3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Maltase-glucoamylase, intestinal
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
2CITA 3MKKA 2ZWZA 2G3NA 1B1YA 3SCWA 1OD0A 2E40A 3VINA 4NF7A 4V28A 4NI3A 2EPKX 2XVNA 2XN2A 2XUCA 4GI8A 3D50A 3WD4A 1EDQA 2GK1B 5CZKA 2OLHA 3QHMA 2QV4A 4U3CA 5CLTA 2VR4A 3CZJA 4OOZA 1H4PA 1TUXA 2OWWA 4AZ7A 3BUQA 1AQMA 2WKGA 4HPGA 3OLDA 2Z1SA 3OA5A 2YIHA 3MS8A 1KB3A 3WL0A 3PZVA 4MB3A 3BSGA 4W7VA 1M03A 3VMOA 1E5JA 3W82A 1A3HA 3QGVA 4C7FA 4BS0A 2FH6A 3ARRA 3SUWA 1JXKA 4XV0A 4JFSA 4CD8A 3WY4A 3A21A 2VCBA 3VIGA 1QBAA 3TV8A 3VUPA 3CZLA 1W3HA 3HMCA 2VR5A 3BSHA 3GNPA 3OGVA 1UA7A 2X2YA 3L4TA 1UWSA 4NRSA 3TONA 3VNZA 4AMWA 3WQ5A 2HISA 4H8UA 2PWHA 4UZUA 4AD3A 5JIWA 2WVVB 3PZMA 1JGIA 4QP0A 4MDOA 4OOUA 4MNJA 4NSBA 3PTKA 3MANA 3ARUA 1B90A 4AIEA 3W38A 2Y8KA 4PMDA 3FHAA 5E09A 2X8RA 3NSNA 4EANA 1DWAM 3WD1A 1PS3A 3GXPA 8A3HA 1M53A 3N9KA 3RM4A 2VOTA 5BYWA 3UERA 1V6XA 3WBEA 1O7DC 5IHRA 3AMCA 4BCEA 3VDAA 3AXIA 4P7RA 4BZYA 1QI2A 1CBGA 2CKSA 1C90A 4DWSD 3ZT7A 5JIPA 2EPMX 1QWNA 1UYQA 3K1DA 1US2A 3LPGA 2DSUA 1W32A 4Z2GA 3BAYA 4ZXOA 4ATDA 3AIWA 1UD3A 3WNLA 2CNCA 5ECUA 1UD8A 2BXYA 4D6IA 1AMYA 3N04A 4H41A 4PMYA 4U33A 2WWDA 4UFHA 2D23A 3IJ9A 2OSWA 4FNTA 5CPQA 3WMBA 4UFKA 1JF5A 1JIBA 2J7FA 3NDZA 5CPTA 3CBWA 3VD5A 4MJ4A 1SZNA 2VT0A 1HXJA 3WDHA 5A8MA 3VIJA 3AMDA 1FP9A 1G0CA 1G01A 2UY5A 1CGVA 1E71M 2DGAA 1XSKA 2EADA 4S3KA 3T0BA 1FFRA 2DSZA 2YL6A 3BVTA 3DX1A 1QI5A 3BVWA 1XSIA 2WVSA 3AS1A 1QHOA 4JCMA 3WNMA 3UR8A 1HF6A 4F8XA 3RPMA 1KGWA 3GXMA 3AICA 1W9BM 3MSGA 2XN1A 2XVPA 5AC4A 1WNOA 1OIFA 2F1AA 2QPSA 3N15A 3VX1A 2YBTA 3SURA 3GBDA 1QW8A 1GVIA 1C91A 4W5ZA 5CGTA 3L4UA 1ZJBA 1J18A 2C7FA 5JBFA 3AJ7A 3OG2A 1CLVA 1GOOA 2G4FA 3PN8A 5A1AA 2ZE0A 3EMCA 4PCSA 4NXSA 1V0NA 4MB4A 3WUGA 1PAMA 2A3CA 5M03A 1R8LA 3GXNA 2A3AA 3U7VA 4NZFA 5E6ZA 4B9YA 3SUTA 3ZJ6A 1AVAA 4JFUA 4E2OA 3MUZ1 1I75A 2BS9A 3PTMA 3FAWA 3KL5A 2DQXA 2PB1A 1WE5A 6A3HA 2XWDA 3ZO9A 1LLOA 1XD0A 5EFFA 1LL7A 5IDIA 2PWFA 3WY2A 1X6NA 1QWUA 3VIIA 2PSPA 2DH2A 2BY1A 3DYMA 5D4YA 1KQYA 1R7OA 4AYSA 4GQQA 1B2YA 5GNXA 1TVNA 1B9ZA 1W1TA 3AYRA 3ARZA 2EPLX 3AZSA 1LG2A 2EJ1A 1V6WA 3WIJA 4QCEA 1TQVA 5M3WA 2VCAA 3KLKA 4CU8A 3LRLA 1UOKA 3VO0A 3UEQA 4JL1A 3VGEA 5BXSA 4DWSA 1O6IA 4UFLA 5JBEA 1MVYA 1J12A 1R34A 4AMCA 1LL6A 1HKIA 3BCFA 3UG3A 1UR0A 4IPLA 4KGLA 3WL1A 2JEQA 1S46A 2QMKA 3KEHA 3WY1A 2XFFA 2E3ZA 2EPOA 1CYGA 4ATWA 1E6XM 3HU7A 2IGTA 4GIAA 3W27A 5C8BB 3BUIA 1JF6A 1J0ZA 4LX4A 4PBGA 3WEZA 4QDMA 1PIGA 5A8PA 1WZKA 1HI7A 3MMWA 2XGBA 5GNZA 3ZMRA 4WSKA 3BLPX 4M29A 1PPIA 1EQCA 1HJWA 1CLXA 1YQ2A 4PMOA 2JIWA 4P8WA 3VOCA 3WFLA 1HXKA 1KXQA 4AD0A 4OBSA 2Y2WA 1EDGA 1VRXA 4NZCA 3SIMA 4EKJA 1UQYA 2WZHA 1NQ6A 4V2XA 1H3GA 4OBRA 2DSKA 3WKZA 1E72M 2E9BA 3VSTA 3A3HA 4B3LA 4D1JA 4PMZA 1HJSA 4CD7A 3M6DA 4Z2KA 3BAIA 4KMQA 3G6MA 2RGLA 1GNXA 4OGZA 3WEOA 2J8FA 1H0GA 5LA0A 1GJWA 2X2IA 2WC4A 4WKAA 1PSPA 3BCDA 1WZMA 3BUDA 5ABFA 3POCA 3FHQA 2YL9A 3W4RA 3H55A 4GI6A 1GUVA 1B3VA 1TR1A 4M56A 2W91A 1E9LA 1HJVA 3D4ZA 1GHRA 3U5UA 2XJ7A 2FGLA 2UWFA 3AOFA 1V03A 4AYGA 4FF5A 1GZJA 4UNIA 3PBGA 3B8SA 3CIVA 3DC0A 4W8LA 2WC3A 1BFNA 1CGUA 3IANA 5IFPA 3GBEA 1U33A 1W1VA 4WKFA 1K9EA 1R85A 3W29A 1GQLA 3WNOA 3O9NA 2ZWYA 1QNRA 1JL8A 4WLCA 1E55A 2CCRA 2WW5A 2XFYA 1VAHA 9CGTA 4PMQA 3EJTA 2W62A 2WHMA 4JKKA 4D1IA 4J3VA 3EJPA 5FD0A 5BXTA 3PZUA 3FNDA 5A6AA 1OCQA 1TZ7A 1BG4A 2WZEA 2NW0A 2GDVA 2J62A 2XFRA 2VX5A 2GDUA 3VD4A 4HZ7A 3LPFA 4W7WA 1JYXA 4OUEA 1NP2A 3THDA 4UZSA 4D71A 3VM7A 1UWRA 1Q4NX 4PMXA 3K8LA 2WMFA 2XG9A 1KXTA 2O9TA 2XPKA 2ZUSA 3IJ8A 4URIA 4TOQA 2CBIA 1NOFA 1B30A 3ZJ7A 4CCEA 1ZBVA 4NRRA 3ARSA 4AC1X 4RE2A 4BQ3A 3VIPA 2X09A 4XZBA 2CHOA 1GQJA 4EK7A 3WQVA 2J78A 1OIMA 3N11A 3F5LA 2EABA 2FHCA 1RD6A 4ZENA 1WDPA 3ZM8A 1LQ0A 4XUYA 1E5NA 4AZHA 1W9DM 1MW2A 4CD5A 3EJRA 4LGXA 1SMDA 5I79A 4UCFA 5HNNA 3CO4A 1GVYA 4YHEA 2YDQA 3VGGA 4H7VA 3EYPA 4EAMA 3L4YA 4CVWA 3UETA 2WMJA 4UFIA 1K9TA 1MQPA 2CPUA 5M5DA 1V02E 3T0AA 1W3KA 1QX1A 3OIHA 4ACZA 4TTGA 1UG6A 3VMNA 4QLJA 4XB3A 3VM5A 2YDRA 2PC8A 3AS0A 4MNLA 1GCYA 4PTVA 2YJQA 1E4IA 2C0HA 2DEPA 4DUXA 1EGZA 1RP8A 4BF7A 2XTKA 5DMYA 1G1YA 4XX6A 4CU7A 2XIIA 3RM8A 3TTSA 3RJYA 2D22A 2F1BA 3EDFA 4UOZA 4PCTA 5A8NA 4QLLA 5HPCA 1IZJA 4PTMA 1IZKA 2FGZA 3VIMA 1HIZA 4U3AA 1E73M 2VVNA 3CH9A 2ZOXA 3QOKA 2VC9A 3A6OA 2NT0A 1VF8A 1ZL1A 2BY0A 4N42A 2J47A 2J7BA 5CG0A 2E9LA 4A3HA 4HMEA 5DO8A 5M17A 1KGXA 3RJXA 4J3UA 2X0YA 3SCSA 5DFAA 1K9DA 2ZXDA 3CHFA 1GQKA 1R87A 5A6BA 4D6DA 3N12A 1MWOA 3WUBA 4JHOA 5DT5A 3N1AA 4GKLA 1V3IA 3B9AA 4B9ZA 3HG5A 4KWUA 3AS3A 2VZTA 2VNCA 2VMFA 1TMQA 1KGUA 1VJSA 2VL4A 2X0HA 3M07A 3ZQ9A 3ARTA 4W87A 1HJQA 4PTXA 1VEPA 2V3GA 3ALGA 4FNSA 3QOMA 4ZEPA 3CPUA 4DUWA 3GH4A 2AAAA 2CHNA 1WDSA 3D52A 3AMGA 2W67A 3AQUA 1EIBA 3AHVA 1VBUA 3D51A 3PTQA 4KGJA 2J74A 8CGTA 3BAXA 2JF7A 2IXVA 4L4PA 2YA0A 3WSUA 5A8OA 3L4ZA 1E9TA 1LF1A 2J7DA 2WCAA 4AZ5A 3PZIA 4CVUA 3L2MA 3VPLA 2XHYA 1EO5A 1UASA 3UR7A 2OWCA 3ALFA 3VDCA 3WD3A 2GUYA 3GZAA 1ZB5A 2GJPA 1QBBA 2J7CA 4QLKA 2CKRA 1TA3B 4N0RA 1E6ZA 1JI2A 1GOKA 4M8UA 1JYVA 4F66A 3J7HA 3VNYA 4B15A 1XGZA 1D2KA 1UD4A 2ZUVA 3AIBA 4QCFA 4TVUA 4BQ5A 1ISXA 1N82A 2W63A 3SUUA 3BH4A 1VFFA 4H8HA 1HWWA 1B3YA 3APGA 3VIHA 1GONA 3GTNA 4PMUA 2PBOA 3DX3A 3PHAA 1W3LA 1FH8A 4YHGA 5IXEA 1NP0A 3DDFA 3VMPA 3WMSA 5KZ6A 1JD9A 1JFHA 1BGGA 1E56A 3SCRA 4A4AA 3MUY1 1J0JA 5E9AA 1RPKA 2YLAA 3CHDA 1C93A 2WXDM 1GPFA 3EDDA 3I3DA 3SCVA 3HZ3A 3WH6A 1KTBA 3WD2A 2D20A 3L4WA 3GYCA 4PUEA 1W9PA 2DT1A 2Y24A 3WH8A 4FK9A 1RH9A 1C3FA 4W85A 2WVTA 3H54A 4PEEA 1UR1A 1EOMA 2D0GA 1MFUA 3ARVA 4JL2A 4UFMA 3LMYA 3VX0A 1Q6FA 5I3DA 3E1F1 2J25A 1H11A 4DM1A 2F2HA 5E0FA 1XHGA 4UQEA 1V3HA 2PF0A 4HMDA 1CXIA 1ZJAA 5I0DA 1PX4A 5A6SA 3BLKA 2OYKA 4ZFMA 4WIWA 2FHFA 1W1YA 2NT1A 2VZSA 1HT6A 3S2CA 1E40A 4CUCA 1JDCA 4W84A 4E4PA 3K8KA 5A69A 3AHXA 5E70A 2YFNA 3WF0A 2O9PA 1BVNP 3T2PA 1VEOA 2WB5A 1JI1A 1WAWA 3ZJ8A 1V08A 3UG5A 3VGDA 1OBAA 4DWSB 4CCCA 3OZOA 3IAQA 1L0PA 3CLWA 3BVUA 3CZNA 2E0PA 1H0IA 5A6MA 5FL0A 1SR0A 4ACZB 3FAXA 1GJUA 2QHAA 5I6SA 1W1PA 3T0DA 2JF6A 4KRTA 1V3KA 1CXLA 1OSEA 1H2JA 3EJUA 2D73A 1ESWA 3CMJA 5A6LA 1MW0A 4OJYA 2D3NA 2DT3A 2F7PA 2JALA 4MTVA 1TCMA 2FH8A 1TG7A 2C8NA 3T2QA 4JKMA 4M1RA 2GJRA 2O92A 1WCGA 1QI3A 1JNDA 4JZ5A 1R47A 4GO8A 2V3EA 1XYFA 1CZ1A 1EQPA 1UWUA 2WLYA 3MV11 4QFUA 2YFOA 3U7BA 3MO4A 5LYRA 1W2VA 3NSMA 4WKHA 3VIKA 4HZ6A 4DM2A 2EPNA 5AYBA 4IPNB 3FY1A 2CETA 3BGAA 2VURA 1NOWA 1H49A 3CGTA 1XV8A 1LL4A 1TQWA 1UH4A 3L4XA 1UR9A 1UKOA 1B3ZA 4HOZA 2FYVA 4JIEA 4B16A 1OINA 3PZNA 3O6AA 2YA1A 5CJ5A 2VI0A 5HXMA 3OB8A 1KQZA 3WDPP 1MFVA 4FLQA 1BAGA 2WCGA 3A22A 2DIJA 2Q8XA 1UR2A 1E6SM 2WM0A 2X2HA 2BV9A 3AZTA 1E1FA 5D9OA 3CZKA 5I24A 5A2CA 3GH5A 2VRKA 3PZTA 5EBAA 1HKKA 4GI9A 3K4DA 4Z2LA 1G5AA 2WMKA 2YBUA 1FOBA 5BXPA 3WQ8A 3F5JA 1KR1A 3WD0A 1VIWA 1SYTA 1J11A 3QHOA 1BYBA 3MMUA 2D0FA 7TAAA 3WDJA 4CN4A 2JIEA 1FH9A 1Q6EA 1DTUA 1GQIA 3VSVA 2QMJA 1NWUA 1PS2A 1JD7A 4GZJA 4ACYA 3UCQA 3K8MA 1KTCA 2J7HA 1HL9A 2ZXAA 5D8WA 2YLLA 1XCWA 1VFOA 2MANA 1UWIA 4FLOA 3SCQA 1JZ2A 1PZ3A 3F4VA 4JHZA 4M81A 3LXBA 4TX8A 3WNPA 3GM8A 4MB5A 3TTYA 1VJZA 1QVBA 3FN9A 2DT2A 4AZ6A 2VRQA 1HJXA 4UQBA 3DYPA 2D24A 3KE0A 3S5ZA 3SEPA 2AOSA 5A3HA 2JFEX 1CDGA 2FE0A 3CZGA 2F8QA 1WDQA 2E9MA 3O2LA 3WQWA 1UH2A 5FIPA 3T09A 5HDRA 5C70A 5A6BD 1D7FA 4U5KA 4P7QA 3POHA 2WKLA 1OD8A 3HG3A 1NM9A 1JNEA 3DDGA 1V02A 1KR0A 1R75A 5DT7A 4FNUA 1TE1A 3GDBA 2X1IA 1CTNA 5EB8A 2W66A 5A95A 1UKQA 4KRUA 1VBRA 4L4OA 3CTTA 4RL3A 3WNKA 7CGTA 7A3HA 3UESA 1E6PA 5DF0A 1V6YA 3VIFA 2TAAA 1HKMA 1WPCA 3BC9A 3FW6A 1BPLB 4AMXA 2F61A 3OLGA 4MDPA 3EJQA 2WANA 2PBGA 3AHTA 5BWFA 4CCDA 3BMWA 1HTYA 4HA4A 1PCPA 3W6MA 1D3CA 3AIRA 1BG9A 2WPGA 1XH1A 3GXTA 3A4AA 2CBUA 1V0KA 3VGFA 1GORA 1KBBA 1JFXA 4TX6A 4TXEA 4EE9A 1E6RA 3CUFA 1KCKA 1SMAA 2BNJA 1BQCA 3JUGA 2Z1KA 3CHEA 1U30A 1E0XA 1E6QM 3RMEA 1JZ4A 5LA2A 3WDQA 4HU8A 1JYNA 2FHBA 3AYSA 1JDAA 1R46A 4D6CA 1QW9A 4H8VA 2EXOA 1Z32X 2XWEA 3N17A 3NSXA 2VJXA 4HPHA 4TVCA 1FA2A 1W2PA 3T08A 5CXPA 1XCXA 1YHTA 4LYRA 1HVXA 2CIPA 4PTWA 1W3JA 2BVDA 1FH7A 1JAKA 3WN6A 3L2LA 2DT0A 2WAGA 1KWKA 2X2JA 4P7LA 5TD4A 3WF4A 3OGRA 4HOXA 3BAKA 2VX7A 4X0NA 2VQTA 1ITCA 2G8ZA 1U2YA 3EDEA 1V0LA 3RO8A 2Y8VA 1ZS2A 4AD1A 3A4XA 1EH9A 1G9HA 3CUGA 4Y7EA 1LG1A 1K6AA 1TQSA 2XM1A 4AIUA 1EDTA 2BVYA 3KZSA 3VD9A 1J01A 3W81A 4Z2HA 3CV5A 3AIVA 3HG4A 4U2YA 5FOOA 2WBKA 3CUIA 3A24A 3EJSA 2GJXB 1UD2A 3GXFA 3HJEA 3AIUA 6CGTA 3LXAA 1SFSA 2WCSA 3EDJA 3CC1A 4DO5A 1CXKA 4P7OA 4X9YA 4U31A 3CUJA 1HP5A 3BVXA 1EXPA 1UA3A 2EBNA 1CIUA 3A47A 1GOIA 5ABFB 2J75A 3ZT6A 3LX9A 2ZX6A 2WBGA 2PWEA 1PJ9A 1PEZA 1C8XA 3KL0A 4GO9A 3AXXA 3MI6A 3ARQA 6TAAA 4IISA 2D2OA 2QF8A 1OGGA 3ARYA 3VGBA 4F9DA 1HX0A 3T2OA 1K9FA 1J0YA 1JZ7A 2UY3A 1CWYA 3CZ8A 3BUBA 1UH3A 4RE4A 1CGWA 2OYLA 1QI0A 1OB0A 2BXZA 3F5KA 4CN6A 4PMRA 3ZR6A 1UKPA 4LPCA 2HVMA 3ZSTA 2XYLA 4AD4A 3OBAA 3M7SA 1BHGA 4GPNA 2B31A 1DWHM 4C7DA 4CKQA 4DO4A 2VQUA 4AZCB 4AISA 4YN5A 2PI6A 4R5EA 3BLBA 1UWQA 4M82A 2IXUA 4PMNA 5D9NA 2ZX8A 1BVZA 3MUIA 2CEQA 3KLLA 1CNVA 1I1WA 4CD6A 4E8DA 4W93A 4MNMA 1R33A 4LYPA 1V6UA 2G3JA 5FL1A 5IFTA 3S6TA 3RIKA 3RILA 2WK2A 3W25A 3IGUA 2OW6A 1TVPA 2J77A 2GFTA 3WH5A 1WB0A 5GQBA 2J7EA 3WMCA 1H1NA 4J28A 1VEMA 3EDKA 3IAPA 3BXWA 1MYRA 5A6JA 3VIOA 3GNRA 3IJ7A 4TVDA 3CMGA 2WNWA 1UZ1A 1ZBWA 4Z2JA 4H04A 4AZIA 1XD1A 5EFDA 1HL8A 2BY3A 2CESA 2CBVA 3NDYA 3I3EA 1J0IA 1E1EA 2V5CA 3WENA 3MSDA 4J7RA 3WELA 1DWJM 3EMZA 2W92A 3IK2A 1ZBKA 1W9VA 4MPKA 4UR9A 2ZX5A 3DHPA 2ZX9A 1KBKA 4HOWA 2O9RA 1V3LA 4UOQA 5BRPA 5ABGA 1E15A 2E8YA 4DO6A 2ZUWA 2ZICA 1MXGA 1C8YA 1E70M 4J3SA 4D6EA 2W5FA 2YA2A 3AMLA 2A3HA 2Y4SA 5D9MA 3AIQA 5BXRA 4AD5A 1DWGM 3WFZA 1H09A 4GZEA 3ARWA 4A3YA 1QHPA 1M7XA 3WUFA 4FLRA 4HA3A 2XN0A 3LPOA 4U2ZA 3CUHA 3AI0A 4HMCA 2JEPA 4IM4A 2A3EA 3ZOAA 1KFWA 4PUDA 1L8NA 3AS2A 1JZ8A 4LYQA 5AY7A 4F9JA 2QPUA 4WF7A 2J7GA 2VUYA 3ARXA 4AY1A 1W9UA 1ODUA 3KL3A 4JFVA 4W5UA 3CHCA 1A47A 5CPSA 1XSJA 2AMGA 1LJYA 2XVLA 1ISYA 4XZWA 1I1XA 3LXCA 4V27A 3BMVA 2OW7A 3ARPA 1HVQA 2EAEA 3DX4A 4UTFA 3WBAA 4BQ4A 3SUSA 3KWXA 3OZPA 1FFQA 3G6LA 1DHKA 4M80A 3ZSSA 3WY3A 1OGSA 4PRWA 1C92A 3A23A 1JDDA 3EBVA 1PIFA 3GXIA 4D6HA 2WHLA 3VDHA 2OSYA 1C8QA 4PSRA 1PX3A 1ECEA 1E43A 5CSUA 1CPUA 5E0CA 5D8ZA 3W28A 3N13A 3W24A 4AZBA 2DH3A 2F7RA 4UQDA 1NWTA 1R7AA 3WUEA 1KCLA 1BYDA 4GQRA 4LXFA 2VRJA 5I5RA 3BVVA 5D9PA 5AYIA 5ABEA 3L4VA 2W61A 3CZEA 3OGSA 3LRKA 1OGBA 1OT1A 1DEDA 1R86A 2BVTA 1BGAA 2YDSA 3RDKA 1EHAA 5GNYA 4R27A 3DX0A 1C7TA 4AZGA 4UQAA 3TA9A 1E4MM 4AW7A 2VZOA 1V6VA 2WVVA 3NJ3A 3ZJKA 3U57A 1PX8A 1CGXA 1UKSA 2VZUA 3VD3A 2OWXA 2YOCA 4FNQA 4W89A 5A8QA 1XRVA 4HU0A 1B3XA 5CSYA 3OLEA 1ISZA 1E4NA 3AIEA 3GNOA 2ZUMA 2XIBA 1VENA 4AEEA 1XC6A 2GVYA 1J9YA 1CENA 4TUFA 4FNPA 2VTFA 1GOQA 4AD2A 5HOSA 2WWCA 1ODZA 2WMIB 1JZ6A 5DEZA 3BAJA 3TP4A 4ATLA 1G94A 3A5VA 1DWFM 3K46A 1WZLA 1ZU8A 1EO7A 1HNYA 2EEXA 2V5DA 1QNQA 2VO5A 4H2CA 3MUAA 2Y5EA 3RCNA 3D4YA 3VTRA 1GOWA 1H5VA 2WSKA 3SCTA 2PWGA 1NARA 3M46A 3WDRA 4PMVA 1P6WA 5CQ1A 1CGTA 5HPOA 1QOXA 3DHUA 2WHJA 5A6KA 5JUVA 4J3WA 1UHVA 1C7SA 3W6LA 1J0KA 3VDBA 4CU6A 1QI4A 4Q7NA 2DDXA 1UR4A 4W8BA 3GXDA 1HJUA 1PZ2A 5LA1A 3AISA 2UY4A 2GSJA 2YKKA 2VX6A 1B3WA 3WQ4A 2ZUNA 5CLWA 4HA1A 2WMIA 2FDMA 4Q22A 2QLYA 2ZXBA 2CBJA 3WH9A 4JKLA 3UG4A 3AFBA 2XM2A 1HN1A 1GOMA 2O9OA 3WDIA 4P8UA 4MADA 1US3A 4FMVA 1CECA 3A4WA 3EMQA 1KWGA 1Q6DA 2F18A 2E8ZA 3U5YA 3AROA 1GW1A 1JAEA 4HZ8A 1EHNA 2OYMA 4B3KA 4LQ1A 1BLIA 1KXHA 1UQZA 1M04A 3BUPA 3MMDA 5E6YA 3II1A 2V3DA 2DPEA 2D0HA 2WMHA 4P7NA 1MXDA 3D3AA 2D3LA 4UOJA 1GHSA 2ZUUA 1IT0A 4TTUA 1TA3A 4S3JA 5A94A 3NCOA 2VVSA 2DSWA 2G3MA 1TFVA 3VU2A 1FHDA 3W53A 2F7QA 4D72A 2XGIA 2BHUA 3D5HA 3ZT5A 1V3MA 3DX2A 3AMKA 4YPJA 3MU7A 1LWHA 4K68A 4MJ2A 4WK9A 3K4AA 4MNKA 5I2UA 3WNNA 2PWDA 2WVUA 3SCNA 1JYWA 4DWSC 2RGMA 1DP0A 4UFJA 1CEOA 3VVGA 4FNRA 2BHYA 1XH2A 1VFUA 4W8AA 2EQDA 4QAWA 2V38A 1JZ5A 4ZE5A 5E1QA 3AZRA 1J10A 1FP8A 2JE8A 3CZSA 4AXNA 1QHZA 1QPKA 5KEZA 4PYSA 5BCAA 2CXGA 1NWRA 2BFGA 3TTOA 1RP9A 3SCPA 5CGMA 3LPPA 1OM0A 4CN1A 2WHKA 4BA0A 4X0VA 3TOPA 2ZUTA 4W86A 2IUZA 4W7UA 1M01A 2GJXA 2ZXQA 2D1ZA 3RM9A 2XSBA 3NYDA 5EMYA 2ZIDA 1B0IA 1H41A 4OZOA 2W4XA 1Q6GA 2GK1A 2YL8A 4OKDA 5ABHA 3VKKA 1F4HA 1JG9A 4NXKA 1XH0A 3SUVA 2WLZA 3QR3A 5FKYA 1OWQA 5I23A 3VD7A 3WF2A 2A3BA 4NZJA 2WYSA 3TTQA 1OT2A 1XYZA 1PBGA 1AQ0A 1QNPA 1UR8A 3PZGA 3NUKA 1T0OA 2XVKA 1NOUA 4RE3A 1B31A 1V3JA 2DSVA 2CYGA 4AEFA 3QHNA 3LRMA 3MV01 4UQ9A 1E3ZA 2F7OA 5AC5A 1ISVA 4ZE4A 3SCOA 4ML4A 1WO2A 1DWIM 1PE31 1E6NA 1UWTA 4J3TA 4PN2A 4ZXLA 1MQRA 3VILA 1UD5A 1AQHA 3SCUA 2BY2A 1EA9C 3W26A 1VB9A 1BYCA 1UUQA 3FXYA 5BROA 3OLIA 2NSXA 2OSXA 4GXPA 4MAVA 3AXHA 1UKTA 4WJXA 1JXJA 1BYAA 4C7GA 3HN3A 2J8GA 3AHYA 1WP6A 3DECA 2J4GA 3WEMA 1TQUA 5HBFA 2EACA 4CGTA 1ZBCA 4D6GA 2XVGA 3PZOA 3GH7A 4GZIA 1Y7VA 2WZIA 5C71A 1UZ4A 4GINA 1VFMA 3W0KA 4JCLA 3B9EA 1V0MA 1BTCA 4AWEA 4MB1A 2WMGA 5I77A 3WQ6A 4F79A 1KXVA 1MW1A 5IHSA 2ESCA 4OIFA 5I78A 1BSIA 3N18A 4JFTA 1UD6A 4AZCA 1NWSA 4NX0A 4WSJA 1WDRA 4HTYA 3WF1A 1E0VA 4D6JA 5F7UA 4DUVA 2DIEA 3H53A 1TQTA 1ITXA 2WC7A 4HP5A 3PZQA 4KH2A 1E3XA 3W37A 1CXHA 2VCCA 4D6FA 1HKJA 1X1NA 2G3IA 2J79A 1MW3A 1E4LA 3ZR5A 4P8XA 4JFWA 1X6LA 4FLSA 2BHZA 3VGHA 2XSAA 4AIOA 4Z2IA 3AHZA 3NIYA 1HP4A 4JAWA 4BQ2A 2VZVA 3HG2A 1MQQA 1WKYA 4UQCA 3ECQA 1FHLA 3DYOA 1LWJA 2E4TA 4IUGA 1CXEA 1E0WA 2ALWA 1EOKA 4E8CA 1J0HA 2EO7A 2V3FA 4PSPA 3BAWA 1O7AA 3S5YA 1IV8A 2WSPA 4J3XA 1W91A 1QNOA 3WH7A 1CGYA 2UY2A 4U5IA 2CERA 4W88A 1JZ3A 4M24A 2ZX7A 1QNSA 2YL5A 5A2BA 4J27A 5FCZA 1BF2A 3B9DA 3ZIZA 4P8VA 3PZ9A 3VSUA 2X05A 1WZAA 3I3BA 4MAZA 1CXFA 3WF3A 1F4AA 5GPRA 5BRQA 4CD4A 5A2AA 3THCA 2VX4A 1Q6CA 5JBDA 2G41A 1ISWA 1NH6A 1W9XA
chains in the Genus database with same CATH superfamily
3PWJA 2H0PA 3QNZA 5LNUA 4OGYL 4X99B 3ZO0A 3LQAH 3MUHL 3E5PA 3QR0A 3ZYZA 2GIXA 4FQXD 3VQMA 4R90L 3L95A 3PQYD 3R06B 1B1YA 4ZNCD 2VGIA 1A6VL 2PP8A 5IVXE 3ZKMD 3VK5A 5LGKA 2H2PD 1EP2A 4NF7A 4V28A 4N1HB 4DYKA 1YMHA 4J12A 2XVNA 3LHUA 4UQIM 3GI8L 3BLDA 3VOJA 4UILL 1S7RA 3D50A 4UT6A 3K5XA 1EDQA 3QRLA 1G6RH 5IM7B 3E9TA 3NMEA 5JA8B 1NPNA 2CDGA 2KHAA 2OLHA 1MHPL 1W56A 5H37G 4HIXL 2XH0A 4K3JH 3QHMA 4JIQA 5C0BA 5CLTA 3UWUA 2OR2A 5JZ7D 3PNZA 3W7NA 1Z89A 3OGOE 4KKBC 4YHZH 3B9KD 3U0WL 3VXRA 1QVOA 1EQWA 3NO5A 3QV8A 3T8QA 4AZ7A 1F1AA 2WKGA 4HPGA 2VC2L 5ABTA 2Z1SA 1UC6A 3K6SB 4ZBCA 3MS8A 2WQWA 4KI5C 5D1XC 4HYTB 4TNFA 3BHBA 4C6BA 4DM1A 3TJHC 4NI6A 4E5TA 2J6EL 3PZVA 1INEL 4MD4B 3IGFA 4NLAA 1I2QA 1AD4A 2OPJA 3IJYA 3JTSB 3VFOB 3KPRA 1C08A 1W8SA 2DB8A 1QPQA 4QEGA 2Z0BA 1SJMA 4KBPA 3VXMA 3PHQA 3QGVA 4RX4A 9PCYA 3GSMA 4C91A 1AFSA 3EGXA 3PABB 4ZJ9A 4HPNA 1PEWA 3CVBA 4ZFGL 1RL1A 4QR6A 3SJVD 4Z7NB 3MOAL 3T81A 1A0QL 3ARRA 4B0MM 1JXKA 4UMAA 4JFSA 3QTPA 5AFDA 2O61B 3ARDA 5EA0L 5AYZA 5HGAA 3LDVA 3JWNH 3GMMA 2XN9B 1QBAA 1JPIA 5EU6B 4H8NA 3VUPA 4C58B 1FCBA 4AW4A 3VU1A 4GW5B 4ZODA 5B3JF 3W57A 2VKZG 1I60A 3GNPA 2IBBA 3MOBH 2I9LA 5AZ2H 1V27A 3RCYA 2X2YA 2JV6A 2P43B 3HAEH 3L3KB 5JNYA 1P4CA 1UWSA 1I1FA 1U5VA 2C13A 3LM3A 3Q44A 3NQCA 4F2UA 1I9RH 2IQAA 3RA7L 3OPZL 2DT0A 3GTXA 4M4RA 5ECGA 1PG7X 3QKZA 3WFBL 3RYMA 1T6VN 1Q0YH 2HISA 2HCVA 3DSFH 4H8UA 2PWHA 4Y5XA 5FYLE 1RKRA 2O5XH 3ZHKA 4PBVC 3VFUB 2X87A 3QGAC 1XGDA 5C6MA 4OF7A 2GSIB 4MNJA 3QXAA 1MCDA 1RZIA 2NUYA 5I0WA 2EVFA 3V4VH 3N6HA 4U1HB 5IB2A 4YGVB 3O3BB 3W38A 1N5YH 4LB4A 3I85A 1SJCA 3HR5A 1TPDA 1BQKA 3P54A 4JS3A 3IVKA 3FHAA 3DX8B 1CL7L 3FQRA 1P9MA 4JFPB 3NSNA 5FR3A 4XN9A 2DW7A 3GXPA 1X9RA 4RZCB 1XYLA 3KBFA 4QWWC 2JELH 1S7SB 1TTFA 4QGYA 5JDSA 5AENA 3B9OA 3N9KA 3VNDA 1CB2A 3T0XA 5BYWA 1KCSH 2E46A 1IC5L 1QNVA 2NV1A 1YYLL 1O7DC 3RZCC 4Z77A 5T1KA 1A53A 1DVXA 1F6LL 2F1EA 5PAZA 5DMJB 4KEUA 4Q14A 4JKNA 4IIBA 1I2OA 3TZFA 4UTUA 2WYTA 3IJSB 4JHVA 4ZPTB 3HE6A 4YHML 1GEQA 2JK5B 3QXAB 3X3GH 2CO7B 5B1CA 1BQHG 1AH0A 7PAZA 4P4KA 1YNYA 1PW3A 1UVQA 5AOKA 5ID0A 1US2A 4XMLH 5FM8A 2EIJB 1BW8A 1SEBB 4RJEA 1JGUL 2EDTA 1Z9NA 1RY0A 3K81A 4GAAA 3G6DL 4K94L 4YDIL 4RUBA 2HTLD 2IIJA 1BVOA 1PFCA 3ECWA 3WNLA 1MG3C 3JTSA 1XL4A 3L7EA 2CNCA 3FB5A 1UD8A 3SN6N 3KXQA 3W01A 4G2DA 5I26A 1DZ0A 2D9QB 3MXVH 2GJZA 5C07B 4JVWA 1G6RB 1WBYB 4CVXA 3G1XA 1WAAF 3LGDA 1PYWA 1PYWB 2QHLA 3EKCA 3SKNA 4QNEA 5H2BB 1P2CB 4MJZA 4N6RB 4FG4A 2KH2B 1KTLB 3PE9A 3E96A 4Y2DA 3KVMA 1DUZA 5AVVB 1XLDA 4FNTA 4J3OF 5FUOH 4UFKA 2VCOA 1ZE3H 3MRJB 2J7FA 5IFJB 5CPTA 5C9KA 3CBWA 5SV4A 3VD5A 4KRPB 4PGCA 4O10A 3RPIB 1ZLUH 4HXAL 2PDFA 4F40A 3JV0A 2OLSA 1WA0X 5LBSL 4OZHB 4BK5C 3AMDA 3GD6A 1FP9A 1GOXA 1H3PL 2QDHA 4FJ6A 2C1OA 1AZ1A 1CGVA 3HE6B 1ZLDA 3LKSA 1LO3L 1MCQA 3GUFA 3RBSA 4AZUA 1E71M 2F38A 3NO1A 4QRPD 1RCQA 1XI3A 1XSKA 4LGRB 1XX9C 3NSDA 4S3KA 4DB7A 3MR9A 2AHIA 2W0LA 4AV0A 5EEVA 1AW2A 4UWMA 2X40A 3UC0H 2W3ZA 1FX6A 1JK9A 3ARDB 2PTTB 3TVMC 3W0WD 1KZYA 1ZA3B 3A4JA 1MI5B 3FU9A 3BVTA 5T1DH 3DX1A 3L9YA 1OFRA 3DX8A 2CCVA 1KJ2H 2FL5B 3BYTA 1S5VA 2R24A 4GYPC 1ZTXH 2NXGA 2HG5A 4NENA 4HISA 3LA4A 1JUEA 4L8DA 4JCMA 3BZGA 4HUUB 1C29A 2DWYA 4R6UA 4CSSA 2M26A 3GXMA 3WLBB 3CZUB 3GK0A 2P28B 4QHMB 4PULA 1J9CT 5I3JA 1W9BM 3CN4A 1U8LB 3WS6C 5LSMA 1QTYT 1R3YA 1VZIA 1N59B 4H0IA 4NWTL 5FECB 1F1DA 1QFWI 2PR9A 2XVPA 4HJSA 5KS9F 1LVEA 2CJUH 2CNYA 5C55A 1OIFA 3E2HC 3IJIA 3OZYA 3URBA 2EDLA 4C83A 4O4VA 4M6AA 1T20A 1GKEA 1BBDL 2YBTA 5C5YA 1VYRA 4JDBA 3APDA 4L0YA 1G5GA 3IMWA 4L0PB 3PF3A 4WFGE 4AGQA 2ZOTA 3P5ZA 4DTGL 2Y5TB 3VB8A 4GKSB 1C91A 2E86A 2FLMA 3RVWC 4W5ZA 5RUBA 4JB9H 3TZVD 4R4BA 1W5MA 3BISA 3M6YA 1E9IA 3BGFB 3L4UA 3VW3H 2ICSA 5I75B 3P2BA 1E0OB 2QGEA 1G7VA 5AKSA 1OGAB 3IXTB 2YKLL 2OZ4A 3AJ7A 4WRHA 5KVGE 1KM0A 1GPOH 3OG2A 5ANMA 3L1FA 3DX6A 5KSBF 3GVVA 1JCKA 1TUFA 2WZAA 3GMOA 2RB8A 2ICEC 1BV8A 2FLIA 1V0NA 4MB4A 3KBHE 3WUGA 1YMMB 2BOCB 4KOCA 3S2JA 1R8LA 1DVFA 3GXNA 3U7VA 2EDWA 5KANI 4NZFA 5C9JB 4GE8A 4L37B 3SZ6A 4LT9A 3M1OA 3P40A 4YDMA 4FX7A 2EDRA 1UQSA 1Q7MA 3ZJ6A 3JVFC 4XZNX 3HGRA 2QJMA 5CZVL 3QFEA 5CILL 4MYAA 1KCRL 4PP2A 5TQ2L 4BHUI 3RO6A 3D25B 4IQHA 5IJBC 2FDSA 4YHPB 4MRBA 6XIMA 4C6KA 2QELA 4XXWA 4O17A 3TS8A 1AI1L 1KCWA 1YNKL 2NR6A 4H9ZA 5AVTB 5DQDL 4L8SB 2A6JA 3ZO9A 1XD0A 5FA4A 4QRTA 1LL7A 4F7TA 3WLWC 3DVGB 3GDKA 2PWFA 1X6NA 3CFUA 2CO1A 4XAPA 2XTSA 3QZWB 4LCCA 2PGEA 2QKIC 3K6NA 4N90E 4KXZI 3MT1A 3MLTB 1EBPA 8FABA 3W84A 3DNKA 4LT7A 1N0LA 1EEXA 5HDOA 3EAUA 4NQDB 4ZMOA 2UZXA 1IGIH 4P2RE 4UU9A 4GQQA 2VOMA 4PN6A 2E7FA 4N02A 4A2SA 3QQDA 1PKQA 4ONFH 4GRLA 5I1JH 2L3BA 4FXRA 1UM6L 3C5JA 4R7DB 1XCQB 1B9ZA 3C6LA 2FYYA 3ARZA 3WIHL 3AZSA 1LG2A 4PR4A 3TW7A 3WIJA 1FP5A 3TA3D 1FFTB 1HILA 2KL6A 3OA3A 2HJLB 4H3DA 4C57C 4XTDA 1EVUA 5CJBA 5GGRB 2APTA 5IW6B 5JLZB 1XIHA 2Z27A 3TFXA 3S35L 1QBMH 4NAMA 2MEJB 4HPYH 3VGEA 5BXSA 4JQIL 4OD3L 5G5DA 4F0MA 1O6IA 1LD9A 4JTAA 4UFLA 2OMBA 5JBEA 3H70A 1IVTA 1R34A 4MNGB 4ZMAT 1PL3A 3H7LA 3NQMA 1XGRA 3GB7B 5D5ME 1ES0A 3BCFA 3VI3B 2C14A 1U8NB 3VI3A 1ZSHA 1JNLH 4FNLL 1RZKC 5IQ7L 4W68A 3KEHA 3FFDB 1E8ZA 1PQZA 3NH7H 1OG6A 4DESA 3UQNA 2WXOA 2R23B 2XQYK 3I9GL 3UIYA 3HU7A 3P0VH 1BX2A 4EUPG 3IU4H 3ZDYF 3M0IA 4GIAA 4LP8A 3W27A 1MZYA 1JCMP 1JZFA 4N8UA 5HMFA 2BSED 2FZBA 3VWKA 1K3UA 2H8ZA 4DGWC 3HZYA 1DEEB 4HH8A 3IPEA 3SDCB 2VSKB 4Z8FL 1ME8A 4QDMA 1XLGA 1XXDC 3F2DA 3TEWA 3VFMA 2Q2LA 4U6YA 1EV2E 1S9YB 1KJ2L 3BT2L 1WZKA 1WHOA 3ZE1E 5JW3H 5K9KB 1UZDA 5HMSA 4MZRA 1HI7A 2XGBA 1Q9WA 5HUPA 1FWHC 1PTZA 2LU3A 1QR7A 3O8AA 2DYPB 5AVUB 4KMTL 1WRFA 3P6LA 4LSTL 1EQCA 3EJCA 1HJWA 4PMOA 5CSZA 2PDHA 3ZVIA 1RULL 3D12B 4P8WA 1T1ZA 4R2GC 2PP7A 5EZIH 1HXKA 4JFQA 1B4TA 3ZTNH 3HFYA 3IWPA 4AD0A 3RG1C 5IHHA 3GUTB 3QI9A 4OBSA 2A6JB 4NNCA 2Y2WA 2WLHA 1EDGA 4EKJA 1I0BA 2FQIA 3H2MA 4G5DA 2BVPA 1NQ6A 3QHFL 4V2XA 4IGSA 3UG8A 4FE9A 2E09A 3CN1A 3MYJB 1TTUA 1H3GA 1YN7A 4ZSOE 2LE9A 5K93A 3SDXA 4OBRA 4ZMTA 1ACYL 1QPXA 2YB4A 4RRPA 4HUXA 2PUQT 1HHJB 1K6QL 4KRPD 5D2TA 2OZNA 5GS3A 4PRAB 4M5ZH 1EJWC 2GUOA 5FUOL 1XF0A 5EGRA 2YQGA 1OHZA 3GQFA 4L9ZA 4DJEC 3B2DC 4RZ6A 4KDTA 3U46B 1IM9D 4GRWF 2LLGA 3M6DA 4W6WB 2XCMC 1NDMA 1IIIA 3HG1B 3OKKB 3TR9A 3GSOA 4LMQE 1OYBA 4HT3A 2Z93B 2DLTA 4HIBA 1GNXA 3WEOA 3NYZA 4PUNA 4JFOB 4K7PY 2H3NA 4U3XA 3U83A 1TJ2A 4JZJB 5DC9B 3MREB 3FU7B 3GJFH 2WC4A 4WKAA 2JKIS 1PSPA 4TNEA 2DTSA 1PZUB 1T03L 3IT8D 3NCWA 5U7SA 2PTDA 4N4QA 1I7TB 1WZMA 3BUDA 5AKQA 5ABFA 3CU1A 2AK4E 4D7BA 3U1SH 4H25B 5D2NA 2OEJA 1Z5YD 4OLYL 4WI3A 2Q8AL 4JNXA 2R1XB 4EUPA 4M56A 3I50H 5I1IH 2NQZA 4O14A 2X3AA 4U4MA 4XK2A 3BRGC 1HJVA 4Y6GA 1H6UA 4MA8L 5CSBA 5EBMA 3S1VA 4OFDA 1GGTA 4X50A 3P61A 1YUHB 1OE1A 2IWEA 3BWAA 3BW2A 5G2WA 3VC5A 5FHBL 5A3IC 1SW0A 4M6ML 4QR7A 1BJ8A 2UWFA 3O0RL 3AOFA 3TVMB 5D05A 2J8OA 1GZJA 1IBZA 4UNIA 4X83A 3ZKXC 2E7LC 1ASOA 4U1GC 3VFVA 4ZNEA 4RGMB 3N9SA 4WZ9A 3CIVA 3DC0A 1G7PA 2HB0A 3MNWA 5IF0A 3GBEA 3B2XA 3FUHA 4OI9A 3C8KA 3CFTA 4LPXA 3OHMB 3WQEA 1S38A 4HCRL 5TIMA 5FB8A 5B7MA 2ZYSA 3MLUH 3MGTA 1O6SA 4OM0L 5GZOA 5IK3A 2QADB 3H85A 3QIUA 5ICZA 5T8GA 5CBJA 2JKAA 3UTTA 1RXLA 3SPJA 1N2VA 3ES7A 3P14A 2AABH 5EULV 4OECA 4EIVA 5B80A 4WKXA 3A4DA 1JL8A 4Z7OB 2O6DA 5EBMB 2VDLH 3AUWB 1GH7A 3KGTA 3KYOB 3GU1A 1FHNA 1SOKA 4ZR8A 1O94A 3IDNB 4M5YL 2BLFA 4AL8L 2J88H 4P2YA 3TO4A 3BW9B 9CGTA 3GUTA 3EJTA 5FOBA 2Z4GA 4QMEA 3KP1A 3R4IA 5J8LA 4PTTB 4J6RL 1VCGA 2YUXA 2PD5A 4JKKA 5XIMA 4MXWH 2J8HA 5DUBB 3EJPA 1RALA 3FU8A 1NGZA 3BP4A 4GT7A 3NEOA 1F4WH 3T65A 1XG3A 2BVOB 1OCQA 1OXYA 4S3DA 1JCNA 3KPPA 2R2HA 3VXOA 4PGJA 5IB3A 2NW0A 1BRLB 4PCKA 4RFOL 4XVUC 2DKSA 3DSNB 3O4OB 6PTDA 3VFNB 4UTCA 1F3WA 2VX5A 4XZHA 3LV5A 1KPVA 5HD8C 5FECA 4KHXL 4NBXB 5GISH 5HHQB 4J5VA 4OCRH 2V2HA 3GDTA 4HZ7A 3MLVL 3CAFA 3LS4L 4XC1L 3MSPA 2P46B 2MCPH 2FJFB 2ZUQB 3ES6A 5SX4I 1JP5A 2CRMA 3VWKB 1PVNA 3K72A 4M00A 4XNAA 1GPWA 2Z29A 3MNZA 3TBTA 3GDRA 3GX9A 3NJXA 3S9ZA 2L8AA 2XWJB 5EU6D 4E42A 3VE0B 4MJIA 2HE5A 4PUUA 3ZL1A 1Q4NX 1QNZH 3BW3A 3EB4A 1JF1B 2EEAA 3PDOA 1T0MA 3O6YX 3R2GA 4QP0A 4NC1E 4G8TA 1IEQA 1KXTA 2QQ6A 2UV8G 1KM6A 4KZDH 3IM1A 5DD6A 4DPAX 3M0MA 2ZUSA 5HK4A 2BWGA 3M0KA 5GS2D 4URIA 5TQLA 2OLDA 2CBIA 1NOFA 4Q58C 1MO0A 3FU6A 2OL3A 3BLIA 4RSYA 4CCEA 3OMAB 2W80C 3WYZA 4TF4A 2IH1A 3R7QA 5C0NC 4AC1X 3FJ4A 3RDTA 1TJHL 2YAPA 3GPSA 3B9VA 1O95A 5BQ7A 5JQ9A 1T1XA 1CI1A 5FIEA 1E4JA 3KOWA 5DLMH 4GXVL 3ZY7A 1A6VH 1RIVL 2X6VA 3WQVA 3AT9A 1YN6B 2FJGB 2WINA 4HV8A 5FO9B 3DVIA 2W60A 3L3OC 2WUBL 4HHAA 2H1LM 4R90H 4F7MB 5ACZB 1SW3A 3F5LA 1LP6A 4Y4HC 4JR9L 3IU3B 5DS1A 2BMKA 4JPSA 4U6XA 5ACMA 2H0FA 3RMJA 4OGYH 5EU6A 1FNLA 4YBLB 4NLHA 3CK0L 4XUYA 4JFHD 4JFQB 5FGBC 3C5ZC 1GA2A 2DWXA 2FLRT 5AAMA 3R7RA 4BCYA 4BZ2H 3GQYA 5C3IA 3WLNA 3HPSA 3C0LA 3MA7B 1WICA 4UCFA 2I14A 3OJMB 4Y9PA 2XFGB 5JOFA 5D5MF 2YR3A 4ISVB 4O8AA 3TEUA 1ZHBA 2YDQA 3LH9A 4QHNA 3VGGA 3EYPA 1DHPA 3MLWL 2WMJA 4AC7C 4E6MA 1D5BB 2AZUA 1QR1A 1PDZA 3PF2A 4XP6L 1N2RA 1K9TA 4JANA 4BSWA 2N7AA 4YH6A 2DYSB 1J8HA 5IBTL 1V02E 5FKAB 2GQHA 1X5FA 1QX1A 1KYOK 5DRWB 1R9ZA 5CZ0A 3U1PA 2AXGB 4TTGA 4ACZA 4NNYB 3C5JB 3KR3L 1LE5B 5F8RC 1W5NA 3GU9A 4XB3A 3VM5A 1F07A 3KXFA 2WIMA 3MQIA 4KTYA 3LENA 3G22A 3MSRA 1IAOB 4I18A 4AENA 2DEPA 3O6FC 3T05A 2YGQA 1DVZA 3WJXA 4XH2B 4UUJA 4DUXA 5F2GA 3W2NA 3BWZA 2FZ9A 1CF8H 3L7RA 4OLZL 4HS3A 1OLLA 1BVKA 2EE9A 3O3AA 3VQLA 3T2LA 3I6TA 3WJZA 5DMYA 3QA3A 4KPHH 4P4RA 2VXVL 3GKWL 3Q1SL 3ELQA 1T7XA 3WBDA 1AH1A 2OOFA 4OZIF 2ESVA 3MI2A 4PRNA 2G96A 1KN4H 4EQ2A 3R0MA 2BDNL 2QT6A 3FDWA 2PDPA 1F6YA 3ZKNC 3B0VC 2NXYC 3FQUA 4X99A 4FQXA 2V5MA 4XO6A 4LPVA 4PCTA 1EF3A 1MDTA 3DOSA 3PFUA 3MRFB 2WWOA 4XVSH 1IZJA 1BZQK 1URZA 3IBOA 5MKGA 1IM3A 2FGZA 3VIMA 3UVIA 3SDYL 2I7GA 3QO0B 1FWFC 4JGNA 1JNHB 4RQQB 1T5XB 4ORGA 5CLZA 5D7JA 4JICA 1MZHA 4HIJA 4BSWB 4LSPH 3O05A 3VFWB 1VF8A 1ZL1A 3KVKA 2P1FA 4O1EA 2VD8A 3VDGA 4P4KD 4NZTL 5DMIL 1MCWW 2FGBA 3DJZA 3FPXA 5EPMA 5FUZL 5DO8A 4EVNB 3MX0A 4FZ8H 3OJDB 3D69B 4NOFA 3TX4A 5FSDC 4QLRA 4J3UA 3DVGA 4U0RC 3QUXD 1RU9L 5HGHB 3BN3B 3QUMA 2GK0B 1J88A 5F71A 1K9DA 5T5NG 1WS8A 3O81A 3MHFA 3OB0K 3RHGA 3MRIB 1QKZL 2NZ9C 4XAKD 4IOIB 4U3SB 2UX6A 2XNAA 3LEVL 4F7PB 5GRVK 4GOAA 2PYEA 1A6PA 1MWOA 4PUBH 3N12A 4D6DA 1OAZL 4PRRA 3MBEA 4O00A 1KYFA 3WUBA 2F54B 1J9TA 2PURA 1A6ZA 5SWSB 1VDGA 2D2HA 4JHOA 1E9OA 1RUQL 2K3HA 5C0AB 2EXWD 4JDZB 2F5BH 2IFGA 4D3CL 4O1FA 1V3IA 2YD3A 5M1TA 3BOLA 3B9AA 2JI3A 1ZALA 2Q01A 2NVCA 1ZLPA 3ATAA 1DQLH 3HG5A 1M3UA 4JXCA 3TWAA 3D0VB 1N2RB 4JANB 5DYFA 2ACSA 5FYJL 4ICNA 4WSHA 3TLRA 2V69A 5AZ1A 4E3VA 4WEBH 1TMQA 1VJSA 3MBFA 3C5ZA 3C2AL 4WW2B 2PRHA 2EINB 3ARTA 4Q4EA 3ZQ9A 3GXUB 2ADIA 1E9PB 2IQ0A 4XCEB 2BSLA 2QADD 4A6YH 1E65A 4PJ7A 2FWOA 1XCTB 4HNOA 1GTHA 1JPFA 4U7SA 3QORD 2JFCA 4L4TB 4FNSA 3QOMA 1U6AH 4X4YB 3CPUA 2QTVA 3HVDA 1K4DA 1NTDA 4GY4A 1UT1A 3EJYC 3TWBA 1EUUA 2GY5A 5LJYH 4FFYL 2XQYG 1YZZA 3QUXB 1X8CA 1GVRA 2IJ0C 5EU6E 1AJ0A 3MV8A 2W67A 4QXTA 1EIBA 3AHVA 4OZFB 1VBUA 2DQMA 2C4XA 5KVFE 4ZXBB 1T40A 2NLIA 1UWGH 3GBNH 3IK4A 4GJIA 3TYBA 3ZKSD 4JDEB 3NURA 1I3VA 2H6PB 2CHZA 1XGQA 1F3DJ 3QORA 4PJAE 5KZCB 2J74A 2OJPA 1GAFL 1UXSA 3P7YA 5FF0A 3C87A 2W9EH 4L4PA 4ZMGA 1DL7H 2VR2A 3L0KA 2EILB 1TR9A 3CXHK 2NZIA 3HNTL 2PDQA 3AB0B 4QF1A 4D8ZA 3EOYG 4NQCE 2FPVA 1FRBA 3L5LA 3P77B 1YW1A 3BH9A 2XINA 4NZUL 5IFHH 4NPKA 1R5VA 2ZZUT 1E9TA 1AACA 1OWRM 1BEUA 2J7DA 2D9CA 1XRTA 2WCAA 4W9IC 4I0PB 3PZIA 4RDYA 3L2MA 3CS2A 1BM3H 2AQSA 1XYBA 1KUMA 1EO5A 1UASA 4HHLA 1TJMA 4N2FA 1X7TA 2BSTA 1TIUA 3G3LA 4N8CL 2VKXA 1DN0B 4JRXD 4WUUB 3T2NH 3VDCA 3VWJC 1SUXA 4IPJA 2GJPA 1QBBA 4PWKA 3S3JA 1Z6KA 4GQPH 4Y9CA 3BPOB 5TE7H 4UT9H 3TCTA 2YW3A 4QLKA 3W7PA 2NQJA 3BSZH 5H2BA 2CKRA 3L3GA 4N0RA 2OZ0A 1W16A 2WQ8A 1JI2A 3SDDC 4RISH 4M8UA 2VH5H 3FQRB 4OQ1A 1UACH 1B4KA 3FGCB 3HUJE 4IJ3C 2PDYA 2L04A 2MNJB 2TSBA 1J2BA 3KYOA 1C12A 2LVEA 4AXKA 4N68A 2EVGA 5EU9A 1W15A 6TIMA 3S5LG 5E9DB 5MEPA 3EPMA 1JFQH 1FO0B 4GAFB 4QIRA 4AGOA 4GY0A 4GP8B 4Q52A 1FWNA 4YWIA 3KOXA 1UD4A 2ZUVA 3WXVH 4LGPB 1ZSDB 4P9ML 2GEQA 1PTDA 5J5DA 4JY6A 4F7EA 4BQ5A 5C0JA 3RTLA 4DW2H 4X6BA 2YK1H 1LEIA 1PO9A 4LAJH 2X9YA 1S7QB 2BGQA 3P02A 4WGXA 4DXKA 1Z48A 1T7ZA 3C6LD 3O0LA 1M7DA 4HZMA 2JQAA 5DUMH 1YPFA 3DCPA 5I6LA 5B8CB 3CDGA 1FYTB 3O2VH 3VIHA 3GTNA 4NSKB 4PMUA 4I0PD 4DGIL 4GYBA 3BCJA 3UJRA 1MQKL 2PBOA 3V4BA 3R1ZA 3IAGC 3STCA 1ML1A 2DD8L 3QFWA 5HI3C 1JMXA 2LHAA 4P2QA 3PHAA 2ZP9A 5ERWA 5FDYA 2Y89A 4LCYB 3PBYA 1S7SA 3BXNA 5JDSB 4S1QL 2B7OA 1PMYA 4Z7UF 2X44D 3ZZSA 3DDFA 4A7QA 4ACTA 5I2IB 1X1OA 2W0UA 4XN5A 4Q8WA 4ZQRA 2QQQA 4MDRA 2COVD 2H47C 5I0XA 2N01B 4QO1A 2E75C 3UTOA 1E56A 4A4AA 3HRZC 1GGIH 3ANVA 5T91A 3QXDA 1Q72L 1FZOB 2A6DB 3VG9C 2FX8H 3EWDA 2BOEX 3C5ZB 1AG1O 1XQKA 4YIQB 1SJXA 1EHKB 1UWEH 1HEHC 2Y7OA 4IEFB 4YTUA 2BSDA 3EDDA 1PF3A 2ARJQ 4HZLB 1DV7A 5CEYA 3MRMA 4LUSB 4Z77B 1H7NA 4FZEH 2EG7A 3QJVB 4K55A 4YHIA 2IFFH 2D20A 3JYBA 4FKEA 4PS3A 1MNSA 2CLHA 1W9PA 5CINL 1P6AB 3QNYA 2H41A 1MJ8L 4PWGA 1I1AD 1I1RA 2CLMA 1IEBA 2LABA 1L2UA 4I2XA 4ZZ9A 4FK9A 4FAAB 5B7FA 5DZNA 4DVBB 1C3FA 1I7TA 4IHOB 1T22B 3D85D 5CBAA 2O61A 3EOOA 1A7QH 4HK6A 1QFWM 2EKJA 4P5KB 3ARBD 5IB2B 1QACA 4PEEA 5LQBL 1MFUA 3DUUB 3RDTC 3SKMA 4PJ7B 1GS8A 1NCBH 2H1PL 2ZOKB 3ARVA 3QUZA 2J66A 4S39A 3TWCH 1UTDA 4DI8A 2FJHA 1E42A 3LMYA 2JF1A 3ZDZE 3O4LB 2ZAGA 4ZOEA 1AP2B 1CLZH 3Q2VA 3ANYA 4PJXF 3E1F1 1NFPA 5TQ0H 1EZLA 3FO9A 4JZOA 4ENLA 1HDMA 3CV2A 5KSUB 1I8KB 4R8WH 3H6AA 5SX5K 4F7CB 4WCYH 4U7MA 3OAYH 4ILSA 1E4XI 4ORGB 5LCVL 1MELA 4HMDA 3CMOL 4ZO6A 5I3HA 1CXIA 1G7HB 1HAUA 1I9JH 3NIGE 4MQTB 3C2OA 3FZUC 3PJWA 3L3HB 4TRPH 4PRHA 1I9EA 4ZFMA 1L6FA 5CCZA 2CO2A 1T6WA 1W1YA 4C6FA 1D6EB 2VZSA 3IGHX 3S2CA 3PBUA 1XRSA 3TR2A 3JSSA 4G5ZH 3W71A 3EXLA 4Y19E 3ZTCC 3F2BA 5EU7C 3EX3A 4L64A 4CSTA 3MUCA 1BVLB 1N8WA 3APMA 3ME0B 4OM1H 2YFNA 4UTHA 2YW4A 4RMRA 1DLHA 3KTSA 1F1GA 1LP9A 2FWLB 2E9GA 4ONHA 1BVNP 4XAGA 1YBQB 4A8NA 4HHWA 4HBCH 4AC2A 2AMUA 2C5DC 2Z7YA 3ARBB 3BGMB 3HKZA 3P73A 4LSUH 4MD4A 4BZ1H 4EPKA 1JI1A 4CMHB 2AFNA 1OK4A 5IV2A 1V08A 3ZJ8A 4EOUA 3PU7A 5BOPA 4YHYB 4DWSB 3HC3H 3CSPA 3DTUB 4GAJH 1L0PA 4JPIB 3L45A 5F0JB 1Z8AA 4Q7DA 3QQ4A 2ISDA 1XKYA 1VSCA 3D08A 5C0CE 4BH8A 1J5CA 1SR0A 4AJYV 4JOMA 1GJUA 3H9SA 3ZRFC 4XNYL 5EDXA 2ZG1A 5BQDA 4JQVC 3VFPB 4YNYA 5L4FA 1W1PA 4G6CA 3TQ0A 1BJMA 1FO0L 1AGDA 1SY6H 3CFBB 5DWUH 3RJQB 1H2JA 3Q8BA 3EJUA 4OF5A 1RZ8B 2FQFA 3ZBMA 2OMYB 2PWUA 3AACA 3DX5A 4N90D 2D73A 3IIOA 5CD3A 3CV7A 4FS9A 4B92A 1IL1A 5J56B 3S36L 4ZUWA 1YMHB 5EN2A 3C60B 1MW0A 5TBOA 1CYXA 5I1KH 2D3NA 2J1WA 1JPGA 2P47B 2DT3A 3RL1B 4ERSL 3APTA 5ALBL 4JIRA 2P3ZA 3TBVA 5CH9A 2B4CC 2P5EA 3SN1A 3E2QA 4GKZA 4DKTA 2QQNH 1OGPA 5CN3A 3IRCA 3AY4A 3THML 1I1YA 4JYFA 3QRFM 4L4VD 2O92A 4HJWA 4JDTL 3ZYIA 3BV4A 2UY6B 2CLIA 4AU0A 5HHMD 2IKIA 2CFFA 4JTLA 1IKOP 3E2SA 1GY2A 3I6KB 2BWQA 3VJ6B 2FPTA 1Z5LA 5LGZA 1SDDB 1TTIA 2NY6C 3GMPA 4MZ8A 3B7RL 2X88A 4QFUA 4GRWB 4JVUA 4UTAA 1RUKH 4S10A 1ECQA 2RH0A 4KEMA 1YHPA 3L54A 3MRPB 1ZE3C 5ILTH 3NA9H 5ABDE 3CX2A 3OR7A 1X1ZA 4X80L 2AJXH 1B3OA 3BQUC 2AP2A 4JM2F 4GKNB 3SE9H 1FHGA 2YAEA 2V5LA 1DVFB 2P42B 3LEYH 3LYRA 2ADFH 3HMXH 5I8CA 2N0KA 2YC1A 1DUYA 1SM3L 4GFXA 3QH3B 4HC1L 2CETA 1PLGL 3BGAA 4ELKA 3L9EA 1M41A 1KACB 1XV8A 1QO2A 4WO4C 4ZS6C 1AJ2A 1B0GB 3L4XA 4H44C 3CFMA 4N2BA 4F8TA 3SKMB 2FZMA 1OHLA 4EUPH 4P3DA 1FTXA 2OULB 4BV1A 3ZR4A 3W7GA 3C60A 1OINA 1PYMA 3KNBA 1GTNA 4XPAH 3M86A 3FTZA 1XDLA 3O6AA 1AFVH 1IEBB 2ARWA 4RX0A 3FMGL 2PPFA 5HXMA 5C2UB 4K5PA 4PP2B 4DWDA 3LSOA 3GLZA 1KQZA 3WFEH 1MFVA 1G7HA 1LNUA 3HUJF 4KY2A 3TIMA 3HI1B 3II3A 1INDH 4ZDHA 1H5BC 3U3HA 4H40A 1UPPA 4U49A 4BH8B 1UR2A 1V5XA 5AVRB 5U4NA 2FBRA 1ZHLB 2WM0A 1BJ1J 5CIPH 4HKBA 5F0PB 3DPBB 4J8RA 2OX5B 1TPUA 3CZKA 1NAMH 4FXSA 5HYSB 2RKXA 3C08H 5BZWB 5I24A 3F6JA 2FB3A 3OGCB 4A35A 1UXLA 1QEWA 3EJYD 2FUQA 3FH7A 1BEXA 3NCFB 3PZTA 1LP9B 2M8XA 3K4DA 3W0WE 2YDAA 2NOYA 4Z2LA 2W9DL 4AAJA 2HXTA 4JTEA 1AZRA 1E28A 1X7SA 1TJIH 4KXZH 5FYLH 4FALA 1DSFL 2WMKA 3LN5B 3OXRB 4HUNB 2R1LA 3N2MA 3T6CA 1FOBA 3TT1L 5B8CC 1KKRA 1SQMA 4H13C 3F5JA 4LVFA 3OG3A 2GEEA 4KXBA 2WLJA 4PB9L 1ZLWH 5BNXD 2QSCH 4A04A 4DAGH 4PREB 1RJZB 5AW6B 3QHOA 4QSFA 2EG8A 3NAAH 4WJEA 4WJ5A 2J9XA 3L13A 4GC3A 1BYBA 1VHNA 3MMUA 1IQDB 1PHQA 5C0FB 1BWLA 4Q2ZB 3V9CA 1AD1A 4H1LH 1FFNA 3B2UC 3DSNA 4CN4A 1RA5A 4WK2B 3QPKA 2JJSA 1Q6EA 1JRCA 2JIEA 4S3BA 4OCSH 4YFDB 4CJ0A 2XSXA 4OV5A 4O1BA 3UCQA 4RZBA 4L18A 3EXSA 1KTCA 2J7HA 4HIPA 4WEMB 2CQVA 5DHVH 2G9HA 4CMMA 2DV0A 3UCCA 5D7JD 2CDFB 3HRZB 4JPVH 4PWIA 2GK2A 3T4AB 2HLEB 5GHWL 3V5DB 3QHZL 2WGXA 2BFVL 3DIFB 1UWIA 2B08A 3TBSA 4ICWA 5SWZA 2RALA 3OVPA 4J6IA 4XBEL 3Q6GH 4ZW6A 4S3FA 2VABB 3HE6C 3N3TA 3TH3T 3BGJA 2FJUB 1DBAL 2WJDA 3JT0A 6FABL 5H8DA 2VZ1A 2CHWA 1TVBB 1NLBH 2X16A 4TX8A 3L5XH 1LGVA 4ZUTB 3WNPA 3B34A 1BXNA 3VRJB 5EOQH 2OXNA 3KDPB 1L5GA 1N10A 1SDAB 1ND0B 3HLAB 2NY3B 1AD9B 3IGLA 1QO5A 2DT2A 2O56A 5LNRA 2P24A 3QEHA 4UQBA 4Y96A 3DYPA 1Z5HA 3FFCB 2XX1A 2D24A 2VFHA 1O75A 3S5ZA 5BZWA 1DYZA 2DQFA 5C09E 2CXKA 2GYSA 3EUUA 4CADA 3QC6X 2XV0A 3RZCD 3U0HA 4J2XA 3VXUA 1A5MC 1FNFA 5A3HA 4WU7B 4F2ME 5LWYL 1SFHA 4LCCC 1EEPA 5BRZD 1MEWA 2FB2A 2ZA2A 4M1CC 2X0WA 3CASA 1MFEH 3UGRA 1FZOA 2A6DA 3AQXA 4YGAB 3O41A 3TPUB 3MODH 3NA8A 4RNJA 5B1BB 3K0WA 5AALA 5AYXA 4QRFA 2LOEA 3B9NA 3Q8CA 2VDML 4GISA 1AGEB 3T09A 2JXMB 2X1RA 3KX6A 2P5WD 3RFRA 1CLYH 3C2VA 1NKOA 3EYUH 2PDKA 4PJ8B 2ZTKA 3QMSA 3QXTA 4QXVA 2WKLA 1PDKB 1NM9A 2GGGA 1ET5A 4G8FB 4P5RA 5B4MD 4A2GA 1CD8A 4YSSA 1XBDA 3QUXA 1R75A 3EH4B 4KKLC 4AX3A 1ZKAA 2NW2B 1K8ZA 2NXZB 2AAMA 1A6WL 3FQTB 4RDQG 4YDJB 1M6UA 4EE2A 4JFDE 5EB8A 4YDVA 4KEZA 1CT8B 5AVYB 5JIQA 5KSBE 2CO4A 5L2KB 1MEHA 1A0DA 5A95A 3QYSA 1RPQA 4DF9A 4DQAA 1FUNA 2J43A 3NG5A 4G6FD 3LNFA 1ZGLP 1VBRA 4L4OA 3CTTA 4RL3A 1LEIB 3CXOA 2JCWA 4CBZA 4LAMA 1J1XH 5DJ8B 4MCMA 2FZ3B 4WJKB 3GSUA 2VW6A 4MFHA 1KSRA 4JY5L 1IIGA 2F19L 3S96A 4LLAA 4M6VA 4KK5C 2XWBA 4KHTL 3VGAB 1CK0H 5HJGA 3EJQA 3PWPD 4MSWB 1P5UB 4EIZC 3AHTA 5E8PA 4A2RA 3LLXA 4AD3A 5FEWA 5AOJA 4OZFH 5CEZH 4LH8A 1HTYA 3T1FB 3U2SA 3HQ1A 4OCSL 3LY0A 4Z7WE 5H94B 2Y7GA 3W6MA 5D7KD 1CLCA 3AIRA 4GIYA 5BMWA 1BG9A 1ZEAH 3P81A 4Y4HD 3L3GB 3CWGA 3GXTA 8PAZA 3A4AA 2GQ8A 3AU2A 3A9IA 4JX6A 7ENLA 4O0QA 2WXLA 3DO4A 4TPRL 2ATMA 3BTNA 3DAQA 3VABA 3NQAA 3HHSA 4XWGL 3LH8A 3GNXA 4NQTA 1FZMA 4Z7VB 3V5HB 2KPWA 4YAQB 3B9KC 5DI8B 1TPXC 3W1NA 4PJ5B 1F6AB 2FCBA 3S3BB 3V0VB 4KTEH 3C8NA 1LK3L 2NXZD 1SJDA 4LALA 5DGRA 4XN8A 3MGOB 4TXEA 4EE9A 4GIEA 1OFQA 4G9PA 1M5WA 1O60A 1KCKA 3GEFA 5C0ND 4N9EA 3FQWB 4NQQA 3BD4A 4U1NB 2XGZA 3EIFA 5GS0L 4P5TA 4MMZA 1OP9A 3MCNA 2V8MA 3MC0A 1NCOA 3QO0A 5CU9A 4JX0A 4KKZA 1JZ4A 2ALAA 4B9JA 1E0XA 4REQA 4FTVE 5LA2A 2VDPL 4CNOA 2WWNA 4FQCH 2A9AA 2CGYA 2FHBA 4KRMB 4AEIL 2C26A 1FWXA 3SECA 3APCA 3B7TA 1VFAA 4QXTB 2BOBA 4IJRA 4KXCA 1R9YA 1DQQB 4H8VA 1INDL 1U9KA 3V7PA 3LB0A 2AEPL 2BCKB 1X3DA 1BD2E 4I77L 1XXXA 5TK2A 3PQYE 1JV2B 3WFEL 5T1MA 3SKJH 1FA2A 3WO8A 2YRLA 3FA4A 3T08A 1A7PH 1DQIA 1RHFA 4PB0H 3QG6A 4HZ1A 4QI3A 4S2SB 1HVXA 5HY9A 1JQVA 4J2PA 4L8SA 3MUGA 3F2LA 1SMOA 3N41F 1XEUA 3PUUA 3BJTA 4GUHA 2JQXA 4X5WB 4PWEA 2VERA 3TNMB 4M1GL 5ANME 4DZBB 1WD8A 2V2XA 4OFPA 4PJBF 2EH7L 1Q9OA 2W07A 4I5BA 4Y1AB 3RX8A 2D8KA 3SQBA 4LVBA 3QBUA 2X2JA 2QSQA 3WF4A 2E56A 1H0DB 2R1YB 1WXYA 3OGRA 1V10A 3LY6A 4X0NA 1MJUL 1EJ7L 3NIDE 3BV7A 4XHJC 4MUPA 2CK0H 4NRXB 2O4QA 5FKAA 3EGDA 3W1ZA 3ZLHA 4NYLB 1OAQH 1ITCA 1WFOA 1S5IH 1U2YA 4FJZA 1JGVH 4GW1B 3EDEA 3MRKB 5GS1C 2A1YA 4BY3A 1MFMA 1RUSA 3D3VD 3RHWF 5D1QA 2GQ3A 4HIEA 4XNMA 2Y8VA 3KCOA 4QM1A 2VDOL 1OARL 4O4WA 2X89A 4B3EA 2PYFB 1UENA 3ETTA 3V1HA 3CXDH 3HQPA 3H1ZA 4BHUA 5J9PA 5EFIA 1AOZA 4UC5A 5EFIB 4UUJB 1EH9A 3GSVA 3LNHA 1G9HA 3MRBB 4EIBA 1F11B 1WQ5A 4OCXL 4Y7EA 2Y6TE 2GSGA 4HIHA 4CLMA 1SHWA 3DBXB 3EOEA 4GQGA 4UB0L 3M88A 1WWAX 3GMQA 4G6KH 4PJIE 5JQHC 3S83A 2WB1A 2BVYA 3KZSA 3GMLB 3TN3A 3VD9A 1Y1UA 3JWOC 1J01A 4HSNA 4Z2HA 5DRWA 5DZAA 1TWWA 3AIVA 2F9BT 1X5ZA 1IGJA 4OR1A 2C1IA 3HG4A 1VADB 4U2YA 2HK1A 2R27A 1LBLA 4JTDA 3VXQB 5C9WA 1AHWA 1HNFA 3FQWA 4GX8A 4OZGB 4RGND 1ID2A 1WAPA 3TZVB 3FO9B 3EJSA 1CQKA 3LKNB 2C1HA 3T42A 2XKUA 3BFOA 2W07B 1FBIL 4Y1AA 4EN3D 1AUSL 1F3RB 1CFNA 1FSKB 1YEIL 2BPBA 3NZUA 4X6CF 3ROLB 6CGTA 3IFNL 2FPYA 1SFSA 2QCMA 3EDJA 1YTKA 1KENH 2R51A 3FB6A 3RI5K 1FCUA 3MNVA 5E5UB 1F56A 1Q1PA 3G18A 4XXDA 4PJ7F 1D3HA 2G5BA 3L3DA 4AQ1B 4R4BB 4PFHA 5DD6B 4HIEB 4XNMB 3REVB 3EKZA 4GC4A 4GH3A 1MCOL 4UTWA 1EXPA 2EBNA 3CL7A 5E9DD 4DNHA 1XO8A 1H7RA 4PBDA 3UO8B 2AVFA 4IUOA 3EGDB 2BNRA 3C8DA 3DURB 2QGCA 1OADA 3FVDA 3R8GA 3RTQB 2ZX6A 1FVCA 3SYQA 2PWEA 1HOCA 3JWOH 2PODA 1KJ2B 1C8XA 2GI7A 3EXJA 2NXIA 1J5SA 3AO0A 3RJOA 3ITLA 3DROB 2D2OA 2QF8A 2UWEA 2DQUL 1AHKA 2JQZA 1TQCC 3LV3B 1KB5B 4M8RA 1QR1B 1ME9A 2BRQA 2VHLA 3T2OA 3WK3A 4F9DA 1B4RA 3FQXB 3TNBA 2VLJA 1J0YA 1XYMA 1X5XA 4NQSB 2UY3A 3PY9A 2WXGA 4KFMA 4AM0B 3WFCL 4A7GA 5K33A 1F2JA 2E6FA 1BG1A 1F3EA 3BUBA 2DEYX 1DJSA 4AJ0A 2OMXA 1NUDA 4PGBA 3WQGA 2MPAH 1OTUC 4WCYL 5I1DA 4AIZB 4R8WL 5C9ZA 1AIFA 1BBJA 3BXNB 1NBZB 3WKML 3NK3A 5LXVA 3UY8A 3AUVA 1CUOA 4ZYKB 1XU6A 4Y7MA 1L0XA 4FXKA 1G6RA 1WBYA 3SPVB 4CVXB 3F5KA 4GGHA 1BCIA 1KTDB 2ZXWB 3S6DA 4AQAB 4PUWA 4W4OA 3UFYA 3DKLA 5KZEA 3K5RA 1MRQA 2G0KA 4NC0B 3ZR6A 4KT2A 4NI8A 2HVMA 3ZSTA 5E99H 2J8TA 2XYLA 3T77B 3LHPH 1KOAA 1CG9A 3N2OA 1WV2A 3NIFE 3L7FB 3OBAA 5T1MB 4LUIA 3S47A 2B31A 3CFCH 1PLAA 5TE4H 4F0KA 1OCWL 5DY2A 3GC5A 4MKNA 2JWYA 3X12A 1MJ8H 4NRYB 2VQUA 1X6UA 4LCVA 3AQYA 3QDGB 1OANA 1NTHA 2PI6A 3DUGA 4R5EA 4RNHA 3TMLA 4L1HA 4HSOA 2J4WH 2HPIA 3QSRA 4H6QA 3HEIB 1SYVB 5JPMC 1R4XA 5HVHC 1E4HA 1OSPL 4JO2H 3SPVA 1CS6A 5CUSH 5FOBB 2CEQA 1I1WA 5D2VA 4ZL1A 5FJJA 4QXWA 3UABA 1QD0A 5M94B 3CYVA 4W9FC 4O02A 1KBIA 3LV6A 1RHHA 4LYPA 4NHVA 4XTRD 4BFRA 4Y2DD 5LGHL 3RWIA 3RIKA 3M5ZA 5DWPA 2NR6D 2X2GA 3NZ1A 3VKBA 2VDNB 4WSGA 3NCXA 1FHVA 3QDME 2VDOB 2R9RA 3I7SA 3LB6C 2WLKA 1D5MB 2YQBA 1N8ZB 2FGWL 4CL7A 1T96A 3WH5A 1BQSA 5KTEH 1AO7A 1Q7ZA 5C6TL 4XMKH 1WB0A 3OU8A 3KVDD 5GQBA 1BF8A 4MVAA 3TW6A 4FQ2H 3PRZA 4HPJA 4QISA 1XLEA 1FDLL 3IAPA 3BXWA 2XY2A 1MYRA 2VLJE 4QYOB 1S1PA 3U2ZA 4B97A 3GSOB 3BZEB 3M9YA 2IAND 4PLJD 2YPLD 4XVJH 3MJMA 3WK1A 1SJHA 4KY1H 5JHDA 4TVDA 2I17A 3OHXA 2AQWA 2H2PC 1XGQB 3QORB 4L4TD 5BVPH 3DHJA 3OR6B 1NDYA 4G7EA 3BQ6A 1JWSA 2PP0A 1Z66A 1UZ1A 2JLPA 2Q86A 3KS5A 1CN4A 5EH1A 3TEYA 3FUIA 4FO4A 2XVBA 1LQ2A 3MPCA 4JKPL 4TLUA 4H04A 1XD1A 4NAEA 1B0WA 4BEQA 2CESA 4YLQT 2NVDA 4MQ7A 2CBVA 5JHLH 3NDYA 3L3OB 4Q8QA 4YXLL 1WCBA 3WXVL 2XNAB 4F7PA 3SSJA 5CKGA 5EZJA 1T21B 3G08A 2W92A 1AH4A 2OCZA 4XNXH 2FEJA 3LKQB 3EMZA 3M17A 5D5MA 2HRWA 2ZX5A 1CGSL 2ZX9A 2VQ1B 4UAOB 1NSNH 4US5D 2FZDA 3EYSH 2P8MB 4Y5XB 1NPUA 8TIMA 1E15A 2A6NA 2EDEA 2GSHA 1NWOA 4MLIA 1TELA 2ZICA 2EZ0D 3CSGA 4G7YH 2NY4C 2AJVL 4LLUB 4KZ0A 3SY0B 5K9QG 2Y0FA 4B90A 2X70A 3MXWL 1DFBH 2DRUA 3NCBB 1HHKB 1A14H 3U4AA 2BTMA 4LVEA 1N4XL 4NBYB 3P0YL 2C1PB 4ZOBA 4V2BA 2F53B 4NQEE 4O13A 5D9MA 3HZMA 3H42H 2IMMA 3FQUB 5C08A 4TULL 4JRFA 3F7RA 4AD5A 2OQHA 4K5NA 2NUXA 5E99L 1SRDA 1S7RB 4JPKH 3FOLB 4O51B 5DJCA 1H09A 3P0WA 1H6TA 4A3YA 5DJDA 2W9EL 1KLUA 4Q4QA 4AVFA 1GAFH 1OP3K 3D69A 3MNMA 1KCBA 2CDEA 3PPSA 1ZJHA 4HA3A 2G2PA 5D2NC 4C1KA 3HAEG 3AI0A 3L95B 4GZ7A 3VFWA 2B4GA 2JEPA 2D7TL 2FEEL 2Y69B 4IM4A 4C6QA 5ESVB 2ZG2A 1IGYB 1O0VA 5LDSA 4PUDA 2F7FA 4P07A 1MDRA 2OLAA 5AY7A 3H2EA 3JWNG 3V0HA 3FA5A 3P67A 4P59L 4XD3A 4M3KB 1U3YA 1R9FA 1WAUA 4ZO8A 3PG9A 2Z64C 1A47A 4I5BB 2P80D 4P61A 1IWPA 25C8H 1MNNA 3OSVA 5AW4B 3TBWB 3V52H 5XIAA 5DYOA 3JV4B 2YYTA 5LAPA 5CJQH 1S7XA 1N68A 3UPRA 3Q01A 2MWCA 4BQ6A 3L08A 1AY1H 1QYGH 1BZOA 1GSKA 3AT0A 3LN5A 3OXRA 5JIIA 3RWFB 4DJMA 1UB6A 4G83A 2RHGA 3NFUA 4UMGA 3DG3A 4F33A 1H51A 4V27A 4MD5B 4IP7A 3WK0A 4IOTA 1K8XA 1XLJA 4A39A 4ERAA 3L4CA 3HFFA 5CC6A 2WTOA 2XV3A 3G1RA 1W1ZA 3D47A 4IKKA 4UOW0 5GZNC 2H9AB 4MWAE 4DBUA 3JZUA 4H5SB 3LI0A 3VFLA 2VLKD 4OCMC 4XBSA 5CGQA 2CIIB 1MH5A 1Z9PA 3QI9C 5J4MA 3BLEA 5ICYB 3IIXA 4I3RL 4ZUSA 1DORA 4XN1A 4IBTA 3OZPA 2ADGB 4X8CA 5H37H 1FFQA 3HKFA 1JN6A 4JRYB 4Z23A 1CTOA 1YECL 1DHKA 4I48B 4LCWA 4DZAA 4MDJA 1IAKA 4KK9C 5DD5L 4ZFZA 3AXLB 2BM3A 5D7LE 4FA7B 4PRWA 5CC5A 1MWAL 3G04A 4O1CA 1AZZC 4PRIB 5DANA 1NBYB 2OSLA 2P5ED 2WMPA 3LERA 1FGNH 3GXIA 1OCBA 5E0KA 3VDHA 2VDOH 3M47A 5IQOA 3QWQB 1RSCA 1KN2H 4L37A 1VCFA 1C8QA 3RTQC 1AKJA 1EWDA 2E67A 1PX3A 3GHRA 3M8OL 4JFFD 1RZKH 1TOXA 3DLQR 5D72L 1B57A 2Z1BA 3MLTA 5BOOA 1AMXA 3LNMA 4XBMA 3NZPA 1CPUA 3NEEA 4HN8A 1UEMA 3M44A 1KLGA 3C2FA 1RZ7L 4Z7IA 2ITCB 3W28A 3N85H 4XCFH 5ADPL 5FCSH 3N13A 3W24A 1P7HL 5AUMB 3T4CA 5L9DL 2HP4A 5ECJE 3G1HA 3O4LD 3QWOB 5H94A 1SDYA 3ZN6A 1NWTA 3T0EB 2WQDA 3WUEA 1W2KT 3VH8G 4K71B 2NUPA 4KMLB 1J5TA 4ERGA 4FEZA 5GGQH 1TPFA 3CXDL 1TPH1 2AJ3B 4DJFC 4UNVA 2B20A 5JLZA 3KPQA 2F68X 4HUKB 1OOAA 5AYIA 1PZ0A 4H1LB 4K0OA 4XWOD 1Z41A 3BPCA 2OODA 4HS6A 2W61A 3BRFA 2ICEA 3ESMA 2YDSA 3EH3B 1XTMA 2R69L 3MBXL 2LV4A 1BZ7A 4GQZA 4QXUL 1N19A 4I48A 2RQEA 3TURA 2KERA 1EZWA 1YXYA 4JZOB 1WUEA 3U2EA 2VE6A 1W1A1 4R27A 5LNDA 5C7VA 1A66A 5DA0B 4F2FA 2LTQC 2CZDA 3H2NA 4L4VA 3REQA 4PG2A 1QSEA 1SLUA 1PX8A 5C7HA 1U22A 2HVOA 1ZOXA 4J9JA 1CGXA 3LS5H 1UKSA 1HUVA 1S5TA 4I0PC 3QJOA 3S6CA 3MJ8B 3MCKA 3RBGA 3BW4A 3IS4A 2YOCA 4W89A 1KGCE 3GBML 4DAIA 4IMKC 1XRVA 4OCYL 2XQBH 5D96B 4ATTA 1A49A 1ZVYA 5CIPA 2ZONA 1B3XA 1N8IA 1YEJH 2VR7A 3IJHB 4MYWB 5ADOL 1GKQA 2LQRA 1OJXA 2ZRZA 2AJUL 1E4NA 4YX2H 3GNOA 1CIDA 2XUWA 2XIBA 2QQLL 5CJ8A 4ZUSB 3Q48A 5GGTA 5IW3A 4BQ9A 3OWRA 4PRHE 1DJGA 2PZNA 1R24A 2JB5H 2A83A 1GOQA 3UXFA 1ODZA 2A5HA 1DJXA 3INUL 4Q32A 5HWJA 5GRZA 4AEIH 4WU7A 3HA0A 1P6CA 1N59A 2J3SA 3FSVA 4N2AA 4OV6F 4ZO9A 5DJ6B 5IF0B 4JR9H 2B3RA 4U6HA 1XGEA 4ATLA 3N6YA 3A5VA 3I75A 5GGSB 3L5JA 4IM8A 1UB6B 4LSSH 1XZWA 1KPUA 1WZLA 3P69A 4WUIA 3RU6A 2EEXA 2VO5A 5DS8A 3UGEA 1GT8A 3G77A 4D0DB 1NDWA 2Y5EA 3E0FA 1KTKE 2JTYA 4BK9A 3PWLA 2E1WA 3SE8H 1J1XL 5T1LA 2ZQKA 2AV7B 2O72A 4KJPC 1KFBA 2FT7A 2JCCE 4XN2A 2MQ0A 4GMTH 1DBJH 3ZYOA 2PWGA 2VW4A 3FTXA 5ESQA 1NARA 1JN6B 3DGBA 3QORC 2QGYA 3HOGA 4H19A 3G6AA 1QOXA 5EOCL 1D7BA 3F4NA 4HWBH 4J3WA 1UHVA 4ENZA 4PJFB 5IHLB 4I13B 2WM1A 3O15A 4CMMB 3W74A 3LKSB 1QSFD 3MV8E 4M5TA 2MOQA 1KCVH 2EDYA 2DM7A 3SE3C 4GBXD 3VDBA 2PMQA 2DDXA 4EZLA 4LHUD 1DE4A 1E6JH 1PZ2A 5T3ZH 4MD0B 5LA1A 1RIHL 5CGYD 5EUOB 4PMNA 3PHSA 4LCWD 4Y2DC 1RV6X 2XISA 1HIMH 2YKKA 4R26H 3TGXA 1B3WA 5ECVA 3MRHB 3DGGA 4L3EE 1WXZA 4P2QE 1VACB 1YC7A 1G4PA 3D48R 2PU1A 2ZUNA 2ZOKA 4Q74A 2GAZA 5CBIA 2P44B 4OD1L 1OF2A 3VG9B 1MSSA 1P6BA 5F2IA 4NS0A 4Y16B 1IC7H 1G7MA 2E6PA 4ZPVA 2WJZA 4XHQA 2N0MA 3K6DA 1JS4A 1T5KA 1K77A 4LLWB 4NQUA 3UPCA 3DUSA 2LLLA 4I2XB 1GOMA 3NZHH 5L6YL 3AC0A 2QR6A 2RFGA 3OX8B 3QHNA 1JPTH 3U2IA 4MADA 4PCNA 2G60H 4C55A 1US3A 2ZKXA 1NANI 2OMZA 1TR7A 4P4KC 3EBHA 3FSOA 5KJ4A 2EHHA 2CLEA 5E8EA 1J8RA 1XB8A 2F18A 3LOWA 3K71B 1WS7A 2YEZA 2E8ZA 4N0FB 2RFXB 2RD0A 4NO0D 4YIQA 4CKVX 1EJ8A 1GW1A 4ELME 1R0AH 2OEKA