3L4TA

Crystal complex of n-terminal human maltase-glucoamylase with bj2661
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
863
structure length
855
Chain Sequence
NELERINCIPDQPPTKATCDQRGCCWNPQAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 855
sequence length 863
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4tA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4tA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4tA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4tA01
2PF0A 4NI3A 4NZFA 3FY1A 1JI2A 3OB8A 5BCAA 4R27A 1I1WA 3IANA 2BY3A 3AIWA 1CGWA 2AOSA 3ZR5A 3AHXA 1AQ0A 3SURA 5EB8A 1V03A 3WEZA 1UA3A 3L4UA 1TG7A 3WDQA 2X1IA 1BSIA 3LRLA 4MDOA 3RM9A 4XUYA 2VRQA 5HNNA 1CGXA 2FDMA 3W0KA 3AICA 1TMQA 1XGZA 2FH8A 1E55A 3CUHA 3MUZ1 5BXRA 3L2LA 1PCPA 3GXFA 3VIGA 5A6BD 5A6JA 3A21A 1UR9A 4E8DA 3ZT6A 2VX5A 3W29A 3NSMA 4ZXOA 4UNIA 3LPPA 1H49A 1SZNA 1Y7VA 5LA0A 1DWFM 1RPKA 3SUSA 3A6OA 8A3HA 2ESCA 1L8NA 3AOFA 3JUGA 1PX8A 3HG4A 5DFAA 3H55A 1R85A 1E5JA 4HA4A 2PWGA 1SMAA 2PBGA 1Q6CA 1TZ7A 2W61A 1G5AA 4F79A 4H04A 3WF1A 1EDGA 3LXAA 5I6SA 2WSPA 1ITXA 1WAWA 2BHYA 1V3LA 1VFFA 3HG2A 1VJZA 1EHAA 2VURA 3OZPA 1QI3A 1FFQA 3F4VA 5EMYA 3BAYA 1FOBA 1GOQA 4KMQA 5A8MA 5I79A 3N1AA 3BVWA 1JD9A 3OIHA 1QI0A 4M82A 2X2HA 3CIVA 1JF6A 5DT5A 4PN2A 3NJ3A 2PI6A 1FFRA 4KRUA 4BF7A 1W1YA 1KB3A 1NP2A 1O7DC 3CGTA 1XC6A 4QLJA 5GQBA 1E3XA 4TXEA 1WZLA 1NOWA 5A94A 4FNRA 1EXPA 4H8HA 1E1EA 3BUPA 2XFRA 2DH2A 3WUFA 3SCPA 5LA1A 4BS0A 5HXMA 2WVTA 4XV0A 4GO8A 4ZENA 3KL5A 4L4OA 2J4GA 3A4WA 3U7VA 4MB5A 2HVMA 3GDBA 1EH9A 3LRKA 4GI9A 1K9FA 1U33A 1HL9A 1W9UA 1V6UA 3SUWA 2DIJA 3BVVA 2VQTA 3MANA 2ZX6A 3WD0A 1E71M 2VZTA 5E70A 2VT0A 3EYPA 3THCA 4UOZA 1M01A 1JI1A 4UQEA 2C0HA 1VAHA 2WMHA 5M03A 2GDVA 1TCMA 1J11A 1ISYA 3AHVA 5CGTA 2VC9A 1UD4A 3CUGA 4ML4A 2F7QA 4GZJA 1E4MM 4DO6A 1KGXA 4DWSB 4HA1A 3BAXA 4FLSA 1LWJA 3ARRA 3BUIA 2QLYA 1BGAA 1KFWA 1H11A 3WH9A 4JCLA 5FOOA 3AIBA 3H53A 1G94A 1CGTA 3SCQA 4Z2JA 3PZNA 1UA7A 2ZXBA 5IHRA 2CETA 3G6LA 2GK1B 2XM1A 1V3JA 1GUVA 3FNDA 1HT6A 3CZJA 1V3MA 1C8YA 5E0CA 1CLVA 3WDPP 1TE1A 3EMCA 3WENA 2VTFA 1JD7A 4ZE5A 1MW2A 4EK7A 3LXCA 5LA2A 4DUWA 3WF4A 5ABHA 2WM0A 3WD1A 4F66A 1VENA 3WL1A 1V6YA 1C90A 4NF7A 4Z2IA 2WHMA 2ZXQA 2WVVA 2CBUA 1WDPA 5E0FA 4LQ1A 4HZ8A 1R7AA 4JHOA 1EOKA 2VUYA 1E0VA 2YBUA 4YN5A 1QNOA 3CO4A 3NSNA 4NZJA 3VSUA 1OT1A 2JFEX 1MFVA 5CQ1A 2Y4SA 2E9LA 2DIEA 4U5KA 4TVDA 4F9JA 4AZ5A 1R87A 2DQXA 1JG9A 3OGVA 4M8UA 2D0GA 1UWSA 1GPFA 2DDXA 2ZIDA 2XTKA 3TTSA 1DEDA 2EO7A 4JIEA 1CECA 3W4RA 3D3AA 4PMUA 4QLKA 2CNCA 1JFHA 4KH2A 5JIPA 1C93A 3S2CA 2FHBA 1Q6EA 2ZXAA 7A3HA 1WZAA 3WNKA 1UQZA 1DWGM 3WH7A 4AZHA 2X0HA 3WF3A 2JF6A 2XN0A 2VVNA 4CCDA 3L4WA 2DT2A 1IZKA 3EJQA 5GPRA 4X0NA 2A3BA 5IHSA 4PYSA 4AYSA 3VNYA 4W87A 1GHSA 2J77A 1BLIA 2ZX9A 1NWSA 5E6ZA 2WC4A 2A3AA 4PTVA 4QDMA 1JZ4A 3GTNA 5A8NA 3T0DA 2YFOA 2Y24A 2XVKA 1DHKA 3UR7A 2J75A 4W86A 3AYSA 2CPUA 2EAEA 4P7NA 2BHUA 4WSKA 3RDKA 5BXTA 1VRXA 3EMZA 1V3KA 3PTMA 5I23A 4NXKA 5I2UA 1X1NA 3PZVA 1MXGA 1C92A 2YDQA 5DF0A 1KTBA 2EPKX 3B9DA 4CVWA 1UHVA 5BWFA 1CIUA 2WLZA 2WMGA 3NIYA 4XZBA 2WMIA 5CG0A 1J9YA 4JCMA 3VDBA 3RJXA 1CGVA 2XSAA 3GH7A 2V3DA 3VSTA 4WK9A 1B1YA 2J62A 4FF5A 5AYBA 1QWUA 3AIUA 2W5FA 4CD5A 5HBFA 1DTUA 1GOWA 2XGIA 3BCDA 3OLGA 1OD8A 4TX8A 3IJ7A 1W3KA 3MKKA 1E56A 3FHAA 3VIJA 3ARZA 4QCEA 1QNPA 1G01A 4FLRA 1B90A 4AD0A 4J28A 3PZGA 3MUY1 2FHCA 1B31A 3KL0A 1QNSA 3K8MA 4MB4A 4ATDA 1ESWA 2FYVA 1QHPA 3UCQA 2D3NA 1TUXA 3GBDA 2DT1A 1E0XA 2ZWZA 4CN4A 5C70A 2ZUNA 3TOPA 4CN6A 3PZ9A 3M07A 1BYBA 3UEQA 2D1ZA 3CZEA 4GPNA 3GNOA 5C71A 2W91A 1GORA 2UY5A 1CZ1A 1UKOA 3DECA 1GHRA 5A8OA 4PEEA 1NP0A 3N9KA 3VD5A 1BG9A 2ZX5A 2DSVA 2CITA 5AY7A 2NT1A 1BG4A 3CHDA 3OLDA 1UR4A 4M56A 1O6IA 3WQ8A 1Z32X 3KWXA 4S3KA 3CMGA 2E40A 1IZJA 1HJVA 4PSPA 1VIWA 1G0CA 3EDFA 4DO5A 1ZBKA 3WBAA 1OGSA 1GOOA 3ECQA 3WDJA 5CXPA 1U2YA 4OKDA 2PSPA 5AYIA 1BGGA 1HJXA 3AHYA 2OWCA 1R8LA 5EFFA 4QCFA 1NQ6A 3MSDA 1KR0A 3W27A 4AD1A 3RIKA 4AEEA 2OWXA 1XD1A 3BVXA 2XPKA 3W82A 1JDCA 5A6AA 3AJ7A 2E9MA 3CLWA 1UH3A 4CGTA 4BQ3A 2OSXA 3CUIA 1UD3A 3F5JA 4IISA 3N17A 1M03A 3VD3A 1CGYA 4CD4A 1LG2A 1EA9C 2XUCA 4V27A 1MW3A 3EDJA 2PWEA 1ITCA 3DX4A 4W7VA 2BY1A 3PZUA 1KBKA 2X05A 1QBBA 2Z1KA 1ISXA 4TTGA 1E1FA 2CESA 3BCFA 1V3IA 4D6GA 4U3AA 3WQWA 1MQRA 1XH2A 3S5YA 2F18A 2WKGA 1WDRA 2XVNA 4U31A 3A22A 1DWJM 1AVAA 3GXIA 1X6NA 1VFUA 3IJ8A 4IPLA 1UKSA 3F5LA 4XZWA 1RH9A 5I24A 3AZSA 1HKKA 4HMDA 5I5RA 2X0YA 3RILA 3O6AA 3BAJA 1ISWA 2VI0A 4BCEA 1WPCA 2W66A 4CD7A 1PZ3A 1QW9A 3D4ZA 1HTYA 1WE5A 1CXIA 3AROA 4J3TA 4AIUA 3ZJ6A 5GNZA 4UQ9A 1PJ9A 3VUPA 3FAWA 1OBAA 3BMVA 1D7FA 5AC5A 1JFXA 4JKMA 3VDCA 3I3BA 2VL4A 2GUYA 2YA0A 4BZYA 4LYRA 2CHOA 3VILA 4U2ZA 4AZ6A 2Y5EA 1H0IA 4ZFMA 2FH6A 1V02E 4LPCA 1EQPA 4RL3A 1MVYA 3WNMA 2CBVA 4BA0A 1HJSA 4MPKA 3SUUA 4U2YA 2BVDA 1BAGA 1QHZA 3EDKA 3OGRA 4CU7A 5CLTA 4FMVA 2MANA 2AAAA 3BH4A 1B3XA 1HJUA 3AMGA 1FH7A 4MB1A 1CNVA 2ZOXA 3MI6A 4LGXA 4PMDA 3BUQA 3SCSA 1XSJA 4D6CA 1NOUA 4C7FA 1XCXA 3F5KA 2F7RA 3SCWA 3T2OA 1GQJA 1JZ7A 3W26A 2J7BA 1NARA 3FAXA 2F61A 1TQWA 1E6QM 3PTKA 2O9TA 2VR5A 2UY3A 3HN3A 2DSKA 4S3JA 1ZBWA 2ZUSA 4GZEA 3VX0A 1HNYA 1E4IA 3GYCA 3PN8A 3J7HA 2VOTA 1AMYA 4PSRA 1ZU8A 4R5EA 4GIAA 3D50A 2CERA 1SFSA 4MADA 4AC1X 2QF8A 2D3LA 1JZ2A 3ZO9A 1D3CA 1QVBA 3G6MA 3K46A 1BVNP 4CCEA 3KE0A 5A6LA 3ZSTA 3TTYA 3VD9A 3N13A 3O2LA 4H41A 2Y2WA 1OD0A 1RD6A 1W1PA 2CXGA 3BAKA 1A3HA 4C7GA 4UZUA 1PX3A 4AD4A 1LL6A 1W9VA 3WD2A 4HZ7A 4OJYA 1E72M 1OINA 4EKJA 2D23A 4N42A 4OUEA 4BQ4A 5JBEA 5GNYA 1QWNA 1RP8A 3WDHA 1FHDA 2FHFA 4CD8A 1HKMA 1HKIA 3WMCA 1P6WA 4ATWA 1U30A 3A4XA 3VX1A 4V2XA 4DUVA 3VD7A 4C7DA 2BVTA 1EIBA 2WMFA 1TA3B 4E4PA 3BMWA 3D52A 4DWSA 1TR1A 4IM4A 3GNRA 4PMVA 3WNPA 1KCLA 3L2MA 3ZM8A 4DUXA 1W9XA 4WKHA 4DO4A 3UR8A 2YA2A 1JYWA 4EE9A 2ZE0A 4MDPA 1JZ5A 3T0BA 3UG5A 3WH6A 3PZIA 3W24A 2O9RA 1J0KA 1JZ8A 2GK1A 2XN2A 2YLLA 4AZ7A 2OSYA 2G3NA 2G3JA 3U57A 1K6AA 3VIFA 3OLIA 5CZKA 2BV9A 2OW6A 2F1BA 1G1YA 1QOXA 3SEPA 1GZJA 1CGUA 3DX0A 1W3HA 2DEPA 5A69A 4Z2LA 1R7OA 2NSXA 2D24A 5A2AA 2W4XA 3OLEA 4MNMA 3WQ4A 1LLOA 4HPHA 5I0DA 2XG9A 3VGEA 1UWQA 3DX2A 1OCQA 4U3CA 3ZR6A 4PCSA 1V08A 3SCVA 1ZB5A 3VMOA 5E1QA 3ZSSA 1F4HA 1TQUA 1W1VA 3B8SA 4PMRA 3PZTA 4D6FA 1CPUA 1KQZA 3AMKA 2WCSA 4KWUA 1V3HA 1QI2A 2C7FA 1W9PA 3WD4A 4J3UA 2UWFA 1JYXA 3W6MA 1S46A 1MW0A 3S5ZA 3VO0A 1KCKA 1QW8A 1UD2A 2XSBA 3LX9A 4F9DA 3QHOA 3W81A 3QOMA 3K8LA 4UOQA 2VVSA 4W7UA 5BRQA 5KZ6A 2VX6A 1AQHA 1MQPA 3BUDA 2EBNA 3L4ZA 1K9EA 2G41A 3BVUA 4D72A 1GCYA 4TTUA 5ABFB 4HOXA 3PBGA 1HI7A 2WB5A 3M46A 3UESA 2B31A 4KGLA 3AIVA 2UY2A 4Z2KA 1JF5A 3AIRA 2RGLA 1FH9A 1KBBA 1NWUA 3WBEA 4PRWA 5A3HA 1CENA 1BFNA 2WKLA 1EO5A 3K4DA 5ECUA 2J79A 3AMLA 1J0ZA 1DP0A 1KWKA 3RPMA 3MSGA 4UQDA 4FNSA 3GM8A 2JIEA 3LPFA 1H1NA 1VBRA 4PUDA 1US3A 2XYLA 4K68A 2VRJA 9CGTA 2IXUA 1V0KA 2D20A 2WZIA 4PMQA 2BS9A 1CXKA 4MNJA 3SCRA 3FHQA 1PSPA 2QPUA 1VEMA 4UFMA 5BYWA 4PMYA 3AS2A 2DT0A 4UFIA 1GVIA 1FA2A 1FHLA 2BXYA 2EPNA 2VMFA 1KXHA 4AZCB 1CXLA 2VZSA 2WHKA 1C8XA 3QOKA 4TUFA 3ZJ8A 2V5DA 2FE0A 1HP4A 1TVNA 4NRSA 2YJQA 1UR8A 3OA5A 1JAEA 3LPGA 2F7PA 4FK9A 1AQMA 2ZUTA 4OBRA 2CBIA 3TP4A 5IDIA 2OYKA 1GOKA 2QMJA 2C8NA 2XN1A 1W2PA 2WHLA 2BVYA 3WMSA 4AD3A 4HZ6A 3SUTA 1LG1A 2WC7A 1JDDA 3VM5A 2WK2A 1KGWA 1J01A 3RO8A 2RGMA 1B9ZA 3HG5A 1K9DA 1BYDA 2XHYA 3BSHA 1JYVA 3CZSA 1W32A 2Y8KA 1E9TA 2VQUA 3RM4A 4DM2A 1PIGA 3T09A 3CMJA 2W63A 4CCCA 8CGTA 4Z2HA 4GINA 2PC8A 4MNKA 1EDQA 2WANA 1CYGA 1TQSA 1V6WA 2YBTA 4CUCA 2X8RA 3AMDA 3VGDA 1CLXA 2D73A 3OZOA 3L4YA 2VZOA 1GJWA 4J3SA 4HMEA 4W7WA 3VIHA 1EQCA 1H5VA 4W88A 3THDA 3ZIZA 3EJTA 3N04A 3MMDA 3WUGA 4OBSA 3GXNA 1QI4A 4FNTA 2YFNA 2IXVA 1VF8A 3TTQA 1XV8A 1HF6A 3I3EA 3A24A 2QV4A 4D1JA 3K8KA 2CKRA 3MS8A 3D51A 1JNDA 3MU7A 1UR1A 3AS3A 4NZCA 2EACA 5A6MA 1KXVA 3B9EA 2ALWA 5CLWA 3SUVA 5ABEA 2JIWA 4AD2A 3H54A 4H8UA 2V5CA 3QHNA 2VZUA 2VNCA 2ZXDA 1R86A 3KLKA 4GO9A 2W62A 4ACZB 3QGVA 1C7TA 1ODUA 3W37A 1CDGA 3AHTA 1HWWA 1B3VA 4AXNA 1UZ1A 4W84A 1OM0A 2XJ7A 2ZICA 2PB1A 3VIKA 1JDAA 3ARYA 2WLYA 3EJPA 3VSVA 4N0RA 3VMPA 5E9AA 2JF7A 4AW7A 1LL7A 3WQVA 3L4VA 5I77A 3B9AA 1FP9A 1E15A 1HXKA 5I78A 4A3YA 1GQKA 3QHMA 2G3IA 2GJPA 1PS2A 3VIOA 4HOWA 4JFUA 1EOMA 2VCCA 5M17A 2NT0A 2E4TA 5A2BA 1KWGA 2V38A 3SCNA 3BVTA 1KQYA 5CPSA 1ZS2A 4GQRA 1TVPA 4GI8A 1GQLA 1A47A 1WO2A 4H8VA 2DGAA 1XH0A 3VNZA 2XM2A 2A3EA 2XWDA 3VDHA 4XB3A 4KGJA 3PZQA 3WIJA 2NW0A 3WQ5A 3VU2A 3WUEA 1E6XM 1MXDA 3M6DA 1TFVA 4KRTA 2VR4A 2QHAA 4ZEPA 3AZRA 4HU8A 4B16A 1UD6A 2G3MA 1D2KA 5FIPA 4D6EA 3T0AA 3OG2A 3RCNA 1B2YA 4ACYA 1UWTA 4P8UA 3II1A 1E6SM 4UFJA 1HVQA 3AS1A 4MAZA 3WY3A 2WNWA 4JKKA 1EGZA 5FL1A 1XHGA 2X2JA 1JXJA 1EHNA 1XSIA 1SYTA 5IXEA 2UY4A 3NDYA 2PBOA 2Z1SA 5CSYA 2J8FA 4J3XA 4IUGA 3EDDA 3AFBA 3WH5A 1GVYA 4M24A 3ZQ9A 2WW5A 3ZMRA 2XFYA 5DMYA 3BGAA 2O9PA 4MTVA 5HOSA 1VBUA 4WSJA 4NRRA 3A47A 1MYRA 2ZX8A 3DC0A 1E70M 3NUKA 5JUVA 4A4AA 3S6TA 6CGTA 3RMEA 1VEPA 2JEPA 3BSGA 2DPEA 4HA3A 4F8XA 4PTMA 1YQ2A 1UWIA 1PPIA 2XGBA 3I3DA 4TVUA 3MMWA 2BXZA 2CBJA 4P7RA 1DWHM 2QMKA 3EJUA 3TA9A 2VCAA 4W8LA 5BXPA 3VDAA 2EABA 2AMGA 3WEOA 2D0HA 3WFZA 1C3FA 5I3DA 4Y7EA 1E0WA 5A6BA 2YDRA 4W8AA 3GXDA 3VPLA 1XSKA 1JAKA 3DYMA 3HG3A 3CBWA 2BY0A 3PZOA 4PTWA 4LYPA 4J7RA 2ZUVA 4URIA 4H2CA 5AC4A 5CJ5A 1M7XA 4V28A 1ECEA 1XCWA 1HJQA 1JNEA 5LYRA 3N11A 2VZVA 3MUIA 1BYCA 3KL3A 5FD0A 3WEMA 2A3CA 1HX0A 4UFKA 3MV11 1QHOA 4FNPA 4OGZA 3WKZA 4B3KA 3ARUA 2WYSA 3TONA 4PMZA 3PTQA 1XD0A 4AYGA 2J78A 1J0JA 1TA3A 2WZHA 4JL1A 3WL0A 4MJ4A 1CXHA 4CD6A 2XVPA 2GJXB 1PZ2A 4NX0A 1KTCA 1GJUA 1E6NA 2WWCA 2XFFA 5KEZA 4D6DA 3W38A 4B9YA 2F8QA 1G9HA 3CUFA 3DYPA 4P8WA 2EPOA 2DH3A 4OZOA 1O7AA 4BQ5A 5A1AA 3IJ9A 1M04A 5EFDA 1OB0A 3CPUA 1WDSA 1UD8A 2E9BA 2WMKA 4PUEA 3N12A 2O92A 3GZAA 1E6PA 3DYOA 4TVCA 3O9NA 3D4YA 3VIPA 5E09A 1XRVA 3WDIA 2YL5A 1WP6A 1DWAM 1MFUA 1SMDA 4JZ5A 4UOJA 5HPCA 1Q6FA 1R75A 2WXDM 3ARQA 1W3JA 1XYFA 1HN1A 3N15A 4PMXA 2BHZA 3QR3A 5D4YA 2CYGA 4UZSA 3GH4A 1ZBVA 3GXPA 2IUZA 3SCUA 2VX7A 5BROA 2WCGA 2CHNA 3BLBA 1OT2A 5CGMA 3W28A 4HTYA 1E73M 2XIBA 2OYMA 3T08A 4UCFA 3BAIA 1B3YA 2EPMX 1J12A 1GOMA 1E6ZA 4D6IA 5CPTA 3MV01 4Z2GA 3VM7A 3CHCA 5A6SA 4AIOA 2WWDA 4JKLA 1JL8A 1OIFA 5A8QA 1IV8A 3EJRA 2BFGA 3LXBA 1UWUA 3AXIA 5ABFA 1UQYA 1W3LA 3CH9A 1LQ0A 2V3EA 3AXXA 1C7SA 2EXOA 3ARXA 2WBKA 1WNOA 1KXQA 1PS3A 1H0GA 4JFTA 4AZGA 4HU0A 4WIWA 3CC1A 1B30A 3ALFA 4Q22A 2F7OA 1PBGA 1UR0A 5D9MA 4EANA 4HPGA 3VGGA 2G8ZA 1JYNA 4PCTA 4AD5A 5FL0A 3FW6A 3EBVA 3T2QA 1EO7A 2ZWYA 3CZLA 2OWWA 4AMWA 1X6LA 2QPSA 3GXMA 1DWIM 4CKQA 2JE8A 2YIHA 4GKLA 2E8YA 1H09A 3E1F1 1JGIA 3WUBA 2V3FA 3AIQA 1V02A 5FKYA 2OW7A 4D1IA 2FGZA 5ABGA 4NXSA 1BYAA 2J7GA 1CTNA 4QLLA 3VTRA 1WZKA 4XX6A 3KZSA 4GXPA 1CBGA 3W6LA 3MMUA 1W91A 2Y8VA 1ZJBA 1OSEA 3FN9A 3HU7A 4GQQA 2J7EA 4DWSD 4JHZA 4AEFA 2J7DA 6TAAA 1TQVA 2WPGA 1N82A 3TV8A 3VGBA 2PWDA 1W9BM 1MW1A 4A3HA 4LXFA 3BAWA 3LPOA 5DT7A 4JAWA 4AZCA 3CTTA 2YL9A 2VRKA 1QNQA 2DSZA 4M80A 3W53A 4W93A 1H41A 3WNLA 2HISA 3OGSA 2Q8XA 3ARWA 3VVGA 7TAAA 2E0PA 5FCZA 1R34A 4J27A 4HMCA 2X2YA 5DEZA 1ISZA 3APGA 3BXWA 2JALA 1VEOA 1C8QA 4OOUA 1JXKA 1UH2A 1ZL1A 1HKJA 2YA1A 4AZBA 1SR0A 5D8ZA 1US2A 4FNUA 2WZEA 4W89A 3D5HA 3ZOAA 5EBAA 1HVXA 5E6YA 1ZBCA 2EADA 1WKYA 1LWHA 2ZUWA 5A6KA 1OGGA 2IGTA 3POCA 3CV5A 3M7SA 4AMCA 4IPNB 1BHGA 2DSWA 3FXYA 1MWOA 2WAGA 4UTFA 3WNOA 1HXJA 1NH6A 1ODZA 2JEQA 4L4PA 1R33A 4EAMA 3DHUA 3K1DA 1YHTA 1C91A 3NSXA 1FH8A 1R47A 2YDSA 1UH4A 4B15A 2DT3A 3NCOA 4AY1A 3CZKA 1V0NA 3VIIA 4FLOA 3TTOA 4J3WA 2D0FA 1UWRA 2GSJA 2W67A 3WQ6A 1WB0A 3SCOA 2YL6A 2GJRA 3ZT7A 3ZJ7A 3VMNA 3ARTA 1HP5A 1OIMA 2WMJA 5M3WA 2YOCA 4FNQA 4MJ2A 2TAAA 3IAPA 3A4AA 1GW1A 4OOZA 3W25A 3WELA 4MNLA 1NM9A 3AI0A 4P8VA 1HL8A 3POHA 1PEZA 1JZ6A 4CVUA 3AIEA 3EMQA 4J3VA 4ACZA 1BVZA 1JIBA 3GXTA 4W85A 2WVVB 1QPKA 1PX4A 1B0IA 3GBEA 5BRPA 3DDFA 1V6XA 1ZJAA 3OBAA 3SCTA 3BLKA 1VB9A 2W92A 1UYQA 1W1TA 4QAWA 5CSUA 1J0YA 3BUBA 4Q7NA 2OLHA 1E3ZA 2BY2A 4QP0A 1BTCA 1NWRA 1GONA 4UQCA 1K9TA 5F7UA 2J7FA 4LYQA 4P8XA 3T2PA 5IFTA 1VFMA 3ARVA 3KLLA 2WCAA 2OSWA 1PIFA 4PTXA 2WVUA 4E8CA 4MB3A 1CXEA 2YLAA 2X09A 1TQTA 3EDEA 3AS0A 3AMCA 3L4TA 1J10A 1GNXA 2V3GA 4QFUA 3NYDA 3BC9A 1F4AA 2A3HA 1EDTA 1BF2A 3UETA 4YHGA 4AISA 2EJ1A 1V0MA 3GH5A 1CXFA 3NDZA 1QNRA 1VJSA 2E8ZA 2G4FA 2E3ZA 1XH1A 1R46A 1V0LA 2F2HA 4UR9A 1CEOA 2CCRA 1UKQA 2J25A 1E5NA 3VIMA 4ATLA 3IGUA 1CWYA 4JFWA 3RJYA 2D22A 3CUJA 1VFOA 1L0PA 4BQ2A 4UQBA 3LMYA 3SIMA 1KXTA 5A8PA 1XYZA 4WLCA 4U5IA 1HJWA 3DDGA 3A23A 2VJXA 3U5YA 2CIPA 2F1AA 2XVLA 6A3HA 3LRMA 5JIWA 4AZIA 5CPQA 4TX6A 3PZMA 2WMIB 1H2JA 3AISA 3DHPA 3WF2A 3CZGA 4P7OA 1H3GA 5A2CA 4D71A 2J74A 3WNNA 2YL8A 2EPLX 2WBGA 5C8BB 2VO5A 4OIFA 4HOZA 4HP5A 4UFLA 4MAVA 4X9YA 3WY1A 1HIZA 2EEXA 3CZNA 1LJYA 4NSBA 4PBGA 1GOIA 1E4NA 4JL2A 4AMXA 1NOFA 3HJEA 3CHEA 4CU6A 1UD5A 1UZ4A 2WVSA 2CEQA 3AZTA 4ZE4A 3ZJKA 2CKSA 4D6HA 3U7BA 2ZUUA 4AWEA 2PWHA 1MQQA 3A5VA 3VGHA 3GNPA 4YPJA 5HDRA 3AHZA 4M1RA 2PWFA 2J47A 1FP8A 3CHFA 4JFVA 3U5UA 2J7CA 4WF7A 3VOCA 1WDQA 3ARSA 5BXSA 2XVGA 4DM1A 2YKKA 1UOKA 1M53A 3PHAA 4JFSA 2GDUA 5HPOA 1BQCA 1W9DM 4ZXLA 1UUQA 4GZIA 1WCGA 1RP9A 1UASA 7CGTA 1UG6A 3DX3A 3A3HA 2WSKA 5A95A 3WN6A 3EJSA 2XIIA 3MUAA 5D9NA 2GFTA 4U33A 4PMOA 1PE31 1IT0A 4PMNA 4RE3A 4H7VA 5DO8A 1ISVA 1Q6DA 3VD4A 4D6JA 3K4AA 2D2OA 3WY4A 4WKFA 1E9LA 1LL4A 5JBDA 3IK2A 4M29A 5D9OA 1WZMA 2VX4A 2GVYA 3DX1A 5IFPA 3IAQA 4WKAA 4B9ZA 3WY2A 4UQAA 1V6VA 4W8BA 5GNXA 5JBFA 3VGFA 1J0IA 2ZUMA 4UFHA 2GJXA 3MO4A 1UKPA 2VCBA 1B3WA 1E6RA 3WFLA 2XWEA 4X0VA 4YHEA 3WMBA 3WDRA 1JZ3A 1E43A 1QX1A 2ZX7A 3WH8A 2WC3A 1OGBA 1Q4NX 1UKTA 4DWSC 4TOQA 3VKKA 3VINA 3UERA 2J8GA 4AIEA 1E40A 1PAMA 4LX4A 1BPLB 5M5DA 3BLPX 1B3ZA 1QI5A 1LF1A 2WHJA 3WSUA 3ALGA 1NWTA 3AQUA 1H4PA 5D8WA 3AXHA 4B3LA 2EQDA 2O9OA 2BNJA 4GI6A 4M81A 3UG3A 1QBAA 1Q6GA 3ARPA 5D9PA 3ZT5A 4E2OA 3L4XA 3CZ8A 1OWQA 4W5UA 3N18A 4W5ZA 4CU8A 4RE4A 1KGUA 3HZ3A 1J18A 3KEHA 2X2IA 4CN1A 3UG4A 1GQIA 2FGLA 2DSUA 1UR2A 3WF0A 1I75A 4P7LA 4P7QA 1E4LA 4FLQA 3WD3A 4RE2A 2J7HA 1W2VA 5TD4A 3AYRA 3RM8A 3HMCA 1J0HA 4WJXA 1T0OA 1I1XA 2OYLA 1KR1A
chains in the Genus database with same CATH superfamily
3PNZA 1ME7A 2M2DA 4PUNA 1CE6A 3P4OA 5E2VH 1DCEA 3HBZA 4HJUA 4QXWA 5HYJE 4LKCB 3HA1A 4AFYA 4HOMA 3O1NA 1M71A 5HNNA 1K8DA 3RVVD 1QP1A 2G0LA 3KWVA 4P23C 4MLIA 1ZLUK 4MA8H 3DETD 3EO0B 4OM1L 3IJDA 2AXGA 2Q8ZA 3BJTA 4MD0B 4KKAD 1DWFM 3ZW3A 1UG9A 5CJXA 4HA4A 4LBEA 4GISA 1QFPA 1OEZW 5B7FA 5HP5A 2WYTA 3OZPA 1G6RH 1NCWL 3AZUA 4JTFA 1BZDA 4X98A 5FO7A 3UAAA 2PCFB 3NJKA 2FGWL 3O3DA 3OAYH 3A64A 3BSZL 1VC4A 5FJTA 1U8JB 5LWYH 2RFXB 1SU5A 3A9BA 3URAA 3EGDA 4PRAB 1MCEA 3LI1A 1WZLA 6XIAA 3HI5H 4H8HA 3MNZA 1NMBL 1OZQA 1LLZA 2Y70A 4R7OA 3KPOA 3C09C 1GGIH 3O6YX 4KUZL 2JKTM 1DVFD 3WE1A 1B4EA 3LRKA 4PJEB 4GT0A 4DYJA 3WLSA 1L3NA 1SHXA 4XBMA 4NC1E 1NGZA 1VAHA 2L4OA 3MRJB 2EH7H 1KKRA 3BT0A 3NJNA 1EGMA 2N7SA 2ETWA 1O5RA 1GGYA 2IOOA 2IAMC 1CD0A 4P2RB 1AL8A 4EI0A 4ELDA 4R4BB 3EEGA 4JQAA 1H0DA 2CRZA 4FOUA 2CLRB 2XFXB 2GK1B 3HFTA 1CI1A 1NFDA 3JYCA 1JXDA 2A73B 3EAUA 5DJYA 3HAEB 3I9GL 1WX0A 1BF6A 4IG2B 3IE9A 2IBBA 4JRLA 5LA2A 1K7EA 4F2FA 2DDQL 3GMQB 3C8HA 3ULVE 3AT0A 5AAMC 4YXGA 3BQUA 2WXOA 1DVQA 4YN5A 3CO4A 3ZDXF 1JWMB 2VOMA 4YBHA 1DE5A 1XGPA 1T5XA 1Q0YL 2A38A 4QRPE 3HB9A 5J4MA 4Q52A 3DMMA 4F2ME 2D2HA 2B3IA 1SZRA 3TO2A 4HPJA 3CFUA 1BBDL 2B7OA 4MDRA 1OVZA 1CFMA 3FXGA 4JQ3A 3O3BB 4B6ZA 1AZZC 2OJPA 1DJIA 5HGAA 3HPLA 4OCYH 4KVPA 1FL5B 1V3KA 4MMXC 4QT5B 2YAEA 1IWAA 5JHLA 2CHXA 4D9QD 1S7XB 4AIXA 4YTQA 1B0RB 2WMGA 2G2NA 1W2KT 2XSAA 3QJAA 4XMVA 3REVB 2O5XL 2V3DA 4NNYB 4IFRA 3FPXA 1REQB 3C0SA 1IAOA 2JQMA 5FF0A 4HK3N 3BLLA 5HDWA 4RQQB 2AKRB 3C9NA 3V0WH 4MCYA 3C09B 3P4LA 3W83A 1TOXA 3IXTA 1HQRB 3ZDXB 1GPWA 3V5HA 4O2FA 3K8MA 4U4MA 3U6XS 3R2GA 5H35B 4JDVB 5G2HA 3SJVB 4MKSA 1FNLA 1TPFA 5I15H 1HQ4A 3GBDA 2DT1A 1CQYA 1OP3H 2CJUH 4GFXA 4LL1A 2X9ZA 4HK6A 4WHTA 1P9MC 5C9ZA 4PVMA 3RIAF 2A9ML 4GAJL 4GBXB 3BO8B 3UJTL 2RD0A 4RAVA 4IH3A 3ENLA 1KFEA 1MNUL 4YFLI 1EYWA 1DO5A 5DQ9A 3NIDE 3S48A 4PS4L 1IVTA 3QDMB 2FZNA 2NT1A 3CHDA 3T05A 1G4RA 3CMGA 1RJLA 3DIFA 4XZMX 1OGSA 1OO2A 4O02L 3ECQA 1OK8A 4ZBJA 4ANUA 2HG0A 1HGWA 4R84A 1OB1B 2X40A 2PP7A 1XLJA 4IRJB 2BCKA 1KG0A 2PU1A 4JKWA 3BLFA 4P99A 2E9MA 2NLYA 2OJEB 1NC2B 5C9JA 1IZCA 5KJRL 1AZBA 4FSAA 1JPFA 4J8RA 5CAYB 5MP6L 3DHMA 2ICWA 3CIAA 1ISXA 2CESA 4D6GA 5LB1A 4KY2A 1KTDA 2TMDA 3LUTA 2F18A 3BV4A 3ZGHA 3A22A 5C0EA 2E27H 4WEVX 4IMDA 2O5YL 4HMDA 1W80A 2W66A 1OAXH 4EI6A 2XKNB 4F7CB 2DAVA 1I45A 1XLGA 3ZKQD 1A8ZA 4UQ9A 1FVCB 4LUTA 4YXKH 2VL4A 3T0VA 1CB4A 4WGVB 3V10A 5CPOA 3QUXA 4NGHH 1F90L 4GYPC 5MHBA 3I6GB 1CVSC 5DFVD 2ZA2A 4FIQA 5TE7L 1IGMH 3HR5A 3QW9A 3KW7A 1CNVA 5FYKD 3GEFA 4Z76B 2Q6WB 3F5KA 5DQJA 3Q8BA 1JZ7A 4NP7A 2WO5A 5F8RC 4POCA 1ZLWH 3B0UX 1BYPA 3DSFH 4L23A 3HN3A 3B9OA 1IILE 1HNYA 4MJIB 2BWQA 1OYAA 1T83C 3K71B 4ICMA 3ZO9A 3SE9L 1UPMB 4CCEA 2HNHA 4BKLA 1IBDA 4Y7OC 2FATL 5F7MC 2AL2B 5GRUH 2HN7A 1BQ5A 5FO9B 3SN6N 1NGXB 4O2EB 4XZUA 4RNRB 4M1DH 3O6DA 5EUOA 1O7DE 3QORA 5SWQB 3OP2A 2NQHA 1FHDA 4XPTL 2OMVB 2Q71A 3L17A 2YGQA 4AK1A 3SDOA 4KROC 1BMZA 2RJGA 4DUXA 3ULUD 3LHPL 2WBXA 2ZE0A 3RZWA 3FQNB 4IEFB 1PFCA 5AOJA 4ZB2A 4LESA 1OWWA 1GPOH 1FFPA 2OSYA 4PJ7B 3FSZA 5KOMC 2QZRA 5I16A 2DEPA 1EFQA 1QSFB 4ZFZA 4F57H 3ITYA 4KFPA 1S9VB 1OAUH 3P5YA 5J8OA 4U3CA 3XINA 2X42A 1OY3B 3SCVA 3IS4A 4UTBA 2GC4C 3B8SA 3H12A 4Y5VA 4X7CC 3KYMA 2A7NA 4NYYA 1W5MA 3NDZE 1CFVL 2XSBA 3RNKB 5AUMA 4EF3A 4BK5C 3SJ3A 5F3BA 3T9WA 2GJLA 4WWNA 2EEBA 1TEYA 1I1CA 3FB6B 1GKEA 4IDJL 3CBRA 3ZTJG 1EAQA 1MF2H 3NQVA 2DI9A 3ZDZB 1Q9OA 5ENLA 4KOCA 2ZWKA 1HH6B 2IF7A 1MHPL 4US5D 4KWOA 4LS0A 1ICQA 1OFQA 1GAFL 5J9PA 2V5LA 1MHEB 1HJBC 4P5TD 3BO9A 1O66A 4FHKA 3HMWL 2VRJA 3FUJA 3AWNA 2WZIA 4BZ1A 2HXTA 4XX1G 2WXJA 4LU5L 1ZLVK 4MNJA 3TROA 4YCOA 1IKNC 4BZ2L 1TPXC 1JWUB 5IQOA 4IOIA 1QFWI 4NWTH 3VFWB 4LHUD 3V6ZB 2BXYA 1N0LA 2WUCL 5JTWA 2HVJB 3SOBH 1C12B 2B4GA 4RKAA 2E68A 4CAGA 1E9OB 1SVCP 4UIOA 3QWOB 1D5BB 1HE7A 2KZHA 4HK7A 3S0PA 3QWQB 5GZNA 2CBIA 4GBDA 3GYEA 2DEYX 2CK2A 2R8SH 2FK9A 1F18A 3RU6A 4AD3A 4PMJA 2A21A 1FPTH 1KYOJ 1W1ZA 4R90L 1HXMA 1BYDA 3CZSA 2P5WE 2I60H 3S6OA 4CCCA 8CGTA 1BX2A 3ZYOA 3BWUF 4KROB 3L3KB 4LCWE 1IBFA 4NO2B 3V0DA 3C60D 3SRHA 2J8OA 2GCYA 4HMEA 4KS0A 3WS3B 1DQLH 2BVUA 5INCA 1MOEA 3U2SB 5J3HD 4WWID 4YH6A 5MERB 4D1JA 3II2A 1RCYA 4DSYA 5FI8A 4HXBL 2EACA 2HK0A 1FZMB 3IFNH 1GHFL 5IFAH 2V5CA 1CU4H 3IMBA 3UQNA 1I4NA 1XQKA 3W71A 4CLMA 2J66A 1C7TA 1CDGA 4HKPA 3SSZA 3CFBB 4CMMA 2WLYA 4JN6A 1KZYA 3BJFA 2LV4A 3WTUA 4Z7QF 1PS2A 3W22A 4CW1B 2J6EL 3P30L 5KZEA 2WO4A 3BVTA 3S6DA 4U6XB 1BVKB 3G1XA 4QOKB 4LSTH 3MODL 1N64H 1WKEA 1ITBB 4DP9X 2I5QA 1AFVH 1WIOA 1PEWA 4I87A 4M6AA 3FHEA 4HU8A 3SY5A 3UC2A 3CVHA 4QISA 4WFGD 4BWLA 4K7YA 2X3AA 4URKA 1FH5L 4OFKA 4X4YA 1AZUA 5EZOL 1KLZA 5JU6A 1GYCA 3TEVA 1DYSA 1J5IA 5JHDB 2X0SA 5F4XA 4J3XA 1TPXB 1QFHA 3Q8AA 4XTDA 4LAQH 4FQPA 1EEXA 4P9MH 1QLEH 3WLPA 3HE6A 3TYZA 2BODX 4QI3A 5F0JB 3IJHA 4JMXA 2OXGA 4H7CA 2UX7A 4JDBA 4E2DA 4ZQKA 3SGJC 3TW9A 1PPIA 5ISZA 4C6CA 4ZD3H 3IVTA 3KJ4C 1PKLA 2QVKA 3DENA 1R19A 2ZUXA 3FOMB 2CQVA 2PLTA 3IIVA 1FWJC 4Z7QB 3CBWA 4PTWA 3AITA 4FTVD 1CTMA 5GIRB 5CJ5A 1E6JL 4F2TA 3TKFA 5F7DB 5RUBA 1XCWA 4P4KD 5LYRA 3PQYE 5DHVA 4Z7IA 3MCKA 1L6SA 5CSRA 3L95B 3MV11 3NRPA 5I09A 3ZWSA 2QZQA 3TONA 3FYIB 2GUBA 4PGLA 3P77B 3FT9A 1UJ3A 4JFPA 1J5SA 1F05A 1QUNA 1KYOK 2B0SH 4NJAH 1I8IB 4YL9A 4H83A 3L5HA 4O13A 2Y36H 1F58H 2DQ6A 1RK6A 3N34A 3RQ3A 4F3FB 4IBLT 2FX9L 1UD8A 3TCTA 2R4SH 1R2RA 2QFRA 2WMKA 2R9HD 1I9IH 3DO7B 4PUEA 3O15A 3J2PA 3GW0A 1E6PA 4DJMA 1JF1A 1I8MA 4C47A 4HHWA 1OLZA 1TJMA 1FC2D 2HH0H 1DWAM 4DAGL 4UOJA 4PJGF 1JCJA 3FH7A 1R75A 3EOYG 1TTIA 4PTNA 2QJIA 1S7UB 1UWFA 4PRNA 4F0KA 4QEEA 2CYGA 4KJWD 2DKMA 1A4JB 4JY6A 2J4WL 1BZOA 2I5YH 4CBZA 5EU9A 3LH2L 1S78D 4M3PA 1S5IL 3W7GA 5PAZA 1E4KA 1UQYA 2ICWI 1JXGA 4JFTA 4AE1A 4ERSH 4PJBF 2GITA 1E5BA 4PGZA 4NBYB 2XWTA 4G80A 2L8AA 1V54B 4HWUA 1SZGA 4JFDA 4DLMA 3X11B 5E8NB 5EU7C 4HFUL 4HIEA 2AXWA 1V02A 4IBTA 4OZIA 1JR1A 4NXSA 1NCAL 3IDXL 2AQVA 2HK1A 3E0GA 2NQ5A 1ADQL 2W0FB 1LD9A 3WIHH 3MWAA 3MGTA 1YE6A 4E41A 4Z7OF 5TE6H 4OI9A 3KJ4B 1LRNA 1ZSHA 2IQ9H 3W53A 2K8QA 3TNOA 3OGSA 2NYYC 4Y2OB 3JV4B 2X70A 3VFPB 4I7VA 4PJGB 4TX9A 1LDCA 4U6YA 1A5MC 5DEZA 1ISZA 3RWHA 5D1QD 5IBLD 5K39A 3HS9A 4LVAA 4N0UA 4TUKL 1FYHB 1SR0A 3N6YA 3P3YA 4NZRH 2WZEA 1WUZA 1NMCC 1KXVC 1KCVL 3ILDA 4I13B 2R1WA 2IGTA 4OJAA 3IRCA 3MLWL 5LKYA 3REQB 4I77L 3FCTB 4RA0C 5C6WH 5CHNA 3KWSA 3SQMA 2G0WA 3HBLA 4PH6A 5CJQH 3X17A 3UAJC 2CCWA 1ET7A 1JFQL 2C9AA 3LKNB 2A99A 5ACZB 3GR8A 5FJIA 2ZYSA 4GP5B 2H2PD 1O4UA 5HYJD 4AYFB 1MRDL 4Y4KA 2QDGA 4PB0L 3LZQA 1HL8A 1OG0A 3I74A 4JBSA 3GRGA 3Q4DA 1PLBA 1JEZA 1D3GA 4WUKH 4Z7OB 2OZ3A 3VXRE 2YO3A 3QKEA 4Q7NA 4IIQA 5LDSA 1SDAB 4MBRA 3OBEA 2NUTA 3QCTH 1UIPA 3GTXA 1NWRA 1KC5L 3G2GA 5AEAA 3UP1A 1FFTB 3C6CA 1CXEA 1GNXA 1CLZL 1INQA 3T8LA 3PJTA 2JKRM 3HF3A 4J1OA 4J3OD 4N22A 4CL7A 3D85A 3OMNB 4WK0B 4ZTPH 4JANA 4N9DA 3ARGD 1JS4A 5CEXB 4LASH 5HGGS 1LO2H 4PV9B 4Z7UE 3EJCA 1EDHA 1QYGH 3GUTA 3KBSA 3GDRA 3COOA 1D6VH 1JTTA 5F1OB 2CRMA 4YHZL 1YZZA 3CN1A 5AC6A 1PQZA 1HC1A 3DXAA 3IDNA 5D7IF 1L3WA 4DX3A 2ID5A 3B4UA 3AALA 1H3GA 4K3DL 4QQ3A 5C8BB 2YGVA 1F13A 3EYQC 4KKLD 4NT6B 4ZS6D 1GG1A 3Q05A 4HUUB 4YHIA 5AVVB 4W68A 1IXQA 4D0CA 4NSBA 3GC2A 2NYZA 3P54A 1H60A 4Y2DA 3UA4A 3ZJKA 1XL9A 3RWCB 4EWND 1EMTH 1MQQA 2HLFC 2WQWA 5DY3A 5DLLA 3IPFA 2YPVA 1BWLA 1P4CA 3M0IA 1J79A 4ZAKD 3BPWA 3MYOA 4OUUB 3IBOA 2OJ1A 4O57A 3H9SE 3L7EB 2Z7KA 2YZ1A 1Q94A 4FI7A 4YQXH 3WJXA 3T0EA 4N4PA 4YHML 1FY6A 3R1GH 3MLZH 2B1AH 3ULVD 4EN3C 3WY4A 4F0LA 2HRPH 3IAQA 2CA4A 1A9EA 4EZKA 4BKTC 1BJ1H 3BIAX 3ES7A 1NGWA 3HFML 2RCSL 3KOWA 2DF3A 3SW6A 5T1MA 2IWKA 4YMPA 1SFJA 2OMYA 1F3RB 4M8QA 3WN5C 1XIDA 2WOYA 4N6RA 4FKHA 4PRPE 1PKMA 1XIBA 1QI5A 4IRSC 2HE5A 3URBA 2CDEA 2AFNA 1IGSA 3RWDB 2HBXA 4B3LA 4DKEL 3ULUF 2LLEA 1QBAA 1AH1A 2Y2TA 4UTJA 4WW2F 3IDGB 5IB1B 2P76A 1Q8MA 5CAHA 1FRBA 4L4TD 4YJZL 4GG6F 5C07B 2TODA 4BK9A 1P4LA 2IH1B 2QSQA 1NCBL 3U30B 2X9WA 4JTEA 4LQFH 3B8UA 4JFXA 3MRKA 3AYRA 4Q7IA 3HMCA 2ROYA 5HMEA 2GJ6D 1JTPA 4N26A 3V5KB 4OI7A 2CO3A 3GSNA 3U7YL 3W0WA 4JG0H 2GQ8A 3K72B 1FAIL 3IXAB 1NDWA 3DI1A 1SO3A 5F93C 2EVJA 2I69A 2VW6A 43C9A 3WDQA 4X9FA 2C15A 4F1ZA 4JK0D 1DVSA 2VRQA 4YSEA 2H0EA 3W0KA 5EU5A 1FJ1B 4WDTA 4DUOA 3M0KA 4R5XA 1QFWM 3PU7A 4BFFA 4L37A 4JR5A 3MKGA 2PA6A 1FLRH 3NSMA 1DLFL 2GKIA 3MRCA 1HZKA 4WV1C 4F80A 2ESCA 4PBXA 3IFLH 1EJSC 1Q6CA 1UC6A 1XIWA 1N8IA 2GOUA 4PGCB 1ZLSH 2ZZ1A 5HHME 4GAYB 1TU2B 5EC1A 3INUL 4YGVB 2OEKA 1EK3A 1JD9A 4M82A 5DT5A 2IDSA 3CGTA 4QLJA 5GQBA 2HJFA 4X6EA 4PWEA 5FYKH 5I1IH 1EXPA 6PTDA 3TR9A 2ADIA 3VKBA 1PSKH 5A43C 4RSVA 4XV0A 4XPGL 2G50A 1YECL 1EH9A 1I9JL 2HS6A 4EN3B 4I9JA 1R3KA 5C7HA 1FHNA 5JA8B 2W65A 3O11A 3THCA 5DZOA 2WXNA 3D18B 2ZCHH 2NW2B 4B9IA 3V3WA 3M4HA 4PJ9A 1JWSA 4LP5A 4HT3A 2WSQA 1OAJA 1OT4A 1T4KA 4QRSA 3ABOA 4ZX6A 5DBUA 3TWBA 1TYEB 1H11A 1KJ2A 1DFBL 4Y2LA 3NOEA 3SE6A 2RIKA 4PS8A 5IHRA 3QYCA 4V2CB 4QE5A 1UXSA 3C6SB 5AB9A 3U7WL 3GSQA 3AABA 4HCGA 4LOUC 3O0RH 3S88H 1MW2A 1KNWA 3WF4A 5ABHA 1V6YA 4N0FA 3B3BA 1UOWA 3AY2A 1TVHA 1WDPA 4P5TB 4A67A 4LLQA 1AH3A 4IL0A 5E0QA 4FQ1L 3CFDB 1SXBA 1KYAA 2YCLB 5C0JA 4TSCL 3VFUA 3UBFA 3TMLA 1M3JA 3MROA 3QZMA 2F8XC 4LHUB 2XTKA 2JJTA 5EPMA 3Q44A 2OMAA 5C7XH 2CJ3A 3P82A 5ICYB 2K9UA 4PB3A 4KH2A 1YPZA 4OLUH 2ENQA 3WF3A 1FHVA 4Y19A 4ZSOE 4AYSA 3MLTB 1YTKA 2OZ0A 3K5XA 4ZMWA 3P73A 3KPSE 2BBFA 4WV1B 3L4CA 1XLAA 3U6XA 1FCCA 1GZHC 2X4RA 3W7DA 1BA9A 3ZLQC 1CQKA 3MLSH 2X2GA 2Y7NA 4NXKA 1W37A 1YEEL 3L3GB 3HC3L 1KTBA 4S1QL 5DI8A 3B9DA 4CVWA 2EVHA 2WLZA 4ZFFB 3G5YB 1UWXK 3SYOA 2LU3A 1I3VA 1XLHA 5JIHA 4HJ0D 5I3JA 2C19A 4NP4L 4AG4H 4PWKA 1XQLA 3H3PL 2QJDA 5AYBA 5DQPA 2W07A 2XGIA 2BSRA 3L0NA 3K6SB 2BK8A 3CN0A 1HKVA 2JI3A 5E94A 1OP4A 1N2RA 4XMWA 4EIZC 3U2CA 1UM6L 2F54E 1NCDH 2LOEA 2CJSA 2JB5H 5KYWB 1CFNB 3RHWK 2Z00A 4K2UH 3FQUB 4MVAA 5BVJA 1P7BA 4JFZH 3PS7A 3OZKA 4G7EB 3APMA 5LGXA 3UEQA 2PRHA 4UTMA 1LO4L 2BP1A 2WLNA 3NZ1A 4N2IA 2GSHA 4S1DC 5I6XC 3PAJA 1GSKA 4DGYL 1JCLA 4WNSA 5T26A 4LVEA 2CITA 1Q9LB 4FFZL 4NRZB 3OLDA 3BZ4B 3N41F 2DICA 3T8MA 1WZ1L 5L8KB 1RV8A 3WS6A 1IZJA 1HJVA 1G0CA 2QSTA 5AYIA 3GHEH 3LKPB 3T6XA 2EE2A 3QISA 4PVNA 1O5XA 5E6ID 4BQ3A 1UD3A 3PWPA 3X1GA 1BFOB 5BO1H 3MMTA 4LV9A 4LEEA 4ONGL 1J5HA 4MAUL 4U1IA 1Y5XA 5A40E 4JJ5A 1DBAH 2Z35B 2AP2A 4U3AA 4PP2A 5LXVA 4ZPTA 5JW4R 4KCVA 1O9WA 4J4PD 3UWYA 1WAAF 1CE1H 3TX9A 4AJWA 3RA7H 5KG9A 1ASPA 3DEQA 1N6QL 5GNZA 5IVOA 2CIKB 1S7SA 4LGSB 4C6NA 5IVXE 1MZZA 5E7BA 1Z9OA 4RLIA 3AU1B 3MV7E 2CRYA 2H45A 4YGAB 3ZMEA 4FTVB 4P4KB 2AAVA 3NCFB 4YHNA 3F12B 3FB8A 3K5SA 4WXZA 2R1YB 3L7RA 2D31B 3RGHA 3ZDWA 4I18C 4XZHA 3WSQL 1MCJA 3F4NA 3NA8A 4GW1A 4L9LB 4R0LA 2P5WD 1JV5B 2CAKA 4FG6D 4W4NA 2VISB 4LCWD 2UY3A 3EWWA 3KYKH 1SOSA 3QJXA 5D30A 5G55A 4AC1X 1ZLPA 1RVGA 4IIEA 4P46D 3CLEH 4ZZKA 4H9VA 2NDFA 4GMSH 4AT6A 4IGSA 4P5MA 3VD9A 3O2LA 4GMTH 5DJ0B 2WGXA 4C6LA 4ODWB 4AD4A 4POUB 4GUHA 4JDTL 1VZWA 5GZOC 1OINA 3SDCA 4HIXL 2FQEA 3WJZA 5AVRB 1CO1A 5C0IA 4Q6JA 3UWEA 4NZDA 1KKOA 1P6WA 3B34A 1A0QL 4YPGB 4DUVA 3VE0A 3IGAB 5JW4N 1KTLB 3VW3H 2NLIA 3TC6A 5EGRA 4QE4A 4OIAA 4L3EE 2QPXA 2YPLA 4IWWA 2K45A 1LEGB 2XH7A 1YEHL 4HEMA 1FGNL 3X14A 4Q14A 2BX5A 1NCHA 3FL7A 1HHGB 3LD8B 1KM5A 4V1YA 3VI3A 2G96A 3P9LB 2X12A 5FV2A 4R53A 1TTQA 4BFJA 3S7GA 2FLMA 5A2AA 3LH9A 4MQ7B 2PDJA 2FBJL 3GJEB 3CQPA 3CS2A 4C57C 1KA9F 5IJVB 4UCGA 1L8PA 1ZB5A 1MREH 4XMZA 1PTGA 3EFDH 3B1UA 5HI5D 2RA1A 3IMUA 4C83A 1VACB 4D6FA 5IV2B 4L29A 4LEQA 3R4IA 3S35H 1B4JH 5JLZA 1NSNH 3RGBA 3NZRA 1TVBA 4G1MB 2EIBA 3QJHA 2IPJA 3G1DA 2FVMA 4TTUA 3QHFH 5I0XA 3QUHA 5DUMH 3VC6A 3BE1H 3QK0A 1IC7H 1TV3A 2QKIB 1MDTA 1KCZA 4A1RA 2CLZB 4RFEA 4J3OF 4JGMA 3NABL 2R29A 5MF5A 1AGCA 4QTGA 4I18B 4S1SH 3FMGH 4Q8MA 3EGSB 4Y8AA 3SCRA 3RZCC 2QVMA 2J1YA 3G5VA 4YC2B 2A2IA 1ZTXL 5BXFB 4UFIA 4JRYA 1TJIH 3E49A 2Q87A 4PWFA 4UBDC 4IT1A 3GSUB 3BE7A 2QQKH 1EFXB 4TUFA 2ADFL 1D9EA 5I1EL 4MMZC 5C0NC 5HYJB 4BHUA 3DROB 1A7NH 4MXQC 2JK2A 1FG2A 1REIA 2DQUL 2N59A 2J2ZB 3G6JB 4BUHA 1V05A 3SUTA 2HRGA 1OF0A 1KGWA 3FN0L 4PLJC 4PTTA 2A4EA 4EOWH 2PETA 2V5BA 3E9AA 2CGRL 5K9KB 3CMJA 2VLKE 1G4SA 4L6HA 4PY7A 1H3PH 3W39A 1AI1H 4FXKA 4JTHA 1BVLA 2BSED 2IKIA 2DW6A 2B77A 3EJTA 3I02B 3SQRA 1P0EA 3ULVF 4PA8A 1JK9A 4MNHB 3O2DA 1VPQA 3FCSA 1XL4A 4QG6A 3URNA 5CP7A 4EDXB 3ARGB 3DFNA 1VFTA 1IEWA 3D51A 1JNDA 3O0LA 4X6DE 2QTVA 1M05A 5FLUA 3WLKX 4APQA 1XF5B 4AVKA 4NERA 3IRDA 2JELL 1Z48A 4PUWA 5BZXA 4QIUA 4CVZA 1S7WA 3TU6A 1B3VA 3DESA 3B7RL 2AJUL 2VABB 4WI9A 5HK4A 2DJUA 4N20A 5I77A 5JXEA 3M45A 4A3YA 2QPDB 5KSBE 1DN0B 1JNLL 3MOAH 1M56B 2VWEE 2NT0A 3VI2A 4EE2A 3W74A 3SY8A 5HHNA 3RG1C 3QS3A 3GG1A 1RK1B 3NPVA 1AZ1A 3J07A 3PZQA 2XNAA 5CCGE 2QZ5A 5ESQB 2DFAA 3GDMA 4YR6A 3VFRB 1TIMA 3E5BA 1QRQA 2YWZA 1QLFA 2DVTA 3TR2A 4NFBA 5BOPA 5D6CA 1RJCA 3BARA 4ZAKB 3M17A 4ZX3A 3V35A 3PBVA 2H6PA 3WY3A 2AJZA 4YWGH 2CMRL 4HZLA 2UY4A 1ZT4B 4HDIB 1WAEA 1KBGH 4J3OH 2WW5A 1CBVH 2E7BA 2OTPA 2FEDD 3EUUA 4OFIA 5IUSA 3CHOA 1HCVA 2AV7A 3P0YH 3CHXA 4XNYH 5EBMA 4NRRA 3K6DA 1O0VA 1RBAA 1HEJC 2AQ1A 1DZBA 4MMZB 4HA3A 3TNMB 4NM8L 3NZPA 3I3DA 2EXWD 2BXZA 3WLBA 1A6WL 2WGNB 1E4XL 1JGLL 1HZHL 2XWRA 4JPWL 4GKNA 3NIDF 2V7HA 1T8XA 1G6RB 1J4EA 3NEXA 1DXFA 3N5AA 4L4TB 2VLRA 4L1DA 1HJQA 5FFOA 3M1BA 1OABA 3AUJA 3N11A 3F7JA 1IBGH 4GXWA 4XXDA 4UFKA 3N43F 2DZUA 4ZUTB 3ARUA 4JX0A 3GMOA 3QULB 3HPJB 1LE9B 3FUHA 4X5QA 2GJ6B 1R3TA 3PGFH 3VXRD 4CD6A 3OPUA 4JTJA 4ONHA 4O9HL 2F8QA 1G9HA 4QE1A 3LKRA 1E28A 1DQQA 3CIQA 1SGKA 4ABWA 3ULVH 4WGKA 1RVFL 2GJZB 3CT2A 3DYOA 1LQSR 3T5WA 4ODSL 5IHUH 1UXLA 4X6BB 4JZ5A 2MNJB 3LS4L 5D5ME 1RUPL 1XYFA 4DKFL 4INFA 2H9GA 3M0VA 3YPIA 1XGEA 3VXSA 5HDBE 3ZFHA 3TN0C 2B08A 1S2VA 2FZ9A 1NOLA 1XR9B 4M93C 3LA4A 2ZRVA 2JJUA 1DKWA 4R8WL 3PWAA 3ZZLA 1BQRA 4XTRD 2V2XB 4L56A 4HZMA 3AXXA 4ZO6A 3GG8A 4OJDH 1H0GA 5FFGA 4WIWA 3ALFA 1U91A 1PBGA 3S34H 4HPGA 4TULL 3FW6A 1W1IE 4IMLB 3V8OA 5F7HA 5E1GA 4PJCE 2E76C 2VSCA 1DQMH 1QOQA 3WUBA 2V3FA 1PDYA 3D0LB 3GAKA 4GP4B 3IMVA 4JAMB 4JVWA 4GQQA 3KYOB 2WN3A 5T33L 4B3EA 2CE6A 1MW1A 1AS8A 5CZVH 4GBXC 2XOTA 2D3VA 3NCWA 1QSEE 2Y07L 1AHWC 4IDLA 4RE0A 3VVGA 4LW7A 5CJMA 4M4RB 4Z42C 1HJCA 5C08A 1C8QA 1U92A 4WR3A 4OOUA 5I03A 3DFHA 4PRPD 4BH7B 5DURD 1EGJA 4MD4A 1XYCA 4IRJC 2HLAB 3V55A 4POZD 4NQEA 1ZS8A 1MEXL 5HGDB 1JCKA 2UV3A 5H1WA 1DJXA 1RZ7L 3W2MA 2B9BA 3GS7A 1YNLL 2GGEA 2VDLL 1RZFL 3DVNA 5T3XL 3CZKA 4XHJD 4FLOA 3UZQA 3LYEA 3ZGIA 3ZT7A 5G5DB 4CSZA 3LNIA 3TCLA 1OE3A 2PDWA 3TWCL 5GGTH 5CSSA 1D5MB 4DY1A 3BAEH 3RNQB 4OFYA 5JHBA 5DS8A 1JHLL 4HNUA 5ENWB 1XH3B 2VXUL 1HHIA 2YQ3A 1Q1JH 1ZJAA 3TN0B 3SCTA 4Y0GA 1EZ2A 1P48A 4CJ1A 2R4RH 1RZIA 2OLHA 2BY2A 5CZRA 5JPNB 2RDTA 4M93B 2HSIA 2V69A 2GAZA 5F7AA 2Y5SA 1ZUAX 1DVUA 2OZTA 1HNGA 2OMNA 4NHCH 2BC4B 5FCUL 1JUFA 1YO4A 4Z7WE 5KYNA 2UVFA 5FYJU 2X6CA 1G1CA 2X7WA 1DJYA 4WW1B 1UQSB 3NZUA 1NIBA 2FEJA 5K9CA 5JZ7D 1Z5HA 5EO0A 3SIMA 3LIZL 2X44D 4H6KA 4JJOA 5CPLA 5E9DA 4F8QA 4JMNA 2YD4A 2CIPA 1PVNA 4AOFA 5T5FL 3J27A 2OB3A 3SGGA 1Q2SA 5DJ8B 2VC6A 1CT5A 1EZUA 1ETA1 2YUXA 1AHWB 4G6CA 4AJYV 4FQCL 2C1PB 3IF1A 2EEXA 4JKNA 4KVNL 1A7QH 5JDSB 1WISA 1DJNA 4CQ9A 4D6HA 4OQTA 4YNGA 2BSSB 1C5BL 3HRPA 5IMMB 2E9GA 3A5VA 3QQ4B 2P49B 1PBYA 1ZHBB 1PZDA 4UUJA 3AREA 5CILH 4GXUM 1ZHNB 1BQCA 1IGCH 5EO1A 3HTLX 2CZNA 4PV1C 3A3HA 2NR6A 4C1LA 2VXTL 3E12A 3O3AA 4PW9A 3WLIA 5KTEH 4F37F 4D6JA 3K4AA 4WNQA 2DQIH 1UC4A 4A68A 4BHUI 2B5IB 5TFSH 3V9FA 4NQSA 5E8EA 1TMLA 3BGJA 4JFHE 1U1JA 4W4OA 1YEWA 1K4GA 4OFPA 1R3LA 3B7SA 3N3EA 2R2HB 3K6FA 1R3RA 3MXVH 1RUQL 4JIHA 1OGBA 1Q4NX 2QUMA 3FTSA 3ZKND 3VOJA 2VUNA 4XN8A 4AIEA 3ERXA 1E27A 3UC0L 2R7EA 1A14L 2PR4H 3AXHA 2O9OA 2UYLA 4O51A 4U1NB 1B0GB 2DTSA 3UADA 1OTUC 2X4UB 1EJXC 4X4XA 3KPSD 1QR1A 4IMFA 3BWWA 1JOIA 4N24A 2CFFA 3FVDA 2NV9A 5K9OB 4R9HA 1G9ML 1IIGA 1GVRA 2XDFA 4WSHA 3HVDA 3L5WA 4JDEA 5E99H 3K30A 4FXTA 1SEQL 2I16A 1OP5K 5BCAA 3RO6A 4LCWB 4Q4OA 5CWSA 5TGBA 3ZTNH 1YMMB 1ZPLA 1BZ7A 2JK5B 1KIQB 4LS1A 4FAAB 1NCJA 4L1HA 2F5AH 2IPTL 4YHLL 1PCPA 3ALWA 1RZMA 4Q4RA 1C29A 5A6JA 3B9KD 3PWJB 4FCHA 2XA3A 4HF5L 2VX5A 1K6QH 1GMIA 2F54D 3O45A 4OAWB 2X9YA 2P5PA 4WXYA 4QXVA 2GHWB 3QT2A 4Q0XL 4WJ8A 4MUPA 5B39G 1ITXA 5KAQG 1YY8A 1FO0A 4LLDB 4NPKA 5C09B 4WCJA 4KK6D 4Y8EA 2QHRL 3C8FA 3UWQA 1MWAA 4EIUA 4DPRA 3G9VA 3GMRA 4KRUA 2W60A 4WY7H 2Z2AA 5ITFB 1GGBL 3E3HA 3CDFA 3N4AA 2W9DL 3MV8E 1TSIA 1BWKA 3BUPA 1ORQA 2X88A 3QNYB 2Y23A 4L4OA 2AJXL 1TX0A 4MB5A 1H3TA 4ZMAT 2CHDA 2DIJA 5XINA 2Z91A 2BOCA 5E70A 4KMLB 3IJLA 4X8JB 3EYPA 5DRIA 2OK0L 4UQEA 4X7DC 2VXQL 3BDXA 5CGTA 3QV9A 4ML4A 5AOKA 1MAJA 5E2TL 2DLGA 5MEPA 1R0AL 4UMAA 2JI2A 4KO5A 1OCWH 1RZ8A 5C9WA 4UB0H 4JCLA 3KR3H 1GH7A 3AIBA 2Y85A 3EZ8A 3VXMA 3TJXA 4Z2JA 3EPNA 5CPMA 3WKML 5C3TA 4F15C 2DQGH 3FNDA 1K70A 2BCMA 2RTTA 4HUXB 1CF8H 1U2HA 4ZUWB 2VTFA 1S9XB 4KO9A 2QW5A 4XO3A 4JQIL 1DORA 4LWWA 4MS8D 1BEXA 1R7AA 3MV7D 4YDIH 1QNOA 4YUEL 1QKZH 3NSNA 3BWUC 5IWLA 2ISWA 1T7ZA 3QNFA 3LB0A 4MFDA 4R7XA 4HJIA 1IGYB 3ORWA 1QNIA 1A1MB 1DEDA 5CJOL 1FBAA 1IAII 1IXNA 2CNCA 3IU3A 4KKBD 1XP3A 1J1PL 5LNSA 3WFHB 3GJFH 1EO8H 1QXLA 1NLDH 4JREC 1DJWA 4M1CD 5DEFA 3QLDA 2Y24A 5SWSA 2C1OB 5FM8A 4IQDA 3F64A 5IJKC 4KESA 4A6GA 4JFYB 3EMZA 1UW9A 4YDLB 4RX4A 3PTMA 4JHBA 2RH9A 3ARFC 4M7JL 2EIZB 1UHVA 1CIUA 3FQ1A 3E2HC 2XZQH 2GYIA 3GH7A 3U1SH 2FWSA 2IWEA 3VSTA 1N59B 4BH8A 4WWOA 2F5BL 1W3IA 2VL5A 5KJ4A 2Z2BA 4MXVE 1C5DB 1MPAL 4XNMB 5CN1A 2AV1B 2X6AA 4M62L 2NX5A 1P5VA 3QI9D 2WINB 1O5DT 4L3ED 3CK0L 5L2KA 3OAZH 2H32A 1QLEB 3SYAA 4HN8A 4LVFA 2FLBT 5DTFB 1ESWA 3FT1A 5FECA 1MAML 4K5OA 3RVVC 3NZHL 3I7QA 3GM0A 4LSUH 2Y6SD 5JXAH 1R1CA 3DETC 3FUNA 2CHWA 2ZUNA 2FT6A 2UY7B 1LEIB 3M07A 2X5PA 5F9OL 4KKAC 2D1ZA 1X44A 5AN7A 3D4CA 2QJNA 1YXYA 2PYEA 2ISFA 1JRHI 2ZX5A 2J6XA 1UJQA 3FQWB 1MRFL 2J1XA 4F15B 3W5MA 4JTGA 3TT3H 2JXMB 2ALRA 3SZ6A 1MAKA 3USBA 4OKDA 4HS3B 1DQWA 4JY8A 4PB9H 5J8LA 3KLDA 3MU3A 3B2VL 1KR0A 2OQJB 2IBGA 4F24A 1QABA 4JN8A 4K3JH 4CRPA 3H42L 4DP1X 1I60A 4LLYA 2DQCL 4HIIA 1NPJA 4M3JA 5CP3H 1R3IH 3FEQA 4DZ8B 1Q6LA 1DVFC 1YIXA 1RALA 4Z7UF 2EUZA 4F9LA 4KFNA 4KX7A 3F05A 3S5YA 4PTUA 4KQNA 5HJLA 4HQVA 1X6NA 5H8PA 3NT0A 1Z9MA 4OCXH 4UT6H 5IB2A 4NSKB 3S9DB 4XVSL 4JREB 2Q3ZA 3PAZA 4MZ1A 3MJ9A 1NBYA 2Z1XA 4H9YA 2GUYA 2NSOA 1EWEA 2A83A 3X13B 4O4WA 1MVYA 3SE3C 5DZAA 3EO1A 4ANKA 4XK2A 2JJSA 3ARFB 2YCJA 3H22A 5F2IA 2IWGA 4U1KB 3U6RA 1UT2A 1GZPA 2DMCA 3E2HB 1BG1A 5CZ0A 3OIXA 3THQA 2OTWA 2WHVA 4UTWA 3BDYL 2K3HA 3RU8L 3MRDB 4XCCL 1M5WA 1FWTA 2YARA 1R24A 5J6HA 2VLKD 5DD0L 1ZZMA 2O9TA 3MREB 2CLVA 4PULA 4HA0A 1ZBWA 4GZEA 3VX0A 2ED9A 2D69A 1SEBB 4MPQA 2EDMA 1AY1H 2QGHA 2RB8A 3ZL2A 3L5AA 3VFNA 5D71H 1EJRC 3SYPA 3KCWA 4MOZA 2E7FA 3WGUB 1RQ5A 3RPIA 3LMJH 1F86A 4DN3L 2H8PB 3SGUA 4EQ2A 3HS8A 2RHEA 1NCGA 2BFVH 2E4FA 2UWEE 2ARWA 2FJHA 3NFNB 3E3QE 5FB8A 3A4XA 3O9WD 3EYSH 3E7JA 1XEUA 4HKZB 1IQWH 4XP4H 1OE1A 3BLIA 2JKJA 3QQ3A 3BK0A 3QDHA 4AKOA 1J0KA 1DBBH 3S2AA 4G7VL 1T3FA 3H7BB 4AIZB 2KLTA 4E8GA 1QOXA 3Q43A 2DLHA 5IK3A 2D24A 1DVFB 4H8WH 2E3VA 2N4IA 3IRPX 5D2NE 1JGDB 4TNWF 2XG9A 4LK4A 3HRZA 3QEQE 5KBDA 1F8TL 1RUKH 4AX6A 3II3A 3RAJH 1WBJA 2GGHA 3SE4A 4UC5A 3LHYA 1AD9A 4E9YA 1W1VA 3ZRCC 2XWBB 3D69A 4PMRA 5DJCA 1UT9A 3QV7A 3KDMB 1TZZA 3OXRB 4JTDA 5HNUA 3KHQA 2OP4H 4D0DA 3ABMB 1I2QA 3MRHA 2MPAH 3H2CA 5JXQA 4KRLB 2QNEA 5LHFA 4X5WA 1XJBA 4KKCD 2REQA 5I75B 3B2PA 5J1AB 4I9TA 2QVHA 3OZYA 3CN4A 3CIXA 4A3RA 3M0JA 2FZ8A 2L7JA 3KS0H 4PHZA 4CC4C 2J88A 5L6YH 1QBLH 3TSMA 1XGUA 5GGQL 5E4EB 3BP5B 9CGTA 1V0KA 4K71B 2IWFA 3DA0A 5JIMA 4OFVA 3UPBA 3IETB 4PRBA 4TSAH 4IHOB 3PPGA 5GISL 4ZQMA 2L5HA 5FPIA 2H0FA 1YEFL 2EEAA 1V55B 3UTTA 4PJBB 2FE0A 5D6DA 3LPGA 3MR9B 5HYSB 4G8EA 1X5YA 4MDIB 3MUCA 4KRNA 1W16A 3S1VA 4WK2B 3FSUA 4EZJA 4K6AA 2J8TA 5CBIA 5HHPA 2OZNA 3TJEH 1WDDA 1R30A 1NEZG 3BPCB 1F6AB 2HKHH 3LIUA 2ICEC 4OD3H 3T4CA 3LU2A 5FYLL 1L7TH 2W88A 4CUCA 1TMCB 2VD9A 3AMDA 4KBXA 4NZTL 2GBUA 3U30C 3VCLB 3MNWB 5CU5A 3U0WH 5B39A 4GAGH 1C9DA 1KLFA 1SHMA 2PCPA 5CKSA 2FVNA 2XJKA 3TTQA 4XBEH 2CKRA 1FUYA 1QEWA 3KYNA 4NZCA 2XG5B 1F3DH 1NLBL 4M7LH 3ONBA 2JBMA 4LCYB 4WEMB 4PGJA 3KLKA 3Q48A 4NN5C 3USZA 2ZOLB 2CLFA 2Z3FA 2YYTA 5FHBH 2QDDA 1MHHA 3TF7C 5F2LA 3RRXA 5DC4B 4IQJA 4V2BA 3ETBF 5HPMB 1IC5H 2Q3AA 1FCVA 3AO0A 2A9CA 2ZCZA 1MQKH 1RCOB 2V38A 3SCNA 3Q6GH 2PTXA 1P1XA 1M57B 3JWOC 3VNZA 2X10A 3NM1A 3L13A 2UZPA 3W9EB 3UNTA 2NW0A 1E6XM 3IMTA 4NHUA 1SW7A 3FYYA 3AY4C 4ZEPA 5I1DA 1FA4A 1QSED 3OG2A 1J8KA 1THAA 2R2EA 2DEWX 3ULUC 1P2CA 4U1JA 2YXMA 4ZUUA 5INDA 4WW2C 3QIBD 4NUJA 2R1XB 3LQZB 1ZHLA 1OX4B 3TW6A 3FA3A 1L9QA 5KBMA 4HVBA 3I9AA 3L65A 1VBGA 1ZT7B 3T0WA 3Q65A 2OKOA 2IIJA 1JZIA 3WH5A 2UXTA 2A6DB 3OKKA 4IJRA 2BINA 1MYRA 2H47C 2QULA 3GS4A 3GO2A 5FW8A 4GCXA 1A4KA 3HNVH 4Y5YA 1EZWA 1RIVL 2JEPA 4U1LB 2VZ3A 4KXDA 4QRPD 3PB0A 1W3NA 2Y9RT 2OFJA 3V4VA 2ZF9A 3A67H 3I10A 4MLSA 1J8VA 2MNRA 1WA2X 2F74A 4W8LA 3E2SA 2AMGA 2D0HA 1E7UA 1E0WA 5D7IB 4PJDE 3VPLA 2GSIA 3WL9B 1UB3A 4MZ8A 2MQ0A 2ICEB 3QJUB 5JOFA 1E5AA 4HPYL 3WEMA 2A3CA 4DN4H 4B3KA 5CMAB 2XV2A 5IM7B 1VRDA 4P5TC 4EN2A 5FDWB 5I1HL 4HLJA 5G4EA 1G87A 2O93L 3W85A 2EYTB 5AHFA 3JZEA 4G8IA 4DEWA 3DIVA 4RISL 4OZOA 4A7GA 5A1AA 3SKOB 1HINH 3W7CA 3T6QC 4R9OA 3K74B 4NN5B 4XC1L 4Q2ZA 4AWUA 1IAIM 2F54B 1WP6A 2BOFX 1BIIB 1SMDA 2ATMA 2OCCB 4YNYA 5LUMA 4Y9PA 4Y7MA 1JPTH 2Y69B 1WXJA 3Q2CA 1EEYB 4R26H 4DZBB 1UB5A 2DQWA 5IB4B 2WCGA 5IVXF 1VYSX 3W3BA 4BUQA 4C5ZA 4JY5L 4QTHA 1RKRA 3MNDA 2VFEA 3VM7A 1XCQB 3MRBB 3FSWA 3QJFA 1OF2A 5ABFA 1U93B 1DFXA 4NI8A 3BW9A 4WW2B 3KNBA 5J3HC 1WA0X 4GG6B 1LT8A 1P6FA 3JXAA 4Q8UA 3W2DL 3ROOB 4YN3A 3CZLA 1QO5A 1XT5A 5EO9A 2NY1D 4S39A 3CXDH 5B38B 2VWSA 4GKLA 5CD3B 2E8YA 5F89A 3K2KA 2EGZA 4XVJL 2HUEA 5GRVL 3VDGA 1CTNA 2B4CC 5ECVA 5D7KE 3W6LA 4PJFE 5J11B 2WWKO 5ITBL 2WPGA 3IS1X 4LXFA 3GW3A 3TM6A 4ZB0A 1Q6QA 1SJEA 3QNZA 2VIRA 1C9SA 4JFHD 1R5WB 1JTOA 4E5TA 3UXAA 1T04A 1S7TA 3KGTA 7ENLA 2EDFA 4Z95H 4LEOB 4C8XA 4AMKL 5F2MA 5HJDA 2PDMA 1RBLA 4IMCA 3CSYA 4K8EA 3GK0A 4IM8A 1NU5A 4BYHA 4LBRA 2P3YA 4FALA 5LAXB 3MV7B 3CH1B 3IDMA 4F2EA 4A3UA 3R1ZA 2H9AA 2BNRA 1ZGDA 1TKKA 2YN5A 1XW8A 4OLYL 3L68A 4IPJA 4X6FA 1X5XA 3N73A 3C56A 3TQ0A 1LUCA 2DT3A 4QF1A 2D0FA 1M6UA 4HXAL 2J27A 4R5TA 3OPZH 2MQGA 2WMPA 3DRQB 3CV7A 2W0KA 1GW0A 4BJLA 2HJKA 2Z25A 2NNRA 5KYXA 4P2QE 4PC8A 4LAKA 1N5YL 3LGGA 1S38A 5DD1L 4NAEA 1A0CA 3AXMA 1R3HB 5F88B 5BRZA 2QCEA 4P4KC 3UT0A 4OZHA 4NZUH 3RX3A 4AQ1B 5LCVL 3C60B 1CTOA 2FQFA 1TQTA 1FIGH 4EBQH 1Q8JA 2XA8L 4EVNA 1P7TB 2V3GA 5KS9A 1GYLA 4L9LC 1EX0A 1Z5LB 1C5CH 3GKAA 2BZDA 1LZOA 3V5DB 3QI9B 2G4FA 1VJSA 4BFGA 3F03K 4JOMA 1HKLL 2E3ZA 1WBYA 1NEUA 1JPMA 3MC5A 2NCEA 3RDTA 4PRIE 5EB9A 2XTLA 3MV8D 3RJYA 1ZWIA 2Z1VA 3C3NA 1XYAA 4KOBA 5CSZB 1KXTA 1SY6L 2R9HC 3QQXA 4QXTA 3NCCB 1HJWA 1IHIA 4XBKA 1UCBL 4O8RA 3S2NA 2XVLA 4IJ3C 3S42A 3CZGA 4OVXA 1PNCA 4DT2A 3WJJC 2VITA 1CLOL 1TFPA 4AWSA 3V4LA 4AENA 5KVDH 4AUUA 3GK8L 4V1XA 4X5XB 4KJWC 1E4NA 5H2ZA 5IMLB 3HJEA 1AQDA 1OSZB 5DSCA 1Q9KB 1UZ4A 4KX9A 3S36L 2A6LA 5M2FX 1AC0A 2G60L 2EXYC 3SQBA 2UZIH 1V7YA 2CLIA 1S78C 1KM3A 3HC4L 2J7CA 4R7DB 5IHLB 4RZCB 1SXNA 3BZJA 2XVGA 4H88H 2ZOUA 1HH9B 2MEJB 5H2BB 1IQDB 3M7OA 2FO4A 3ARDA 2YUZA 2Y2YA 3CL6A 3F7VA 3LD8C 1HSBA 2WXRA 3RKPA 2A4ZA 3OVQA 3I2CH 4X6DF 3RWFA 2Z64C 5A2LH 3EYOB 4DIXA 5DHDA 1E9PB 2VFGA 4UFHA 1UKPA 4GQ9H 3I6RA 4X0VA 5D1ZD 2P3EA 5DDHB 3IU4L 2IDQA 3A5FA 4JG1L 3B7UX 4ZMLA 3UERA 8FABA 5L2JB 1ND0B 4QTIL 1BVNT 5C0BE 1V7MH 4LCSA 3MYJB 5KSBF 2I9LA 3QO0A 3VKCA 1C1EH 1XB3A 3QYSA 4PJHA 2IH3A 4E2OA 2ZPKL 3I6KA 5EBGA 3F01A 2X1SA 5D1QC 5IBLC 4MWAE 1KRCC 5D8JL 1H7PA 2QKIC 2Q7YB 3NQ6A 4JO5A 4HISA 2HNEA 4UANA 3S9ZA 3N41B 3ZK0A 1YYLH 1NEZA 2X0UA 4HLZG 1FCUA 2PF0A 2VLKB 5TH2B 4GH7B 2R82A 4OKVA 4JPQA 2NQLA 3JV0A 3W7JA 4QNPE 3ISRA 1I1YA 3WYRA 4YC2C 1XCTA 4BQBA 5LGJB 4B5ZA 2OULB 5KVDE 2GIMA 1E55A 3L2LA 3N6HA 3GXFA 1D9KA 5CO1A 4UQIM 4OF3A 1HO1A 3PG9A 2H2PC 4YDVB 3P2VA 4NFCA 1S3RA 4RGOH 5KSAD 3KZ8A 3GIYA 4IJ3B 8A3HA 4AV4A 1PX8A 2IADB 4FA8A 4ZPVB 3N14A 2DPKA 4PWHA 5I6SA 3SDXA 1A5KC 2FX8H 5B1BB 1VFFA 5DBTA 2EDEA 3FBKA 1YN7A 1E6OL 5EMYA 5KSBB 5A8MA 3MACL 4PP1C 1Y0LA 3EJYD 1OCZB 3KBPA 1F4YL 3KXFE 2PI6A 1NUFA 1AS6A 1KB3A 2XACC 4X8GA 1RJZA 4K7PX 1L9TA 2LAAA 2G9HB 2YD8A 2Q01A 1FORH 4XNZC 4HZ1A 1TTFA 2XH0A 4J3OC 3STBA 1ODAA 1LEKA 3ARGC 4OLZL 3VOIA 3EOLA 3LZ5A 4Q4KA 1W9UA 1IGFH 4O11A 1MZRA 2Z31D 1PYWB 2B4CL 3EGXA 3UYPA 5M03A 2P8PA 4A6YL 4CC1A 2GDVA 5DYOA 5I17B 4EPSA 4GZJA 3LBMA 4DO6A 2JGQA 1U8NB 1B4LA 2ENPA 1U8OA 3NCXA 2H0JA 2PN5A 4KKLC 4ZS6C 3CH0A 3SCQA 5HDBF 4H4IA 4XCEA 3S3BB 3TPUA 3FYPA 4MNQE 5AHIA 1XAUA 5D1QB 4FA6A 1FWXA 2OMBA 5FJPA 4EK7A 1FX6A 1SXCA 4XPBH 4A2EA 4XXCA 1R3YA 1KYDA 2XQBH 4DVRH 3FGCB 2FIKA 3FVMA 5AG8A 4ZAKC 3KJ6L 4KKNA 1I3GL 2CBQA 4JQ4A 4DP7X 4M51A 3H3KA 2FDSA 2R8WA 4I9XA 5BMWA 4RDWA 3PQYD 5DA0B 3UZWA 4K4KA 3ULVC 2DJXA 1U8KB 1CECA 1DCLA 4PJCF 5JIPA 1IGTA 3X3GH 1Q6EA 3Q5TA 1RJPA 1NWOA 1UQZA 3V0TA 4EX4A 2X0HA 1ONXA 2VDPH 1T66D 2DT2A 1IZKA 4LNRB 4H5SB 3HG1A 2ZX9A 2CRIA 2N1TE 3RTQD 3Q7JA 5HQMA 5IB5B 4F7EB 2PD5A 5A8NA 2PKDA 5DCDA 1G67A 3EBHA 2I9TA 3WAJA 4XXWA 1I8LA 4JM4H 1LP9E 3IGSA 1C92A 1IM3D 3KOZA 5GRJH 1G7UA 3LSBA 5EZLB 1KV5A 4JE4B 2GVJA 4YBQD 4YHKL 1OHLA 1QWUA 2N01B 1G7MA 3CNKA 5G1TA 5DJDB 2V7NA 4XNZB 2BVPA 4WJ5A 3WFBH 1JGEB 3NIFE 1I0BA 1OAKL 3MA7A 1U5HA 5AC8A 1B90A 4HYTB 1DUZB 4G1EA 4QEGA 3MLRL 4C4KT 4G6KL 4KXAA 4N02A 3FT4A 3QR1A 2PPGA 3RB5A 5L4IA 1OE2A 4K3EH 5C97A 5B3JE 5KZCD 5C70A 4PJCB 4CNSA 7PAZA 2RUSA 1Y18B 4GPNA 3QEQD 3GNOA 1T40A 4XMLH 1OF6A 1NVMA 1U3YA 4PEEA 4KK5C 4NBZB 2W0UA 1BXCA 2PP8A 1O6TA 3S37H 2PDNA 4OQ1A 2LVEA 3V52L 2J71A 3WIFA 4BELD 1K85A 3MGAA 1U8PA 1VIWA 2PYFB 3RWEA 3WEAA 3WDJA 3AHYA 4V11A 4WEUD 1P6BA 2W9MA 5C0AA 1NQ6A 3MGOA 5DS1A 2Y25A 3SKNB 3TQVA 5JOEA 3FO9A 1TRDA 4JB9L 4GVHA 3TZVD 3V6OE 2NW3B 2DMHA 1ELSA 3RX8A 3APTA 3F5JA 2WBJA 1AO7A 4DP2X 2LLNA 4Z7WF 1A3WA 1KBKA 1SNRA 1QBBA 3MQIA 2XISA 3MRFB 2OI9B 1V7AA 2BWDA 3PFQA 3FQTB 1AIFB 2NTFB 2ADAA 4I48B 3VXQB 3SADA 1XEDA 5DUBA 5T1LA 1Z3NA 4Y2WA 4QRPB 5C0CE 5KN5B 4F2MB 2WXFA 1QW9A 4EDWL 1IEBB 2JF1A 4NUMA 3AROA 1D7BA 3FONA 5IG7B 1YNQA 1HL2A 2MSPA 2E7MA 4JKMA 4ZCWA 4QNWA 2E74C 4I4WA 4IPPA 1S2UA 4AZ6A 1PZSA 1LDPL 2J3SA 3N9SA 4P2AA 3EYVB 1OZUA 2GK0A 1MY5A 1AQKL 2O26U 4LDEB 3BIKB 1QNZH 3L3JB 4CADB 3NPUA 1SSDA 3NQGA 1TTAA 1L6GA 4HJEA 2V6AA 2MTAA 2J6WA 4LGXA 1HUVA 3SCSA 4D6CA 3PAOA 5AD0A 2VD8A 3PWLB 3WEBA 4N2HA 3DX8A 3CJPA 1Q2RA 2QGCA 4RAHA 3BRFA 5FGCE 4B7LA 4DHGA 4EMZA 3I50L 1AR1D 3GYCA 5GSRB 3J7HA 4GIAA 3GRWA 5LIKX 3L67A 5GJMA 4XH2A 1ETZA 3QFGA 3B2XA 4LGPB 2D3LA 1ZVSA 1BXXA 4DPAX 1BQLH 1SF5A 4AM0Q 2OCFD 3KE0A 5E8DL 5LIUX 1WKFA 3OZMA 4H41A 3PJLA 2XYBA 4C7GA 4O4YL 1PX3A 1SXZA 4IF2A 1N0XH 4LCCA 4J6RL 3WQOA 2CBTA 4JFOA 1WFNA 4OZFG 2VSKB 3B8TA 4KEMA 1YN6A 3L3IB 2FR4A 2G5UA 1J6OA 1P0KA 2Y63A 5E2UL 1POKA 3CCHB 3WNPA 1ZT1B 5JPNC 3H6AA 3UF9A 4HJ0C 4IFKB 4AEHH 3NIDB 4JYFA 3DK2A 4Z3TA 4ABUA 3BPLC 3BVJA 4NRYB