 4R27A 2JIEA 3GYCA 2XWEA 1PX4A 2FHBA 5DO8A 1HJVA 1IZJA 3HG5A 5I23A 1UKOA 5D9OA 2BHYA 4PTMA 1CXHA 4PMZA 4CD5A 3GXNA 4CKQA 1AMYA 1BHGA 3EJUA 1NWUA 1OBAA 1WKYA 1BGGA 3DYMA 1HKMA 3IANA 2UY5A 2XG9A 2O92A 3WQ4A 3CZJA 3VMOA 1MQPA 1J01A 4OUEA 4DUXA 1CTNA 2WB5A 3OZPA 4W5ZA 1ISWA 1V0KA 1UASA 4CVWA 1E6ZA 1UR1A 1HN1A 5HPCA 4W8LA 2XFRA 4RE4A 3VIIA 1JD7A 3VM5A 3SCVA 3WNMA 1CENA 3VIMA 1KXVA 1DWIM 1VBRA 3PHAA 2IXVA 3K8MA 1GHRA 5KEZA 3VD9A 4E8CA 1GJWA 1PZ2A 5I24A 2FE0A 4QAWA 1UA3A 1KQYA 3WD3A 4ZXLA 2W67A 3EDKA 3W81A 2ZX9A 2Z1KA 2D22A 4CD6A 3OLEA 2ZX8A 2CNCA 1UQYA 1US2A 1E9TA 1NP2A 3WUEA 3CZEA 2VCCA 1HF6A 1LQ0A 3M46A 3CMJA 3BLKA 3KEHA 1KR1A 2CBVA 2YLLA 3A4XA 2GJXB 3WD4A 3BGAA 2VCAA 3PBGA 4CGTA 3SCNA 1VIWA 2BNJA 3VVGA 5A6BD 2J78A 5CG0A 2XVGA 1F4AA 1JI1A 2WYSA 3MV11 3CTTA 1BYBA 3W27A 1E6XM 5HNNA 1H4PA 3EDFA 3FW6A 2E40A 1BYAA 1G01A 5IHRA 5DT5A 1KTBA 4FNPA 1JI2A 5ABGA 3MS8A 4KRUA 3ZR5A 1JFXA 8A3HA 2VX7A 1E6SM 1B3XA 1B3ZA 3AHZA 1ISYA 3CHCA 1UD8A 4J3SA 4UQEA 1V6VA 2NSXA 2JF6A 1JG9A 3EDJA 3TTSA 4JIEA 3ZJ6A 1HXJA 1XYFA 3LXBA 2D0FA 1I75A 3KL5A 5E09A 5D9NA 3D52A 1KBKA 2E8ZA 3WENA 1NQ6A 2BY2A 3CC1A 1C8QA 3H55A 2X1IA 3KLLA 1UKQA 2UY2A 4N42A 4FLRA 5C70A 3GXPA 3BSHA 3VDAA 3OLDA 3JUGA 3KL3A 3N9KA 5E70A 1UR2A 4D6CA 1V3LA 1QI3A 4JFUA 3D50A 2WM0A 3FNDA 1W32A 4B9ZA 4FMVA 1J12A 2WHJA 1EGZA 2QV4A 2J74A 2BXZA 3KL0A 4GI9A 2WZHA 2GSJA 1PSPA 2DIEA 3AHVA 3QR3A 3VIKA 4HMDA 1GOIA 2WHLA 3HN3A 3GNRA 1WZLA 3MMUA 1W1TA 5A8MA 1PX3A 2YDQA 4ZENA 4C7GA 1E6QM 1UYQA 1E9LA 2NT1A 3TV8A 1B90A 1WAWA 1J0ZA 1BSIA 5A6LA 5D9MA 3WH6A 1Q6GA 2VZSA 1CGWA 1PBGA 3QHOA 3DECA 5EBAA 5IFPA 5LA0A 1FA2A 2CBIA 4H04A 3AZTA 3MV01 3PN8A 1QI5A 1G9HA 1E6RA 2X2HA 3ARWA 3FAWA 3DX0A 4W88A 1JDAA 5E6YA 2VJXA 1Y7VA 2YL5A 4MADA 3EMQA 3S5YA 5BXSA 4AY1A 4W93A 4QLLA 1UKSA 4AIOA 5M03A 4KGJA 5BRPA 2DT3A 1B31A 1BFNA 4WIWA 3FN9A 2CESA 4AYGA 3ECQA 2VX4A 5A2BA 3PZTA 1MVYA 2J4GA 7TAAA 1QW8A 1E0XA 1L0PA 4HMEA 4AD4A 5F7UA 4D6JA 2A3HA 4UQDA 1GJUA 4EANA 3RJXA 1V3KA 4MNJA 1RP8A 2A3CA 1RP9A 2XN0A 1XHGA 4OOZA 3F5KA 7A3HA 2WWCA 3NCOA 1EHAA 2EADA 2Y8KA 3PZOA 4K68A 1QWUA 3AMGA 3AFBA 1DWFM 2GDUA 1TQTA 2ZUSA 2ZUWA 1AQHA 1NARA 4NXSA 1UWQA 1U33A 3W38A 1K9EA 4BF7A 1HXKA 1TCMA 3EJTA 3VD3A 1EXPA 2EQDA 1GOWA 5FD0A 2WZIA 2V3DA 2D2OA 2PI6A 3W4RA 3J7HA 1R8LA 5I78A 3GBDA 2ZE0A 3RM8A 4J3WA 2J7GA 5HPOA 1H0GA 2C7FA 1TVPA 3RPMA 1O7AA 3UG5A 1WDRA 2A3AA 1EDGA 4JHZA 1G1YA 3N15A 3BCFA 4PSRA 1TE1A 3CHEA 2NW0A 3LRMA 4CU8A 5DFAA 2W62A 4AD0A 1ITXA 1WNOA 2EJ1A 3WD0A 4AIUA 2WZEA 1R33A 4AIEA 5JBDA 3CZNA 4CU7A 1QNQA 3VD5A 2EO7A 3CIVA 1OB0A 1ISZA 4Z2GA 1QHPA 1OD0A 1XC6A 4JFTA 1ZBVA 5AC4A 1DP0A 1UH2A 3QHNA 3ARVA 2XFYA 1WDQA 1UD4A 1KWGA 4AEEA 4BQ5A 4CD7A 1UR0A 3CO4A 1UR8A 3T0BA 4W7UA 3AHYA 3GZAA 3U7BA 4XZWA 1CPUA 1HVXA 4NRSA 1UH4A 4HP5A 2WWDA 3QHMA 3BCDA 1WDSA 3N12A 4HA3A 1H11A 3VGDA 2XYLA 4UFKA 2YKKA 4PSPA 1ZJAA 3AS0A 1E5JA 3VGGA 1H0IA 1R75A 3GDBA 1WP6A 1TQSA 4GO9A 2D3LA 1PS3A 2WCAA 5CPTA 2W91A 9CGTA 3AQUA 4OBRA 2WHMA 1WB0A 1LLOA 1F4HA 1BYCA 1NWTA 1A3HA 1NH6A 2EPKX 3LPPA 1KCLA 2XVLA 2CEQA 3ZOAA 4A3HA 3WFZA 2DPEA 3K46A 1H3GA 1QW9A 2ZXBA 2XHYA 1TQWA 2F7OA 1GOOA 1EQCA 1R85A 2ZWZA 1TFVA 3EDEA 3LXAA 3AROA 4L4PA 2WMIA 5A6JA 1B9ZA 2XVNA 2GJPA 5BXPA 2ZXAA 3S2CA 3L2MA 3K4AA 3FY1A 3PZVA 4ATWA 1XD1A 2PB1A 3VU2A 3QOKA 3A5VA 4KWUA 2OWCA 5ABEA 2F18A 2FH6A 1Q6EA 3WD2A 2O9OA 3N13A 3PZIA 1XSJA 3NIYA 4MDOA 3W29A 4GZIA 3WQWA 1DWHM 5ABFB 2QMJA 2WKLA 1FH7A 4U5KA 1HJQA 1JZ5A 2CBJA 5BYWA 3SUWA 1FOBA 2VI0A 3N04A 4HZ6A 1AQMA 3DHPA 1CEOA 3M07A 5FOOA 2XGBA 1CGVA 1OGSA 1E1FA 3ZT5A 4H8UA 1W91A 2YL9A 1D7FA 3CHDA 2JFEX 3OB8A 5A94A 2XIBA 4RE3A 5AY7A 4JFSA 3MKKA 4GZJA 1CLVA 3IJ7A 2GJXA 3WNNA 1PCPA 4AZGA 4GI8A 1D3CA 2XVKA 1V3HA 4AZBA 3VMNA 3A4WA 3BVVA 5FL0A 5E6ZA 1MXDA 4FNQA 4QCEA 5CGMA 1E70M 5E1QA 4NSBA 5DF0A 4GKLA 4AW7A 3F4VA 3RDKA 4OZOA 3PTMA 1R86A 4F79A 2W5FA 2MANA 1ZS2A 1LL6A 1LF1A 5BXTA 1BGAA 2ZOXA 2D0GA 4HU0A 3VSTA 4IISA 2V5CA 3CH9A 8CGTA 3BUIA 1E5NA 3FXYA 1R34A 3UERA 4B3KA 1U2YA 4UZSA 3SEPA 3AYSA 1TG7A 3CZLA 3PZQA 3PZNA 2WLZA 2ZWYA 4DWSA 1PE31 3IJ9A 1NOUA 2CERA 3WNLA 4JKMA 2W63A 1EO7A 1KFWA 3NDZA 2ZX6A 3UETA 2J7BA 3T09A 3KE0A 5CJ5A 1C90A 3NUKA 4F66A 1QHOA 4B3LA 5BRQA 1W9VA 2GK1B 3LPFA 2HISA 2WC7A 1VEOA 1JZ7A 5A8QA 1QI2A 4TX8A 1V0NA 2YLAA 4W8AA 5I79A 3AMDA 4H2CA 1WZKA 1VAHA 3A23A 1JYVA 3LPGA 5D4YA 2EPOA 3HMCA 3MI6A 1GOMA 1V02E 4HPHA 1UD2A 4RL3A 1IZKA 2FHCA 3VUPA 1VFUA 4GPNA 3A24A 3GTNA 4HZ7A 4D6DA 4CD8A 1W3HA 1MYRA 3UESA 1UZ1A 3BH4A 1UZ4A 1EQPA 1P6WA 1KGWA 1W1PA 1Q4NX 5EFDA 1I1WA 1XYZA 1VFOA 2PWDA 4BQ2A 3RCNA 1E4NA 4MB3A 1E0WA 3WMSA 3WL1A 4X0NA 4Z2JA 3BUBA 3GH4A 3VTRA 2YDSA 2WSPA 1K9FA 1B3WA 5CLTA 2WMIB 4MB1A 1KWKA 5CQ1A 1TZ7A 4CN6A 1KB3A 1OM0A 2XM2A 5CPQA 4AZ5A 3WH9A 2ESCA 3ZIZA 3WMBA 2CETA 4P7OA 4DM1A 2QMKA 3NSNA 1BG4A 4FLSA 1CZ1A 1UD6A 3BAKA 3U7VA 7CGTA 3RIKA 1UWUA 4AC1X 5AYIA 4PMYA 4MTVA 2DSVA 4B15A 3UCQA 2GJRA 4P7RA 1HX0A 1MW1A 1UWIA 4J3VA 1GONA 3WQ5A 1FHLA 3K8KA 4FNSA 3AIWA 3U57A 3AICA 2WHKA 4JL1A 4M29A 1J0HA 2RGLA 2EPNA 2X8RA 4UQBA 2O9RA 4RE2A 3VOCA 4V27A 1HKJA 3WMCA 3OA5A 4XX6A 1XH1A 3WFLA 1SZNA 3T2QA 2G8ZA 4D6EA 3AIVA 2J47A 1R47A 4AXNA 1S46A 2XWDA 4AMWA 1G0CA 3VD7A 2WLYA 3BAWA 1E6PA 1E4IA 1UWSA 4HA1A 2D0HA 5CGTA 1UH3A 1J0IA 2ZUTA 3T08A 1ESWA 2CXGA 1FHDA 2G3MA 5D9PA 1YHTA 3O6AA 1UKPA 4UZUA 2JEPA 4ATDA 1ZB5A 3AMLA 3HG3A 1ZJBA 2F1BA 4IUGA 1J10A 2XSBA 4M81A 5A8NA 2WANA 3MANA 2GFTA 3FAXA 1EOKA 2W92A 1CXLA 5BCAA 4LGXA 3VKKA 3POHA 1YQ2A 1W1YA 3W82A 3WN6A 3GXDA 3II1A 3UR7A 2WC3A 2XPKA 1SR0A 3TONA 4WKAA 1E15A 4DWSB 1H5VA 3NYDA 4EK7A 1JZ3A 2VZVA 3K8LA 2DIJA 4UCFA 3WH5A 1CGTA 2D23A 3VGFA 3AIQA 3I3EA 4L4OA 3PTQA 4CU6A 1MW0A 2J8FA 1WPCA 4U5IA 4ZE5A 3WF0A 4KGLA 3WKZA 1PX8A 5CXPA 1Q6FA 1UG6A 4P8VA 2WVUA 4IM4A 2DSZA 2EAEA 4EE9A 3W26A 5CPSA 4P8UA 4UQAA 2F61A 4DWSD 2UY4A 2CCRA 1QNRA 2DGAA 1HTYA 5A2AA 1EA9C 1LG2A 3EJQA 4D1IA 3BAJA 2VX6A 4R5EA 3HU7A 1EHNA 4UQ9A 5I2UA 1JGIA 5AYBA 1XV8A 1UUQA 4A4AA 3GXTA 1SYTA 4BZYA 2XGIA 5E9AA 1JAKA 2XFFA 3AISA 1VFMA 1M7XA 3QGVA 4U2ZA 1W2VA 4URIA 3G6LA 2A3BA 3VIJA 4PCSA 2XM1A 2Y8VA 5M5DA 4MAZA 4MB5A 3W53A 3DX2A 3IJ8A 2IXUA 4OIFA 1OIMA 3SCTA 1PAMA 1XSIA 3VMPA 3ZSTA 2WBGA 1CYGA 3B9EA 5I0DA 1IT0A 3VIPA 4PBGA 4P7NA 3M6DA 2BHUA 4H8HA 4Y7EA 5IXEA 2G3JA 4U31A 3HG2A 1C92A 2DSUA 3HZ3A 3NDYA 3AIEA 4J3UA 5KZ6A 1G94A 1TUXA 1MW2A 4X9YA 2FYVA 3PZ9A 4KH2A 3GXMA 1X1NA 3CZKA 4CD4A 1XH0A 5ABFA 3CMGA 3VDCA 4FK9A 2EXOA 4PTVA 5I5RA 1LL7A 2JALA 4MAVA 4UNIA 4CCDA 2ZUNA 1CIUA 4H41A 1BVZA 1TQUA 3CUFA 2WVVA 4NRRA 1V02A 4NX0A 4LYPA 3N17A 2D20A 3M7SA 4H8VA 1K9TA 1T0OA 4U33A 4J7RA 1KCKA 3DYPA 1VRXA 5AC5A 1V6XA 3SCSA 3BVUA 3WD1A 1NM9A 4ACZA 4QCFA 1UQZA 3W37A 4S3JA 2CYGA 5D8WA 4PN2A 3SUSA 1DEDA 2V3EA 3S5ZA 1GOQA 2VQUA 1KXTA 2PBGA 4UFIA 4LXFA 3DYOA 5JIPA 5BXRA 5FCZA 1V3JA 2DDXA 3THDA 2VUYA 1R7OA 1C91A 1QWNA 2Y5EA 1CBGA 1E73M 2X0HA 4WF7A 2V3GA 1JAEA 4OJYA 3AXXA 1JL8A 4P8WA 4PMDA 3T0AA 3APGA 3UG4A 1QI0A 2BXYA 1GCYA 2OSXA 2A3EA 3EMZA 2VX5A 2Q8XA 2E9MA 2YA1A 2J25A 4WK9A 1C7TA 3VIOA 4D6GA 4MPKA 1QVBA 5GQBA 3EMCA 1GW1A 4PUDA 5JIWA 5CLWA 2EPLX 2UWFA 4DUVA 4WSJA 1ZBWA 1A47A 2GK1A 1X6LA 3ZQ9A 3VSUA 4QLJA 2WK2A 1HIZA 2IGTA 1HJXA 1JDDA 1E43A 3POCA 5BROA 1JNDA 4N0RA 3O9NA 1NWRA 2IUZA 2YOCA 3WQVA 2PSPA 2DH3A 3VGEA 3WY2A 3VM7A 2BVYA 4QLKA 4GQRA 5JUVA 3OGVA 3U5YA 3VD4A 1JYNA 1HKKA 3VDHA 1SMAA 2V38A 3GXIA 4M8UA 3HG4A 2VZTA 1ZL1A 1W1VA 1JFHA 1M03A 3AJ7A 4X0VA 2G41A 3CZ8A 1JYXA 2OWXA 2D24A 3D3AA 2X05A 2WMHA 2JEQA 4F9DA 1J11A 2BFGA 3BLBA 3NSMA 2WMFA 3ARPA 1QX1A 3SCRA 4MB4A 4JZ5A 3H53A 1NWSA 3BUPA 2YBTA 2XUCA 1KXHA 3ZJKA 3WEZA 3UR8A 4WLCA 1CDGA 4W85A 1XD0A 1QOXA 3TTYA 3TTQA 2ZUUA 2CKRA 5TD4A 4D1JA 1TQVA 3MUIA 4W7VA 1B0IA 2WC4A 2AOSA 3ZSSA 5DT7A 3ARTA 4AYSA 4F9JA 3T2OA 1AQ0A 2VTFA 4W89A 4MJ2A 4TX6A 1W9PA 1CGUA 3NSXA 1EDTA 1GOKA 1HL9A 3KWXA 1UWTA 2Z1SA 4GXPA 1VBUA 3WNPA 5ABHA 5CSYA 1OGGA 3VPLA 2YA2A 3OLIA 2WVVB 3SCQA 3WBEA 4MJ4A 2ZX7A 2PWFA 3RMEA 4W7WA 3EJPA 2F8QA 3D5HA 1C3FA 1HP4A 2DEPA 3A3HA 2CIPA 1Z32X 2QLYA 1IV8A 3WH8A 5A6MA 4ACZB 1WO2A 1GNXA 2J7DA 4F8XA 2PWGA 4P7LA 1V3MA 2VT0A 4XB3A 2AMGA 2QPUA 3UG3A 2J8GA 1PIGA 4NF7A 1E56A 1GUVA 1ISXA 1UOKA 2VNCA 3DDFA 2OYLA 3THCA 5HDRA 2VR4A 1JZ8A 5A3HA 1E1EA 2WVSA 1ODZA 4WJXA 2AAAA 4NZFA 1PEZA 1XCXA 1E3XA 1GVYA 2DH2A 2UY3A 4UFMA 2OLHA 3WIJA 3AI0A 2WCGA 4HU8A 4JCMA 2FDMA 2X09A 3PZMA 4OOUA 1HL8A 4C7DA 3L4UA 1B3VA 4PYSA 1KQZA 4W84A 1VEPA 3FHAA 4ZFMA 2TAAA 3IK2A 2X2IA 2YDRA 3RO8A 1CGYA 2J77A 2WAGA 3WF2A 2DT1A 2E9BA 2ZICA 4FF5A 6TAAA 3VILA 3VNZA 5C71A 1FP8A 3BVWA 3CGTA 2JIWA 3AMCA
chains in the Genus database with same CATH superfamily
1E67A 4YZWA 1DIOA 4PUNA 4JGJA 5B1AB 5IK3A 3U4BH 1C7SA 1GYVA 3LQAH 3F3HA 3FQRA 3G5ZB 2ARJA 4PCYA 4ZW7A 1RZFL 1JJUA 2VJ8A 3FTGB 5GRXG 4MDRA 2ADFL 2KZ1B 2HMCA 1LO0H 5ICYB 2YOAA 4L8DA 2XWJB 5DUBA 1OZUA 2D7MA 5C7XH 2Q87A 3I6TA 5DHVA 1Q7ZA 5F93C 4JXCA 4Z2LA 3DTXB 3WJMA 1NJ9B 4J2MA 4ZRGA 5KZMA 4OCRL 2YLHA 4JEJA 2LE9A 2K7QA 4KFPA 2CDFB 3GI9L 1XEDA 3IIOA 4EBQH 2PTDA 5E00B 3GKWH 4HBCL 2VVSA 4GKNA 4ZNCD 1ZIBA 1WDWA 3PUDA 1YEDA 2CHOA 4RPQA 2WZPA 4U1GB 1MJ8H 4PH8A 4KFZC 5T8GA 4OUIA 3MRJA 1RFDL 2XN9B 3WEMA 2VDIA 2MTAA 4CVUA 3RIFK 1C9SA 2EC8A 1X7IA 5MEPA 2Q02A 3G5YB 4Z23A 1WWWX 3C8KB 5EFIB 1MFVA 4B97A 3IXTA 3UTSE 2HVBA 3CIAA 4APXA 5KSVB 3DHJA 5G4WA 4Q89A 5AHEA 3DRQA 4PRPA 4PS4L 4PFMA 2RH0A 1F3RB 4HGMA 5EG6C 5AKRA 5AB1A 1Q7MA 2F0CA 1U8IB 2YR3A 5SWUA 4O14A 1NCAL 5A2FA 1SYVA 1RA0A 2X4NB 2WMKA 3SDOA 4IP7A 4M56A 5IKCB 3KUMA 3U6RA 4PYHA 1I1FB 2DMGA 2IGLA 3OIHA 4AEHH 2P26A 5M2FX 3CAFA 2VN4A 3MGTB 3RA7L 5BO1H 3O6YX 1UWXH 1IT8A 1J93A 3MMEA 1B2YA 4YR6B 1UCBL 3VTTA 4ZL1A 4PU2A 4PCTA 3UBGA 3UZVA 1X5GA 3E2RA 1KF9B 3UPRB 3CQKA 4IYKA 4QRQA 2DUZA 4WFGE 4XH2B 5I1DB 3NPUA 2LAGB 5D1ZD 5CBAA 2VERN 2KL6A 3GNOA 1VFAA 3V4PH 5H4YA 4O4WA 1CD1A 1BVNP 1S5HB 1RIHL 3KDMB 1DBJL 3UAJA 3HJEA 4KMTH 2EYSB 4L4VE 2ODHA 4PR5B 1CFTA 2A6LA 1M68A 2Z29A 1AW2A 1UR9A 1AGDB 5E4IA 2QVFB 3KLDA 1F05A 3G18A 1LBFA 2DZSA 1Q9LA 1P4CA 3U30C 5DSCB 3CK0H 2NY0B 2XIDA 3ULSA 5AHIA 1G4RA 1REQB 3N6HA 5HXMA 2F54E 4WO4A 2AV7A 4RQQB 1VKXA 4JKLA 5HOSA 1WT5A 1E4XL 1JF6A 3VJ6A 1X4ZA 3IARA 5GHWH 3B9KB 4AWEA 2F53A 4J27A 2E0PA 3SO5A 1MIEL 1JV5B 1BVLA 4BFJA 1C8XA 5IHLB 5J1TC 1Q6DA 3VGBA 4DP2X 3NT0A 3RU8L 4DVOA 3MLRL 1MUMA 1PZCA 4ZXBC 3O7UA 2Q6WA 4H9ZA 3H2CA 3NZSA 4P3DB 3WH7A 3TEXA 2OMWA 2ZZ6A 3B6SB 2V9QA 3FU7B 3RAJL 1B6UA 4LCWD 4JFZL 4UI2A 3OVUB 2B1AL 3GHUA 1XTMA 3UZ5A 1W3LA 3SCWA 4ZMWA 1RUQH 1ZLDA 1AJ0A 4UT9H 1KB5H 3BIBX 4F37F 2AZUA 4XNYL 4KJYA 1FCBA 1FTXA 3AU6A 2XJ7A 3QJUB 2ZUMA 4DKEH 1UOVA 4YAQA 2NTSP 3OXRB 5DT1L 1U8LB 1O5XA 1AKJA 2RJGA 5F9JA 5A6AA 4TVSa 4HJ1A 3HLAA 4OUUB 2DT0A 1RR2A 3CS2A 3H9SB 1XYMA 4XPTL 3FU8A 4JFQB 1W3JA 4GMSL 5CJXC 2YMTA 5SWZB 4RDQF 5CN2A 5MKGB 3B97A 1OTTC 1MWOA 5IW1A 4WDUA 4HKZA 5JUEL 4PMVA 5CKGA 1QBBA 3ZVHB 3FO2B 1NTDA 1F4YL 5DS1A 3VFTB 3KPQA 1I7ZA 1QSFB 3DX7A 4J3XA 2WSRA 3U4BL 2XOTA 1CFBA 3P0GB 3GUFA 5AAWA 5TGBA 1E55A 4N9DA 5I3JA 4FC3E 5HP5A 4NC1C 4J2PA 3UAJC 1XPGA 2A1YA 1TV8A 2QPXA 4W5UA 2VFIA 3ZN6A 5BWFA 4GIOA 2DMBA 2KZWA 1HSBA 3MJWA 4MCYB 3W76A 3IF1A 3JVFC 5F96H 5DZNA 5G4HC 3HE7B 3OKKB 1ME7A 2NMSA 3P40A 1DE6A 1Z1WA 4A29A 4MNQB 2P5EE 2VYRE 2FWUA 1MNUH 2HV5A 1JGVH 5CSZA 2BBFA 2YD0A 4YE0A 2VMCA 5EU6D 2B31A 3CN4A 4IOIB 2MUCA 2XTJD 3VFSA 1IGIL 5C0EB 2CPCA 3GSOA 1E5BA 3NN8B 3RGVC 3I84A 4YO0B 1Y65A 2C9RA 3K5XA 1NINA 2JH2A 1WD8A 2WNXA 2XWEA 1TTQA 4ZMGA 2CDEB 1PNDA 2GAZB 2UWEA 1X5LA 3F58H 5GZOA 2BOBA 1GTEA 1WT5C 3SO7A 2IFFH 2I7GA 4XC3H 4MA8H 4TLUA 1YLVA 5ANMA 3AVEA 4ML9A 3V5KB 1BHGA 4KK8D 3BWWA 1DL3A 2O92A 1OD9A 1PS9A 1YG9A 4Y16B 1LUCA 4WHYG 3ESNA 2XG5A 4E41D 3Q3GA 5BWAA 1WICA 1HN1A 3VXOB 4JO2L 1MFEL 2ED7A 3F7YB 1TV4A 3N25A 3VD9A 4I18B 4RW5A 1P6FA 4AJWA 4UNLA 4ZXLA 5CEYB 1JNHB 5HHNB 4DYKA 2BXVA 5IQ9B 3CFEA 1YTDA 1DQDL 4P8QA 4BR1A 4OVVA 2GSGB 2RIKA 5BO1L 2DLFH 5TQ2H 2PO6C 5I19H 3WJJA 3DSFH 3B1UA 2IQDA 4NKOB 2XVGA 5AAMA 4ONGH 5AVUB 1E6XM 3AB0B 1H4PA 2E40A 3VKBA 3IIPA 5DJ6A 4C83A 1CE6B 5FYJU 2X4PA 2A77H 1UA6L 5EL1A 3VNDA 4C1LA 1S7QA 1UENA 1HXJA 2R1WB 4M61B 2QCMA 5DXXA 9XIMA 1UROA 3JWNE 4I7UA 2YPLB 2BK8A 4HIQA 1XCTA 1GY1A 4O1CA 1NPNA 5BZDA 3MW7A 1UW9A 3R2GA 3WJSA 1FP5A 5AUMA 1INDL 4IJ3C 3KPOB 4XMVA 4GXMA 4NUJB 1AG6A 2NQ9A 1N67A 1EGZA 5K9KA 2PR9A 3W2NA 2ENYA 2DIEA 5HHXL 3D4GA 4KRPC 1B4EA 2MNJB 4PUBH 4EF9A 5FO7A 4OVUA 3CPLA 4JTCA 1PZDA 5JOPE 5CF3A 5BOJA 4GXVH 5IFPA 4DNHA 5F6HJ 2PCYA 2QTEA 2CBIA 5TQ0L 2CCLA 1EFQA 3F6LA 1A3QA 4MMZA 4JPGA 4IG2B 1BZDA 1KCSL 2X41A 3TL5A 2FIKA 4BHUI 2UX6A 2OZ4A 1BFNA 3TO4D 2LV4A 2X42A 3W74A 2JCCE 4OE7A 5F9OH 3BPLB 4F8LA 3W11D 4AD4A 1E50A 3U6XA 3HMWL 4HF5H 4AYFA 2NQZA 3NCOA 1EHAA 1Q9OB 1I8AA 3WTUA 1YPZB 1LLZA 2VDOH 3W1NA 2QR0A 4CQ8A 2OT0A 4LLDA 4BK5A 3H2MA 3TXVA 4DXVA 4S3AA 5GZOC 3VZZA 2HDJA 2NX1A 3EJTA 2F6XA 2MCMA 4YDKH 1R3RA 3NYZA 3PDOB 1V77A 2DQDH 1FJ1A 3N41B 1K3ZA 4LLQB 1FVPA 1E5YA 3KCWA 3BP4A 2FSDA 3FO9A 3KRBA 1EL3A 1K6QH 1LQSR 4DHLA 5IUCA 3MV9D 2WZEA 1DN2A 4XCEA 5KZCD 1ISZA 4NQ1A 3DGDA 2WQSA 1UH2A 3QYCA 4IJRA 1VPOL 1I2NA 3L5MA 4PRHE 3CM4A 2QPEB 2GTWB 1SHXA 1T4WA 2QSCH 1WP6A 4XN4A 5DYOB 2I9UA 5AVQB 3WJJC 1HO4A 5D32A 4Q56A 4A3HA 3REVB 5C0GB 2WQXA 4Y4FD 4GUCA 4M3HA 1BDYA 2X9YA 4K55A 2EDDA 1FL3A 3N0AA 2FB4H 2H41A 1XPYA 2DZEA 4FDWA 5DEFA 5I28A 3PZVA 3VU2A 1CBVH 3FTZA 3QEQD 4QXGH 3ES6B 2A38A 3LD8B 5LIUX 3UW6A 4HCDA 2AQRA 3O6KH 2RCSH 4KITB 2OMYB 1NANH 5FOOA 2BSSB 2P42B 1E1FA 3G6AB 5K9OA 4NAQA 2JFEX 4TNVF 1YNYA 3NZ8B 1EMTL 5L2JB 2GJXA 1QRQA 4MM1A 3HBPA 4JRYE 3GHBL 4IHOA 3G9AB 3GU2A 4D0DB 1U83A 1KXTB 4WZHA 5FCSH 2P5WB 2EVFA 4PJ8D 4ZVJA 3MGAA 2OTDA 4JFEA 8CGTA 1W72A 7PAZA 5GRVL 3BUVA 1I31A 1T1XB 4YGVB 1Y6NR 3V0EA 3S47A 2ZWYA 3CFCL 5I1EL 1KIUA 2AGJH 1RHHB 5KSUA 1TV7A 3LU2A 4NPYB 5BRQA 3LPFA 2FZ3B 5FAGA 1KPVA 1R5WA 1K4DB 1Z0MA 5EIIB 5B7ZA 4TX8A 1V0NA 4FQQA 5JDJA 1HEZA 3A23A 3L3IA 1V02E 4XUGA 2L7EA 4HPHA 1IZKA 1MEXL 4XO4A 3QIBA 3VUPA 2BDQA 4ZUUB 4UBPC 3KM8A 2CRYA 2CRMA 3PHOB 1NMBH 2NZIA 1KGWA 4XAZA 4OM1L 1PQZB 1KENL 2B20A 4LS2A 4MB3A 2W9EH 1GWJA 3KHJA 4AH2A 2WP3T 3GEFA 3MRNA 5L9DL 5HYJD 1I8LA 4X2UA 5EU7C 1NY1A 3O0KA 4CN6A 1BLNB 2J8UA 4FLSA 4JO3L 4JFDD 1SDYA 4OW6A 5EIIG 7CGTA 1VFSA 1F90L 4LEQA 3DFHA 3MJMA 4AF0A 5KYYB 2WD0A 2HCZX 2WHKA 5J6HB 3H26A 3W01A 4O02A 5CS7A 3V7MA 4RE2A 1T89A 4NNCA 5CAHA 5IJKA 2AI0H 3T2QA 4AXNA 2WLYA 4UC5A 3PJNA 1YMMA 3LZFH 1ZB5A 4XPAH 3HHSB 3TJLA 5B8CC 5L7XH 1AD4A 5SV4A 2W92A 4GQZA 5B3SB 4JS7A 2C1HA 1F11A 2EDWA 5SWSE 1ZGLP 5GJTL 3K8LA 4P5TA 3QTPA 1H5BA 32C2B 1T99A 4U1JB 1U58A 1MW0A 3WS3A 5EA0L 4NZTL 1QNIA 1PX8A 3P30H 2FYMA 3CVCA 5C9UA 5J6GA 3BD3A 5I26A 4ZO9A 3W0WD 4MXQD 5IK3B 1FFOB 2CCWA 1G43A 1HTYA 1BBDL 4OLYL 2PDYA 3U30B 3BAJA 4U6VH 3QCVH 1AZCA 5F9OL 5DVLA 3FQRB 2ARJB 2WMPA 5EY5A 2JB6A 5T1LD 4HF5L 1HU8A 3QGVA 2C4XA 4AM0A 1P0EA 2FDSA 5DUBB 1JUBA 2O30A 3QXVA 4QE1A 2DP3A 1KEMH 3S35H 2BIHA 2EXYC 4KDVA 5D02A 5L4FA 1LLAA 5F1VA 1RZ7H 1L2UA 4S23A 1DIKA 4A2HA 4YHIA 1GYCA 3HZ3A 4FQ2L 3IGHX 3O3RA 3TKFA 4ZXBB 2FYVA 4KH2A 3VDCA 3UWVA 2OMXA 2FAUA 5E6UB 3B0PA 2HVJB 4XC1H 4WUUD 5H2BB 2K7PA 3L1OL 1MDTA 4NQDB 3CFIC 1H7PA 2UZPA 3WFHA 2YYUA 5MEPB 4IL2A 3P73B 3HI5H 4FF7A 2VLRA 1P1ZB 1DSWA 2NW2A 4O2FB 4U1LB 5FR3A 2HT4D 3IXTB 4APXB 4LT9A 2DDXA 4ZMZA 3V0VB 1S1PA 3WX7A 4Z1AA 2X0HA 3QAQA 5ENWB 2CBTA 1NQBA 3L3JA 2A4AA 3DRQB 4AG4H 1NBYA 2QDEA 1QI0A 3T71A 2VX5A 4NQXA 5I1IL 2BSDA 4I13B 5KBDA 4ZX3A 3VIOA 3LKQA 1VRSA 5HVFB 1SZEA 1XDMA 3UJSA 4V1XA 1ND0A 3FCTA 3HZVA 4FTVA 3LK6A 3V7AE 2DQMA 4GQPH 2D31A 4EDWH 4DZIA 2DVXA 2G0KA 1EBAA 2TRSA 5CNHA 3SDAD 4NQEE 4D8LA 3IPEA 1U5HA 3WY2A 2CHRA 1MCRA 3HM7A 4XTRC 1OEPA 2DWXA 1MF2H 1OX4B 1M03A 1P1XA 4JMNA 4QRQB 3LN5B 1GZ1A 3FTGA 2BFGA 3RE0A 1VFAB 5ICYA 3SCRA 5E03A 2ENPA 1TEYA 1AR1C 1CS6A 2MPAH 3SRHA 1IGCL 3JZYA 2CZVA 3DTXA 3SD2A 3WGVB 1NJ9A 2O26U 4ELDA 4P5TC 1N19A 2VHLA 3MUIA 4UTIA 1L0XA 3W88A 3P67A 2VTFA 1L6PA 4PJIF 5LB1A 4LP5A 4A2SA 3LIZL 2GVGA 4XMLL 3QQXA 1TTBA 4PGBB 3Q2LA 3QYSA 3VWJD 5AVNA 1K5NA 1JUFB 3NJIA 3K4ZA 2AGJL 4PJCF 3DFNA 4AQOA 5AC6A 3D5HA 1Q9LB 5G2IA 2XN9A 1AZZC 2E1WA 2VM3A 3RGVB 3LQLA 5IBLD 2INFA 4L3EB 2UZXB 4OU3A 2COVD 4F8XA 1GA2A 4Y9PA 3MLZL 3G5YA 5E2WL 3P0VH 3C8KA 2J8GA 5EFIA 5I1AA 3UJTH 4R84A 2VNCA 5A3HA 4ZZ9A 4L9ZA 3NRFA 3VJ6B 3ZZSA 2ZXCA 3B3BA 2OMBA 2WCGA 1FY6A 2F53B 4Q9CA 3SGJC 4IDLA 3UDWA 4LJ3A 1U8IA 3RX4A 2AEQH 2WAGA 2DT1A 1JZEA 2X4NA 3A0OA 4I77H 3S88H 2Q6WB 1KELH 5KS9E 5E9XA 1ORQA 4M7SA 2J8TA 3MI2A 2ZXGA 2WMJA 3MGTA 2J75A 2VCBA 3UWWA 3C2AL 4OIIH 3FC8A 4Q2ZB 1H3PL 5JXQA 5K59E 4YR6A 3GS7A 1OWWA 4HZAA 2A7BA 3NGJA 1OGAD 1YIXA 1R3YA 3FO0L 1M9HA 5D1XD 2PO6B 3I9PA 1AZ1A 1SLUA 1PB0A 3Q2DA 3T2NH 3EEGA 4IIHA 3VVWA 2YA0A 4PJHE 3PQYB 3KDMA 5FSEC 3DX5A 3PB0A 2XWRA 2KKQA 4PR5A 3NYKA 1KRAC 1WZAA 5F9JB 2BVTA 1LMKA 1T5WB 1HUVA 1NIDA 3IJYB 4J3OC 2XIJA 3BKYH 1FE8L 1Y5WA 4G7YH 1AGDA 4CMHC 4I0PA 3BXWA 2BWGA 1NCCH 4OR1A 4TVPD 1Q6OA 4LOUC 5F7BA 5E93A 2CFFA 3DKHA 3KYMA 3V6BR 4B6ZA 1XIBA 1T83A 5IW1B 1L6WA 4HKZB 3OZYA 4HCLA 5A3IC 4PJBE 3TU6A 3U9PL 1BVNT 3DX7B 4KRPB 2NUYA 2EVGA 1REQA 2EGZA 4YXGA 2GI0A 3VI2A 5FHBL 1OF2B 4GP5B 3SDCC 1MI5D 3OQRA 4JAMB 3OG3A 4RQQA 2B2XL 4MF4A 4DXKA 1LT7A 4Q9BA 3D33A 1FFRA 4D2NA 1H60A 5J1SC 1XC4A 5AYQA 2Y3AA 3JWOC 1HSBB 1P53A 1LDPH 2JJTA 3N2BA 3UF9A 3LPOA 1NQKA 4QDMA 2BNUB 4O1EA 1W3NA 2ZYRA 1K4HA 4WQOA 3QNZA 3B6SA 2NZ9D 1DJGA 3FU7A 1LBMA 4O1DA 3ZY7A 3P80A 1JPHA 4B60A 2V5BA 2CQVA 4G9FB 2E7DA 5MP6L 3P54A 5EEYA 1M4KA 2F84A 4DGVL 5IB2A 1UWEL 5JH2A 2UWEB 5JXED 4BQ4A 3MV7D 3T3ME 2BOBB 1VBJA 3LHPH 1HQRB 5CC7A 2SFPA 5ANMB 5FW8A 1UJQA 4JMXA 4GYBA 1BF2A 3OXRA 2XETA 3UDWC 1U8LA 3QMSA 1T7ZA 5MERB 2OCJA 2WWOA 4DUWA 3GHRA 2FLRT 3UWEA 2AKRB 4FOMA 2XG5B 1ZY9A 1FCCA 4LESA 2QDGA 4C90A 1QZ1A 1Z8AA 4QT5B 1PIFA 3WQ6A 4AG4L 3MUHL 4LNCA 1TEGA 4JFQA 1RVGA 2X0UA 3EFDH 4PTDA 2WLJA 3HBQA 5SWZA 4GZEA 5HMSA 2J44A 1D7BA 3VXRA 3BAIA 4MG4A 3MO4A 3G1DA 1F2XK 3U2CA 3ZVHA 4DGUA 4B3ZA 4I5BB 1HKWA 4XWOD 1QRKA 1QSFA 3INOA 2BNQD 6PAZA 3BKMH 4PLKC 4UT7L 1KLYA 5D7SH 4QF1A 4JRXB 3BW4A 1NA8A 2X3AA 5D4JA 5L4JA 3NIFB 4A2MA 1O6IA 4MCYA 1SMDA 3CUXA 3HE7A 3Q5TA 3OKKA 1S7QB 2FQIA 2MPAL 1MH5B 4LBAA 2Q7NA 1CWVA 3RG6A 5TFSH 4I0PC 1W9BM 4WW1B 4D9RD 4BWWA 3B2DC 1XCTB 4N5ED 4IOIA 5TPWH 2H2PD 1E28B 2GSHA 3QDME 3GZPA 5C0EA 1YE4A 3BPNC 2QPSA 2D3JA 3MRBB 5K9KB 3KGSA 4NHCL 1QABA 2B4GA 3C12A 2IPGA 2W65B 3IJHA 4HQQH 5D2LE 4TUFA 4GRWF 1OSZA 4FD0A 2GAZA 1MKFA 2ZZ1A 4YOKA 3L95A 1P48A 2WNQA 1NCOA 4ZO6A 3HC2A 5KJRH 3GH5A 2R83A 2A6KB 3NCEB 2YQ3A 4KX9A 3UJTL 3VCNA 4C6BA 2JJTC 4OH2A 4A2LA 4Y16A 3EPMA 2HTLD 4ZW3A 1QHZA 4GG6A 4UWMA 4X4XB 2DJLA 4H01A 2ZP9A 2FIKB 4KZDH 1L4IA 1EJTC 2AEQL 4UINL 2POZA 4IRSD 4P2OC 2ZAGA 4I77L 3A5FA 3BURA 5CEYA 5HHNA 1CR9H 1V6YA 2Z25A 5HHMD 2AQ3A 3ARDC 2JKAA 4OCSH 4RH4A 2QR0B 3EO9H 4LLDB 2YFNA 2IC2A 1JPSL 4EIBA 4HCRA 3N14A 3FQ1A 5MENB 4NKOA 3I4EA 4HMCA 5HHOA 2ICSA 1VZWA 4R53A 4HIJA 1FJ1B 3WY1A 1CE6A 1Z9SB 3A67H 4NPJA 3T2NL 4C7FA 1R6VA 3BP4B 3QQ4A 3FO9B 1A6PA 2R1WA 4JKKA 4M61A 3P4NA 2OYKA 4NYYA 3RPBA 1HQ4A 3VNMA 4FNTA 3BC9A 1MQRA 1NICA 3ARQA 2B0SH 1U3HC 4YSCA 3WJLA 5CJBA 3KPOA 2BDNH 4G6FD 4NUJA 4QHKJ 1TVDA 1I7UB 4B41A 3GYCA 4OAWB 4XSLA 4XZ4A 3TSDA 1D5IL 1TU2B 2WLHA 2V0AA 4KKXA 1F4XL 2IPTL 5B8CB 3NSFA 2OTUB 4B27A 1BGGA 4O9HL 3IANA 2VDQB 1FL3B 4N2BA 2XPYA 1H7NA 4DUXA 4XKMA 5DEFB 2DEWX 1E6ZA 1F3DH 2VLJE 2Y06H 4UR8A 3OL2A 1V7NL 1HYSC 2KHAA 4U6HB 3CQPA 1MRDH 4LHQB 1DWIM 2IG2H 2AKZA 3KPRA 2Z1PA 1RJCA 1LDPL 2P48B 2OULB 3QSRA 1JVKA 1UA3A 1K8CA 4N1EA 5C7VA 3FTXA 5ITBL 2Z1KA 2X0WA 3OPZL 1IBGL 1Q9OA 2GJXB 4E41E 1I85A 3P1VA 1VIWA 2R15A 2QVTA 3VVGA 3ONBA 2AEPH 3HS8A 5CG0A 1NMCC 4EO5A 5D93C 2K6ZA 2A0LC 1G01A 3L12A 1EZLA 3IM1A 3VD1A 3PDOA 4JFEB 1JFXA 1W72B 3LHPL 3PULA 1AR2A 4LLQA 3H4HA 5J8OA 1G4PA 1D5BB 1KIUB 1G6RA 1S3HA 2Z91A 4F8QA 4G8GA 1EHXA 1JZFA 4Y1AD 2D0FA 3BN9D 3TBCA 5C97A 4MJ5A 1NQ6A 4KRLB 1KPVB 3E2QA 4FQQB 4TNWF 3VDAA 2E67A 4W9TA 3FQYA 1HEZB 1KXQE 4TQIA 3CL7A 3V4UL 3QR2A 1XBVA 3VOJA 2X9ZA 4B9ZA 4R2GC 4K3GA 4ODSH 1R3JB 1XAKA 3C3UA 4H0LC 5AL0A 1ZRQA 1NUNB 1AFVH 3DA0A 1WD9A 4P49A 4CVXB 1ZVNA 5DYOA 4PRRA 3STEA 5DJ8A 1P5VB 2NT1A 1Q38A 2FJFA 1N8WA 3P82A 5CLZA 1Q6GA 4DAGH 2JK5A 2DQIH 3KRZA 1M3JA 1UUMA 3MRNB 1Q2SA 5C0GA 4N26A 3GW3A 1NCBL 4HEPG 4UV7H 2NQ5A 3B2PA 2B3RA 2E59A 1CLCA 1H3UA 3RX2A 2J8UB 1JDAA 5E6YA 2Y7DA 2Y5QA 5BXSA 3OX8A 5FGSA 1IX2A 2XWCA 3ASWA 4BFNA 4GUOA 2BOEX 4RZ4A 3E0FA 1BMWA 2DT3A 1RAKA 4AF0B 5E8PA 3A9IA 1NU5A 1MWAA 2IPJA 3M1BA 4NYUA 1I3VA 3ESVF 2OMYA 2E9JA 2PPDA 3G6AA 1E2ZA 2EADA 3L17A 3CE1A 1NDTA 5TQLA 4XP1L 4N2IA 1MY5A 1E9IA 1YMMB 5TPWL 1DJHA 2ZUSA 5CUSH 1O5PA 4AL8H 4K3JL 2EH7H 1K9EA 5AYUH 3HQPA 3ZL4H 2HNEA 2WZIA 2P5WA 1AR1B 3RM8A 1GPOH 2J7GA 1NBVL 3EF7A 4H25B 4Q8TA 2UBPC 4LNYA 2NWSA 4FG6D 5C0BE 5HJGA 3GMNB 1EO8H 2DW6A 1DCEA 4P5TB 3WQCA 3NIGB 4XBEH 1U58B 4GAFB 3W72A 2OKMA 3T6QC 3QFJD 5HQEA 3WYZA 5J6GB 5EIIA 1IFHH 4GBUA 1OFDA 4M6MH 4FQXD 1X5HA 1CU4L 2L3BA 5CCJA 4RGND 3ZDWA 4ZUUA 4YSAA 3PBMA 4P23C 3M45A 4TULL 2Y1VA 4OBRA 4KTDH 4XTDA 2WMPB 2JB6B 1L9WA 1PQZA 2ATPB 5IOBA 2ZZ3A 4ZQNA 3DK2A 3PPHA 3WK0A 3SKMB 3N06B 2F5AL 5FESA 1HYRC 5C8JA 4QYAA 4OCSL 4I7WA 2REQB 5L8LB 1YO4A 2A5HA 3AROA 1VQTA 4KVNH 4GAGL 5F8RC 4LSTH 3N2JA 1HH6B 3FT4B 1BLNA 1U8OA 3PGCB 3QAZC 4FFZL 2GPTA 2PB1A 3LKOB 2ZTJA 3FCUB 3UYIA 3L54A 4KUCD 3FYYA 3W29A 3A67L 5KYYA 2R29H 3NO3A 4NJAH 5J6HA 2XA8L 4QNWA 3E02A 3OAUL 1VDGA 5K9QI 5IJDC 4Z7NF 3UWQA 2EC9U 3MRPA 4G6AD 3WFHB 4QR6A 1CFNB 2VLRB 2JQXA 3D6GA 4J4PC 2NW2B 4NSBA 5EF1A 2QCGA 1AH1A 2BDNL 2VXQL 4AI7A 5BRZA 5IB3B 3RJDA 4CSTA 4EIZC 4UTAL 3CH9A 1ICTA 5EMKA 4HHLA 3L3JB 3WIHA 4UZSA 4XAFA 1BJ8A 2FJHB 4HQVA 32C2A 1ND0B 4OLVL 3IDMB 3FCTB 3QF0A 5H37G 3V52L 3PC0A 5HVGB 1VEOA 4CMHB 4OU1A 3ULVD 1FO0L 4OZ4B 1C12A 1THCA 1YECH 1IGFL 3UJ2A 3WQGA 1UGNA 4KZ0A 2F1EA 1FFOA 1MRDL 2IG2L 5LCVH 3UESA 5DGRA 5CJQH 4X8CA 3G0XA 4B5NA 4A55A 3RCNA 1QA9B 3SDCB 3ZDXE 1OPOA 1ZIAA 5KW9H 2NDGA 5D7JA 2EKGA 4KNTA 2Q3RA 1UURA 4J3OG 1KTDB 1MG3C 4DGIL 1UD6A 4NNPL 3Q9QA 3Q48A 4UUJB 4QOKE 2E1DA 1EFZA 3GB6A 4ZXBA 3K8KA 4HHAA 4RZ6A 2VUOA 1BV8A 4N0UE 1K5NB 3IGSA 3QJHA 2CR3A 1OAQH 3GDMA 2HVJA 4F48A 2DQWA 1VZGA 5HYJE 2F7FA 5H2BA 1G0CA 5EIVA 4PJ5D 3BV7A 4BY3A 4NQDA 4TUKL 1ECQA 4FJZA 3P73A 3N0PB 3NSCA 1P1ZA 5I1AB 4O2FA 1FQ9C 1DPMA 4U1LA 4Q8UA 2HPMA 3QGKC 3MANA 4ZB2A 1EOKA 3V0VA 4P2RE 1JZGA 1W1YA 5ENWA 3NL5A 2Y1YA 1GY2A 2WC3A 2YGOA 3J2PA 4WKAA 1H5VA 2OCZA 2VZVA 5GS1C 5DD5L 4M7LL 5F4WA 4HXAH 1EK3A 4UCFA 3WH5A 1FWRA 2GCYA 4RFOL 3M0MA 3WKQA 3DV6B 1JUEA 6XIAA 1QBLH 5D1QD 5C0AB 4UV7L 1U8MB 5CXPA 3UCDA 1ORQB 1Q9WA 1JNNH 5D55A 5I5MA 3BICA 5CJXA 3T8XB 3Q67A 1ME9A 2XHNA 4OZHB 3W7QA 1YJDL 1QSVA 1F8TH 2R0WL 2A9NH 1TPVA 4Q8WA 1EHNA 5I2UA 5AYBA 5I1JL 1OX4A 4DJDC 1GYWA 3HPZA 3LN5A 5EZIH 2CO7B 3VG0L 3G6LA 4Q4SA 3HB9A 5MF5A 3SFKA 3QR0A 5DC0A 4F33B 4OIFA 3U0WH 3UIYA 1E9ZB 3L2IA 1E5AA 3MA8A 3RPDA 2B7DT 4AL8L 3W0WE 3OQ3B 3GJEB 3LYRA 3OKDA 2RMNA 1CYWA 1JWUB 1P4UA 3QJRB 1ALDA 4DP0X 5EBMB 1A8JH 3AIEA 4J3UA 1GPOL 1T2JA 3VQ2C 1E3FA 1G9NH 4RPPA 4YLWA 2E6YA 4L9XA 1UTDA 4I0PB 4V2BA 3QA3A 1EO8L 4UNIA 3OZKA 2QJNA 3ES8A 4PGBA 2V5YA 1BVZA 5JHBA 3IJ6A 1Z5LB 1JUFA 3MBXH 3KYMB 3ID7A 1TKWB 3PL6C 3ZMEA 3L5WA 2PR4H 2XXGA 4WY0A 4AYMC 3RGVA 3BPNB 3TYZA 1VF5C 1CFVL 4L3EA 2UZXA 2MHAB 4B91A 1ERNA 2DWTA 4YIWA 2WW8A 2GYSA 4KBXA 1Z44A 3FJ6A 3T8QA 2PF8A 4GY0A 5DJ0A 4E36A 1E73M 1QBML 2APFA 3BPOC 1XIGA 4IT1A 5D7JC 4I3RL 4PRNA 3EMZA 4WUUE 2Q8XA 3F64A 3R4RA 3GMLB 2BS71 1VCVA 4MY8A 2GIMA 4FZEH 2FBJH 4MPKA 1TPC1 2G97A 3OWEA 3QCTL 2NXGA 4PUDA 2X10A 3QJZA 5EN2A 2UWFA 3Q44A 2AQQA 1FUNA 2AQSA 4NOBA 3EWYA 2R0KL 2X9XA 4RV8A 3QNZB 1XG4A 4JM4L 2QAPA 3FT0A 1NPUA 4Q2ZA 1Z5HA 4IIZA 4WGWB 1F2QA 1SQ7A 2V38A 4EUPG 3B0YA 1CLOL 3BGGA 3PF3A 2WWKT 3AJ7A 4JHAH 2VFHA 2YGNA 4O2EB 1WFTA 3NGFA 3EGJA 2EIDA 3CHQA 5IB2B 4OTXL 2PO6A 4ZTPH 2DQHH 2G5RA 4HK6A 3UG8A 5DK2A 3SJVE 1NWSA 4LVEA 5DY2A 4OSUL 4H9VA 1RZQA 1G4MA 3PQYA 3UR8A 4WLCA 2H6OA 4M1DL 3TTYA 1A02N 3S97C 4AQLA 5TD4A 3IFNH 2AOSA 2ESVE 2AANA 5IW6B 1ZHNA 4F9JA 4LU0A 1T5WA 1DQLL 1Q1JL 3IJYA 3LCYA 2QDHA 3NURA 3RKDC 1UWTA 2Z1SA 4G7VL 4G6ML 2ISFA 2IMMA 5GRJL 5FOBB 1DBKL 2DQEL 4AVIA 3B0VC 1C3FA 3VXRB 1U3HB 3WMLA 3IETA 4HYWA 4XRCB 4AVJA 4P7LA 2WOQA 3X1GA 5KUKA 1MZHA 4L1WA 4QF1B 1OF2A 2WVSA 4JAMA 4J23A 5I0ZA 3IDYC 3LQAL 5CJQL 2B8OT 1E9OA 4C6IA 3RR4A 2Q7YB 3PG2A 3B4YA 3WJZA 1LO0L 3GXUB 3X12B 4C56E 3E2HC 3CU7A 4FF5A 5C7XL 4MJJA 2BNUA 4G7EA 3CGTA 1YEKH 1DOSA 3EJCA 3RN6A 1J5HA 4K39A 4MAYD 1F18A 3TLRA 2YL6A 1AP2A 4E42B 5F8QC 1MO0A 3S3CB 4EBQL 2YAHA 4X5LA 3GKWL 3S37X 5FGCB 4JKWA 1JPTH 4G9FA 3GR7A 1EC8A 4HUKB 5EO0A 1A7PH 4R4NC 4UFJA 1X6NA 3IJHB 5F2IA 4HG4J 1MJ8L 1OSZB 4MZRA 1IGSA 1EWEA 5EDXA 1NMCB 3VFWA 1XBYA 5IMMA 3L95B 2Z6JA 1L7TH 3QO1A 1HQRA 5K7JA 1PLCA 4KKBC 5C3LD 4TNFA 2YJQA 4OBSA 4TL4A 3QMTA 2FZ9A 1V0MA 5MERA 1YUHB 4POZC 2AKRA 4GG6B 1Z5YD 1UACH 3M7FB 4QT5A 2PDNA 3WF1A 3PWAA 3OPSA 1LQ2A 1KCXA 3O07A 2VO5A 4L1GA 2IAND 4L29B 3IXAA 1YNPA 5CILH 3EB4A 2X2YA 3AXHA 4R2GB 2BP5M 1NFDE 4AEHL 3MV8D 4OV4A 1YNTF 1NOAA 4I5BA 1YNLH 3RWFA 3KPMB 4AD3A 3EOTH 1G67A 2A9NL 4DP8X 3TEUA 4JRXA 1G4SA 2NY1B 2FDBP 1C93A 1DTUA 1YRKA 3SGKA 5HHOB 4JDTH 4HIJB 1T40A 4J1UB 1D7CA 2VRQA 1T5AA 3V4PL 4HU3A 3IK4A 3QQ4B 3JWNC 1MH5A 4P5RA 3C2SA 5DLMH 1POKA 1WUEA 4I9WE 3WDRA 1PZ1A 4KMTL 4OI9A 3P4NB 3BEVA 4WW1A 1HQ4B 1US0A 2W61A 4UU9B 1NLDH 3WUFA 2G4JA 3B0XA 4O1AA 1E28A 3FDKA 3OJMB 1ITQA 3T81A 3OEXA 2ZTKA 2Q7AA 5AW4B 3MRBA 1HEHC 3LRKA 2W65A 3EWWA 5F0PB 4GUQA 4MNKA 3TCTA 1QR4A 4PJAF 3MDJA 3CK0L 2R6OA 1DJIA 5I06A 5EZOH 4ZMQA 4BWTA 2A6KA 1BWMA 4JHUA 4JAWA 2EDXA 5DEGA 4U3CA 2C9XA 4DOHB 1SBSH 4X4XA 5GHWL 4CVZB 4PJXF 3U5UA 1BWWA 3KPRB 2YCLB 3ZKXB 4HK3J 4OF5A 3ZO9A 3OVPA 2HRGA 4KFMA 3CL6A 4X0KA 3JTBA 4YN3A 1EBHA 3HNSH 4YK4C 2OR8A 4O1BA 5FOJA 1SU5A 2OR7A 2WYTA 2PURA 4P23B 3EKZA 2NY6D 4V1DA 2EIKB 2F8XC 5I82A 4S1DC 2BIMA 3OU8A 5HR6A 5AZ2H 4U1SB 2VSDA 4GRLD 5MENA 1T0NB 4JHAL 1RSFA 4O0KA 4JPKH 1ZXKA 1LP9B 3D2TA 4ONFH 1RUQL 5FA3A 1AMKA 4UT9L 1KB5L 1Z9SA 5BUAA 5D2NE 4HSNA 5GS3A 5ECUA 3UTTD 1G6RB 4DKEL 2C0HA 4GYKA 1E40A 3QAZB 4FQIH 4X3ZA 2Z91B 4G8GB 4F0HA 4LX4A 4MJ5B 3C52A 2E4TA 3C2OA 4AJVA 1JCXA 3WDQA 1WUFA 3BISA 1B54A 4MFHA 1TTRA 3L4XA 4XMXA 3FGCB 1NKOA 1KBBA 1Q85A 4IQHA 1JCYA 1BXXA 4KX7A 1SZRA 5AOZA 1WDAA 1I7UA 4OAWA 2R1PA 3O3AB 2P3ZA 1FWCC 5DJ8B 1TU2A 3KZSA 3BQUA 2FJFB 4WD0A 2EDBA 5JH1A 1R5IA 2JK5B 1CGXA 5B8CA 5JIMA 3SGKC 1KT2B 2D4DA 2OTUA 4QDGA 1UIPA 4XZBA 3BKCH 4U0QB 1SN5A 1E9QB 1KYFA 4F2ME 4Z7OE 4UFHA 1RPUA 2Q3XA 3O6DA 4YDMA 1IR2A 3WTSA 3ZHLA 4XMTA 3VKAA 4RFNC 4P5UA 3OX8B 4UTAA 3E1F1 3MN8A 2F6KA 1HCZA 2CWRA 4U6HA 2JELH 3QW3A 4JN7A 4IKKA 2YUWA 1GORA 4QFUA 5E8PB 4NN7C 5F96L 4HOXA 1V7MH 3WNIA 2RB8A 1MWAB 3BZJA 1XUZA 3M1BB 1FAIH 2J1ZA 2GVEA 4K23H 4W9GC 1MNUL 1JGVL 2IWGA 5C0IA 4V28A 4OJFH 4PEEA 5BXFA 2LU3A 1XGYH 2EDEA 5FW6A 4HU2A 5KTEH 4CKVX 1A4MA 5DVPA 5I1HH 3D0LB 4ZZFA 3SY6A 3ARXA 3RUGF 4LAQH 1J8SA 4IGNA 3SDXE 3K13A 5D4HA 5HINA 4M62H 4XB8A 2J4WH 4XOCA 2W8CA 3F58L 2AABH 4FKEA 1SUHA 2NQLA 2IFFL 1NIBA 3BE1H 4XC3L 3IAPA 4MA8L 1D5BA 4MYXA 4KJPD 4XODA 4HEPA 2IWFA 4OV5A 2FX7H 3E0IA 3KBMA 2J72A 4CNPA 5ADOH 3VDBA 3SYOA 4LF3B 2HVNA 1R3JA 1CG9B 4PBVC 1F2JA 2LR4A 2PKDA 3BZGA 5IQNA 3UTSB 4CVXA 3U9IA 4QXTB 4WJEA 2XZ7A 1EA0A 1P5VA 1BYNA 2XIMA 5C8JB 3JR2A 2DWYA 1WKYA 5H91A 1YNLL 2AJSH 2PPFA 2DLFL 5TQ2L 3S4TA 5I19L 2AMXA 5C0NC 3DSFL 1U8OB 2Z64C 4W5ZA 4NB7A 2EEBA 3DETD 5GS1B 4ONGL 4W8LA 2XFRA 3QFDB 2WPBA 5ISZD 1XLLA 4XN2A 5KSAD 3QTGA 3SSZA 1QOQA 1XF4B 1PZ2A 2CIKB 2A77L 1J2BA 3ABKB 3FJLA 3T44A 1VYPX 4LCRA 4QRAA 3L5LA 3M46A 3BLKA 4CAGA 2BSCA 3MRPB 2PUZA 2VGLM 1BF6A 3NTYA 1OAYH 1NLDL 3WLBB 4ERSH 3Q65A 4CGTA 1QMLA 1WJ3A 4U3SB 1K3UA 1F00I 3BQUC 3JT2A 3BLEA 1YDNA 3KYKH 1MCLA 3APNA 4W9CC 5BRZB 4KAQH 2XRAH 4FNPA 4H25A 2CHDA 4DBWA 3AHZA 3PP3H 1ZSXA 3OZMA 3GMNA 2NSXA 4PUBL 1SJMA 1AXSA 3TFKD 1OF8A 1OC7A 1E9YB 2R9RA 4YE4H 1A4KB 2G5WA 4GXVL 2HX9A 3CFMA 3CHXA 4NM4H 2ATKA 3RDTD 4JM2D 3BSHA 3PF2A 4EPEC 1C12B 4AC7C 4OGYH 2R2BA 4NUQA 4XO7A 1JNLH 1XLIA 3AG2B 3WLWC 3V5DB 3PL6B 1ZP3A 2WO4A 1MCNA 1AO7D 5E2JA 1EJOH 3ARFC 2EIMB 4G42B 2ZUYA 3CMOH 3W83A 3DIVA 4YMPA 1W1TA 4GCXA 4O18A 1PX3A 1BFOB 2ATPA 3TE9A 1J0ZA 2R24A 3VK5A 1Z3NA 2PYEB 2ACQA 1CFSA 3OA3A 3PGDB 3SKMA 4I2XA 2VDOL 3MP5A 1D9KD 4KKCD 4OJCA 2JB5H 3BPOB 2REQA 5D7JB 3HE6D 1G9HA 4O57A 2O93L 1M7JA 4X98A 3SGJA 1HH6A 3FT4A 3ZTJG 2GY7B 4DQOH 4W93A 3PGCA 3W1RA 4YDKL 3FFCD 3LKOA 4U7SA 3GG0A 2SEBB 3VB9A 2DQDL 3FUEA 3HI1A 4AYGA 3KNBB 3EFFA 4HHAB 5I3IA 3MO1B 4WNJA 3QJHB 2EG8A 2VXTH 4KJQD 3QC3A 5H37A 1K6QL 3HG1E 1PTDA 3OJ2C 3R58A 4W6WB 3NMEA 2GDUA 2UXGA 2YB4A 1MRFH 1KCZA 1CFNA 2EG6A 2K6YA 4G2AA 4PV1C 4C55A 3O0LA 1ETB1 2D2OA 3Q8CA 4B9PA 1R8LA 1O4UA 3WHE0 3KS0J 2QSCL 5IB3A 5HPOA 1K2DB 4Z3EA 4TNWK 3RWEA 5L4MA 1CJYA 1EDGA 2Y6TE 4JHZA 4PVLA 3BCFA 3PREA 2EKJA 2XQYK 4JPWH 1X44A 1TZ9A 2FJHA 2GCYB 4YIQA 1PUDA 1F3JB 2DMKA 4OZGE 3IDMA 3DK0A 3QHNA 2FB4L 1ZS8B 1Q9WB 3PS7A 4BCXA 4LEXH 3VUSA 4OZ4A 4W68A 3U7BA 4HKPA 1TRDA 2W60B 4XI5D 4RA0C 4UFKA 1PG7H 1IF2A 1CBVL 3OKMB 3UVAA 4E2DA 4QXGL 4MLJA 2YZ8A 3TNMB 3WLSA 3T6ZA 2DU2A 4RA3A 3R7RA 3O6KL 2RCSL 1NBCA 1YJDC 3STCA 4I5UA 1LYQA 3ZOAA 3QUMH 3QFJE 1QA9A 3SDCA 2EINB 2PD9A 4PUKA 2Q9OA 3IDYB 4C6NA 2VDRH 2ZWZA 3HQOA 1XGYL 3PXLA 2XVNA 4MMYB 3L0GA 4HUVB 3OKDB 1KTDA 4RGNE 1XZWA 2R14A 3FVMA 3E2HB 4UUJA 2FTAA 2Z7UA 3WQWA 4IP4A 3QA3B 5BYWA 2B4CH 5EOCH 1ZLEA 1DQMH 4WCJA 3L5WB 3RVWC 2MOGA 3ZLGA 4WY0B 5IF0A 4KI5E 4EPBC 4Q3MA 5ADOL 5FL0A 1QOKA 1O9WA 2B7NA 3CFKA 4QR7A 3MP3A 2W5FA 1LF1A 5DJ0B 5I3KA 1AGEB 1RY7B 1NMBL 1A0EA 4PRNB 4QGCA 3SN4A 3WTTA 4B2DD 4B9FA 2ICWI 3H6AA 3QG6B 3THMH 2W9EL 3KP0A 4I3SH 1DANT 5EN2B 5CJ5A 4F66A 3OG6B 2X9WA 3DV6A 5DHXB 4TVPH 5C0AA 2AJSL 1U8MA 4J9JA 2C3HA 4H2CA 5E1IA 1UZHA 4WWKD 2FQDA 3T8XA 1VFUA 3MLUH 1PKQA 1WCQA 4OZHA 1OVDA 1Q8MA 1AQFA 1MYRA 5TBOA 4JFHD 2WJFA 3DMMA 1EZVY 4DFHA 3LTPA 2HZHA 2WHVA 4WK4B 3ILPA 2CO7A 2AI0L 2BOGX 5DK2B 4JQXA 2O7SA 4F33A 3D3VE 5L4IA 1NJJA 3VKJA 2CLVB 3FQ2A 1VPXA 4L4LA 3LZFL 2WQVA 3MTXA 3GJEA 4XPAL 2DL9A 3KYKL 1JWUA 5L7XL 4F57H 4ISVA 1ZHNB 2XRAL 5EBMA 2BMBA 2ZOUA 1FWXA 5F3FA 2Z92A 5TAOA 5I0WA 2RGLA 1T03H 5IVXE 1P43A 1XO8A 3OO2A 1Z5LA 1EKOA 1KDJA 2KPWA 4YE4L 1TKWA 4AMWA 4BFBD 3AQZA 1TQCC 3IETB 3LN3A 3IRZA 3T08A 4IJ3B 3P30L 2Y63A 4EI5C 1E4WH 2MHAA 3OR6A 2GY5A 4KZCA 1DFXA 1AHMA 2CWXA 1AJZA 4N3TA 1I9EA 4IUGA 2H45A 4EUPA 3FAXA 3STLB 1ZNNA 3VKKA 3GIQA 4RRPG 2VITB 4U6VL 4JG5A 3V0TA 3QCVL 1MSSA 1E9OB 3PUGA 5ECVA 3F4DA 1FNSH 3JWNG 4WRHA 4AV0A 3M43A 1JZ3A 2CNYA 3T42A 5GIRB 3GMLA 1ITUA 3LQAC 4PJ5E 2XFXA 4YTRA 2YD5A 3WU1A 3PTQA 4KK5C 5BU9A 1X4XA 4Y4HC 1K70A 3FCPA 5EA9A 3NZHH 3JVGC 4Y89A 4G7EB 1KEML 3S35L 1E1CB 5CHNA 5D7IE 2VENA 3Q01A 1EB3A 1RZ7L 4QRBA 3US1A 3W2JA 4P8UA 1ZJIA 3NCMA 3R89A 2UY4A 1AP2B 4US5A 4P2OA 2Z24A 3UZQA 4JTGA 2APTA 2X6VA 4GIPD 4FFVD 5AVXB 5HI4D 5DO2C 4M9OA 5EO0B 1EZWA 4O2EA 3ARDA 2ICWJ 4XC1L 1Z9NA 2VR9A 3CB8A 1R6WA 4HNUA 3A4JA 3VFWB 5IMMB 2WSQA 5EMJA 3QO1B 1BGXH 3QDJD 5D5MA 3HI5L 4V33A 4K3ZA 3BGFC 4B5WA 3QWRD 4E3VA 4U31A 3QWOB 3E38A 5IW6A 5EBUA 3NP4A 4KK9C 3WAJA 3GXMA 1LEGB 4DNMA 1VZIA 3CMGA 5I3HA 2WN2A 4XXWC 4CCDA 4RWYH 2KZBA 4KKAC 1A80A 3IXAB 3I2CH 1W6LA 1CW2A 5FOBA 3ZTEA 1DJXA 1X5XA 3GHTA 1K9TA 2W94A 4GVIA 1U3HA 4M6PA 3DMMC 1PYMA 1UQZA 4EDWL 4R5TA 4XRCA 5G2HA 3K71A 3DZ1A 4DN4H 3RWFB 3APFA 1PG7L 3WOVA 2DJMA 1GOXA 3IV8A 1YAIA 2MOVA 4JQXC 2C1GA 3SDDD 4PJGE 3APGA 1F8IA 1MF2L 2DY3A 1W8OA 2Q7YA 3IDGB 2ZZUT 4WK9A 3N43B 1Y1DA 3HHMA 1A5KC 2OLDA 4N2LA 3X12A 2E28A 3V2AR 5LIWX 1XR2A 1NUFA 1NSJA 5ID0B 4RMWA 3ZQ9A 1BFSA 1HIZA 4PMEA 2EAWA 4L23A 1KPRA 1E43A 3BEVB 5CCZA 5AYTA 2PSPA 4I89A 4E42A 1XQKA 4X5XA 1QPPA 1TR9A 1XDJA 4I9JA 1G0YR 1N6VA 3RL2B 5JLZB 1OCOB 3KLAA 1SXCA 1A0CA 4MJHA 2OODA 1S7RA 3KPTA 1T2XA 1BJ1H 3QUYD 1Q4WA 4ZS6D 4W85A 4Q7BA 1PCSA 4LCWE 4NQCA 3VTMA 3P0VL 1OZTG 2XKUA 5M7QA 4HNVA 3HFMH 3EHBD 1ZA6B 3M4HA 5DEGB 1YUHA 1O68A 2ABBA 4MJ2A 4X6BB 1EDTA 4NS0A 4E9TA 3ZYJA 3VPLA 1RVKA 2WVVB 2FT7A 2CK2A 4JTFA 1KJMA 3NQFA 4L29A 3F2CA 4X0KB 3SSGA 3CZUB 1WBXB 2CIPA 5BMWA 2WXPA 2QLYA 2NR6C 3S88L 1KELL 3R0DA 1CICA 2EDMA 3S8GB 3KCLA 3GDTA 3D85D 3DDFA 4V1DB 1OK4A 3EJZD 1NVMA 4OIIL 3PHQB 3FUJA 3KPMA 1USZA 4XMUA 1E3XA 3PRZA 3E0GA 1N6UA 2HT2C 1XGQB 4TOYH 4Z3HA 1DQJA 4FYTA 4M3KB 1LORA 3L4UA 3UJFA 2CIIB 5FA3B 4GD0A 5DHYA 4W84A 4WTZG 2TAAA 1F6LL 1EJRC 4J1UA 3QYQA 1CGYA 1U1UA 4PWFA 3R4DA 3W07A 1R0MA 1IAIH 3DXAA 5KETA 3EX2A 2WXOA 4F37K 3TQ0A 3LERA 4DZBB 1MFDH 1CE1H 3RM4A 4OKDA 4UU9A 5DK3A 3HBZA 1TE6A 3BKYL 4I88A 4DPAX 3VQMA 4G7YL 3E5PA 1QZNA 5FYKD 3C8DA 1NCCL 4J28A 1FC1A 1PD1A 4O2CA 1UKTA 2DWSA 1TVLA 1MDLA 1G9MH 3EBVA 3BQUB 4XHJC 4L4TA 1AL8A 1R5IB 3BUQA 1HWWA 1W17A 5I77A 1UXWB 5EU6E 3R79A 1C5BH 2XTJE 1TV2A 1GS6X 4A8LA 4XUYA 2QVKA 5D8ZA 4DO6A 4TVCA 3AY4C 3LB0A 1FNSL 3B37A 1M01A 2ALRA 3D12B 4CVZA 4ONHA 3MTRA 4MAUH 2VC7A 2YCLA 3TQKA 4N02A 1V10A 1U4FA 1GTFA 1FYTD 2V5TA 3ZJ7A 4JN2B 3PTKA 3WIIH 1FO0B 1S2VA 2XSAA 2NWRA 4C1KA 5I6OA 5C0IB 3QBUA 1ASQA 5BXFB 4P23A 2FMOA 3N2CA 3BVXA 2FVKA 1V6UA 4KFNA 2YUVA 4Y5VC 3KCOA 4U1SA 3DOIA 1T0NA 3QWNA 1TPDA 3DC0A 2BASA 3B7SA 3B3IB 1LP9A 1PJWA 3SGEH 2E27H 4UDTA 2JF7A 1ORSA 1MFAH 3MV8E 1HNGA 4QLRA 1OGBA 4K1GA 4OV5B 3TVAA 3KTXA 1I45A 4PRIA 3IFLH 3VX1A 1GRWA 1S1RA 1I2PA 1Z41A 2QNEA 3FGCA 3AW5A 4GAAA 3GS4A 1CICC 1S7UA 3BMVA 1NIUA 4PTWA 1BLIA 3D39A 3EFDL 1DFBH 2ZA2A 4WSGA 1N2VA 3O3AA 3BUDA 1CDBA 4J4PA 4IQEA 5KSBE 35C8H 3QZLA 1GVOA 1L8PA 4XQ6A 3IFPA 3QJOA 4NUWA 3M1OA 1R30A 1I7RB 3RZWA 1KT2A 4DN4L 3TWAA 3NIDF 1BBJA 3BKML 4BH7B 4X83A 1E9QA 1M6OB 2R59A 3BYTA 1E27B 5D7SL 4DM2A 3IE9A 4HJFA 1GVFA 1FZMA 4HJWA 3HZYB 4WDXA 2QDVA 4GACA 4NQEB 2H32B 1XF5A 3VX0A 3EYPA 1P4IH 4P04A 3SQRA 4ZAKA 4HW6A 2W4XA 2E3ZA 1JCLA 1H09A 3VI4F 5J12C 3VFVB 1UR4A 3A6BH 5TFSL 2P43B 2GBAA 4NQUA 3PFQA 3UEQA 2JKIS 2Z35A 1IBDA 1FUYA 1F6YA 1ET7A 2OZ0A 2Y25A 1FNHA 3B2UD 4R6UA 4K5NA 3D0LA 5AWNH 1EJSC 1MXSA 4NIRA 4PB0H 5JYLA 3MNMA 4JQIH 3NJMA 1K9DA 4HALA 1FSKC 4HGWB 1T96A 1OE3A 3LJ3A 3V7AG 2EEXA 1EERB 1MFNA 4FI8A 4UTBH 2PWVA 1HWGB 4OGAD 4HQQL 4QLWA 5E8EB 3K1KC 1AXSB 3LTSA 4X7EC 4DPRA 5GRUH 3WK1A 1SW3A 5KJRL 2EE3A 4OLXH 3CBJB 2ATKB 1ZZMA 1X9QA 2X6CA 3CH1B 3WAKA 3ZJ8A 5ESAA 2R2BB 4GY7A 1VGKA 1KM6A 3ARZA 4JY6B 4XXDA 4JR5A 3LIZA 4ES8A 3UJJH 4LF3A 4KZDL 4ICWA 3AAZB 1CG9A 4J8RA 1T5XA 3UFYA 5A69A 1H7OA 2CKBH 5T5NG 3UTTE 4FR6A 1KFAH 3UTSA 1W6TA 4QXTA 3OJDA 1AZNA 3D09A 1IT7A 3MV9E 4WVXA 1CR9L 1IM9B 1CFSB 1BQUA 3N44B 1MRQA 4I2XB 1JUKA 3EO9L 2GK0B 2P5PA 3Q9PA 5L9FA 1M53A 2QCEA 4M80A 1XZ0A 4X98B 4YHMH 1IEWA 2VGFA 2YDAA 5GS1A 3MAWA 3VXUD 3BLLA 2V3FA 3P14A 3QFDA 4I3GA 3MROB 1T66D 1JZIA 1Z0NA 4ONVA 1ISVA 3ULVH 4IGSA 3HI1B 2GGJA 1RI8A 3EFFB 2Q3AA 1GYNA 1XF4A 2CIKA 4XV0A 1P4LA 2RACA 3I75A 2G9HB 4ELKA 4EPDC 1PO9A 5ABTA 3V6OE 3J8F7 4F58H 3I6GA 2ZP8A 1XL9A 1XRVA 3TX9A 4BUQA 4HPYH 4E9WA 4GIAA 4GB9A 3WLBA 5FB8B 4MFDA 2B0SL 3A21A 3RHWF 4DJDA 4U3SA 1UEYA 3QEQE 1N64H 5ALCH 5FHAH 3DHUA 2WBWB 1JQVA 4L4VA 4ZMLA 4R4BA 3RWEB 3QARA 4N8VB 1LJMA 4WV1C 4YVXA 3H22A 1BWKA 3QW9A 2J5LC 4NKMA 5KBLA 4YIQB 2WXNA 4GHRA 2WVTA 5FO8A 1A4KA 4B9IA 4ZAKC 3CHFA 3WKNA 1UQSB 1YPIA 3ALWA 1T0MB 1AXTH 4M0XA 3AYTA 2IIJA 2Y06L 1K85A 3SKUD 4PJBB 2W07B 2PU1A 3KFTA 3V5DA 2BMKA 2Q3ZA 4HNTA 4WWOA 3PL6A 2Y0SA 3GBLA 1N18A 3SE4C 1TQCB 1H41A 4RNIA 3ULUF 4G42A 2F54A 4H40A 4EI5B 4LRIC 2O72A 5F9WC 3BL3A 1BFOA 2BHYA 2JKEA 4N8VG 1EGJH 3LLXA 1MCDA 2PYEA 3Q5OA 3NK3A 3PGDA 1PG7W