3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
1TA3A 1C91A 4AZHA 3D5HA 3SIMA 1CNVA 3BXWA 2VX6A 2W63A 4F66A 5BXRA 5ABHA 3DC0A 3ZSSA 1G9HA 1QNOA 3IAPA 3WNPA 3DYOA 4AD3A 2IUZA 3ARQA 4NZFA 2NT0A 5A8OA 1E0VA 3CUGA 1WDPA 3VSTA 3UR7A 4GO8A 3AIEA 2CYGA 4E2OA 2DQXA 2IXUA 2X2YA 2A3HA 4ZENA 5A6JA 3B9AA 1C8QA 4NXKA 2D20A 2WCAA 4OOZA 5I77A 1ZBVA 3VIPA 3S2CA 3AMCA 5CZKA 3WD0A 4CCDA 1FHDA 4ATLA 1B0IA 5CJ5A 2FYVA 3LPPA 1LL7A 4H8VA 5GNXA 5CPSA 5A3HA 2XTKA 4HU0A 4WJXA 4YN5A 2J25A 4UCFA 2QHAA 1PIFA 2OW7A 1UD3A 1HT6A 5ABGA 1LJYA 2G3MA 1H11A 3THCA 1KBKA 3BUQA 3WELA 1QNSA 3T0BA 4JKKA 2ZXBA 3I3EA 4M56A 1EIBA 3AZRA 1E1FA 2WZHA 4CU7A 2OYLA 1HKIA 3MANA 2XN1A 5TD4A 1QNRA 4PMYA 4WKAA 1Y7VA 4UFMA 3OLIA 3NDYA 3WNOA 5ABEA 1NWTA 3A24A 3RJXA 1JG9A 1KTCA 2O9TA 4D6CA 2BHUA 3CUFA 3D3AA 1AQHA 3WY3A 3TTSA 4W89A 3KLLA 4M82A 1J0ZA 4WSJA 5I3DA 3F5LA 1BYDA 1IT0A 4ATDA 1XSJA 2WLYA 4U5KA 3PTMA 3WBEA 1Z32X 3W38A 1CXLA 1J0KA 2F1AA 3N04A 4AZIA 1HX0A 1OSEA 1X6NA 4PCSA 4JHOA 2GVYA 4TTUA 1OIMA 4AZ5A 1WZKA 1UOKA 4RL3A 2CHNA 1QHPA 3W4RA 3QHNA 3M6DA 3GNOA 2RGLA 3EDEA 1US2A 3GXTA 3K8KA 3GNPA 3I3BA 4N42A 1JYWA 1ZBKA 1EQPA 1EDGA 4OZOA 1B90A 1PE31 3E1F1 3EDKA 3BLPX 4BA0A 1E9LA 1GQJA 4C7FA 5IXEA 2WMHA 1PAMA 3T08A 1W9DM 1JFHA 1FHLA 1TVPA 3GBEA 4GIAA 4U3AA 4LXFA 1E6PA 4DO6A 2YA0A 1YHTA 1LL4A 4BCEA 3EDDA 4PTWA 5A94A 3ZJKA 4HZ6A 3CV5A 3NCOA 1HKJA 1OT2A 4CD5A 3WDHA 2VCAA 4FNTA 4H04A 5E70A 2WMGA 2Y4SA 1OD8A 2Y2WA 4URIA 2WBGA 3AIBA 1J0YA 3VIMA 4HA4A 1WDQA 3QOMA 4W88A 1VFUA 3WH7A 2Y8KA 3AZSA 1VFFA 2E3ZA 3PN8A 2VT0A 1HJVA 1M01A 4MB3A 4W7WA 4W5UA 1LF1A 3T2PA 4IM4A 2UY2A 3S5YA 3LPGA 3FW6A 1CBGA 3J7HA 1VRXA 4AD1A 5BYWA 4CU8A 1W32A 3AMKA 1BAGA 2XWEA 4Z2GA 3II1A 3A47A 1MW2A 1EO5A 4PSRA 4HMCA 4U3CA 3WQ6A 3PZ9A 2YL8A 1CXHA 3SUTA 1BG4A 3AHXA 1BYCA 1JDCA 2WC3A 4CD7A 5BXSA 3GM8A 4PUEA 4CN6A 3TTOA 2CBVA 4XZBA 3HMCA 4A3HA 4J28A 1UA7A 3W53A 4J3UA 2DSUA 3ARVA 4HTYA 1HJUA 3VX1A 1Q4NX 3HG5A 1KXVA 3L2MA 4UR9A 3QR3A 1J9YA 4D1JA 2DDXA 2XG9A 3WMSA 3ALGA 1UQYA 6A3HA 2BY0A 5A6LA 2PBOA 4AWEA 3L4XA 3PZIA 4L4OA 2VI0A 3PBGA 3BMWA 1QI4A 4QDMA 2EABA 2WVTA 3IJ9A 1J0JA 1TCMA 1TQSA 1J18A 2V38A 1CXIA 1XSKA 3MO4A 3WDRA 1DWGM 3W28A 2ZX5A 3ZJ7A 1Q6GA 4GI8A 1XH1A 3DHUA 3T0AA 2C7FA 4PMUA 1HWWA 3AIRA 3MSDA 1MYRA 2D0HA 4ACYA 3WMCA 1FH7A 1KWKA 1GNXA 3CPUA 1BHGA 3OZOA 4KGJA 4FLSA 5CLWA 1V3LA 4PMQA 3WD1A 4AZCB 1JZ4A 2XYLA 3LXAA 2GUYA 4GQRA 5I23A 1C7SA 4XZWA 3H55A 2DSZA 3EBVA 5KZ6A 1R47A 1KR1A 4H8UA 4W87A 5FKYA 1OGBA 3A3HA 3ALFA 5JUVA 7TAAA 1K9EA 4MNMA 3HU7A 4HZ8A 1EDQA 3CMJA 1QNPA 2DSWA 1QW9A 3CLWA 3QHMA 3W27A 2VQTA 2Y8VA 5I79A 4DM2A 3K8LA 2WYSA 5I78A 3MMWA 1V08A 3VIJA 3EJTA 3AIQA 4WF7A 4DWSA 2E0PA 1GQLA 3OB8A 3SCNA 1G1YA 1NQ6A 2J7EA 1N82A 3GH5A 3VX0A 3WNKA 1TQTA 1E6ZA 4MDOA 1GVIA 3GH7A 2FHBA 1LG2A 2D0GA 3CZKA 2AAAA 4ZFMA 5LA2A 2WWDA 1EA9C 5E1QA 5DT7A 1ZBCA 2J7HA 4NZJA 1T0OA 1H09A 1QHZA 1V02E 2CITA 4LYQA 4P8XA 1EHAA 3VGDA 4AD4A 4MNLA 2WMIA 1QPKA 1XH0A 4PUDA 2YLAA 2J75A 4TVDA 2JIWA 1E72M 1MFUA 3RJYA 1TUXA 1CGYA 4GINA 3WD4A 2XFRA 1R85A 1B3WA 2ZIDA 4JFVA 2PB1A 2D3LA 5C71A 5I6SA 4XUYA 4NX0A 4MB5A 2NW0A 4CCCA 3CO4A 2IGTA 2GFTA 3VOCA 3SURA 3WFZA 1W1PA 1R7OA 2XIIA 3H53A 4DUVA 4R5EA 1E4LA 3B9DA 3AMLA 5CG0A 1PEZA 1CPUA 4LPCA 1EQCA 5IFPA 1R7AA 4H41A 5A8PA 1TQVA 3BCDA 1UD6A 5HDRA 4JZ5A 3ARUA 2XN0A 1E5NA 4PMVA 2D73A 1TR1A 8A3HA 1US3A 1KB3A 8CGTA 1JDDA 1CEOA 2EXOA 5IHRA 5E09A 3VILA 5HPOA 4AMCA 2GJXB 4J3XA 4LYPA 4KGLA 1TQWA 4FK9A 4Z2HA 3VM5A 3ZR5A 1G0CA 3UESA 1B1YA 1C8YA 4Z2LA 4MPKA 1CLXA 1BG9A 3A23A 3N17A 4MAVA 3VNYA 2GJPA 5FL0A 2CBUA 2WPGA 3QHOA 3AISA 2DIJA 3WUGA 1GOQA 3WN6A 4Z2IA 2V3FA 1V6UA 1RP9A 2YBUA 4S3KA 3VIIA 4X9YA 2WMJA 4JL2A 3CIVA 4Z2JA 1V02A 2BXZA 4C7GA 1WZMA 1KGXA 3VSUA 1ZBWA 3CHDA 3GTNA 1E4MM 4QFUA 3AIWA 5ECUA 2WCGA 3TA9A 3F5KA 2FHCA 4AY1A 5FL1A 3CHCA 1DP0A 1GHRA 4B3LA 4H7VA 4EK7A 1UD8A 1KFWA 2QF8A 2X8RA 4U31A 3WF2A 1A3HA 5BRPA 1WDRA 3W6MA 5A2BA 1GOWA 2G3NA 7A3HA 4M80A 2YL5A 3WDQA 1EXPA 3MUIA 2C0HA 5A6BA 1QWNA 3VGHA 4UNIA 4A4AA 1V0KA 2ZWZA 5LA0A 1UR0A 1ECEA 4PMNA 4C7DA 3AS0A 2PWFA 5C70A 2ZX7A 5DFAA 2HISA 1LL6A 2X2JA 5M3WA 2F7RA 1IV8A 3ZIZA 4JFUA 2QLYA 2UY5A 2F7PA 2V3EA 3OLDA 2F2HA 4TX6A 1XYZA 3L4YA 1JZ8A 4RE3A 1UKQA 4YHEA 4J3WA 1ZS2A 4J27A 2VX5A 3SUUA 4B3KA 2WLZA 1BFNA 4JCMA 3BUPA 3EJUA 3WSUA 4AZCA 1XCXA 3VPLA 5A95A 4LQ1A 4TVCA 1RH9A 1R8LA 3NSMA 5IFTA 1KTBA 4GPNA 2WC4A 2WHLA 1JXJA 4U2YA 4XV0A 4D6JA 2VOTA 4S3JA 1H4PA 2XVNA 1ITXA 1H3GA 3N12A 1W9UA 4AZGA 1BYBA 4AC1X 2OYKA 1B3XA 1XC6A 3SCRA 4H8HA 2CNCA 1I1XA 2X1IA 1TVNA 1MW0A 1TZ7A 2XGIA 2VCBA 2BFGA 1BQCA 2ZUWA 4BQ3A 3BVWA 1CXFA 2RGMA 3BVUA 2VZTA 2FH8A 3M46A 2WWCA 3OZPA 3ZOAA 4V28A 2GDVA 1HI7A 4PMRA 4DWSC 1R87A 1OINA 5HOSA 2X09A 3WNMA 1GW1A 2DSVA 1UA3A 1GUVA 5CLTA 4ML4A 3EJPA 1OBAA 1J0IA 1QI2A 1XGZA 1HIZA 5D4YA 3W6LA 2YA2A 2CBIA 2X0YA 1H2JA 4AIOA 4AW7A 2DH3A 1NWUA 2FH6A 2J79A 3IJ8A 1VEOA 1CECA 3BUIA 4OKDA 3EDJA 4AZ6A 1JI2A 3PHAA 1OB0A 4WSKA 2XPKA 4AIEA 3GNRA 1WZAA 4AYGA 4P8WA 1EOMA 3WF4A 3N11A 3N9KA 2YL6A 3CZNA 1R34A 5AYIA 1UR9A 4IUGA 3FAWA 3VIFA 3BC9A 2EPMX 5GNZA 2FGLA 2QV4A 1JFXA 3VD5A 4NXSA 2XHYA 2D3NA 5D8WA 1PS2A 3NIYA 2DEPA 4PCTA 1CZ1A 4FMVA 2E4TA 2VJXA 3MUZ1 3AOFA 3KZSA 4QCFA 3BMVA 1KQZA 2DT0A 2WBKA 5BROA 1M03A 1NWSA 1RP8A 4W85A 1TFVA 3BSHA 1TG7A 3U5UA 3RILA 1TA3B 4FLQA 3PZVA 2A3CA 3GXFA 4E8CA 5DO8A 3UG3A 1ISXA 1SMAA 4CVUA 4LGXA 4B9ZA 4HPGA 3OLEA 2TAAA 3MI6A 2BXYA 3K1DA 3AXXA 4P7QA 1G5AA 1EOKA 4D71A 1UWRA 3K4AA 4CD8A 3NUKA 5I0DA 2E40A 2WCSA 3AI0A 2W67A 1HJWA 1VAHA 3ZQ9A 2WMKA 4WKHA 3JUGA 1W3JA 3MSGA 3VU2A 2VURA 3SUWA 3MMDA 1Q6DA 3AS1A 3DDFA 3RPMA 1LQ0A 3GXIA 1ESWA 1KR0A 2J78A 2YL9A 5DMYA 1DWAM 3OG2A 4FNUA 4F8XA 5D8ZA 3LPOA 3T0DA 4EAMA 3W24A 1E4IA 4H2CA 4QCEA 2BY2A 3BSGA 3VDCA 2W92A 1U30A 2PWHA 3ZT5A 4P7RA 3SCQA 3WQVA 3TV8A 2XIBA 1WKYA 3BLBA 2E8YA 1WE5A 3PZTA 5I24A 4UOJA 3BAYA 1JZ5A 3NDZA 1LG1A 2GJRA 4CN4A 1B30A 5LYRA 3ARYA 1QX1A 2ZX6A 3S6TA 1HNYA 4CVWA 4PRWA 5IDIA 4B16A 2D0FA 2UWFA 2D1ZA 1KBBA 5A8NA 1EO7A 4M24A 1PSPA 1UASA 5A8MA 1MFVA 3W82A 4UQBA 2JFEX 3EMQA 3DX1A 1JL8A 2G3JA 1CIUA 3SCVA 3N15A 3CZLA 4MADA 4KWUA 1UHVA 4FNQA 3DX0A 2XUCA 2WKGA 1V3IA 2J4GA 1KGUA 3WY4A 3WQ5A 3GBDA 4DO5A 4TOQA 2CCRA 3EMCA 4D1IA 3ARSA 2ZX8A 3KL0A 2A3EA 3VIOA 2J7FA 2F1BA 1DWJM 1NOFA 1C7TA 4UQCA 1HL9A 1QWUA 1R86A 1PPIA 1LLOA 3D4ZA 3VGGA 2OWCA 3U7VA 1E3ZA 1VJZA 2XVKA 4AXNA 2XVLA 1E40A 3LRMA 3G6LA 1H49A 4J3SA 1W2PA 1UWTA 3EMZA 1GORA 2J7BA 4DUXA 2E9BA 1E6RA 2XFFA 1HVXA 3AXIA 2ZUTA 3D50A 2DT2A 1LWJA 4D6EA 1GOOA 1H41A 1B2YA 3W0KA 2D24A 3RM8A 1A47A 1XCWA 1L8NA 2J62A 3O2LA 3THDA 1BGAA 2DT3A 5M03A 4QLKA 2WZIA 3OGRA 1X1NA 1QBAA 1HL8A 3AROA 5C8BB 2JALA 5JIPA 3WF0A 3M7SA 2Z1SA 1E0XA 4K68A 2W66A 1AQ0A 3BUBA 2VZVA 2DSKA 3WEZA 2WHKA 2VUYA 3VMPA 3RCNA 3ZSTA 1ZB5A 4NI3A 4M81A 1P6WA 3GDBA 4CD6A 3LRKA 2VO5A 1QI3A 3ECQA 1UWIA 2QPSA 4GO9A 3FN9A 1HJXA 5DF0A 1VENA 1JIBA 1J11A 2PI6A 2VRKA 2D23A 4W7UA 3VIHA 1MW1A 2BVYA 1NM9A 2BHYA 4E4PA 1JZ7A 4DUWA 2ZXDA 4L4PA 3AJ7A 2F61A 4GI6A 4EANA 3QGVA 4UZUA 3GXPA 1UH4A 3A4AA 4JFWA 2EBNA 4RE4A 4QAWA 4IPLA 3RM4A 3WDIA 2ZICA 1QHOA 2HVMA 2OW6A 1UG6A 3BVXA 1BTCA 4DWSB 2V3GA 3OBAA 4MNJA 3HZ3A 1WZLA 1YQ2A 1U2YA 2G3IA 4MTVA 1GZJA 1MXGA 1E4NA 3PZMA 4GZEA 2WSPA 3UEQA 4MJ4A 4BQ5A 4FNPA 1CXEA 3U57A 1EDTA 1QI0A 2UY3A 2NSXA 3VSVA 2J74A 1FA2A 1PIGA 3A4WA 4PEEA 3AHVA 5D9MA 2OWXA 4V2XA 2C8NA 3CMGA 4U2ZA 1DEDA 4NSBA 3WD2A 3SCUA 3W37A 3VDBA 1KCLA 1FP9A 5FCZA 2EPOA 5AC5A 2A3BA 3WD3A 2YA1A 2EPLX 3SCWA 1DWHM 2O9OA 2VX4A 4W8BA 1O7AA 4ZEPA 1C90A 2XVPA 1GOIA 1QNQA 3OA5A 1UWUA 3VDAA 1QW8A 1UKPA 2PF0A 2Y24A 4WLCA 1KCKA 4B9YA 1PS3A 2VZSA 1FP8A 5DEZA 5D9OA 1GQIA 3WH6A 4MAZA 1E0WA 2CPUA 1VFMA 2PBGA 4KH2A 3CZGA 3N1AA 2VTFA 3K4DA 1V0LA 1MW3A 2EACA 3DDGA 2CKRA 1FH9A 3AXHA 3OGVA 1UKOA 1QOXA 2JF6A 3CUJA 1UR4A 1PJ9A 5FOOA 4HMDA 4HOWA 1CGTA 1OWQA 4XX6A 4MDPA 2G41A 1KQYA 1UKTA 3L4TA 5CPTA 2PWEA 4P7OA 2BVTA 1W91A 4YHGA 3BAWA 2B31A 2WVVB 3PZGA 3DYMA 1UD2A 5A6KA 1V3MA 3QOKA 2W5FA 3W26A 1E43A 4CGTA 3UERA 4MJ2A 3WL1A 1ISVA 1XV8A 1GJWA 3A4XA 1HVQA 1JI1A 1E55A 2E9MA 1UH3A 1WAWA 2WW5A 1V3HA 2WNWA 4HOXA 4CKQA 1DWIM 2FGZA 1EGZA 2BY3A 1D7FA 1JZ2A 3MUY1 2WVVA 3WFLA 2OYMA 3WH9A 2YFNA 5CGTA 4XB3A 4OBRA 1XD1A 1XHGA 3KLKA 3WNLA 2QMKA 4E8DA 1UQZA 1UYQA 1PX4A 5E9AA 3PZNA 1HN1A 2EPKX 1AQMA 1JD7A 4BZYA 1GOMA 3CUIA 1KXTA 1W9PA 1G01A 1E6SM 3VMOA 3BGAA 1H0IA 1GJUA 3RMEA 2A3AA 1MVYA 1Q6EA 4AMWA 3HG3A 1B3ZA 1D2KA 5A6AA 3WQ4A 3WBAA 3IANA 1WP6A 2F18A 4IISA 1WB0A 4HZ7A 4MB4A 5FIPA 1XSIA 3TONA 4ZE4A 1JF5A 1UWQA 3ZT7A 3WENA 3MS8A 3POHA 3O6AA 5M17A 1U33A 2ZXQA 4W84A 2W61A 3DYPA 2DIEA 3MUAA 3AYSA 2O9PA 2VMFA 2YDQA 1GHSA 1XD0A 1OM0A 1B9ZA 1ZL1A 2ZOXA 1H1NA 4UQEA 4TVUA 3ARXA 4U5IA 1B3YA 5BXTA 3A6OA 1I1WA 2ZXAA 1PX8A 1E70M 2MANA 1E15A 3KE0A 3CZSA 1BGGA 1WDSA 4PN2A 4QP0A 3AS2A 4KRUA 5JBDA 3LX9A 3EYPA 5CSUA 2WMFA 1G94A 1VF8A 3UETA 3EJSA 4HA3A 1GQKA 3D52A 3ZR6A 5A1AA 1L0PA 2YLLA 3FXYA 1FFRA 1H0GA 1XYFA 1H5VA 1B31A 2GJXA 1HXJA 3VD9A 5A8QA 2EQDA 2GDUA 5IHSA 4KMQA 4UFLA 4CU6A 2V3DA 1SMDA 4JAWA 3L4VA 2X0HA 4ZXOA 1PCPA 4PTVA 3AMGA 5HNNA 1OT1A 2WC7A 2BS9A 4AEEA 2ESCA 2PWDA 3D4YA 3BUDA 5JBFA 1W1TA 3MV11 1GPFA 2YFOA 3NYDA 1FH8A 1W1VA 1CLVA 1LWHA 3EDFA 3KWXA 1FOBA 3WQWA 2VZOA 2VCCA 2VC9A 3VINA 1JAEA 3U7BA 1J0HA 3TTQA 4BS0A 1B3VA 1NP2A 4GXPA 4HU8A 3WEMA 3T09A 2WK2A 1NOUA 2WZEA 3WUEA 3ARPA 2AMGA 1C8XA 1JYVA 1J12A 3DX3A 5E6ZA 3VTRA 5I5RA 1KGWA 4OJYA 1NOWA 1R46A 4AZ7A 1S46A 1BYAA 3BLKA 4CD4A 3T2OA 3FNDA 3ZM8A 4DWSD 1UD5A 2PC8A 1BPLB 2ZUNA 1ZJBA 3BCFA 4ACZA 3OLGA 1C93A 5HPCA 1O6IA 5GQBA 4JIEA 1BSIA 2WB5A 3FHQA 4HMEA 2VZUA 3VIGA 2XWDA 2VR4A 2X2HA 2EADA 1K9TA 3T2QA 1SFSA 1W1YA 3LXBA 1E3XA 1NARA 4TX8A 1CGVA 2WKLA 3CH9A 1JGIA 4D6FA 4FNSA 4FLOA 3MMUA 3BAIA 1ISWA 3WQ8A 2YBTA 1VBRA 3WEOA 1VIWA 2DH2A 2YIHA 3SCSA 2WXDM 2F8QA 1AVAA 4AEFA 2VVNA 2D22A 1EHNA 3AHZA 3HG4A 7CGTA 4UFHA 3F5JA 3BAXA 5KEZA 4AD0A 4MNKA 5BCAA 3AICA 3PZOA 1K9FA 4OOUA 3ZMRA 1MXDA 1JNEA 2JEPA 2W62A 2XFYA 1PZ3A 2DGAA 5M5DA 1HJQA 3SCTA 1IZKA 4D6GA 3SCPA 3CHFA 2FE0A 2VVSA 1CWYA 3VM7A 3ZJ6A 3ARZA 1VEMA 2CXGA 2NT1A 4JFSA 4MB1A 5EFDA 5LA1A 3HJEA 4Q7NA 1HKMA 2ZUVA 1E73M 1HP4A 2YDRA 4UFKA 3CBWA 1WO2A 3GXDA 4ATWA 2CKSA 2WHJA 2W4XA 1MQRA 4AYSA 1JDAA 3A5VA 1V3JA 3HG2A 3HN3A 3LXCA 1F4AA 4HP5A 4PMDA 4PSPA 3BAKA 5GNYA 1R33A 4TTGA 1QVBA 3KL5A 2FDMA 1HXKA 3VUPA 2G4FA 3ZJ8A 3PTQA 4A3YA 4NF7A 4TXEA 4OGZA 4PMZA 4PMXA 1OGSA 3RDKA 1WNOA 3WY1A 4W86A 4LYRA 2V5CA 1J01A 1X6LA 2VRJA 4HOZA 3LMYA 3VDHA 3BAJA 4M1RA 1ODZA 4F9JA 2XVGA 3W29A 1ODUA 5A2CA 3CZ8A 3VD3A 5JIWA 2CIPA 3NSNA 1JXKA 3WDPP 1E6QM 2OSXA 4UZSA 1UR1A 1W9BM 2J8GA 1M7XA 3L4WA 4JL1A 4J7RA 3WY2A 1JD9A 3A21A 1CGUA 4P7NA 4W93A 5EB8A 3PTKA 4PTXA 2XSAA 4D72A 1CXKA 1W9XA 3TTYA 3KEHA 3POCA 3WL0A 4AISA 3RM9A 3AMDA 4F79A 2PSPA 2PWGA 1HKKA 1HF6A 1E1EA 1PZ2A 1V6YA 3O9NA 4Z2KA 3B8SA 4ZXLA 1VB9A 3WIJA 2WMIB 2VL4A 4GQQA 2E9LA 5ABFB 2J8FA 1UR2A 5EBAA 3WUFA 1ISZA 2OWWA 4WK9A 2QMJA 2YJQA 1GOKA 1HP5A 3N13A 5F7UA 4AD2A 1VEPA 4JHZA 1BVNP 4U33A 1J10A 2CHOA 3B9EA 4D6HA 1OCQA 5JBEA 5A6BD 3NJ3A 4YPJA 1CGWA 2ZX9A 3ARRA 1I75A 2YOCA 3VGBA 3AZTA 2O9RA 1GONA 3WH8A 4JFTA 3KL3A 1JAKA 2EJ1A 2XM1A 2XGBA 3VNZA 2VX7A 4WKFA 4J3VA 2EEXA 1JZ3A 2WAGA 2QPUA 1E6XM 1NH6A 2D2OA 3CZEA 4W5ZA 4PBGA 4CCEA 3VO0A 4ZE5A 2JIEA 2FHFA 5A6MA 3SUSA 4BF7A 5EMYA 3VMNA 4CUCA 1MQPA 2O92A 1JZ6A 2EAEA 3FAXA 3AS3A 2ZE0A 1M53A 4LX4A 3A22A 3WKZA 3L4UA 1C3FA 5BXPA 1ZJAA 4FLRA 1WCGA 1V6XA 3IAQA 3W25A 1R75A 2F7OA 4M29A 1NWRA 5CGMA 1D3CA 3NSXA 1V6VA 4DO4A 3OGSA 4D6IA 4X0NA 4NRRA 2J7DA 4GZIA 2GK1B 2XN2A 4NRSA 2OSWA 4WIWA 3H54A 2VQUA 3GXNA 3EJQA 3UG4A 1UZ1A 4AMXA 1W3HA 3PZQA 3UG5A 1JNDA 3BH4A 1DWFM 1E71M 5AYBA 5A6SA 1UD4A 1V0NA 3MV01 4Y7EA 2F7QA 1SR0A 4B15A 3S5ZA 4V27A 4GZJA 4R27A 1HTYA 4PMOA 2CETA 3CZJA 3MKKA 5DT5A 3DX2A 1SYTA 1V0MA 4GI9A 5A69A 1GCYA 3AQUA 3K46A 2VNCA 1JYXA 3SCOA 5I2UA 3G6MA 2W91A 3GXMA 1W9VA 1V3KA 4GKLA 3SEPA 1W3LA 5E6YA 3CTTA 2XM2A 1K9DA 1KXHA 5BWFA 2ZWYA 5ABFA 2UY4A 2XJ7A 4UQDA 1M04A 4FNRA 2GK1A 1QBBA 4X0VA 3AHYA 3WF1A 3AIVA 4W7VA 3DECA 4UQ9A 5FD0A 2EO7A 1RPKA 3CUHA 3SUVA 1JF6A 1NP0A 5HBFA 5BRQA 1UUQA 3CHEA 5CXPA 3ARWA 1HJSA 3WF3A 1UR8A 5AY7A 2ZUUA 2CESA 3LPFA 3VVGA 5EFFA 1TE1A 4BQ2A 2J7CA 2GSJA 3CGTA 3DX4A 4N0RA 4P8UA 1F4HA 2CEQA 2J7GA 4PTMA 1SZNA 4IPNB 2XSBA 3ARTA 2Z1KA 3DHPA 3W81A 4TUFA 3VKKA 4JCLA 3VGEA 2V5DA 1Q6FA 3IJ7A 1ISYA 1CDGA 1O7DC 3EJRA 2Y5EA 3D51A 2BV9A 1RD6A 3IK2A 2IXVA 4JKMA 2VR5A 3WH5A 2WVUA 3U5YA 1TQUA 1E6NA 5D9PA 3IGUA 1GVYA 3BVTA 3ZO9A 1E9TA 4D6DA 3L2LA 3TOPA 4KRTA 2J77A 1JYNA 2DPEA 1CGXA 1W3KA 3AFBA 4OUEA 3WUBA 2YKKA 2JEQA 4NZCA 1OIFA 4EKJA 4QLLA 4ACZB 3VGFA 1Q6CA 5CQ1A 1K6AA 5D9NA 3GYCA 2WANA 1UH2A 1E5JA 2WHMA 4AZBA 4UTFA 1XH2A 3VD7A 5AC4A 1UZ4A 2YDSA 4UFJA 1AMYA 5HXMA 1VBUA 3I3DA 3MU7A 4Q22A 1CYGA 1OD0A 3WDJA 2E8ZA 4OIFA 1ZU8A 2G8ZA 3AHTA 3APGA 1MQQA 4W8LA 1BF2A 4P7LA 1ITCA 1UWSA 1XRVA 1CTNA 3WMBA 4HPHA 1WPCA 1QI5A 3FHAA 3PZUA 2AOSA 4J3TA 4W8AA 1TMQA 2DT1A 4RE2A 3N18A 3BVVA 6TAAA 1DHKA 2WSKA 1PX3A 4DM1A 1PBGA 2JE8A 2X2IA 3CC1A 1EH9A 2X05A 4JKLA 3WNNA 4AD5A 6CGTA 3UCQA 2ZUSA 1CENA 1VJSA 1C92A 2WVSA 4AIUA 3VIKA 4FF5A 2WM0A 3VD4A 4EE9A 1W2VA 4QLJA 1E56A 2ZUMA 3AIUA 4OBSA 5CPQA 4M8UA 3GH4A 1UKSA 2CBJA 3FY1A 1FFQA 3ZT6A 1BLIA 1MWOA 2BY1A 4UOQA 4UFIA 2OSYA 1DTUA 5GPRA 4BQ4A 1BVZA 1VFOA 5E0CA 2ALWA 3AYRA 3RIKA 2EPNA 3OIHA 3UR8A 4UOZA 2OLHA 3K8MA 4UQAA 1OGGA 5A2AA 3M07A 4HA1A 4PYSA 4P8VA 4CN1A 5CSYA 2CERA 9CGTA 1IZJA 1V6WA 3RO8A 1KWGA 3L4ZA 3F4VA 3GZAA 5E0FA 2BVDA 4F9DA 2BNJA 2J47A 2JF7A 2VRQA 3TP4A 3LRLA 1KXQA 2BHZA 1V03A 2Q8XA
chains in the Genus database with same CATH superfamily
1NAKH 3M1OA 1TA3A 4AZHA 1ETB1 2FJUB 3KPQB 4RIRA 5I09A 5HYSG 1DYZA 3U7WH 1VERA 1J8HE 1N55A 3F1QA 3WJMB 3CQPA 2W63A 2GVJA 4AB4A 2FL5A 4WEBL 3FL7A 5K9QG 4G6KH 1QUMA 1KJ3L 1I8KA 1PG7H 3SGJA 4C6JA 4EDWH 5E93A 1RY7B 4NJ9H 4WUKL 3UAAA 1G9HA 3IAPA 1NJ9B 2OJEA 4AD3A 3FKKA 3LG3A 3UIYA 2IUZA 2YKLL 1S7UA 5EUOF 3EHBD 1NJ9A 2NT0A 4Z7WB 1FDJA 1UOLA 2UZIH 4NKIL 4UNVA 3EWDA 4IU3B 1HQ4B 3IDNB 3HI6H 3CUGA 3PWUB 2GB2A 3PF2A 3PDOB 4RWYL 1KB5L 1RQHA 4PJHF 1MUWA 5K2ZA 3N34A 2EUVA 4Z7OB 2C4XA 3T9PA 2X2YA 3KPOB 3MJ8B 3LZ5A 5TJWK 1JGUH 3MOQA 5DD5H 2PCQA 5A6JA 4NXKA 4LIQH 4X8CA 2VDMH 1SHSA 3G6JA 2JJWA 1IEXA 2XX0A 3HPSA 2JKNA 1J6PA 1QRND 5F9WC 4YU1A 1G7HB 2QVFB 2QHRL 4AKOA 1CVRA 3WOVA 3CFCH 1W72A 2XN9B 3W0WA 1EZSA 3S2CA 3AMCA 3VVVA 4IIDA 5HR7A 1VZHA 4LCWD 3SKNA 3ITOA 1UBPC 3MFFA 2PAJA 1WIPA 2OT1A 3SDAA 4A7UA 1YN6B 3B1UA 4H8VA 4PJCB 2QF7A 1MCCA 4Z9KB 5IHLB 2VIRA 2XG5B 4OD3H 2RACA 2V5SA 4DERA 2MH4A 2UY6B 1AZ1A 4ASTA 2J9ZA 2J25A 2F6UA 2VR8A 3LZQA 2KKQA 3HFMH 3WEAA 2WXFA 3WKPA 1LLZA 2XDHA 3K2GA 5FAJA 2L7EA 3SPIA 2Z0UA 1LOLA 1E4KA 4OD1H 3O2DA 4NZTH 1R5IB 3B4UA 3W72A 1UD3A 3ML8A 3PWVB 1RPXA 1UXSA 1S5HA 2Y1YA 4BEIA 2EKSA 3RL1B 4U1GC 1H11A 3Q37A 1FHGA 1S4IA 3SODB 5IJVA 3BEWA 1EP2A 3MYOA 3D1MC 3TF4A 1EZWA 3WELA 4JFFE 1A7RL 3HOJA 1CL7I 2ISWA 4JZJC 3T0BA 1M1XA 3QYSA 2JNZA 4IMLB 4RISH 4TQ8A 2ZXBA 4TPRL 4P5TA 5FL1A 5FF0A 4OLUH 5LNGA 1E1FA 3R11A 4R34A 3VXGA 4ZYKA 3MANA 2XN1A 2P7TA 5TD4A 3PBMA 4NOBA 1M7IA 3C5XA 5BOEA 5JUEL 5D1XB 3NPZB 5E4IA 4OTXH 3LB6D 5JW3H 4QXGL 3ESNA 2AC0A 5FYLE 1BRLB 2Z92A 2C7UB 4MZIA 1HOCA 1Z5LA 2IC2A 3EB4A 3VKJA 2XZ7A 4L3CB 5AYTA 1NFKA 5HVGB 2GPTA 1L2QA 4I6KA 4FQQB 1KC7A 4BINA 4AMCA 3RJXA 4EUPB 5E9XA 4KXZI 2CU9A 1NTHA 1CBVH 3DX9A 1KFGA 4ODTL 3W11D 4JBSA 1Q2SA 1UOWA 3LSOA 3DTUB 4M9OA 4OM1H 1G7MA 3BIKA 2A6DB 1SOKA 4HK0A 3RWFB 1MF2H 4C55A 3OVGA 4M82A 3NCMA 4KEZA 3LSOB 1KPRB 3BH8A 2P42B 3OKMB 3QYCA 4HHLA 3RTLA 1VRSA 1GAFH 3G1VA 5JIKA 2CRYA 5SV4A 5HGBA 5I30H 4QDPA 5H91A 4U5KA 5BU6A 4ZQMA 5LZLA 4IDJL 1X7IA 3H2FA 4MGGA 3BH9B 1MJ8L 3UYPB 4WHCA 1RPQA 1R30A 2X70B 1J0KA 2F1AA 3CN0A 1OCNA 3D33A 2AL1A 5DJ0B 2DQJL 4AZIA 3O6FA 4E38A 1F6AB 3OKOA 2X28A 1A7OH 1RZJH 3WLBA 5C0CB 4AM0Q 3NR0A 2G95A 1WZKA 2Z64C 3CSYA 3K72B 1DLFH 3TNNA 3EADA 1UOKA 4RL3A 4PBDA 3BKCL 5AOJA 1LP9B 2OTPA 1LYXA 3BWAB 5DJ8A 2CLZB 3WFBH 4FOKA 3EF4A 5LQBH 4K8RC 2Y36H 3C60A 3CDGB 4YZFE 1LE9B 3FJ4A 3A0OA 3NO1A 1UR3M 2APXA 2NY2B 1KXVC 4WO4C 1DQWA 3GNOA 2RGLA 3C8FA 4FR6A 3I3BA 3GNPA 1KFJA 1JYWA 3SZ6A 5DFVD 3NIGB 3VRJA 4P23B 2KLRA 3C86A 1MOEA 3E1F1 1FWFC 5JVLA 3EDKA 3PPCA 3BLPX 3NQIA 3T77A 4BA0A 4FYSA 2NZIA 4ZFGL 5HHOB 1E9LA 1KM4A 4AM0B 4BHUA 4O1FA 2KPNA 3VXUD 1E65A 3RFRA 5JXAH 4M62H 2GFBB 2BSBA 4S1QH 2WQWA 1T1YB 4FI7A 5EB9A 3PHSA 5EU6E 5ICYB 3QSKB 1TVPA 4S2BA 1NFDB 2QDVA 4FG4A 2AV7B 2YA0A 4HV8A 2NCEA 3EDDA 3FT1A 5C0GA 4LL4A 5A94A 2CLOA 5CPLA 4HZ6A 3CV5A 5LNWA 1OT2A 5DMKB 1LBFA 4WEUD 4ODTH 3WDHA 1M2VA 3QNXA 1AR1B 2P5NA 4H04A 5E70A 3DOHA 4IBYA 5I3GA 4FNLH 4NT6A 2ICWJ 3SCMA 4KESA 1IM9D 3JZEA 3TSBA 1J48A 2IALA 2Y4SA 5U4NA 4YYFA 2AQ2A 4G2DA 2DUXA 1OD8A 2VXQH 2Y2WA 2WSDA 3QULB 4JPWH 1F3RB 4N2OA 5AYQA 2V7NA 1QPNA 4PJCE 4OTXL 4GUHA 4E36A 1BSLA 4JFZL 3LN4A 1J0YA 1UXWA 3NAAH 4DJFC 3GTTA 4JLRA 2OMYB 2HTKC 5DEFA 5LBSA 3QOMA 4YSSA 4RLIA 3S83A 4FXGC 4QRRA 4X7EC 4N6FA 3DKJA 5KMYA 4WXZA 1VFUA 3UMTA 5JHBA 5JO5B 5FJUA 4YX2L 1JCYA 1DKWA 1AHWB 3KS0H 3OKEA 5DGRA 1A3LH 3BOFA 3NZGA 4NIYE 3PN8A 4U28A 1HJVA 4UTLA 1XYAA 4YVXA 1HEZA 3U4BH 3NZSA 1M01A 4X2UA 4S1DD 2V0TA 4JRFA 4M48L 2A7PA 4JO1L 4IM4A 1IKOP 1A1NA 1NTDA 1MJJA 1LO5A 2B81A 3FW6A 3TZVC 1X96A 4NIKB 3ZKMD 3ULUC 5FO8A 3IBOA 4U1SB 2X4SA 1F3DJ 4NO3B 1VRXA 4NLAA 4CU8A 4AD1A 5BYWA 5JR1L 4E0RB 4F5CA 4JJ5B 5E1AA 2Z6FA 4IBWA 3EBGA 5AVVB 3FYIB 2NQ3A 3A47A 1XP3A 1DUZA 1RALA 4OU1A 1KM5A 3H1ZA 5F1OB 3AWEA 3FRPG 3X1GA 1JHLL 2BOBB 2R0WH 3IU3A 4N9GA 1EO5A 4H8QA 4YN3A 4HMCA 3Q3GB 5MP6L 3T1GA 4NN6B 3PZ9A 4JOMA 2D7QA 5M94B 5T26A 2O30A 1CXHA 1KSRA 3CE1A 2BSTA 4GSRA 2O4MA 4GKOA 1BZ7A 4MVAA 2DLFH 2TSBA 1JDCA 3G6DH 3MI2A 1QCWA 3EWXA 2BINA 2EEFA 1QBMH 3LPWA 4KDTC 5MEOB 3LVTA 3M5XA 4CD7A 4FZ8H 3GM8A 3L5WA 4M7JH 2CM6A 3TTOA 4Z7QF 2KL6A 3WLWD 3PWPD 4IOSD 3TEUA 3UAJA 3FRUA 3LMJL 1OCOB 2ODIA 3CHRA 4FXGA 1JQVA 3AQYA 5FO7A 2WZPA 2C9XA 4J28A 5GGSY 4BSVB 4E9QA 1QR1B 2WZMA 3BTNA 3W53A 3G5YA 2DSUA 5KSBB 1EJUC 1BFSA 2XTLA 2WAQA 2OZ4A 3TJHD 1HJUA 4JZOA 1OFEA 4MZ3A 4HTYA 1MJ7L 1Q4NX 2AI0H 1IM9B 3JWNH 4ZD3L 3L2MA 3FB8A 1JWUB 5J3HC 1S7SA 2WLJA 1N4XH 3CN2A 3UJFA 1TWWA 2A77H 1XBYA 1E9IA 1IXQA 5KVDE 1XBDA 3QR3A 3ATZA 4D1JA 1TEFA 2QTVA 2WQVA 3MPCA 5K9OB 2XG9A 3TT1L 3BG3A 2HTLC 1G6RA 1M3JA 2WYIA 4U6HB 3KBHE 3FF7A 2YYTA 5AW3B 3O8XB 2BY0A 1KGCD 2ZCGA 4FFYL 2A6IB 2E6JA 5DD1L 2A1YA 4H9YA 4QTIL 4Z7IA 3DVNA 3RPTA 5GGUA 3JWOH 3PZIA 2AAVA 3MLZL 5DD6A 3FU0A 3BMWA 3F2LA 3QR0A 4X7CC 3NGFA 4K4KA 2ATKA 4V11A 2B14A 2WVTA 4K2UL 1RCYA 4IJ3B 4MA1C 3IJ9A 4BFNA 1S5VA 3H0TB 3L17A 1PEWA 1TCMA 1J18A 2B1HL 1XSKA 4G72B 2J9YA 2ZKWA 3CX5K 3PAVA 1VADA 4PUBL 2ZX5A 2EG6A 2VFDA 4K73A 3ZJ7A 2TMDA 4DXVA 1YPFA 3IRPX 2NY1C 3Q2CA 5K3VA 2ARJA 1XH1A 2DI9A 4ZYKB 4JO2L 2XQYG 3AIRA 2V17H 4PJBB 1B9KA 4W81A 5E1HB 3QGAC 3S0CA 1J5SA 3L3IA 5DJXA 3OR7A 2YXMA 3IS0X 4NFDA 3WMCA 4AQEA 5ENLA 2DEWX 1GNXA 3SSGA 4MY8A 3VFMB 3TN6A 3SDAD 3CPUA 1K4CA 1M7PA 4DESA 2MIZA 4RE0A 1RV8A 4RVBA 4P5KB 3U9WA 3W88A 3RITA 2W60A 1BKSA 2CZ5A 1V3LA 1AZRA 1PZBA 4KPHH 4PRIE 4EVNA 4PMQA 2XFXA 3B6SA 3KLDA 3F2BA 3U2SA 1G7QA 1KRCC 2NX5D 3UWZA 3TDFA 3LCYA 1JZ4A 3BJ91 4HJJL 4OZFG 4X5XB 1AZBA 4R4FL 3GB6A 3LQMA 2X4PA 4AITA 2HJFB 1TJHH 3GSRA 4IS6A 2EDHA 4OJFH 5J5RA 1RJCA 1J8VA 5KZ6A 4ROQA 3KPLA 3C6SA 4W87A 3RLGA 1RIHL 2CMRL 1EDYA 1KDJA 4YMPA 5J6HA 1OGBA 1TPWA 3K1KC 3NOIA 1QLEH 4C4UA 3GC2A 1KTDA 1GOFA 2FWOB 4MBRA 2ZPKH 1U1UA 3DERA 2C34A 3ZDZF 6PCYA 1K9EA 1NELA 4MSSA 3RWGA 1V4YA 2FZBA 2WXOA 3S9DB 3HU7A 2NR6A 3MVIA 4PWKA 4YGVB 3N9SA 4KTYA 4AQ8C 2PPDA 3ONBA 3W27A 5HVFB 3OPUA 4FN0A 2VQTA 4R90L 2ZBTA 1GZHC 1SJMA 4DBUA 2K78A 2VERA 2YPVH 4TXVB 3UR5A 4ADUA 1E4KC 5D7LD 4ZMNA 1VFAB 1QAPA 3UZQB 1RZGB 4DM2A 4LCWB 3D2UB 3JV6A 2D31A 4DETA 1UWEL 4U49A 4NAMA 1XLGA 3EJTA 4M6AA 2JKTM 4L5FL 1M42A 1EQWA 3ZFHA 1G1YA 3INUH 4OZHF 1EAPA 3APDA 5I1CL 3MUGB 3WIHA 3GH5A 5F9JA 3LV3B 3QLLA 2YXFA 4M61B 5FHAH 4UTBA 1FHNA 3BKYH 2E9IA 1E6ZA 1L7IH 2PN5A 1YNKH 1BQGA 3ZDYB 3H3PL 1LG2A 2KMWA 2D0GA 4TV3A 2BNQA 1MFEL 1I4NA 2HNHA 4A38A 4ZFMA 1IVLA 2F68X 1HG3A 1RK5A 3FQNB 4KOCA 1TJRA 4GXUM 1WDWA 4HB7A 4KKZA 4O53A 1Z9LA 3GSOB 4YNGA 2YAOA 3U1QA 5L9DH 3RAJL 1G67A 3TA3C 3D4GA 3KLAB 4PCNA 3EBIA 1JNNL 3NT0A 1IQWL 1T0OA 2YK1H 2BIMA 3LQZB 4NZJA 4XNXL 2Q6WA 1HE7A 1RK1A 1V10A 1XGYL 4WOZA 2QV2A 3FT2A 2VITB 5CEXB 4AWTA 2X9ZA 3ZE0E 2XICA 3Q43A 1IKNA 3CHVA 3P0WA 3TCSA 1GVQA 1OAKL 1NF0A 1WHOA 2HQAA 3S3GA 3V5HA 2HJLA 4GCAA 5EMLA 4AQZA 3VGDA 1A4KB 1ACYL 5T5NF 3AO0A 1VBHA 2Z2UA 4K94H 3NN8A 5GVJA 3BP6A 3GMNA 4PUDA 4L1LA 1KBVA 3THQA 3ZLGA 3GB7A 1NCHA 2J75A 3W76A 1MI5D 4HZLB 3CH1B 2ETWA 1HGWA 1NLDH 4XVTL 2EUXA 2BNUA 3SGKC 5FDWB 4JY6B 1SJHB 1JXDA 2CPCA 3UTPD 1OO2A 2Q8BL 3KPLB 4PRDA 5AOLA 1CYWA 4Q97A 2XFRA 1IC4L 3I74A 1MVFA 1G9EA 1R85A 4JDYA 2WINB 3DO7A 4DVRL 1I1AB 1WXYA 3AB0C 3OYXA 4X61A 4XUYA 1DBAH 2OB3A 1TX0A 4CCCA 3EOTL 4EEEA 5TE4L 3ZTNH 3W1UA 4Z7QE 5LO7A 1DQMH 3T0EB 5C6PB 5LAPA 5J11C 3GLZA 2IS7A 1E5AA 4NKDB 1W6LA 4TLTA 3GPEA 4N4QA 1BZ8A 4EUPG 3SURA 3VOCA 4IX2A 2K6WA 3WLOA 4QHMA 4Y5YC 1V05A 1Z9SA 3PWLB 4YXLL 1D5ZB 3EXTA 4L1BA 3G1XA 2PXYB 3L3OA 4HJWA 5I1JH 1RFDL 2XIIA 2WJ7A 4KKAD 3V95A 2IBZY 4DUVA 5JW5B 1T3FA 2I9UA 4ECLA 1WIUA 2R69H 3BDXA 4HJ0D 1O68A 2HBXA 5JPNC 2WXPA 1W0MA 3N2OA 3L3IB 2UWEA 3TVMD 2ZWLT 4MQXD 5KG9A 2Q71A 2XOTA 4CW1B 1LO3H 2H0JA 4KO7A 4LPCA 1PSCA 3BL3A 1NFAA 3TAKA 1D7KA 3DIDA 4L3EA 1UD6A 5KAQF 4JFDA 4M5SA 1XRFA 3FKUS 1UUNA 4QRRD 1J93A 1Q8AA 2MNUA 5SV3A 3TH4T 4JTFA 1KB3A 1EZVY 1FORH 3MUJA 5EC2B 5AVWB 4OU3A 4N2GA 3UC2A 4JTDA 4KCTA 2XJLA 3JQOB 2J43A 1XXXA 1ADQH 1QMUA 1V7AA 5E09A 3SI9A 2XXMB 4FFVC 4KGLA 1SJVA 1TO3A 3DX7A 3X12B 4F9PA 3K6OA 1E6JH 3T8LA 2IOOA 3H85A 1JCKA 1KCVH 1AO7B 4MZRA 2G5BA 5TQ2L 3TBSB 1B1YA 1IBBA 1UCTA 4LUIA 2IQTA 3R06B 3UESA 4GPVA 4QXUL 1S2WA 4G3YL 3TPUA 4D8AA 1DQVA 1WRFA 4UTMA 3HRZC 3N17A 4AVHA 2MMXA 3HI1B 4FEMA 4FAAB 1W56A 2VFEA 5J89A 2QHRH 4Y1AA 1TEGA 1JNNH 3CHSA 3ZE1F 1U3HA 1KPVA 2DIJA 4L8CA 3Q2VA 3GD6A 1FHVA 2PABA 4XISA 5EO9B 1B57A 5EZJB 2WLHA 4JO8A 4ZUSB 4Z78A 5C0DB 1XYCA 4OZ4A 2V3FA 1G5GA 3AWFA 4PRHE 1RJQA 3PRZA 4HUUA 2J8UE 3Q9PA 3T9WA 3QQ9D 4LHUB 5AW7B 2O4EA 3EO0B 2VIRB 2WMJA 4IMGA 3B9KC 1J1PL 4MJHA 3DG6A 4Z2JA 5J7CC 2H0FA 3CUXA 2ZOLA 4BJHA 1KJMA 1FDLH 3TYFA 3UWEA 4PJAB 5L88L 1P1ZA 5IHWA 2X0UA 3NA4A 5T3XL 1DE6A 1LM1A 1ACXA 1WZMA 3C5SB 2XZAL 1FNGA 1KGXA 1BA9A 1A9VA 4MS6A 4AHOA 4C5YA 3JVGA 1OP4A 4O02A 1E4MM 1R5IA 4ZFQA 3TPKA 4ONGH 2WCGA 1S5IH 3ZE1E 3DWTA 3QY7A 4AY1A 4MXWL 4TRPL 3QCUL 1FRBA 1DFBH 2DYPA 1OEPA 2HROA 3CL6A 3HPJA 1GMIA 1DP0A 5B3JF 1GZGA 4UQ2B 1MQKH 3CBJB 1EANA 2Y70A 3LHVA 1U8PB 5AKQA 1IT8A 3UW6A 3D7PA 4FEIA 1IAOA 5HDQH 1THAA 1ED3A 4NC2B 4M5PA 1UD8A 1KBJA 1EEYA 4C4KO 5KS9E 4Q6XA 2PLMA 1CG9B 4HCLA 4ZSOA 3ZXWA 4QXGH 1HQRA 4F4RA 2GSIA 4JPGA 5D7HA 2CLFA 5CD5D 4RNJA 3SDXB 2CHRA 1QT1A 2AQNA 2GJJA 3ME0A 2F15A 1FYTE 4HQQL 4TVPH 2P24A 3GMQB 2BG5A 5FK9A 4Y2OA 1WF5A 4NO2B 4XMKL 1FCQA 4J40A 1XB8A 4XODA 3TN3A 4AK1A 1NCJA 2HUEA 2ICES 3FUEA 1T41A 1GPOL 2YL5A 3BT2H 4P3CL 4A04A 3CU7A 4UT6L 4ZAKC 3B3IA 2C0HA 4KWSA 3VB8A 5A6BA 1J9SA 5JOFB 1I31A 3VGHA 4Z3EA 4H2AA 4K3HA 1V0KA 4QJ1A 4A4AA 2FJGA 2ZWZA 5LA0A 3P6LA 1GYAA 2IG2L 2AKRB 4N86A 3SDYL 1OFQA 2CLEA 4MCZB 4OM0H 1J9RA 3NQEA 4XMPH 2V2XA 4PWHA 1OARL 3AS0A 5D1QE 5KW9H 3O16A 4GP4B 1O94A 2ACRA 4C91A 1ZLWK 4K8RD 3T07A 2IGFL 4ELME 4NM4H 3N4AA 4PJ8C 1SW3A 4JO2H 1YXCA 4J3OH 4JFUA 1XIJA 2UY5A 1F90H 4YSQA 5KTEH 5C3LD 2V3EA 3OLDA 1OE2A 4NFCA 3K3QA 2DFAA 3QFDB 2PDQA 1H0DA 5F1SA 5FA5A 5GS0H 1AQKL 4N2KA 1A3WA 5K9KA 1OV8A 3C75A 4U1HA 3W7OA 1YEFH 3UP1A 5I1EL 1UKQA 2F74A 3CHPA 3F01A 3UXKA 2JH2A 5C9XA 2VX5A 3SUUA 3F5WA 3P1VA 2YD3A 3BZ4B 1PNDA 4P05A 3TZVB 4H2HA 5IJBC 3CFJB 4JCMA 4YXHH 1HYRC 1VHPA 5J13B 2HPOA 1S9VA 1KCRH 2HT2C 1EJRC 1RCXB 2IQ0A 2Y89A 1HSAA 3DX6A 3WSQL 5CSZB 1LVEA 3QR1A 1NPJA 3UAEA 4AZCA 3QQXA 1XCXA 1W8OA 2VDLB 4TSAL 2I5IA 5A95A 1KBIA 1EO8H 5F72S 1H60A 5SX5H 3Q9QA 4U1HB 3RGTA 2JWYA 5LN8A 3DJZA 4YVVA 2FQIA 5ITBL 2PGFA 1ZANL 1A2YB 5I1KH 1XIWA 3W1ZA 1RH9A 1RIVL 5DLML 4RZ4A 2Y1VA 4WX2A 3PJWA 1HINH 1QLEB 4QO1A 3CLFL 3LOWA 5DJYB 2DZAA 4DF1A 2H3XC 5DD3L 3W7KA 4U2YA 4DBDA 1A5FH 2VN5A 2VP8A 3E7JA 3K80A 4GSQA 5KYNA 1GGOA 1JR1A 2ZSVB 5BMFH 3H9SA 6FABL 3LCGA 4K37A 1TYGA 5K1JA 3UNTA 2JKAA 2ZKHL 1H3GA 3T6QC 1S7VB 3N12A 1W9UA 4PS3A 2J24A 3R4IA 4S1SL 1VGAA 4AZGA 2XXCB 2CGRH 3NJHA 3OQEA 3F4NA 3X13B 5HYQA 5AUMA 1WFMA 1XC6A 4I0PA 5HUPA 3B9NA 2P5ED 2X4QA 4H8HA 1I1XA 2QR6A 3PULA 5T5FH 3UVAA 5TTRA 5JIHA 1TZ7A 1FYTA 4QPEA 2VCBA 3K2UL 3FFDB 1BQCA 5CPMA 3BVWA 3HGJA 4G56A 1DQDL 1CXFA 1DQKA 1ADDA 2RGMA 4BWLA 3HUJF 2F58H 1DQJB 4D2NA 3M46A 3QG6A 3B9OA 3OZPA 2I5YL 4ZSOE 4QM1A 4EZMA 3RK8A 4DWSC 3NOEA 3UZEC 3EYFA 3AGWA 3LM7A 2ZA1A 3EOLA 1S9WA 1GW1A 3NQ8A 2QXWA 3O8XD 2HCVA 4OZGA 1Q9OB 2ROYA 2CDGB 1LO4H 5HP5A 1GUVA 2WV3A 1BVLA 1MI5B 1KJVB 3EJPA 4LFHD 1OBAA 2XKSA 1QI2A 2N7BA 4E8GA 3FB8B 1P6AB 3VZYA 1FZOB 1BZ9B 1NCNA 5CU9A 1IAOB 5K39A 3TYUA 3W6LA 2CBIA 4WTXA 4CSTA 4Y9GA 4YXHL 4IRJC 2ZRXA 3G5EA 3U2ZA 1EIXA 1TREA 3CZFA 2OMBA 4Y4HA 3WLQA 3V4PH 1JPGB 2RR3A 1NBYA 4W9KC 5I2IA 4UUIA 3WJYA 5LNSA 2AJ3A 1KM3A 1PLCA 4MAYD 3WJJC 2YD4A 2FH6A 3CUPA 5HJ3B 5D70L 3FUIA 3RVTD 4OKDA 3C8KA 2XACC 2GOKA 2FT7A 2Z35B 4LVNC 1U93A 4ONFH 1GQNA 1JI2A 4OVUA 3NZ1A 2B08A 4XSLA 3S4TA 3P9WB 1BBJB 1MNZA 1OXYA 3V6OC 2JKSA 3LH9A 5B4MD 1YEWA 4AYGA 2IDQA 5FCUH 3CLMA 3U6RB 3R0MA 5I3JA 2C16A 4GJTB 5E0KA 4Q6IB 4E9RA 3N9KA 4PLNC 4I5UA 1IWPA 2XG5A 3MRMB 2VO8A 4WCYH 3ZTNL 4QIUA 1FKWA 5CNHA 2HTLD 4XPHH 2ISFA 5AYIA 3UPRA 5D5MA 4XC1L 1UR9A 3N9RA 3QPKA 5CR1A 4I7VA 4GCXA 4C83A 2GZXA 3FAWA 2M1KA 2MKLC 1D9KD 1P84K 4BCYA 1MHCA 1T6VN 1WA2X 4PJEF 3WKML 1X8CA 1VH7A 5SWSD 5GJMA 4ELDA 3BQ6A 1L5GB 2DM7A 1G7HA 4RDBA 4GT7A 1ZHLB 3QEHB 4J6RH 5CR8A 5LIYX 1FV1B 2GEEA 1LOQA 3FO0L 5AOZA 2QDEA 4APQD 3TEZA 4F0HA 5D8WA 2F58L 5LCVL 1NAMA 4FC3E 4MASA 5BS0E 5BPPA 2OXNA 4OLVH 1UB5B 3NIYA 4ODXB 4PCTA 1PB0A 4BSWB 3PR2A 4Z1PA 3DETC 5IB4A 2F19H 3PG2A 1F3JB 2X4UA 4P3WA 1CZ1A 4JFDE 2G4JA 4HHPA 5CAKA 1A5MC 5F1KC 4A37A 3WYRA 5DFWH 4NUJB 5JHAA 1KQZA 1M5WA 1KIQB 1JNJA 4LOUC 1LTDA 5BROA 3MLUH 2VDKL 1OCWH 4H25A 3EFFA 1O1ZA 4GRLA 2WNXA 3B3DA 3FX4A 4L9XA 3U83A 3MP4A 4CNPA 2M8XA 4W9EC 4TUJB 1EMTL 1A7PH 2IPKA 1PLGL 1ED3B 1PKNA 4U1NA 4YUEH 5T1JA 3SGGA 3BSHA 4OCXH 5D6CB 2PXYD 3CV1A 3TW6A 5JW4Q 3W2DL 2BM3A 4FMFA 4O5LH 1TA3B 4QF1B 5IMKB 1XIWB 3MCLH 3PGFL 2VDIA 3M17A 3MRGB 2K70A 4HA0A 4QXIA 4BR1A 4E8CA 2FSEA 3GHEH 3AQZA 2DM3A 3UO8B 4PLJC 1Z44A 3SM0A 2WOBA 4ZMPA 2VDLL 4L0YA 1XIMA 3HC0A 3MU3A 1ISXA 1T4KA 3K4WA 3KHJA 4L61A 5EMKA 4NQEE 3CJJA 4S3DA 2UWEF 1SMAA 2AJZA 5DS8A 2BZNA 3M0KA 4LGXA 2G5UA 2VXTL 3NH7L 1CFNA 1HHHA 4P9ML 5T33H 5F9WB 2X0VA 3V0JA 3NQ6A 4L48A 1EUAA 3FZUD 4LU5H 2PR9A 3CIAA 2WINA 3O6LH 4RQQA 1F4XL 3K1DA 1I45A 4WDWA 2D7MA 3SBRA 3QYMA 5IGXL 1EOKA 3FEQA 1UWRA 4JG0H 43CAA 1ZS8A 5DFVC 3VRLE 5AHNA 4IHOB 5FXCH 1U3HC 1MUJA 9RUBA 2ADJB 3I84A 4CD8A 1T21B 4NNPH 4KZDL 3MLXH 3G5VB 2AV1B 4C57C 3ZDXF 1PZ5A 4M1CC 2PW2A 1MUMA 3DFNA 1SXNA 3LH8A 4ONOA 5DHYA 2ZXGA 5EZPA 4PS7A 3HQNA 2E40A 3ABZA 2NSOA 2HXTA 1U8JA 4NWUH 2ATPA 4K6AA 2Y7MA 4X98B 1OGAA 5BJTA 3L7FB 2X7LA 1HJWA 3KOXA 1VAHA 1ZHAA 2WMKA 2FAUA 2BBFA 2A3LA 2D8KA 1HH9B 3S1UA 4CNSA 1QNIA 4LK4A 3RWJA 5B1KA 4N4YB 3MSGA 4EACA 1WCQA 5BO1L 4WXYA 5GGTA 3OXSA 2Z8SA 4LPVA 1DBBH 1Q9KA 3HNVH 1NFBA 2E7MA 5L2KB 3HLAB 3O6CA 3B2VH 1GT8A 3JVAA 3VFRA 1H09A 1KR0A 3ML9A 5IFAH 3VC5A 3PABA 4CBPA 2BK8A 2CBOA 2J78A 4Z3FA 4WGHA 2PCFA 4L4VB 4IW4C 4Z7OE 3LNHA 1DWAM 1U8CB 3IJDA 5EZOL 3PANA 4FNUA 3LZRA 2X4UB 1F3JA 4JQAA 5D8ZA 3LPOA 3KLHD 4YO0B 1EZVX 3T0DA 2HVJB 4FULA 3QCVH 5DC4B 1DLHA 2EXWD 1L6XA 4FL4C 4H2CA 1XX9C 4Y16B 2JKIS 2BY2A 4ZK8A 4LSBA 3TURA 1Y6MR 4QCEA 4ZW7A 2W92A 2ILLA 3AXLA 4HAKA 5ABDE 4LGRB 7PAZA 3CXHK 3D48R 2GY5A 1K5NB 4HUNB 4N1HB 3WE6B 4BSJA 1VFTA 2CG9X 3W9DB 2Q3OA 3WQVA 2XIBA 4KKBD 1FL3B 3BYTA 3KGSA 5EU4A 4OF6A 1SPDA 2GVEA 4IBVA 4ACTA 3AG1B 2NLJB 1XISA 1QZ1A 3JSSA 3TBVB 5I24A 1JZ5A 3TEYA 3FSAA 4JGDA 5CINH 1LG1A 3W01A 5D5MB 1OAQL 2ZOTA 2VQ1A 5E6IA 1A7OL 2ROXA 4OM0L 2QQQA 4Z7OF 4KFNA 2ZX6A 2X3CA 4V1YA 3F85A 1RK0B 4YHPB 1NCBL 3M47A 3W75A 3CFEB 5HY9A 5I8OH 1MCLA 3I6LE 2P76A 4K0OA 1ZLEA 4OZHB 4B0MB 2D0FA 1SYVB 3H2MA 4XAYA 5F3FA 4K38A 2XYCA 2H1XA 3P9LA 3CHXA 1EO7A 4UV7H 4XP4L 2DZWA 3N3EA 2I14A 2ZDRA 1OK6A 1T2QH 4Y90A 3QUKA 4L8SB 5TAOA 4JHWH 1PSPA 2JKPA 4YE4H 4Y4KD 4NPKA 4XNDA 3RLHA 4PTDA 3RUGA 1F1DA 4GG8A 4WQ6A 1UENA 1FY6A 4GG9A 2Q2LA 4ETQB 3UJ2A 1JGVH 2Z31B 3TQKA 3FQ1A 3DX1A 3G6DL 2BS71 3FTXA 3MAWA 3OWEA 4XR8C 4O2EB 5AVRB 2G3JA 4RDZA 3CH1A 5IQNA 5CEWA 1IT7A 2OT0A 2LU5A 5I19L 4MADA 1JZHA 1ZVHA 4K7VA 4RBPH 1A4AA 4A2GA 3P9LB 3DC8A 2XUCA 3D85B 4X83A 1V3IA 3D0VB 1JFQH 2KT6A 1UG9A 4PGEA 2HEJA 4GUGA 4LCVA 3WQ5A 2VLLA 1BZ9A 2CLHA 3VXRB 1UZ8B 4ZFOB 1NQKA 1A4JA 5MEPB 1XIIA 2CCRA 4X6EA 4IGBB 1LEIA 3L3HA 4L6OA 1MJ7H 1UURA 1C7TA 3SKMB 1ZV2A 9PCYA 2XUWA 5CJNA 4W9JC 4EOUA 4GQ9H 1HL9A 1QWUA 2W9DL 4G8IA 5AEAA 3QWNA 2NTFA 1EBGA 1AYRA 2EE3A 3RL2A 1I60A 4IIEA 2GTQA 2EDQA 4DYJA 4UT6A 3BGMA 5DZJA 1ZA3A 2YGQA 3SKOB 2IADB 2R24A 4F40A 3V6OE 2NUTB 4WEBH 1LLOA 2B9AA 5FO9B 3QHFL 4RDVA 4PYGA 3U7AA 3D4ZA 2EYTA 3VGGA 2FRGP 1CR9H 1E3ZA 2CQVA 2H8XA 3M5YA 4P5SA 4H8NA 1UW9A 4M6QA 4WDTA 4IU3A 4CC0A 4PV1C 1BQHA 4WWID 1T1XB 3F8UB 2VGBA 3G2GA 1CE1L 1NDWA 5FEBA 2D7TL 2RHGA 2OMYA 3GT6A 5CINL 2EJAA 4XAGA 3B9KA 5FA3A 3D9AL 1N5AB 4Y19A 1AD0A 1XGQA 5K9QI 1QHQA 5I1GH 3WLWC 1G1OA 3EMZA 2VFIA 3PBUA 3F7VA 3ZY7A 4DUXA 1HCYA 1K3UA 4N5EC 4FG0A 5C0IB 4Q8WA 4RV3A 2XFFA 1U95B 2VUNA 5K4XA 1CDCA 3OZLA 3S8HA 1MIEH 1XFPA 2WJDA 5F0JB 3LZFH 3QZLA 3RU8X 4UILH 1JRHI 4EOWL 5AHFA 3ZWSA 2TRHA 3NQKA 1CDHA 3OTTA 4WWOA 1UM4L 4P2AA 1X5KA 4RFEA 5GZNA 1TUFA 4C1NA 5I17A 1KGYE 5EF3A 1ETA1 2YUXA 5SWSE 2Y85A 4J2PA 3LN5B 5INDB 1EAQA 5FYJH 2VVNA 4M1GH 4P4KB 3LOTA 4XAPA 4PVMA 3O2LA 1MHEA 4Y4HD 3MBXH 3GDLA 1O7SA 1GGCH 4H9XA 1YJDC 4KQ3L 1R3QA 3KYKH 1UC4A 1T1ZA 4YC2B 1Q63A 4DJFA 4PRHB 1OK4A 1S9VB 1P7BA 1U92A 1IGFH 1VQTA 5DLCA 4Y4FC 4DEPB 1Q0EA 4G9FA 3BZ4A 2X4RA 4AXKA 3WF0A 4HJJH 2ZZ1A 3FOMB 3RGVD 2Z1SA 1PZUB 3IETB 3M0XA 1U83A 2ICWB 4NQDE 15C8L 3PQYD 2GUBA 4R7OA 2VZVA 4NUQA 4K9EH 5GIRA 1I3RB 3MNZA 4OH2A 4KUCD 3WEZA 4WRHA 2DQ6A 2VUYA 4LKXA 3VMPA 2JMRA 8XIAA 2P8BA 1CK0H 1YEHH 1FNSH 3AZUA 3C6LD 3V7MA 5EEWA 5LBGA 3ATYA 1BXVA 5IMOA 3K6SA 2QV5A 4TPRH 2OSLB 3MJ9L 2CO7A 3EZJB 1PIIA 2QDWA 3BZ5A 3UWYA 1MWAB 3LRKA 4UB0L 3MV9D 4JS7A 3ECQA 3P9MA 1JQXA 4FNLL 5ESAB 5EMJA 3P2TA 5FV2A 2OMUB 2QPSA 5FYJU 1GH7A 2MPAH 3E2QA 3C60D 2V2TB 5HJYA 5K7JA 4O19A 1OCBA 5C0AA 3TFCA 2A2IA 4UMBA 1NKOA 3UYPA 1IILE 1BQUA 1RH8A 4PJCF 1SFLA 4EDWL 3U36B 5E95B 5AYZA 1DXFA 1P4UA 1LLAA 4WI6A 4JPKL 1BQHB 4BI6A 1MDAA 4U1KB 1IC7H 2ZOUA 2DQIH 4F0LA 3GXPA 1L2UA 4LEXL 1RL1A 2P26A 3A4AA 1UH4A 3PSVA 3UCDA 4D8LA 4DLFA 2Z3FA 4Z0BH 4B7LA 5MERA 2Z8WC 2QELA 1KB5H 2ENQA 4RE4A 4Y2OB 3DX8A 1GPOH 4DEPC 1F45A 3G6AA 3G18A 4I48B 5E56A 3KAAA 1ZPLA 1HDMB 4FHBD 4JFFA 2YCEA 3ARDC 2Q8AH 4PRPB 4I18B 4R85A 4YC2C 5HYJB 4IUOA 4AMKH 2VEIA 4ANUA 4AY0A 2HKHL 2DQJH 4ZG1A 3QDMB 2ON3A 2V3GA 4B3VA 4YHNA 2QADC 3BICA 4XPFL 3TBTB 4IGBA 5IREA 4MTVA 1WZLA 1U2YA 4HIPA 5ANME 5FF7A 1MXGA 2NQ9A 4PY8J 3MBEC 2EYRA 4GIEA 2Z7YA 2JKLA 3FB7A 2JCCB 5HGAA 2WSPA 3UBPC 2XWTA 3SGDH 5D1QC 1ADSA 1ETZA 5CIPA 3TA6A 3HMCA 3ELAT 2K45A 2EPHA 4IWWA 4QTHB 4JRXE 3W70A 3VNMA 5FYKH 1MFDL 3OGCA 4AT6B 4EDXB 3S1XA 3GO1L 3A4WA 4N8UA 4ERGA 4NRXA 4V2XA 1US0A 5FUOL 1DEDA 4NSBA 4E6MA 3FSWA 5EOCH 3S1GA 2HRPL 3SCUA 2R0ZL 2Z93A 1FP9A 3DPDA 4M7LH 2EPOA 1RIUH 3SKUD 3DURA 5AC5A 3QUKB 4L8SA 1BV8A 1NBZB 2DKUA 4L9LC 1WFTA 2LFEA 3RWCB 4W8BA 1KIRB 3MRRB 1CDIA 2VX4A 1XPYA 2XVPA 4ZEPA 1HU8A 3B6SB 3OA5A 4R7DB 4EIBA 4CSSA 4YHPA 5ADOH 1QW8A 3WIIL 1UKPA 4UNUA 4KK5D 5IROC 3O6DA 2P52A 2OJZL 4F27A 2GTZA 1KCKA 4LCCB 5FAAA 1ZPTA 4B9YA 3QUZC 4FI4A 2N56A 1OF0A 2OEKA 1A1NB 4NZRL 1NC4D 5B8CB 3THUA 4QS6A 4X5QA 3WUWG 1D7DA 3ZGHA 4LMQI 2VLRD 3CSYB 1E0WA 4Q8MA 4DZBA 2NCMA 1LQ2A 1ZRQA 4KDVA 5GZOA 2PBGA 3BD3A 1W1A1 3N1AA 4KETA 3MBEA 3K4DA 2H3BA 1RZKL 4HNCA 3VYOA 1OL0A 2CKRA 4N24A 5D1QA 2Q09A 3OGVA 1TF4A 3C61A 2XWBA 2OOFA 4GUOA 1QOXA 2JF6A 2DD8H 2Q3RA 1RJLA 3TXAA 3VNIA 4PJXE 3L5AA 5EIQA 1OC6A 4CNUA 2H3DA 4DCQA 2ESVA 2IDCA 3QXUA 4NNYA 1FWTA 1BF6A 2P8MA 1W2KT 4K8EA 4U6YA 2Y72A 4S3AA 1UKTA 5CP3A 1R9FA 4LUSA 3QI9B 3RDTD 5IOPB 4PL2A 4F7CA 2NWRA 5D7JB 2CJTA 4XKYA 4MMXC 2YWYA 5D1ZA 4P7OA 4QOKD 3V6FB 1IQWH 1W91A 2QVMA 3FT9A 4IDLA 5FW7A 3BAWA 3Q2DA 1GZHA 3GO1H 3PZGA 3NCXA 5E9DA 3UXLA 3T8QA 4YE0A 2F5BH 4MA7L 5E9DE 2V2TA 5L4MA 5C09E 3INOA 1M7IB 1M7DA 1T99A 4G8FA 4NN5C 2EXWC 4CGTA 3CXOA 4L7ZA 2C13A 5BRZE 4MKNA 3TW9A 1N2VA 4MJ2A 3IMBA 3QC0A 2H2PD 4GEJA 2BO0A 3WQCA 1ISVA 1ROWA 2AEIT 4RPQA 3QV8A 2CBPA 4JHMA 3A4XA 2LV4A 3APNA 3PUCA 2NQLA 4PJEB 4RUBA 4UUJA 3V4PA 4OJEH 3O9WA 2ZDSA 1K8DA 4QDGA 4W6XB 5DK2A 4ADGA 4HUWB 1PKYA 2E9MA 4O8RA 4Y9MA 2QGCA 2AK4E 1V3HA 2H6UA 3WLNA 4BDVB 4ICNA 4EVNB 5LBVA 5TPWL 4CKQA 1NGXA 3PWVA 4O54A 3FU3A 4BDVA 4FAMA 1PAZA 4QRTB 4O57A 1JZ2A 2GSHA 4A7QA 1CBJA 2EE9A 4F7MB 1DQUA 1XDMA 2YFNA 5CGTA 2OMTA 1XC4A 3KLKA 1E4WL 3WNLA 1UJPA 4LCQA 1NAKL 1UYQA 4JG5A 3STFA 4GA8A 5E9AA 2QDDA 3FTYA 4FLHA 4QDMA 2WXGA 1X4XA 1AQMA 4FHKA 1PYFA 2EPKX 3ZO0A 1TVHB 1JD7A 3R12A 2NQCA 3SB0A 5EY5A 1PGRB 3IU4H 2B20A 2BVPB 3ES6B 1KXTA 4G6JL 5ANMB 3CUIA 1W9PA 3R0UA 1WUEA 2XRAL 4NUGH 2QVNA 1LORA 1HSBB 3EOUA 4ZTEA 1G01A 1ZT4B 1QFWH 2WXJA 5IVZA 1YEEH 2BOLA 4IP7A 1RUAH 1WUNT 3HHMA 1GW9A 2LVEA 2IFFL 2OL3H 4G82A 3FT3A 1IM3D 3BPNB 1CDJA 2VGGA 3CFKB 4AMWA 3HG3A 3I6KB 4PAZA 1B3ZA 4N2FA 3FO0H 5ID0A 1N59B 3HFYA 5KANI 1H9VA 2Z31D 3ARFC 3S2AA 4LASH 3X11A 4D0CA 4NNYB 4MUPA 1U4FA 5EPMB 1VCGA 3FK4A 5DRCA 4G7SB 4Z7WA 3N1PC 5LHEA 1RLBA 3C0SA 1YEKH 2E28A 4QS5A 3CQHA 1UXWB 1IEAB 3S98A 1L8PA 1JV5A 1XSIA 3GEWB 3OHXC 4LCUB 2QCLA 4KK8C 1JF5A 3L7EA 1PU0A 4LL9A 4K5PA 3VFUB 2WNGA 5FF6B 2C7UA 3IN2A 4P99A 2H8ZA 3WENA 3O6AA 4DUOA 3NZ8A 5IEHB 3BV7A 2ZXQA 4OY9A 4PGEB 3IWVA 4B4FA 3MRJB 4W84A 4NQCE 4XVSL 4J2QA 2W61A 3KYOB 3LTVA 4H9VA 3DYPA 2DIEA 5EUOA 4NT0A 4POCA 2UY7A 2O9PA 4FTVD 5LCVA 2QZRA 4KCWA 4ALAC 1SHMA 3DRTB 3IJSB 4JN2A 2R1YA 4LLQB 5AAWC 4BUGA 4DTGH 2YDQA 4KO5A 3CPLB 5CZ0A 1NUDA 5C54A 1UM6L 1ZL1A 2BMKA 3RLUA 1H1NA 4Z77A 2OMZA 2WLLB 2X9XA 1TPH1 3AYTA 1LEIB 3MUHL 1W5OA 5EMMA 2DW5A 3HC3H 3WO4C 3DX5A 4PJ8D 1RLWA 3B05A 4RRPM 1TYEB 2OQJB 5DI8A 3A6OA 5HI4D 1I1WA 3QJAA 1QLRA 1PX8A 3QORD 1KG0A 4LIQE 1NBYB 2V67A 1NBQA 2AXFA 4PJXF 2DL2A 1DBJH 2CK0L 1AY1H 1E15A 3KE0A 5FDYA 3ZL1A 3LB6C 4KRPB 2HK1A 4WFGE 4KW2A 4G6JH 3TSMA 1ZCCA 1U21A 2P49B 1W6TA 4YVPA 4KMTH 4EI0A 4JRYA 4X0KA 4S39A 3UJSA 2YMTA 2AI0L 4F20A 4QP0A 2E5CA 4NBYB 3NIDB 4QRSA 1DQLH 3LX9A 1DVYA 4P4RA 1J5OL 3D12B 3TWAA 1B54A 3O3AB 4WK2B 5B7YA 5CSUA 3RZCD 3TIEB 3BZFB 5DY2A 3CMOH 3KVPA 2G30A 2Z9TA 2W88A 5DSCA 5AQ0A 4AIXA 5A1AA 1L0PA 4OUUB 1EHLH 5CF3A 4FHJA 4UIMA 1RK0A 4GWEA 3M1ZA 1I3VA 2XA8H 4G8EA 1AJ7L 3I6GA 3TBYB 1MF2L 2BP3A 3KPPB 1EZLA 3MT1A 3BLIA 3OOQA 1WAEA 3WLRA 4NO5B 4UFLA 4K3JL 1SMDA 1RUMH 4ZQOA 3BKYL 3TJIA 4JNXA 2W65A 4JAWA 5F1NA 2X0HA 3T7VA 2VW4A 5TF1L 4R97B 1RURL 2XTJD 4ZXBA 2RQ8A 3MUUA 3NL2A 1I8KB 4EPEC 4PTVA 4K3EL 2C0AA 5HNNA 4QLLA 4NYLA 1E9OA 4I4WB 4F15C 3HRPA 2HG5A 3VWKA 2G0LA 1PBYA 2EDNA 4YAQB 2Z28A 5DHMC 3EEGA 3LIUA 5IVXF 3GG7A 2PE4A 1DLFL 3MXVH 2FTPA 3GKWH 3TWYA 2P5EE 3DETD 1CD8A 2Q8AL 3VFTA 4ZVJA 1QK0A 1FH8A 4P57B 1W1VA 1LWHA 4Z7VA 3N06B 4G43B 4YNYA 4LT7A 1IL1A 3HURA 3U8GA 3EDFA 3KWXA 5FWRA 5C0BB 2V9DA 1ENUA 4UWMA 4KK6D 4AV0A 3PS6A 5LGZA 1PFCA 4A1RA 1NMCB 1OLLA 3NIGE 5IM7A 2ZA3A 1BD2E 1SYSA 5CZXC 1Z3NA 2VCCA 3UWUA 5C07D 2FGWL 2R23B 3T0WA 1T03L 2LW3A 5DUBB 2VC9A 4QRPE 4RMTA 2X7WA 4Y9PA 1OHQA 5CGYC 5C0JB 3CDZB 4N1CA 1DE5A 4BS0A 4DBEA 1T1ZB 4N6EA 5AG9A 4R4FH 4HU8A 3MROA 1XLFA 1Q8MA 2MTAA 1RLDA 4QX4A 1KM0A 3F2DA 3BFWA 2WK2A 3ARPA 1LQBC 1K8IA 1UC5A 4BKLB 3B8IA 3IDJB 4KVNH 3VXNA 3DX3A 3N43B 3P0YL 2HB0A 5I5RA 1KGWA 4LAQL 5AZ0A 4OJYA 3GJFA 1K8DB 3GZKA 2UUDK 1FCUA 1H5BB 1WQVT 1BVNT 1MZZA 1S46A 4YH6A 3BLKA 3O07A 4K7PY 2DJ4A 3FNDA 1M56B 1DUZB 3MLTB 1UD5A 2FJSA 1U0QA 1NICA 3MRIB 1BPLB 1KELL 3LH2L 2ZUNA 1QW7A 1EGJL 1T4KB 1R2RA 2EIZB 1OY0A 5AOIA 5C97A 1ZANH 3OLGA 4HWUA 5I1KL 1O6IA 5GQBA 2DJUA 1X8FA 2Q6WB 4NZ4A 5GRJL 2WXLA 5D7IA 1BSIA 1R19A 4IIHA 4PTTA 1XI3A 4RFEB 1EEZA 5IBTL 3WKMH 4O9HH 2CLRB 2G37A 2VEPA 3RX9A 2XWDA 2ZZ6A 3VIGA 2VR4A 4N9DA 4V1XA 3SY1A 4JIIX 3MGTA 1JNHB 2VLKD 4QCIB 3PXJA 1SFSA 1QEWA 3L4CA 3FXIC 3PQYB 4M7ZC 1NAMB 4O28A 3LXBA 1E3XA 1MFAL 2GBTA 3NEOA 3BGMB 1BQHG 1CLYH 1A6VH 4XZUB 1NARA 4TX8A 5EU9A 3X1BA 4NWTL 3W7EA 2FD6H 3JWDC 2Q7YA 1NEYA 1S7RA 4FLOA 4EX4A 3BAIA 2YPLE 3QUZA 1HC1A 1MLCB 1YUHB 3ZVVA 1HHJB 2OR8A 3MA9H 1D8WA 1UACH 3DXAB 4FIQA 3UJRA 3DUSA 3W7LA 3LMZA 1Z6KA 1FVDA 3EAUA 3D9AH 4K8RH 4BFBD 4PGBA 3QDJD 4OQTL 1DE4A 1VP5A 3BAXA 4OCNC 1ZLVK 3WTYA 2VGFA 4AD0A 3LV5A 4M43L 4L4JA 5D8JL 3WFBL 2EUWA 2H5UA 4J5VA 2OTWB 3NFPA 3WS3B 2BODX 4J1UB 3PNWA 2WUCH 3PZOA 3BZFA 4MPQA 2QLVB 4YGVA 1D7BA 3SADA 2MOGA 2ZNWA 4TVPD 1SDAB 3CFUA 3FYEB 2OFQA 4XNBA 4OZIA 2C19A 3OZ9H 2JEPA 2W62A 3ITVA 1QUPA 3JXAA 4HV8B 2CLKA 2DGAA 3ZUCA 3BUYA 3QFJA 3U9UB 1HJQA 3SO3C 4UTKA 5HNRA 3PP3K 5DURD 3ZHNA 4XK2A 3HA1A 4HFUL 1XLCA 1EEYB 3CHFA 2FE0A 4QHPA 5C0EB 2DZBA 4OIBA 5HHPB 2AQTA 1OYBA 5IFHL 3LBCA 3BZDA 3CFTA 1VEMA 4Q14A 3B1TA 4YTUA 3EWCA 4HZAA 1KIRA 2KZ1B 4JFSA 4MB1A 2WLIB 3G3DA 5TDPA 5T33L 1TJ2A 4N22A 5HDWA 3VXQB 4MCNA 2P5WE 3HJEA 4QHNA 4MUZA 5LA1A 3W7CA 1HKMA 3VFPA 1PL9A 3KCJA 4GSDH 2NNCA 2Q1EA 4AUYA 1RA5A 1P7QD 1BTMA 1NCAH 4AF0A 1BREA 3GXDA 1OALA 3C8KB 2WJEA 4S2SA 4EZLA 5TPWH 1D9EA 4NQED 1KJVA 4JR5A 2Q86B 4OQVA 1XIDA 3CUPB 2BRRH 3APFA 2BIOA 3L3KA 2VR2A 5ETUB 4ZMYA 4LLQA 5TFSL 3CVCA 1GZPA 3L95B 4R2GB 2GQAA 3PUOA 4PJ6A 2A5HA 5D2YA 2B0SH 3W7GA 1H8SA 3HG1B 1OYAA 3HS0B 5IQOA 4PJFF 3BRGC 4DF9A 1B4KA 2OGJA 5HMSA 1QD0A 2NY4D 3R8GA 5IY5B 4GIOA 4F3FB 1QVBA 4N2EA 3VUPA 3L81A 4ZO9A 3KBWA 4LEEA 2VABA 4JO4H 4NF7A 4TXEA 3T71A 3QTGA 2J4WH 3W7MA 1O5DT 3HE7B 5KOVC 3X1EA 5ISZD 4FERA 2AXWA 4MA8H 1WNOA 3WY1A 3PBYA 2V5CA 1XH3B 2J8HA 1ZKAA 4HC1A 4YX2H 1J01A 1X6LA 2A9NL 4JEGB 4ZT1A 1XTMA 3SQMA 2OP4H 3AXLB 4UQIM 3LIZL 4WV1A 5T5NG 4HOZA 3HZMB 4FQJH 4MWAA 3TWBA 2FO4A 3VRIB 1GZ1A 2VDGA 3FYPA 5I6OA 4M1RA 1DVFA 1PS9A 5EKYA 3GJFK 4MA3B 5F0MB 1G9NL 2M83A 2HVBA 3RUBL 4L9LA 3SE8H 5I6PA 3LEYH 4YXKH 3IFOA 3CFCL 5FJTA 4MD5B 3W83A 1Q3NA 1BQSA 3IRSA 3CZ8A 5H2BA 2WXKA 3VD3A 5JIWA 1PZ5B 3M7FB 4HJIA 4YHKH 4D8PB 2CIPA 4WTQA 3DROB 3FN3A 3GRWA 5LGJB 1JVNA 3IPWA 3SCMC 4CDGC 1AGCB 1UR1A 3GVGA 2J5LB 4NENA 1M7XA 1S7WB 3F84A 4JFEB 4J7RA 4Q9QL 3FOMA 2Z8RA 4P7NA 3EJJX 3RWJB 4LEOA 4BSVA 3BWWA 5LAXA 4UNKA 1AD9B 1SBSH 5C7ZA 4PRNB 4ABQA 1DQTA 3P54A 4OLXL 3QPQC 4P5TC 2X7LB 5SWSA 5KVGH 4LUJA 2ICCA 4LLVA 4D72A 2ERJC 2WLNA 1OEZW 4PBWD 4X4ME 4AISA 3V16A 4F79A 4RESB 1F86A 2PSPA 1IC4H 3ANVA 3T40A 4XTRC 1U36A 3IMVA 1HF6A 1W5QA 5FSEC 4C56A 1V6YA 3O9NA 1SJEA 1IE4A 2DJSA 4L8BB 4IMDA 2B4CC 4N2NA 3HVNA 4OCRL 1I3GH 4OT7A 4I85A 4HJSA 4K5LA 1XGRB 1CYXA 2C3XA 3MLWH 3ZKNC 2E9LA 4G11A 2EP6A 2WO5A 4EKXA 5ABFB 3IGAB 3N2MA 5EBAA 1YTKA 4HPYL 2V9UA 3TYEA 1NPUA 3VZXA 4LRNH 5C0ND 3QNYA 3O6YX 2RTTA 3MRNA 3RGVC 1WC7B 1ZK5A 2EO9A 3D2UD 3OF6A 4HC1H 4F1ZA 4PCPA 1W0WB 1TIUA 5IB3A 1GVRA 1SW0A 3QDME 1BVKA 1ZHNB 3KWTA 2IF7A 4KHXL 4N2MA 3T65A 4EBQH 2WIIA 1FA4A 1S7TB 4U33A 4D6HA 3VGAC 4HH9A 4KTEH 4QXWA 4BE5A 1A0EA 4Q8PA 1OCQA 5FHAL 2O56A 5JBEA 5A6BD 4IGHA 1KFAL 4WKZB 1R3TA 2QR0B 1HESA 3FO9A 4R5XA 1CGWA 5BRBA 3IVUA 3H42H 1WA3A 1NIDA 2OODA 4DYEA 3L8QA 2W0FB 1H6TA 2C3WA 2YOCA 3CC5A 2CKNA 3AZTA 5EU6B 2HFEA 1K85A 2I5QA 2WNNA 4JFTA 5HNUA 4GAGL 1OF2B 3C60C 2DQHH 1M1BA 4L4VE 3LEXB 5C9JB 2CSPA 2RHEA 4WKFA 4NJAH 2E6FA 2D7PA 3MA8A 5FYKE 2FYYA 4W6WB 2OV0A 5C6WH 2EEXA 2GCYB 5IHHA 5DHVB 4H20H 3ZE0B 2WAGA 1RVFH 2NX1A 4XAWH 4FXJA 4ABWA 4H6RA 3UPMA 5DJ2A 1GTFA 1E6XM 2EIJB 2NY7H 4PUJA 4R88A 3VAEA 4U10A 2H2SD 4V2BA 3MRCA 3NQAA 4CCEA 3RZWA 4FQIL 3VO0A 2DVTA 4HNVA 3ISIX 3LUTA 4P2VA 3GMRB 4ZE5A 3W22A 2JIEA 4JX5A 3IDIA 5A6MA 1ITBB 3RZCB 4D9RE 4BF7A 2YDAA 3IKCA 4CUCA 5ETUA 5G5DB 5KWYC 1XR8A 1QNZH 4P4RB 5E24E 1MQPA 1K4GA 3QRFM 4L23A 3B97A 2E6DA 1EC9A 3BEVA 4ORIA 3D3FA 4DFHA 3LU2A 4X6EB 1KJMB 4K94C 5C0QA 3WKZA 3LDBC 4P5UA 4X80L 5IBUG 1OM9A 4BWWA 1ZJAA 1L9OA 4Q9QH 3KGUA 4QRRE 3VFGL 1UWFA 2MFNA 1KEGH 1V6XA 1WCGA 4AL8H 3HG0A 3W25A 3WQGA 2MWCA 1Q13A 1ME9A 4IOFD 4IJRA 5AC6A 3MREA 5CGMA 3UGUA 1KG0B 4QEHA 4JFXB