3L4YA

Crystal complex of n-terminal human maltase-glucoamylase with nr4-8ii
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 272
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4yA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4yA01
2D0FA 4P7RA 2Q8XA 2WPGA 4HP5A 2WMFA 4QCEA 4D6IA 4V28A 3SCOA 1GVYA 4CCDA 3HG4A 1PPIA 2YOCA 5E9AA 1E4LA 5C8BB 2D1ZA 3A6OA 2W67A 1B9ZA 4PEEA 1E6SM 1RD6A 4GPNA 1NQ6A 1GJUA 2A3AA 4M80A 4UOJA 1UOKA 1KTCA 1J9YA 3H53A 4F9JA 4D6CA 3CZKA 3BXWA 3VNZA 1KFWA 1UHVA 3H55A 3BUIA 3SEPA 3WEOA 2E4TA 2WMIA 2ZUTA 3PTQA 3VIFA 1JFHA 2WC4A 1E0VA 4GZEA 3W24A 1WAWA 5EB8A 1GCYA 1W3HA 3FW6A 4FLQA 5I0DA 3CUIA 4J27A 1OSEA 2FGZA 5KEZA 1B3XA 4D6HA 2XN2A 3AMGA 1F4HA 3OZPA 3F5JA 2FHBA 5I5RA 2ZUMA 1EO7A 2VR4A 2VUYA 2DT2A 3POHA 4W87A 1GW1A 4HU8A 1Q6DA 1T0OA 1IV8A 2X2HA 2FH8A 4JL1A 1M7XA 4MTVA 2YJQA 4CGTA 2YDQA 1E6PA 3GXFA 1B31A 4H8HA 4RE4A 1BHGA 1WKYA 3ARTA 4XV0A 1EXPA 3PZMA 1V0KA 3WUGA 3GNRA 3VMPA 4JHZA 5E09A 4AMXA 3AIVA 5AYIA 4PCTA 4HU0A 3VUPA 2BHYA 1UWRA 1MW3A 4ATLA 3F5LA 4U3CA 2XGBA 3D3AA 1LG1A 1ZBVA 2QHAA 1B90A 1JYXA 2QPUA 1CZ1A 1UR9A 1UD3A 2AOSA 2DT1A 3II1A 5D8WA 2WMKA 2QMJA 3DDGA 2VX4A 1PX3A 4JCMA 1KTBA 4TX8A 2F7OA 4TXEA 1BSIA 1JF5A 1LL7A 2E0PA 2NT1A 4W8LA 1C7SA 8A3HA 2XGIA 1UH2A 3VD4A 1HT6A 3ALGA 1NH6A 3VD3A 1WO2A 3B8SA 4HA4A 4WKAA 3TONA 4IISA 4UFKA 4OOUA 4DO5A 1QW8A 2VR5A 3CLWA 1QNOA 3HZ3A 2VZVA 4AZHA 1H0IA 3RMEA 2J7BA 1JG9A 1QW9A 3WNKA 4UCFA 3WF2A 4UQAA 4CVWA 3VIOA 1ITCA 3WQ4A 1FHLA 1UWIA 1YHTA 1R8LA 5CZKA 2HISA 4Z2JA 2Y24A 3T2QA 1UR0A 2GK1A 3GH4A 4W7VA 2ZWYA 1ZBKA 1BLIA 3ARXA 1W3JA 1FH9A 1ZBWA 4J3WA 2D73A 5ABFB 1EOKA 4AC1X 1D3CA 5A6LA 4OUEA 3LPGA 1JDAA 3N13A 3WUFA 1H09A 1M53A 1QNPA 4WK9A 2W91A 1MQPA 2DDXA 2XYLA 3IAQA 1UKOA 4NF7A 1K9TA 3WQ6A 3AHXA 3UESA 2X2YA 4DUWA 2EADA 2BV9A 4FNRA 4CN6A 3OZOA 3BVTA 3WH8A 5A2BA 1C92A 1JIBA 3PZIA 4AD4A 2YL9A 2PWGA 3WNLA 1EQPA 2OWCA 5FL0A 2DSZA 1BYCA 2IUZA 3BAYA 2O9OA 1GOIA 1TMQA 2ZICA 3W26A 1MFUA 4Z2HA 2A3CA 4GO9A 2VRJA 3AHTA 1HKIA 3K4DA 1LL4A 1CDGA 4MAZA 3AIWA 1CPUA 2ZX6A 3FAXA 5ABHA 4BZYA 1MQQA 2GJXA 3ZJKA 1XC6A 2WNWA 1HXKA 5IDIA 2ZX9A 1QVBA 2PF0A 1QX1A 3BH4A 4HOWA 5A69A 2YL5A 3T08A 3W27A 1IT0A 1HJQA 3OA5A 4D71A 1M03A 1TQSA 4GXPA 3UR8A 1FHDA 3CBWA 4X0VA 1X1NA 2EABA 1R86A 3GXDA 1GOOA 4PTVA 4CCEA 1HKMA 2NT0A 3W28A 1ZS2A 4W93A 4XX6A 1VFFA 3W37A 1GONA 4CD8A 2ZUVA 4OJYA 2C7FA 3VX0A 2WKGA 3ARVA 4MB4A 4MJ4A 2WSPA 2BXYA 1JYVA 1QI4A 5JBFA 1TVPA 1B2YA 2JIEA 4DO6A 1HP5A 4R5EA 3AMKA 3ZMRA 1VEPA 3HG2A 3QOKA 4R27A 4ZXLA 1EDGA 2X09A 2YFOA 3GYCA 3AISA 1PZ2A 4AYGA 1JDCA 3L4XA 1XYZA 3LXCA 5I77A 3PZVA 4QFUA 2EPOA 1UWUA 3D4ZA 1W3KA 2XHYA 3RILA 1E15A 4PYSA 4KRTA 4AD0A 1E1EA 1TUXA 1ZJAA 3A4WA 3A23A 4FLOA 2OYKA 2XFYA 1QNSA 2E9BA 1ZJBA 1PX8A 1WE5A 1CTNA 3S2CA 1E9TA 2VQTA 5D9NA 2QMKA 3CUFA 1JZ8A 2D23A 3BUBA 1C3FA 2CHOA 3VDBA 5GNYA 2QF8A 1P6WA 5BWFA 1HTYA 3GDBA 3SCTA 3T2OA 3FXYA 2GK1B 1UD8A 5D4YA 2CXGA 3WY4A 5FCZA 3KZSA 1QWNA 1J01A 3TTSA 5I78A 1AMYA 1UR8A 4HA1A 3OBAA 5A1AA 1Q6CA 1TFVA 2FHFA 2WWDA 1H4PA 3N11A 2X0HA 2ALWA 4LXFA 1NOUA 3RJYA 3PTMA 4JFUA 3SCPA 3NDYA 2J7GA 2FE0A 4C7DA 3VIHA 4HOXA 3WDPP 1W9DM 3CZ8A 2CYGA 2YDSA 3CGTA 1K9EA 1W1TA 3AJ7A 2DSVA 2G4FA 1R85A 3NSXA 3WH5A 3I3BA 1ISVA 5GPRA 3VIPA 3VVGA 1PEZA 4IUGA 3SUVA 2QPSA 2EPMX 1K6AA 4AXNA 1UH3A 4TX6A 2YA0A 4EAMA 1UR2A 4P8WA 1KWGA 4AW7A 1K9FA 4UFJA 4NXKA 1RP8A 1XH0A 1XD0A 4FNPA 1BVZA 3ARQA 1WDQA 2OSXA 3WBEA 2EO7A 3ZQ9A 1WNOA 4BF7A 4MDPA 4JKMA 1CGUA 3WDJA 2OWWA 3BMVA 4OIFA 1HN1A 1G5AA 4RL3A 2NW0A 1MWOA 4CU8A 1QWUA 3E1F1 1D2KA 2DSWA 5A6BA 3CUJA 4DM1A 1M04A 1ODZA 3DC0A 2DIEA 5E6ZA 2XWDA 3CPUA 1AVAA 3PZOA 3BC9A 5DMYA 2IXUA 3LMYA 3VGDA 3ZR6A 4GZIA 4MADA 1IZKA 2VMFA 2VQUA 1JZ4A 4OBSA 4Z2KA 3ARSA 1BG4A 1OD8A 3AXHA 1KQZA 2PWEA 1C7TA 5GNZA 1R47A 2YDRA 3BUQA 1H11A 5GNXA 1XSIA 1HJXA 4Z2GA 4HZ6A 3WIJA 3OB8A 4XUYA 2WZIA 1UH4A 3WNNA 4YHEA 4W8AA 3SCNA 3W4RA 4BCEA 3BMWA 1OT2A 2EQDA 3QGVA 2E3ZA 4JIEA 3CV5A 1E72M 2VTFA 2WSKA 4PSPA 4BA0A 3U5YA 3RM8A 3A22A 1CIUA 1TG7A 1B3YA 1R75A 4PMYA 4JZ5A 3QHNA 4GZJA 2FDMA 2J7DA 2BVYA 4NX0A 2E40A 4ACZB 2DIJA 3AIRA 1DWIM 1E1FA 1J18A 1JGIA 2XWEA 2D0HA 1HVXA 2B31A 5A8MA 5HDRA 3ZOAA 3TV8A 4MB1A 3SCRA 1Y7VA 3WH9A 4MNMA 4F66A 4OBRA 4V2XA 4GQQA 3AS3A 4OZOA 1I1XA 3SURA 4ZE5A 3BAXA 4NZJA 3AI0A 2ZOXA 3IANA 5ABFA 3W0KA 1EHAA 1Z32X 1CXEA 2ZX8A 4GI8A 4PMXA 3ZT6A 4KMQA 2VRKA 5A6SA 3VGGA 1L8NA 4M29A 1UR4A 2A3EA 2XG9A 3WQVA 1SFSA 3F5KA 4W5UA 1CBGA 2CKRA 3CUHA 2D20A 5A8NA 4GKLA 2G3JA 3ZIZA 1RH9A 5BYWA 4XB3A 2YL8A 2J47A 2FYVA 3MSDA 1H49A 3KL5A 2J7EA 3CMGA 1V6VA 1NWSA 1OD0A 1BQCA 1AQMA 1UA7A 4AEFA 4UR9A 1TCMA 2WBKA 2ZUNA 3SCQA 3RJXA 4D72A 3KL0A 1KBKA 3LRKA 2A3BA 4M1RA 5I24A 4TVCA 1EIBA 5C71A 1V3LA 4A4AA 5HPCA 3UR7A 1MW2A 3GNOA 1GHSA 1E4NA 1QOXA 1QBAA 3KL3A 1QHOA 4QLLA 3AXIA 4WLCA 2EJ1A 3NJ3A 1UWQA 1A3HA 4JFSA 1NP2A 4TOQA 4C7GA 3NSMA 1V6UA 1U30A 2JALA 2A3HA 4AZCB 1BYBA 2XFRA 2JFEX 2WWCA 5HXMA 4MJ2A 4UZUA 3B9AA 3ZJ8A 3WL0A 3N15A 1J0JA 3VDHA 2VO5A 2OWXA 1QPKA 3N18A 3OLGA 2OSWA 4E8CA 2XIIA 4D6GA 4DM2A 1W9VA 1UD6A 1QI3A 3ARUA 3VIGA 1XCXA 3ARYA 2JF6A 5DEZA 4AD5A 4PTMA 4CD4A 3BAIA 2E9LA 3QHOA 3ARRA 5CLTA 2WVSA 3MS8A 3PTKA 1PE31 1V02E 4HMDA 1XHGA 2PWHA 3OLDA 5FD0A 3BLPX 2J8FA 5AY7A 4FLRA 3WDQA 4D6EA 4YN5A 3A47A 2WK2A 4WF7A 3HJEA 2VI0A 2W92A 4W7UA 4DWSB 1V03A 2E8ZA 2VX7A 1VEMA 4PN2A 1W3LA 1KGUA 3S6TA 2EEXA 5A6BD 4TTGA 2G3IA 2XN0A 1EGZA 4E4PA 4NZFA 3CHFA 2ZUSA 3BVUA 1NWRA 5CPTA 3A4AA 3SUUA 3D52A 2YA1A 3KEHA 3WL1A 5I79A 2OYLA 2UY4A 2UY5A 4AWEA 1UA3A 1HIZA 3O6AA 3MU7A 3SUWA 1BYDA 3AZRA 3AIUA 2DH2A 2PWDA 1HI7A 1U33A 2PWFA 3D4YA 4GINA 4WSJA 2BVDA 1MVYA 1WCGA 1PS3A 3CTTA 4Z2LA 5A6AA 3F4VA 1OWQA 2VX5A 1TQVA 4UOQA 2WVVB 3OGSA 2WVUA 4AMCA 2J79A 3WF3A 1QI2A 1W2VA 1EQCA 1KGWA 3ZT5A 1FP9A 3HU7A 4ZEPA 1ISWA 4CVUA 2YLAA 1E73M 1W1PA 5E0CA 4LPCA 1OT1A 1PAMA 4N0RA 5M17A 3SIMA 1WZMA 5KZ6A 1KB3A 1VBUA 3GXTA 2JF7A 3CIVA 4PMOA 1GQLA 5EFDA 3EJUA 5CG0A 1B3WA 2DSUA 1R87A 4CD5A 3W81A 1TA3A 1UWTA 3WENA 1JDDA 3G6LA 3DX4A 1SMAA 1G01A 2GVYA 1DEDA 2XPKA 5CSYA 2ZE0A 3HMCA 4GQRA 3THDA 4U2ZA 3PZGA 3LRLA 2JEQA 3BLKA 9CGTA 4D1IA 4JCLA 3GXIA 3MMUA 1A47A 4J3UA 4AMWA 1WZAA 1UYQA 2Z1SA 3ZM8A 7TAAA 3BVWA 2GDUA 4M24A 4XZWA 1VJZA 2CBVA 5A8OA 2VOTA 3CHCA 4AD3A 4M82A 4FMVA 2W63A 1OINA 1C8XA 1UKSA 5CPQA 3AYSA 4P7LA 1OGBA 4EK7A 2G41A 2CBJA 5BXPA 5IHRA 3WBAA 5E6YA 3AZTA 3U5UA 4C7FA 1E0XA 1J0HA 3ECQA 1KXVA 1CXKA 2EACA 1ZL1A 1GZJA 1QNQA 4PRWA 4CD6A 3EDDA 3VIKA 4B16A 3FHAA 1YQ2A 2O92A 2EPNA 5HPOA 1MQRA 1J10A 3CH9A 2VJXA 4HMEA 1KGXA 5D8ZA 4S3KA 4PMQA 3BCFA 1H5VA 3WMSA 2CITA 1VRXA 1FFRA 3RDKA 1HP4A 3SUTA 3BAWA 1V0NA 3AHZA 4MAVA 4LYQA 2ZWZA 5LA2A 5FIPA 5A6MA 3WUEA 1RP9A 2XVPA 2F7RA 1JAEA 4X9YA 1EA9C 3TOPA 1IZJA 1H0GA 3LX9A 5E0FA 1CXFA 2ZXAA 3NIYA 4PUDA 2F61A 2VZUA 1XYFA 4MNJA 4AZGA 6A3HA 4D6DA 3TTOA 3UCQA 1E6XM 3GBEA 2PI6A 1UD2A 2WC3A 4RE3A 1CGVA 1EO5A 2WXDM 4ACZA 3S5YA 4AZ6A 3AROA 1V3IA 4W85A 1LWHA 3A4XA 4AZ7A 8CGTA 2WMGA 2VNCA 4MPKA 3WEZA 1PZ3A 1JNEA 3AIQA 1DWGM 4EKJA 5I23A 4AZIA 1LG2A 4NRRA 2ZUWA 2VL4A 5D9OA 3POCA 1US2A 1J0YA 3LPFA 1KXTA 3BVVA 1OGGA 2PBGA 4FNSA 3RM4A 2VVSA 2X2IA 3VSUA 4UOZA 3ZJ6A 4UZSA 1C93A 4J3VA 5JBDA 2G3NA 3PZUA 3AS0A 2YLLA 1WZKA 2FHCA 1G0CA 3GNPA 1JZ3A 3TTYA 4WIWA 2XFFA 1UUQA 4D1JA 4GIAA 4KGLA 3SCSA 5AYBA 1KBBA 4ACYA 3BSHA 4WKHA 1GUVA 2YIHA 3VGEA 2VCCA 3OIHA 3K8LA 2PB1A 1V6YA 4P8XA 1D7FA 1ZB5A 2ZXQA 1FA2A 3QR3A 3WDRA 3OG2A 5AC5A 3CMJA 1HXJA 3AIBA 1GVIA 1W9UA 3VINA 3DYOA 3MUAA 3W25A 4N42A 1TA3B 2D22A 1VB9A 2VCBA 3VILA 3KE0A 1UKQA 2J74A 3VGHA 1PCPA 4AYSA 1JZ6A 3D5HA 1M01A 2WHKA 1JI1A 1W91A 3BCDA 4A3YA 1AQHA 3W82A 3S5ZA 4LGXA 3UETA 3IK2A 1JYNA 3IJ8A 2DEPA 1SZNA 4YPJA 2VZTA 2CHNA 5DFAA 5I3DA 5EBAA 1OCQA 3GXPA 2QV4A 2XN1A 3N12A 1HWWA 2BY0A 3VIMA 1CYGA 4QLJA 1MXGA 1EH9A 2YBUA 1HL9A 3N04A 5BXSA 1VAHA 4LX4A 1VF8A 4DWSC 1CLXA 3ZSSA 2XSAA 4YHGA 2RGMA 4M81A 1E6ZA 3VD7A 2J25A 5A2AA 4FNTA 4CUCA 1QHZA 4AZCA 3VTRA 5DO8A 3RO8A 3EDEA 1WPCA 4OGZA 4GI6A 4U31A 2JIWA 4A3HA 4QAWA 3WH6A 1R7OA 4ATWA 1I1WA 3AZSA 3WD1A 6TAAA 1HJWA 5E70A 1VFUA 4U33A 1W9BM 1V3KA 4BS0A 2VZOA 1BG9A 5HOSA 3BAJA 1CWYA 2YL6A 4DO4A 2ZX5A 1C90A 2DH3A 1H41A 1WB0A 3WD3A 3VM7A 3T0AA 2FH6A 2D2OA 2AMGA 3BGAA 1JI2A 4LYPA 2OW7A 1I75A 2XVKA 1NP0A 2WVTA 1L0PA 2J7HA 3VM5A 2BVTA 3L4UA 4DWSA 3LPOA 4Q22A 2W62A 1C8YA 2W4XA 1F4AA 3W38A 4UFLA 4P8UA 2CESA 3WN6A 4JFVA 2EAEA 1V0LA 1CEOA 3HG3A 1QHPA 2GDVA 5ABEA 2W61A 4JKKA 2OSYA 4W8BA 5IFTA 1ODUA 1BYAA 3IJ7A 4KWUA 4UQDA 1MFVA 1W9PA 3IGUA 4P7OA 3A3HA 2BXZA 4K68A 3EBVA 3AMDA 3SCUA 1KXHA 1W32A 2CBUA 3GH7A 3AYRA 1KQYA 2F1AA 3DX0A 1ZU8A 4FF5A 4LYRA 2UY2A 1MW0A 2V3FA 1LJYA 1JZ7A 3EJPA 1E4IA 2WVVA 1HVQA 3WELA 2EPLX 4UFIA 1V0MA 1LWJA 3G6MA 3RM9A 2WHMA 2Y8KA 4FNUA 4W89A 3EDFA 1EHNA 1JYWA 3A24A 1NWUA 2X0YA 3A21A 3WD4A 1E40A 2J78A 3AHVA 2DGAA 1TQUA 4CD7A 1S46A 1B1YA 4W5ZA 4DUXA 3VDCA 4L4OA 3BLBA 4CCCA 3L4ZA 5D9MA 4L4PA 1C91A 4ML4A 4AISA 3PBGA 1B30A 1HJUA 4PMZA 1PIGA 3K1DA 1KR0A 2WW5A 4H7VA 2BY3A 3EMCA 1CXIA 1OB0A 3PZ9A 4BQ2A 1JFXA 3PN8A 2HVMA 2EXOA 1TZ7A 1UZ4A 4W86A 1DHKA 3UEQA 1BF2A 3GZAA 2BS9A 2E9MA 2CERA 2DPEA 4FK9A 2F1BA 2O9PA 1H1NA 2V3DA 1ECEA 1JAKA 4AIOA 1W1VA 4IM4A 3WY3A 3VIIA 3ARPA 1V6WA 3H54A 4KH2A 1B0IA 1GOQA 3DECA 3WNOA 1FH8A 1XD1A 4J3TA 5TD4A 3T0BA 3RIKA 3TTQA 1BAGA 3PZQA 5DF0A 1UKPA 2XM2A 2D3NA 2J7FA 1GOMA 5IHSA 3N1AA 1JZ2A 4GO8A 1JL8A 1UR1A 2VRQA 2NSXA 3WD2A 3RCNA 3DHPA 2W5FA 3RPMA 1W2PA 3DYMA 2TAAA 3VD5A 3VIJA 2IGTA 1G1YA 4ZE4A 3L2LA 3AICA 3W53A 4B3KA 4AIEA 1GPFA 2RGLA 3AHYA 2WHJA 4HPGA 4MB5A 2F2HA 3CC1A 2DT0A 2V3EA 5ECUA 2PBOA 3PZNA 1NOFA 1WDSA 1G9HA 4MB3A 4WKFA 1HL8A 1GQJA 2VURA 3AFBA 1HNYA 1FOBA 3AXXA 5CPSA 5C70A 2V3GA 5A6KA 4AD2A 1BVNP 3L2MA 1BTCA 4ZXOA 3U57A 5I2UA 3WFLA 3WF0A 4BQ4A 2BFGA 1UD4A 1JNDA 3NSNA 5FOOA 3I3DA 2CPUA 4UNIA 3UERA 3WUBA 3L4TA 2F7PA 3VU2A 4F9DA 4NXSA 1H3GA 2WAGA 3WKZA 1HJSA 2Y2WA 2J4GA 2Z1KA 4EE9A 1GOWA 4H2CA 3VGBA 4W7WA 3VMOA 2ZIDA 3LPPA 2UWFA 5HBFA 2WCGA 1JXKA 3TA9A 4JL2A 5M5DA 5AC4A 3NCOA 3M7SA 3AS1A 5A95A 3GBDA 4CN4A 1CLVA 4DWSD 4HTYA 5FKYA 4AY1A 1CGXA 1W1YA 3VNYA 1KCKA 4MNKA 4FNQA 4J3XA 3APGA 3VSTA 2WLYA 4H8UA 1UWSA 2CKSA 5EFFA 5F7UA 1JXJA 3BUPA 2WM0A 3K8KA 3N17A 2Y4SA 4H8VA 1J0ZA 3WSUA 3ALFA 4U5IA 1UG6A 1TQTA 1KWKA 2OW6A 5GQBA 4B9YA 1NOWA 2XJ7A 5A3HA 2YKKA 3NDZA 3W29A 2WANA 1CGTA 1JD9A 2X1IA 3N9KA 2GUYA 2D3LA 1V3MA 1GNXA 3HN3A 3VSVA 1TVNA 7A3HA 3MMDA 4AIUA 2CBIA 1PJ9A 2GSJA 3VO0A 3AMLA 3CUGA 1DTUA 1V3JA 4NRSA 1DWAM 3BVXA 4HZ8A 3O9NA 2YA2A 4GI9A 1FH7A 1VIWA 2GJRA 1BGAA 5DT7A 4S3JA 2VT0A 3WY1A 5FL1A 3EJSA 3KWXA 2XTKA 3FHQA 1MW1A 1MYRA 2Y5EA 4EANA 4E8DA 1LQ0A 3MANA 4J7RA 1US3A 5LA0A 3D50A 3LXBA 2V5DA 1J0IA 1OIFA 2CNCA 4F8XA 5A8QA 2BY1A 3UG5A 3T2PA 3DX2A 1NWTA 3GXNA 3U7BA 2YBTA 1JZ5A 3MV01 2CCRA 1LLOA 1BGGA 2WYSA 1XSJA 1DWHM 3ZR5A 1E6RA 4P7NA 1OM0A 1ISXA 1HKKA 3I3EA 1E70M 2BHUA 4ATDA 3WF4A 5LYRA 2MANA 3MMWA 1TR1A 3JUGA 1PBGA 3WNPA 2Y8VA 1XV8A 1BPLB 1U2YA 4PCSA 2PC8A 4WSKA 1SR0A 2WMIB 4M56A 1OBAA 5EMYA 3AIEA 1DP0A 4U5KA 1HJVA 4ZFMA 1VFMA 3FN9A 3A5VA 3KLLA 5BRPA 2C8NA 3AQUA 3WMCA 4QCFA 1E4MM 2OYMA 1GHRA 4U3AA 3DYPA 4PUEA 1QNRA 2JE8A 3NYDA 3B9EA 1XSKA 1Q6GA 3WD0A 5M03A 3EDJA 1Q4NX 1E6QM 4HMCA 1WZLA 4KRUA 1B3ZA 2WB5A 4Y7EA 5A2CA 2DQXA 4TUFA 2O9TA 2WCAA 2WLZA 5D9PA 4PSRA 4J3SA 3CZLA 4H41A 3DX1A 3VMNA 3SUSA 3K8MA 3CHEA 1KCLA 2G3MA 4W88A 2D0GA 3WDIA 5CQ1A 1E55A 3O2LA 3OLEA 3MO4A 5CXPA 1V02A 1E9LA 1UZ1A 2VC9A 1UASA 3ARZA 4V27A 3BSGA 4PMUA 3MUY1 5JUVA 1V08A 4JFWA 4PMDA 1VBRA 1JD7A 4PTWA 2F7QA 1FP8A 4D6FA 3IJ9A 2WMJA 4URIA 3SCWA 4WJXA 4Z2IA 2WHLA 5A8PA 3KLKA 2JEPA 1OGSA 1FFQA 1LL6A 2ESCA 5JBEA 2OLHA 2VVNA 1E3XA 1ITXA 3ZJ7A 3EJRA 3J7HA 1CENA 2VX6A 1WP6A 3FY1A 7CGTA 4CU6A 3CO4A 2J77A 4TVDA 5BRQA 5DT5A 2QLYA 5CGTA 4D6JA 4QP0A 1GJWA 4UQCA 3ZT7A 3FNDA 3TP4A 4OOZA 1ZBCA 3AS2A 4UQ9A 1G94A 2F18A 4X0NA 5A94A 2WBGA 1SMDA 3VGFA 1E6NA 6CGTA 2CEQA 2BY2A 3EJQA 4DUVA 1HX0A 4Q7NA 3CZJA 3DHUA 2PSPA 2AAAA 3EDKA 2J8GA 2GJPA 5CLWA 3B9DA 3UG4A 3MV11 1KXQA 3L4VA 2O9RA 4HA3A 1XGZA 1PS2A 1SYTA 3HG5A 1UKTA 4AEEA 1CGWA 4UQBA 2ZXDA 3PZTA 4QDMA 4W84A 5I6SA 1MXDA 1XH1A 4OKDA 4CKQA 1TE1A 2F8QA 5BXTA 1PIFA 3GXMA 4B3LA 3MI6A 4M8UA 2WCSA 4AZ5A 4NI3A 3GM8A 3QOMA 1E5NA 2YFNA 4BQ5A 2BNJA 2C0HA 4CU7A 1KR1A 2WKLA 3OGRA 3ZO9A 1VJSA 3CZGA 4MDOA 2XIBA 1J0KA 3WQ8A 1JF6A 2CIPA 1PX4A 2FGLA 5IXEA 1V3HA 2J75A 1C8QA 1R46A 3EMZA 1H2JA 3CZNA 1AQ0A 1NARA 4PTXA 1XH2A 4HZ7A 3U7VA 4NSBA 5M3WA 3VPLA 4PMRA 1OIMA 3VOCA 2G8ZA 3WQWA 1LF1A 4RE2A 1BFNA 4JKLA 4P7QA 4IPNB 4PMNA 2XUCA 1HKJA 3ZSTA 3GH5A 3LRMA 2DT3A 2WZHA 5IFPA 5CSUA 4NZCA 4FLSA 2UY3A 1J11A 3K46A 3MSGA 2GJXB 1VFOA 2XM1A 2XSBA 1R33A 1E56A 3W6MA 4H04A 5JIPA 3FAWA 1R7AA 4JHOA 5E1QA 1XRVA 1DWJM 2DSKA 5BCAA 3WFZA 3WQ5A 2V5CA 3T0DA 4P8VA 2GFTA 4AD1A 2WMHA 4QLKA 1CGYA 4J28A 4ZENA 5CJ5A 2V38A 1CXLA 1QI5A 1CNVA 3VDAA 1Q6FA 4KGJA 1J12A 1V6XA 4JFTA 4BQ3A 1PSPA 3OGVA 2X05A 4TTUA 4U2YA 1UQZA 1W9XA 1E5JA 4UFMA 1EDTA 1ISZA 5BROA 2J62A 3ARWA 3CHDA 3EYPA 1N82A 1UQYA 3WNMA 3VX1A 1EDQA 1E3ZA 3PHAA 4B15A 1GOKA 3WH7A 3CZEA 5BXRA 2X2JA 1Q6EA 4XZBA 1E0WA 1NM9A 3WY2A 4AZBA 2E8YA 3IAPA 3UG3A 3AMCA 2IXVA 2VCAA 4HOZA 2W66A 2XVNA 4CN1A 3NUKA 1UD5A 3BAKA 1X6NA 1QI0A 1TQWA 3W6LA 2ZUUA 1CXHA 1O7AA 1VEOA 1EOMA 1GQIA 3AOFA 4JAWA 2ZX7A 5JIWA 1HF6A 2XVGA 2J7CA 4B9ZA 1O7DC 1GQKA 1WDRA 1O6IA 5LA1A 1RPKA 3DDFA 4IPLA 1WDPA 5CGMA 4HPHA 3DX3A 1X6LA 3T09A 1XCWA 3MKKA 1R34A 4MNLA 1DWFM 2CETA 1ESWA 3MUIA 3WMBA 2X8RA 3WF1A 1VENA 4PMVA 4F79A 4PBGA 5A6JA 2EBNA 3EJTA 3MUZ1 5HNNA 2BHZA 1B3VA 3OLIA 3SCVA 3WDHA 1CECA 3THCA 5ABGA 3GTNA 2EPKX 1ISYA 2XVLA 4UTFA 3BUDA 4LQ1A 4TVUA 3L4WA 3QHMA 1K9DA 1GORA 3EMQA 4E2OA 2D24A 4UFHA 3VD9A 3M6DA 1QBBA 2WC7A 3M07A 3K4AA 3LXAA 3VKKA 2ZXBA 3D51A 3WEMA 2VZSA 3CZSA 2WZEA 1E43A 4UQEA 1E71M 3L4YA 3M46A
chains in the Genus database with same CATH superfamily
1TPH1 1S2TA 3KLQA 3MRMB 2OR9L 3RNQA 3HPLA 2GK0B 2C9UA 1TZHA 4D6CA 4G3YL 3PAZA 4XP9L 1SW0A 2ZOUA 3D46A 1R9FA 4Y5VB 3C6SA 3VOHA 1WAWA 4IKKA 3CZFA 2ZOOA 1BFTA 3WIFA 5FYLL 4A2MA 3TYFA 4QT5A 4OZIA 5ETUB 1VCBC 3OEXA 2FJGA 1ONWA 3GXFA 3IK4A 1ZHLA 3MACL 4QR6A 4A37A 4OF8A 1U6AH 3SPJA 1YECL 3S3SA 4FX8A 4LHQB 1TEYA 1Q2SA 1RKRA 1A5FL 3UTZB 1C9SA 2HRGA 1R3SA 1N64H 2VW6A 3MV9B 5CCHE 1SUJA 4ODHL 3SZ6A 5TE6H 3QEGL 1KCVH 3ARGD 4LKCB 2V33A 3FCGA 4ICCX 4TX8A 1NAML 2NY6D 4XO4A 4M7ZC 1AYRA 3O3BB 3TU9A 3RMEA 2NR6C 4GYBA 3M4HA 2W65B 4WY0B 2DYRB 4CVWA 4LDEB 3A3WA 3OVPA 3FEMA 2XTJC 2JJSC 3RIAF 4EN3B 1BLIA 3ARXA 4PL1A 1TSHA 1B5TA 1EEPA 3LPGA 3CWHA 4UT9A 3M0VA 1FCVA 1H09A 1JHKH 3F05A 6TIMA 4GQPH 3MV7D 4XKYA 4FI6A 4DUWA 5DHMC 3NP4A 3DZ1A 2NR6A 5G2WA 2I5YL 1NCDH 3T8XA 3F4NA 4O52A 5U4NA 3FLUA 4QJ5B 2JJSA 3VXUD 4QHUB 1ADDA 4GWEA 2YW4A 1TUPA 4G6AC 4R7OA 3OZ9L 3MYJB 3TM6A 4IMLB 4GUHA 1ZEAH 4O51B 1XC6A 3S7GA 4OH2A 2PF0A 2MQCA 4HOWA 3RPIB 1S5TA 2APBA 4FHJA 1KO0A 4APQB 2R1MA 3VB9A 3TZNA 1FHDA 4X5WA 1AIFA 1XGTB 2GBAA 1IGJA 2H2SC 3MHUA 1HCVA 1XB8A 1QSZA 1P9MC 1P5VB 3LCYA 4YHOH 3JWNH 1J2BA 2AXGB 4PCFA 3LQAC 4P0DA 2WZAA 3GUWA 4MQXD 2BXYA 4PJIA 3PWIA 2EDHA 4Z7UB 1OE3A 5C0CB 3I84A 1MCOL 4F8NA 4MRBA 4R27A 4DNLA 2EDNA 2QCFA 1XMEB 3ETBJ 3UF9A 3FMGH 1YEDA 3RVVD 1P9MA 1C5DA 4JIHA 5BOOA 4K5LA 3QCVL 3A23A 5JNYA 3VFSA 3WMQA 2RACA 3PANA 1URIA 1T5WB 4H83A 3QYNA 4E9LA 3SDOA 1DE4A 5HHMB 3VQ2C 1Z1WA 4I2XE 1FZKA 1UD8A 2GCYB 1KA9F 4YHML 3KZSA 3MHGA 2KMWA 1UACL 2O1AA 2X89A 1QA9B 2WZ0A 3NPZB 5F0PB 1QKZH 1T4WA 5D2VA 4CQDA 2WQVA 3HNTL 3L1OH 3AWOA 1I7ZA 2IPUG 1RQ5A 4A8RA 3DX6A 3K2UL 1BVLA 4AVIA 4DGYH 3CVDA 1U8OB 4BFBD 2IQ9H 4P8WA 3D85B 4BFIB 4JRXE 1AHWB 4HS3B 4G83A 1Z6JT 3IDYB 1J6PA 2G4EA 3WBEA 3P2DA 1AJ7L 5T1LB 3GI9H 4ZX6A 4OLYL 5KJ7E 4OZHF 2X0SA 4PUWA 4KW2A 3TCEA 1SJHA 2E7CA 3C2YA 4JN8A 3CPUA 3IXAB 3BC9A 5DMYA 3Q8CA 1S6NA 5GRVK 1SO4A 1LT7A 3FYOA 2AQ2A 5HPMA 2PWEA 4FRWA 2ZF9A 4JUSA 1FYTD 1Y0EA 3QYCA 1U3HC 2VERN 4QHPA 4ZMOA 2JI2A 3WNNA 3RX3A 5C9ZA 1HH9A 2R2EA 4IJCA 1SXAA 3QGVA 2YEZB 3DHMA 3GSVB 2DQJL 4ALAL 4X9IA 3RM8A 3W7GA 4XCCL 4KS0A 4FIQA 1A1MA 4JZ5A 3LTSA 1M9WA 3VQ1C 4RDWA 3QXTA 2AZUA 3W2NA 1J48A 2D0HA 3EXTA 1GGBL 5HGHA 1AG6A 1TJMA 3IU3B 3SPHA 4K94L 4V1DD 4YOKA 4OT1L 5CR8A 4G1EA 3Q48A 1LP9F 1KV5A 1U3HA 1NCBH 4XCFL 5ICXB 3LAFA 4GQQA 2O56A 1SYSA 3SURA 2IW0A 4PGEA 1UEYA 2HRLA 2YHGA 1OCRB 2QVTA 2B81A 4GI8A 2J8UA 5GZOD 4JNMA 3GG1A 2WO2B 4W9TA 3DSFL 5GSVA 3ML8A 3MV8A 1P69B 3VGGA 1DPMA 1GZQB 2DW5A 1WOBA 1DUYA 4W9EC 1WFUA 1OTSD 2QKSA 1V6VA 4YDIH 1MNSA 2BRRH 4JHWL 1CE1H 4PJAB 4K7PY 4YDJB 3W9ZA 1I1AD 3NQFA 4X8XA 3VAVA 4JANA 3A12A 5D7IB 2HKHH 3WUWG 2IANE 4WTZA 1ZSXA 3GNOA 3DFYA 4WDWA 3PDDA 1CR9L 4I5RA 4MD5B 1VFBB 4IOSD 1Z66A 4WLCA 4JM2D 1GVEA 4C7GA 1AZ1A 5DHDA 5JW4N 4E42B 4AGQA 1MJ7L 1ILSA 4WGXA 4UUIA 3DIFA 4X60A 3KW3A 2EKGA 4E8CA 5AW0B 4YL9A 1E7VA 3QR1A 1RQBA 4HNVA 3R8BB 3PTKA 5BPPA 4DBDA 3STLB 4FQXB 1TJXA 3HJEA 4Z76B 4S1RL 4JFFE 2VI0A 1V03A 3V0VB 3IB4A 1OTUC 4F2TA 4IQLA 2PXYB 1MFCL 4IL0A 3UIZA 3TXVA 1EGZA 1DQLL 3Q6FA 2JIXB 4X9FA 3UPAA 4YHKH 2XRAH 2OYLA 4OFPA 3L0GA 1UA3A 3RU6A 4TV5A 3A6CH 3FA5A 2F5BH 1HI7A 4OZFB 1JGEB 1R1CA 1OWQA 4LVNB 4AUBA 3OAYH 3TWAA 5JIMA 4P8QA 1F6AB 3QFJE 2OMVB 4TQIA 5E1AB 3ZVHB 1WWAX 2HWZH 2SFPA 3VC6A 2NX5D 2E27H 3VDGA 3TLRA 5EFDA 4XN1A 4LOUC 4XH2B 1F6LL 4M48L 4DBEA 3S6CA 3WENA 3HUJE 2C13A 5BJTA 5LHDA 2CLIA 4UB0L 1BQUA 3SBWA 3QJFA 3WD5H 3T42A 5DCBA 3CFEB 4JCLA 3ZM8A 1UCWA 4J23A 3SPGA 1E9QA 3STPA 4DQWA 1TV2A 4P5MB 1MCDA 1IC1A 4F2BA 3ECUA 3U2JA 3P3TA 1XRSA 4EK7A 4OQTA 3U5UA 1QPXA 1BMGA 3QM3A 3ECQA 2HFGH 4L0ZA 5L88H 3QO1A 3ZGHA 1OB1B 1AGEA 4H40A 3FHAA 5FF2A 3QQNA 5EPMA 1XLGA 2EPNA 1DUZA 1HXYB 3NN8A 3EZ8A 4P9HL 2OYPA 1HP4A 3JT2A 1VDGA 3SUTA 2VWEE 3IDNA 2BK8A 3WUEA 1RP9A 4WHTA 5JW5A 5F9JA 1IGYA 1FWAC 1TPUA 1OFPA 4QRNA 2ZXAA 5C08D 2HPMA 1YY8B 3KPQB 2EO9A 2GOUA 5LAXA 4PRPB 3MLSH 4RW3A 4IIBA 3WJMB 4AQ1B 1HSAA 2WXDM 4M1CD 4NAJA 3MRIA 3HC3H 2DYPA 1BQHB 1MNUH 2Z1WA 2NY3D 3EWYA 3OHIA 2X1TA 4BBWA 1AFSA 3NAAL 1L6FA 5I23A 4NRRA 1JPSL 1FBIH 5D9OA 2OCCB 1J0YA 2WBJC 2Z1XA 3ZJAA 2IPUK 2VVSA 1R3HA 2A9DA 3EZ4A 2R29H 3TTYA 4P2QB 1UWEH 3MLXL 4Y16B 2VJ8A 3SO3B 4UWMA 1RPUA 1ZB5A 3QR3A 3VAEA 3DYOA 4N42A 1TA3B 7TIMA 4B5NA 4L3EE 2ZRVA 4UV4L 2WBJA 1M01A 5K9QI 5TFSH 4PLOB 2EUXA 3W7JA 1JGLH 3R58A 3C75A 4KH9A 4WVRA 4PC8A 1W80A 4Q9QH 5A5WA 5EEZA 2DLFH 5H2BA 4AU0A 4ZMVA 4W4NA 5GS0L 2XSAA 3KX6A 4YHGA 3OX8B 3D39A 5DJ0B 5HSFA 1OHQA 3QJZA 4ZOBA 3EDEA 4TU1A 4OGZA 4OZIE 2QGDA 4WO4D 2BNQB 2H90A 5MEOB 1Q45A 1V3KA 5HOSA 1A64A 3GK0A 5SWSE 1AACA 1YJDC 5EZOH 5ITFA 5IR1B 3CIXA 2IGLA 3VM7A 3KDPB 4PGBA 4JPWH 1U2HA 2OW7A 3PF3A 2OLSA 2C9SA 3VM5A 3P84A 3ILEA 4KKRA 3F83A 2CESA 2FBJL 3EPOA 1CEOA 4TNGA 5ABEA 2W61A 3GS4A 1VHPA 3HZYA 4G9PA 4P7OA 2DWDB 1G9NH 3AMDA 3B8IA 4KJWC 1DDHA 1E0UA 2GYSA 5F7BA 1E3FA 2CO6A 3DUUB 1RH8A 3LIZA 5I73B 1DJYA 1LUCA 1CQKA 4QHKJ 1LEGA 3O6FB 3TN5A 4I18B 3MZGB 1LO5B 4PJ7E 1Z5YD 3JUZA 2DGAA 1HOEA 3UBXG 2O5XH 3MP5A 3FU8A 1OO2A 2WOQA 1PIGA 4E0CA 1CXIA 3V36A 2VDKL 3QJSB 1NBQA 4WKXA 2JB5L 3U48A 4HJ1A 1GOGA 2XTJE 3G5YB 3JTSB 1CU4L 4EQ3A 3P69A 3LCXA 4LLVA 4EF3A 3CNKA 2Q3ZA 1QLFA 4NQCB 4I90A 3RK8A 1A4JA 3SY5A 3B03A 4M9PA 4IJRA 4ZMTA 5LGYA 5ID1A 5TD4A 1WLHA 2IIJA 1F86A 2J7FA 2N3JA 3N1AA 1YRKA 4CVXA 4C90A 5CIPB 2IH3B 3WD2A 3DHPA 4ZUVA 5KS9A 3N43F 4MNGB 3QZPA 4Y4KD 3IU4L 3BQ6A 1MH5B 4MB5A 3TBWA 3FO0H 2MKLC 3ASNB 2C1HA 3GJFH 2YAHA 1Z3GH 2OJ1A 4PJIE 5CSSA 1I53A 5IIEB 2GZXA 1KJMB 2FT8A 5FF6B 5IHWA 4L37B 1UD4A 1A7NL 3QRBA 2AGJH 1TSRA 3BN9D 1OP5H 3E0VA 4GIPD 4YBQD 3VGBA 2V37A 1UXWA 1FDZA 5J6HA 3VXRD 3EOAA 3ZE1E 4XZIA 1H6FA 4PWKA 4W70A 1U3YA 4BM7A 1SQMA 5EFFA 2OEMA 2VD8A 1IBGH 3BUPA 4Y1SA 2WM0A 2F53E 3SR7A 3V8CA 3QV7A 2EGZA 1TMHA 2AL2A 1QTSA 1ZLPA 4GQ9H 2H3DA 1YDYA 4A22A 3GSNB 4ZO7A 1VIZA 3VKJA 2JF1A 1PSKL 4FQCH 4HZ8A 3SDCB 3EO1B 5F8RC 4G5DA 4C65A 5G4EA 3QPKA 3GSUA 4KZCA 1W37A 3TJIA 4GEJA 3WI9A 4KVPA 3BDBA 4WQ6A 4QI3A 5A40E 2XTSA 1NUGA 4OKVB 1JZ5A 3NCYS 2CCRA 4OLUH 3QDHA 1XSJA 5CKSA 1DWHM 3X12A 2AJXH 1ISXA 1KTJA 1F90H 3C56A 1QNIA 2OOFA 1OSZB 2PD5A 2OT0A 4LIQL 1LQSR 2VM3A 1CDBA 3NXFA 5TPWH 5EMYA 3O8XC 2HJLA 4U5KA 3W23A 2C8NA 3I6KA 3WAKA 5KAQF 2J1YA 2QGHA 1H63A 4MCYA 5IQ9A 1I9IL 2JE8A 3B9EA 4KKBC 2ORBH 3VZYA 4OV9A 5FDWA 3G0SA 2PW2A 4U1GB 4HMCA 2AAMA 2C7UB 3C5JB 2VLLA 2IOOA 3GB7B 3SCMB 5A2CA 3EJCA 1BEYH 4GQGA 4Q6IB 4X7FC 4YJ5A 2HZHA 3G7TA 1ECZA 1SXZA 1E9LA 3O8XA 5ANMB 4PMUA 4KRLB 1GTNA 2EYRB 3MR9A 3O6YX 1IKOP 1ITXA 2D7TL 1ITBB 1FE8L 3EX4A 1G7IB 4ZFOA 3H1ZA 1ZLWK 5FWQA 4C56E 4XBSA 3DGBA 3NACL 4DVBB 2J8UE 3IFPA 5A94A 3WKQA 3CPRA 3V0WL 3UGRA 3U82B 1UUNA 1TCRB 3D25B 3E6FA 2B4CL 4H1LH 4DUVA 1D7BA 4ES8A 5AZUA 5CCJA 2LT9A 2AGKA 2DKMA 3MV11 2QUVA 3GU2A 1E5AA 1K8DB 4ONHA 2A77L 3GLZA 2JKEA 1PLGH 4W84A 3AUJA 2WLJA 4NYLB 2Z4TA 2CKBL 4AZ5A 1GOHA 3Q3GB 1KB5B 2MPVA 1VPOH 3AU6A 1HG3A 5L8JB 3GM0A 1FXPA 3PPEA 4H5SB 4R2GC 1TWZA 4RWYL 4HJ0C 1AH0A 5IXEA 3EWCA 3NPWA 3TA4D 3ARFA 1LDSA 1S9WB 1U93B 3HE6C 4A7VA 4WCJA 4NJGA 4RE2A 1ML0A 5ESQA 1K2DA 3GR4A 1SLUA 2JI1A 2VUKA 4JRYD 5EU4A 4PTUB 5IB4A 3M17A 4FXGC 5FM4A 5D2XA 2XM1A 2IDQA 2HBVA 1TTBA 3WE6B 3TZVB 4JFYA 2QUNA 3W0WA 1XRVA 2ACSA 2CUHA 3LKOB 3WFZA 4ADGA 5IBLC 2WQDA 4EPBC 4DZBB 1M7UA 4ZT1A 3QV8A 1QI5A 3CLFL 5KYUB 1PSPA 2QVFB 3HE6A 5FIEA 3OGVA 3HNVH 3DOIA 4TTUA 1CBJA 1LLAA 1CG9A 3BZ4B 5C07A 1P1ZB 1MRCL 3BD3A 4KJQD 1E3ZA 2YXVA 2Q8BL 3W71A 2A6JA 4GISA 3WH7A 4FXGA 2W66A 3AVEA 4TVSa 3RKDD 1G9MC 2Q6WB 1M56B 4ML9A 1ED3A 4UWQB 5DHEA 5AKSA 4KEUA 3TUUA 3BWSA 2VDML 4TV6A 1RHHA 1DVYA 1W5QA 4IPLA 3TE9A 5I8KH 1TZGH 2HTLC 3MKKA 4LJ3A 4YVXA 1IKNC 3L6FB 1Y1UA 4ZQKA 4XCNA 4K9JA 4UYQA 4XP1L 1FG9C 2EVGA 3D18A 4J2XA 3OLIA 4UMGA 1Q9KB 3GTNA 5E9NA 1X5ZA 4XPTH 1F8MA 2A85A 5FW8A 4YHNA 5K39B 3VACA 3NGJA 1UGKA 4XBPA 2EC8A 5CAYB 2KDYA 1KNWA 4P7RA 2Q8XA 1IKNA 3VRJB 4FQPA 4QCEA 3LGGA 3MSYA 2EDLA 1Z3NA 1RIVH 4ABUA 3LJ3A 4KCUA 3GHBL 2A6DA 5LWYH 1J86A 4FKHA 1ASOA 1RAKA 1Q6OA 4GMEA 3VIFA 2BVOA 3W24A 2YGVA 4H9ZA 4N7QA 3BL3A 3T0EB 4Q6XA 2RQEA 4RNFA 1PTZA 3F04A 1NEZA 3DMMD 3FFOA 4DKFL 2R0WL 1HE7A 4GNVA 3T77B 5EO0A 4XWOD 4RDVA 3SIKA 1E4XI 1S2VA 4HFWA 4OV5B 2QCMA 5A6TC 2G75A 2CSPA 4NJ9L 3EKZA 3WUWA 3O3DA 3IGAB 3IMTA 3MRDA 4G8IB 5B21A 4AQ8C 4F0MA 1X44A 3IJEB 1T8QA 3KM8A 4DLFA 2FEDC 1SN0A 5D8WA 1UZ8A 2V69A 4LHUG 2WMKA 1ZHBA 1M7DB 1T5XB 1PX3A 2GITA 3PL6D 1FIGL 4FOMA 4ZSOA 3WIHL 2CZDA 2YEVB 2ZOKB 3SN1A 1AKPA 2NY0D 2WOYA 3L5WB 5K2ZA 1T8XA 1WV2A 3LKRB 4RFOL 1FFTB 2K6ZA 2AC0A 4P5TD 3CN3A 4AQ8A 1P6FA 3U2ZA 5J1TC 4KTEL 3ATZA 3QRHA 4FABL 3O3EA 2XC8A 5B7ZA 2PPEA 4WUKL 2CHXA 1EOKA 1JERA 3QWNA 4NOBA 5IM7B 5CJQL 2AXFA 3TN0C 4BCZA 3E0IA 2EC9T 1MQPA 4Q4QA 4KO9A 1US0A 1TKKA 2Z8VC 3SE9H 2BV9A 1RV8A 2ZRYA 3UTTD 3K72A 5DT1L 3D39E 3HE7D 5LCVL 3RX9A 2IUZA 1PDYA 3S2JA 1CFSB 4KY1L 1HKIA 1LL4A 3VA8A 1K4CB 3O1NA 2ZX6A 2MWCA 2N4IA 3TN0A 1TYJA 4LARL 3MJMA 2WNWA 1R3JA 5CO1A 3UPRA 2Z0UA 4C5ZA 1MRAA 4D71A 2KDGA 1R86A 5E9DA 2VDHA 3EHBC 2GGIA 4PTVA 2W0PA 1HHJB 1ZS8A 3MREA 4IP4A 1QPRA 5DD3L 1LK3H 1H60A 4FSAA 3PPSA 1AGFA 2K3HA 3BYTA 1M3UA 1TNNA 1MVUA 5KVDL 1LHZA 4PIBA 1B2YA 3BH8A 2QVIA 5KSBB 1IHIA 1L9NA 1SEBA 2CHDA 1GGCL 3RWGA 3AG2B 3PWJA 5AL8A 2QQLL 4P4KC 35C8L 4LSSL 4QXUL 1HE8A 3AISA 5E2WL 2R0LL 5I77A 2OR9H 3WLBA 3WO4C 3LCIA 1IQDA 4G3YH 4XP9H 4PMEA 4WW2C 5MERA 2E77A 2WO3B 4KFPA 1E9TA 3K6SA 1HL2A 4LCYA 1HIMH 2CR0A 2DPKA 5FYLH 3FU0A 2A7NA 2OLAA 1KJ2B 1H4PA 3T6VA 2NPLX 3SCPA 5C0DA 3MACH 1CI1A 3LHVA 3S2MA 1IEIA 1YECH 4RZKA 4URTB 4B91A 4WW2A 1KV8A 1ID2A 5DVLA 5TQ0H 5L8KB 1ISVA 2VE6B 4DFIA 5HMFA 1A5FH 3L7RA 1K6AA 4ODHH 1KCWA 2F19L 1A5CA 2H0PA 4H00A 5KS9E 3VUAA 4RFNB 3UH8A 5I3HA 3R79A 5FW6A 2FIQA 1S9XB 5JA9A 2ON3A 2B1AL 3HOJA 2JGYA 1CGUA 1ODAA 2IG2L 4OIFA 4I9AA 1A6UL 3ZBMA 3B0VC 2H6PA 3KAOA 2ZDSA 2Y62A 4ZDHB 4W9DC 4L8DB 1KQZA 3VK5A 5KBPA 4GAYB 5CP7A 2EYTA 1HJXA 1NOAA 4YO0B 4Z0XA 1GS7A 2EKCA 4XUYA 2P8MA 4U4MA 5IOPB 2D7MA 1OT2A 3B9OA 1UTDA 1XIWD 1S9VA 3U5YA 1UEMA 2VDQB 1B2WL 4C1NA 3I6SA 4PMYA 5TDOB 4NNPH 3KPTA 4NQSB 2I5YH 1XR8B 1ORSA 5LHFA 4ERSH 2FLBT 4FJZA 5SWZD 4DT2A 3WH9A 1X5JA 4UXDA 3OZ9H 1TZ9A 5FF4A 4LU0A 2QGCA 1GRWA 2E6QA 3RIAK 3O9WB 4L8BA 3ZT6A 1VC4A 3TVMC 2ICWI 2EEDA 1SQ7A 3RF9A 2QDWA 3HN5A 1URLA 3DV6A 2XIOA 1SUXA 4RGOL 2J47A 4JN7A 2C9QA 5FYKE 1OD0A 2A0LD 1O95A 3V6ZB 5IV2A 3G08A 1I1FB 3IGFA 4TULL 1V3LA 4DKAA 5HUPA 1DQJA 1MJJA 4Z0JA 1LL1A 3TVMA 3VCRA 4MMZB 1MCOH 4PW3A 1V7YA 4D9RE 4MF4A 3Q94A 1A3HA 4YWIA 1MHEA 3NZRA 1IM9D 4CNOA 2JK5B 2JALA 4AZCB 1T80A 2WWCA 3NCJL 5C3IA 1K03A 3WL0A 5MI0C 2QVMA 4AMAA 3QCVH 2DLHA 1KNOA 3W7NA 1VD6A 2W38A 1W9VA 1WS8A 1U3NA 4QBXA 3VIGA 2DWEA 4DBUA 1X5GA 3AWFA 1WYJA 3IKKA 5DS8B 1S8DB 4A6YL 3WN5B 3FA4A 2FMNA 2PSNA 2UY7B 4YHMH 3KS6A 1EP1A 3QUYD 1UACH 1RUAL 4GRWB 1VEMA 4JGNA 2NQ9A 3B37A 3UXKA 1GSMA 4GXFA 3PPGA 1FSKC 3HNTH 1QSFE 3K2UH 3DG3A 1XWVA 5AW3B 3GGWA 3IXTB 1SYVA 2ZVRA 1TSIA 1EEUA 5JMOC 3SDDC 3SUWA 2F68X 3JV0A 2XX0A 4YS1A 1T3FB 2DFAA 5I17B 1A4MA 2CLRA 2H26B 3ARDD 3WAJA 5E8EA 4HUKB 2OTWB 3TROA 3O06A 4ZAKC 5IVXA 4CVUA 4XVOA 1MCPH 5FO9B 3OJDB 4GCAA 5T9CE 4OLYH 5HJXA 3B5HA 2OR8A 2CALA 4OZGA 2X10A 4L64A 3KPPB 5GSRA 1S5WA 3SDDA 5KG9B 4W4OC 3GVQA 4KUCD 4KKLC 4QYOB 2QCCA 3KPMB 3F12B 4RGNC 3LRLA 4D1IA 4MDJA 4BH8A 5HYSA 2CBTA 4S3BA 2Y25A 4H1ZA 3CB3A 2GDUA 4ZAKA 3UA3A 3HB3D 3M1OA 2DQJH 1HFUA 1UKSA 1GZPA 3B5TA 3TESA 2O5ZL 4XCCH 4P7LA 4PV9B 4QHKI 3B3IA 1OL0A 2CZVA 5A2KH 1Z9SB 1B0GB 5CJMA 4IZGA 2L7UA 4W4OA 2O72A 3NJKA 3W0WE 1GGBH 3QDMA 2XY2A 4IP7A 4K94H 3RGVB 4OT1H 3QS2A 2AJ3A 5KSUB 4XOEA 3OKLB 3RWCA 3NL3A 4HLJA 4Z3HA 4XCFH 5C07E 4DNMA 5A6MA 1H3WM 3MCKA 3TOPA 1NCUA 4RFEB 2EXYC 2HMID 3NIYA 3PABB 3DSFH 2ZA1A 1JFQL 4S0SD 2FYMA 2NVAA 2Y5QA 1E1CA 3FB5B 4DZHA 2P10A 1CGVA 1OX4B 4C4BA 4Z3EA 2X30A 3UQNA 4WWKC 1L5GA 5I1DA 5E6SB 1A6VH 4JHWH 1ETJA 3O2WL 4AG4L 3WL9A 3EZJB 2IBZY 4DP9X 1L0YA 3T1GA 1JOIA 1CDIA 3VXTB 5BNXD 3OAYK 3NOYA 3QWQB 4N8VA 5T1KB 4P57A 5CCZA 1OP3K 4WFHE 4EN2A 5FSEC 2PDFA 4PLJD 3GVGA 1O6SA 4XC3L 4NZ8A 4A2HA 3ZDZF 4HJJL 3ORWA 2W9DL 1UJ3B 5GVJA 1QOQA 5EIIG 5FYJE 1GVIA 3S98A 4HKBA 5FHBL 2R1YB 5DJCA 3CDGB 1WCBA 3B9KB 3BWAA 3E1ZA 4JUTA 4PJ8C 4HIPA 5AVYB 1FO0H 4X99B 5TDPB 2CHNA 5MEQB 4IOTA 3TX4A 1QPOA 5I3DA 2IAMB 2HVBA 2KZKA 2VEIA 4ZFGL 4H44C 4Z6AT 3RWFA 1MFCH 2DJUA 2R83A 2Y89A 4HF5L 4NZ5A 1VCFA 2B5IB 1DQLH 2H1LM 5C0AD 1I85C 4EVNB 2DJ4A 3UW6A 1HXMA 4AT6B 5JYLA 4PJ8A 2EYSA 4WENB 1BG9A 1VADB 3DI2B 5C09A 4WO0A 4CNPA 1Q5MA 2GJZA 4ZUUA 1JPDX 5I3FA 3UOAB 3WD3A 4MD0B 4FFYL 4Y19A 1NP0A 5BU9A 4PMJA 1F4AA 3LCHA 1I85A 4M48H 1K3UA 3WN6A 1IWPA 1OK6A 1S1PA 2Y22A 3LRGA 3ULVL 1ACYL 1ODUA 3SDXB 4J4KA 1MRDL 4UB0H 2BOCB 2PURA 3VI3A 4G8EB 32C2B 4JX6A 3SKMB 4S3EA 4JIIX 2DICA 1AD9B 3FTXA 3LU2A 2J57A 2V3FA 2X4NA 4UFIA 2AK4A 5DY3A 1B4EA 5BS0D 4F33A 4X9GA 1LK2B 3F2CA 3JWNC 1SHSA 3N91A 3QH3A 1Q94A 1K7EA 4PN6A 1N8ZB 5JW4R 1QO2A 1AMKA 3E0WA 4I7ZC 1XIHA 2PPDA 3VRIA 1S46A 4DUXA 3ALXA 3BLBA 4XGZB 2Z8RA 3L4ZA 3WLIA 4XCYA 1BOGA 3T7VA 4XMKL 1P5UB 4XOBA 4HK5A 1TZ7A 4ADUA 1BD2B 4JE4B 4FTVA 3BPNB 1L8PA 1VYRA 3ITLA 4PJFA 3B7SA 4WEBH 4H1LG 1OFBA 1PD6A 2YD2A 3WHXB 3RITA 3LTPA 4IGBC 1KFKA 2VQ4A 3RIKA 2BCKA 4HH9B 1GR7A 1DSFL 4QO1A 4YLWA 1IBFA 2ZJSL 3AUVA 2NQJA 4Q4MA 4B3EA 3NAAH 1GEQA 3MBDA 3AG1B 5E9DE 1JPSH 2VRQA 2F54B 5I09A 1AMXA 2W5PA 4AGMA 5E03A 1FNGA 5HHXH 1CT8B 4AEOA 2R0KL 3AHYA 2O6EA 1JHTA 4XHQA 5A43C 4YZFF 3VNJA 4LSUL 5GJPA 4QRPB 2FEEI 2NNAA 1RJLB 1BM7A 5AW9B 3AXMA 4IGBA 4KK5C 4HUNB 4N8UA 4B9IA 4OV4A 2XNAB 3RWEA 1S7VA 1ZGLB 1UXSA 4XAYA 1JGVH 4MA7L 1JNDA 4UNIA 5KAQG 4I5BB 2LTQB 4XSMA 4UV4H 1EC7A 4P46D 4XWGL 4AUJA 3BYYA 3W7HA 1TLKA 1HJSA 2C19A 5HNRA 4U6YB 2I24N 3KVPA 2ZIDA 4ZW7A 2WCGA 2GWGA 2LU7A 4G6JL 4DWSD 3V4PL 2W95A 1CYWA 2ZOTA 4FNQA 4HIHA 5GS0H 3BW3A 5GJNA 5D02A 4E5XG 3ROOA 2CIIA 5DANA 7REQA 4JX5A 4RZ4A 5JHMA 3X2QB 3UTPD 4NHUA 5A2JH 3BP4B 1SO3A 3CN0A 3OKYA 5IW3A 3E2QA 1S7UB 3O9NA 5DI8A 1FH7A 2C5DC 5GRZA 2B0SL 3WY1A 1MW1A 3PQYB 1MYRA 3H6OA 3TH6A 1IFGA 4FMKA 2NV9A 4JFQB 1W15A 3TZFA 2FBJH 3LXBA 3ABGA 1CVRA 1KT2A 2G30A 3RDJA 4YBLC 4FXKB 3MV01 3IMRA 4WK2B 2GKIA 4F2FA 1HKKA 3L5AA 3UGEA 2OP4L 4AUUA 5KVFL 3NIFB 3WF4A 4MOZA 3L3OB 4AWUA 1ZV5A 5BV7B 2G60L 3WE1A 3CH0A 1Z9LA 4NQEB 5I76A 4KX7A 4WSKA 3IKCB 5GRYA 3SPVB 1OBAA 2E6YA 3AIEA 1H7WA 1I7UB 4IF2A 5K9DA 2DJSA 1IGML 2QELA 2IC2A 1XSKA 1Q6GA 2RFXA 5I5IA 4MNQD 3IIOA 3GJFK 1ZP3A 5CPMA 1QABA 2O9TA 1FZJA 4DJFD 4BUQA 1MQ8A 3TBCA 3TC7A 1FVPA 3BLIA 4PFMA 4Z3IA 1OP5K 2VDKH 1DXFA 2JB5H 4Z1CA 4Q7IA 5G4NA 1CU4H 2VLME 1IM3B 1LL6A 4LSBA 4XPHL 3TBTB 5EIQA 1K70A 3KBJA 4KWVA 1RMFH 2YBRA 5FUZL 4FXTA 5GJTL 1GJWA 4ONGH 3T44A 3AS2A 1G94A 1IX2A 1FUYA 2FR4A 4NC2B 2GY7B 4WFED 3QEUA 2ZNXA 1IBDA 1Y18A 4K6AA 2QVNA 6CGTA 4GX8A 3FA3A 4NZUL 3N4FA 2Y3AA 3VE0B 2CCVA 3AT8A 2JB6B 3WHE0 3L4VA 3AAZB 4EMZA 1IEWA 1XGZA 3IU4H 1UKTA 1A5UA 1XIEA 1MXDA 4EI6A 2BP0B 3OAZH 3H2CA 3OYXA 1LO4L 1PIFA 2ZRUA 3MJYA 4NI3A 3T4AC 1AOZA 5J6GA 2CFFA 2BNJA 3LOTA 1M71A 3TYDA 3T65A 1A7NH 3SM0A 1INQA 1DJNA 2BVUA 2XHNA 4L0YA 4GE8A 5M3WA 3V9FA 1WZ1L 5IY5B 4JKLA 2DTSA 2PYEA 4OLXL 1AO7B 1HKJA 2HRHA 3LRMA 2UY3A 1UROA 4CADA 4DVOA 3BRDA 3FU3A 2X6MA 1LP9A 3GMQA 2WO4A 4N9EA 3T4AA 3M47A 1MG2C 2Q09A 3BW2A 4ECLA 4IDLA 4JHOA 1R3KB 3P4NB 1I1RA 2ODIA 4S11A 3WXVL 3C0LA 3NZ8A 4AD1A 3BJ91 2ZSVA 1NBVL 3B4YA 4PB4A 4AM0Q 2H6OA 1JPFB 3MLWH 2X70B 1V6XA 1SF3A 4NX5A 1PYWA 3V0TA 3L9EA 4NFCA 5D1XB 1JV5A 1PSKH 1M2VB 4KTGA 5FB8A 2QZQA 4N0CD 1GOKA 2X2JA 2CGYA 1GVQA 2IXVA 3JWOL 2LR4A 2ZP9A 1FNEA 5J12B 4PYHA 4WNQB 3PWVA 4F8QA 2DW7A 1EX0A 1WBXB 4OBTA 2J9ZA 4P2VA 3QRGH 3H12A 3KLSA 1DOSA 2YOAA 1IRAY 4PY7B 2EKSA 4OZGE 3DTDA 4Z7NF 4OB5L 1FFOB 1JZJA 1XCFA 4PMVA 3EYFA 2FSEB 4ZW6A 4HPYL 4LIQH 2DZWA 4WDUA 2R1WB 2WQPA 2V5KA 3BIAX 3DGGA 5IB2B 2PDXA 4JZOA 3Q37A 3L4WA 1RZQA 2WAHA 2VKXA 2UZXA 3Q65A 3EGSB 5F0MB 2FPVA 3F2BA 5DWUL 2Y5TA 2AL1A 5KBKA 4MA3B 4CNUA 3S97C 1S9YA 4D0CA 2H3NB 3GKZA 4D6IA 4V28A 3GO1L 2MH4A 1E4LA 1GYLA 1QHQA 2QULA 1B3IA 1W8OA 1NIFA 4UOJA 4RGNE 3HV8A 4AGLA 5GGUA 4F9JA 3CZKA 1SO5A 3QUGA 1MFBL 3KLAA 1I8IA 1P4IL 3PGCB 2D7TH 1N0XL 1M5WA 3LBMA 2FGZA 4UR8A 2RMNA 3Q5YA 1F4HA 1K8IB 3NACH 5AOIA 1ZPLA 3V0WH 1ZA3B 1SFLA 1XTLA 3KDMA 4LOCA 4XV0A 1FDLL 2XKUA 3S3CB 3BH9A 2C91A 5B4MC 1WIOA 4HU3A 2YPLB 3AB0B 1JPHA 5HDOA 4U1JB 3D3AA 3NDOA 1LG1A 3FHEA 5CPOA 1N8FA 2CKBH 3L9YA 1JYXA 4F57L 5HHOD 4MJ5B 3VH8B 3WTSA 5LBGA 3KPRE 1KTBA 3W7KA 4ZQTA 4GJTB 4ODWA 3EA1A 4RWYH 1HT6A 2KC0A 1R2SA 2W79A 5HGAA 1JCYA 3FDWA 4WKAA 4PREA 4GAGL 3U3HA 3C2FA 2CLPA 3G9VA 2QUMA 1ITCA 3T2QA 1UR0A 1EDHA 2FIKA 3W1TA 1MCCA 3CFQA 2BOEX 2ZWYA 3C3UA 4Z7VF 3WKMH 3I85A 3ITTA 1RA5A 5FM5O 2V81A 5H6HA 4NQ1A 3CLFH 5IMOB 3RTQC 2MOQA 4C6EA 2CDGB 2IBZX 3RZCC 1MRCH 2YSWA 2Z35B 4YFLI 2EIZB 5KYXA 1RCQA 5C0IA 2Q8BH 1ZT1A 1LMIA 5BZWA 5FL0A 4XD3A 1XS2A 4J4PD 1RULL 4U7MA 3S6OA 4KI5F 1CMOA 2HLAB 4AQAA 3IRSA 2MQGA 2EG7A 1PIIA 4QOKB 5D7JC 1RLWA 2J1WA 2NUPB 5EU3A 1HKVA 4PGJA 3HBPA 2VC2B 4Z3JA 4Y19E 3N9SA 3RTQA 1IT0A 4Z08A 3RZCA 5FA3B 5PAZA 1AH3A 3GE7A 3TT1L 1N59A 3P67A 5F93C 3ZDXE 3IJHA 1Q72L 2ZUVA 5HNUA 4EUPH 4G8FB 2V2HA 5JIHA 1FHVA 4MJ4A 3VI3E 5D7JA 4B96A 5JHLA 3ASWA 4JLRB 2ICWJ 4NAQA 5JBFA 3BQUC 1AGCB 2AK4E 4GSDL 1SY6A 4EI5C 1FWHC 1ZSDB 2I5QA 1FGNL 1UATA 1EX1A 1TREA 1MLCA 1F05A 5JW4Q 3O4OC 2ISDA 1F1AA 2OMAA 3GHBH 4YC2B 5CEZD 2HE5A 4AXKA 1ZLVH 1SPQA 1KCZA 1QNSA 4K3HA 4NUJA 4IJTA 5TK4A 3P73B 4NQXA 3CUXA 3CUFA 3H70A 3BKJH 5ECJE 2H47C 1NKGA 2P47B 4FFWC 5EMKA 2FNBA 5D4YA 1RQEA 3X13B 2FQGA 4XMPL 4MS8D 3RUGA 4DKFH 3NQMA 1XYCA 3KVMA 2R0WH 4FTVE 2Q8ZA 4LQFL 3U2OA 3WYRA 3KJ4C 4PJFE 2Y6SD 4WY7H 3DFNA 2E68A 4DKEH 3NSCA 1VFTA 2B77A 5GPRA 3C60B 3K5SA 2EPMX 2D7PA 4MYWB 1XJBA 1HYSD 4G9DA 2Z29A 3I6RA 4Z1AA 4PJHB 1OD7A 4UFJA 2PUQT 3CSPA 1FIGH 2V17L 3WIHH 2WIIB 3ATEA 3ESVF 3MWCA 1AXSA 3ZZQA 5AEAA 3MZTA 4Y1AA 1W72L 3F2DA 5JUEL 4X5XA 4ZXBB 4YLBA 2QW5A 2IMRA 4KTEH 3FZUC 3TF7C 1OD8A 1CICC 4FABH 1KSRA 4MTMA 1R47A 3ET9F 4WUKH 3GMNB 3IFOA 1JUEA 5EB9A 4AHOA 2YAPA 3KYMB 5CJQH 3W4RA 5C0GA 3GWQA 4I5UA 2YPVA 4LKXB 2CCLA 2HKAA 4YGVB 2FYYB 5D4IA 3V6BR 5BVPL 3UGVA 3Q7JA 2J7DA 4OFKA 4Z5RB 2WNZA 2BIOA 1BEUA 1DWIM 5DT1H 2XWEA 5HDRA 2Y7QB 4XO8A 3OKOB 4N8CL 5LCVH 1CICA 5C6TH 5IBTH 1KLGA 3HIZA 1QSEA 3EBHA 2VN7A 4KY1H 1YSOA 2BIQA 1FHUA 4RA3A 1W16A 5EOQL 1OJXA 2GJJA 5T3ZD 3N85L 4BK9A 4JMXA 4LARH 3SGGA 5F7DB 1AY1H 2QQQA 43C9A 2HEJA 4TV3A 1BJ1J 1BXVA 4LCWD 4NIKB 1H1ZA 5IW6B 1P7QA 2A9NL 3E9UA 2FD6L 4LLYB 3B4UA 4AYMC 3QPQC 3QISA 4HCFA 3ZTNL 1PD0A 3PGDB 3MSDA 4KJPD 1FWRA 1WFMA 1JK8B 2QJNA 1CLYL 1VRDA 3MHZA 3LUTA 4A68A 5LHEA 1NC4D 1R5IA 2E67A 3S2AA 2E5CA 5ERWA 1YHPA 1TZZA 5J8LA 4CNNA 4MVBD 3HPZA 5SV4A 5LIKX 3AXIA 5K93A 4LGPB 35C8H 4LSSH 4QXUH 1MI5A 1NP2A 3BXNA 2XBZA 3NSMA 5E2WH 2Z64C 2HV5A 1NINA 5AVZB 3S36H 2X9ZA 2QGYA 3TWBA 1HH6B 4XZMX 1KLFA 1P84J 2OSWA 2D3JA 3DUGA 3OJVC 4D6GA 3OYZA 2XICA 1JN6A 1WA0X 2J6EL 4PTMA 3OVQA 3ARRA 4XVUD 4KETA 2JQAA 3OLDA 1NCNA 4RDBA 1EUAA 1HWHB 3P9WB 3WLTA 5EBGA 4LANA 5GZNC 1SXNA 2EDQA 1KG0B 3M0MA 3H7VA 4M8QB 3C09C 4DP6X 2AKZA 5CBAB 4V33A 1Z9PA 1TQBB 3PWPB 4WSJA 4O2CA 2KPWA 3ZW3A 2WVVB 5IB1A 5I0XA 4ZMZA 2NLYA 2F19H 2EG6A 3IGXA 4OLZL 3REWA 1K5WA 3ZLQC 2XFXB 1R3YA 4PWJA 4UDTA 2CHWA 4GSRA 4NL1A 1PY0A 2B1AH 4G8TA 1MY7A 5DJ2A 4JK0D 2BC4A 3LZQA 4P07A 1A6UH 1DN0B 3AJXA 4CD5A 5CLXA 1LBMA 3RY6C 3GAKA 2PYFB 3CSTA 5F88A 3ZYZA 5MENB 5AUMB 1C5BL 2GOKA 3FEQA 4LE8A 1PZ5A 4AMWA 3ERPA 1JGDA 4E5TA 1JRHL 4M24A 2CBVA 3HGSA 4P2CG 1KCRL 4O02B 3KBWA 3APNA 1E9ZB 3WBAA 2WSDA 3MRBB 1LP9E 3T1FB 4GUGA 3RY6A 1E5ZA 3ZIMA 1GZJA 1WQ5A 5AYQA 3BRFA 4ZUWB 2YW3A 1CLOL 1ZJIA 3MUHL 4O18A 1G7UA 1CFMA 2QSQA 3TC9A 3R4DA 1X8FA 3GUGA 4KKCD 2N0MA 2JLPA 3GLEA 2QDEA 4JNZA 2NNCA 3KS0J 2BVQA 3MRCB 1W6LA 2PI6A 4MAYD 4LO9A 1GT8A 3S36X 2A99A 2FPTA 2RHEA 4RGOH 1B4JL 3VXOA 3I6EA 2BODX 1FGVL 2ANUA 3UZZA 3OODA 4XPFL 5J7CC 1EPVA 2YR1A 3AIQA 2EDTA 1BZ9B 1W0VB 2ZUWA 1SHWA 2FJFB 2X3CA 4TULH 3LPFA 1GW6A 2Y7NA 3MBWA 4UMAA 1G7HB 1R5VB 1OZQA 4DETA 2A6KB 2DBJA 4P2YA 1S7RB 4QIRA 1T6VN 5FF0A 4OTXL 1FG2A 5E8PA 3NJIA 4H0HB 2WQXA 1M9HA 5D33A 3SCSA 5AYBA 1KN4L 3MV8E 3APMA 2VCCA 3OIHA 4JCWA 3NCJH 1V6YA 2K1MA 3D4GA 3X1EA 2VAAB 1KTDA 1BD0A 2PRMA 4NO2B 3JYBA 3C6LD 4MHBA 1S5IL 4F9PC 5CFAA 1KZYA 3ZZLA 4PAZA 1UKQA 4CSTA 2VKWA 5HJYA 4MJJA 4HYRA 3KOXA 5JPNC 4ZB2A 4N9CA 1EFZA 1JYNA 4A6YH 2EXSA 4QRTB 4CMHC 5EDXA 2I7GA 4OM1L 1XB6A 2XN1A 1I0BA 3N12A 5AC8A 3FCUB 2GIXA 5ISZB 3TS8A 2BOGX 3OKNA 3N04A 3RX8A 4POYA 3MRHB 1A25A 1VF8A 5CP3A 1AW2A 2VGLM 1JK9B 3UZVB 3HURA 3RO8A 4F9PA 4DBWA 3BO8A 3D0CA 4WV1C 2GEQA 6TAAA 4X7TA 5JPNA 1FWDC 1HQTA 1OQXA 2AQNA 2YL6A 4NZDA 4AV0A 1IB5A 4NP9A 3SYPA 4A38A 1FA4A 1TPC1 3LOWA 4ASTA 4JO2L 4G6ML 2ZYRA 3L95B 4IU2A 1JJKA 4NEHB 4LVOB 3EOTL 3QUXD 2D2CC 2VYOA 1BVKA 2WTRA 4PWFA 3FGCB 3DESA 4WV1A 2RH0A 5IHUL 1BYAA 4TTDD 2PNDA 5D7LA 3E2SA 4LSQL 4PWHA 1KXHA 1BYNA 4NJHA 4YWSA 4QHRA 5HHQA 2VDPL 2DY3A 5AENA 3SN0A 5C97A 1ULVA 5CZXC 3RWDA 3VU1A 2O5ZH 4DIXA 2OZ4H 4XCEA 1JYWA 4F0RA 4O4YL 4GQ0A 2OMNA 1COBA 4XHJC 4YYCA 3WD4A 2LU3A 1E2VA 5CBEB 1KIPA 3HA1A 3H9SD 3ZKQD 2JQZA 4EBQL 4GKSB 1U92B 2AQ1A 3M6YA 1OCCB 1EZWA 2BY3A 4MD4B 2HX7A 1BFVL 2YZ5A 1DXIA 1JFXA 4HWZA 4FR6A 3O11B 4D8ZA 2BXVA 4ZL1A 2UX7A 4J35A 1JFQH 5J13B 5G4HC 1PDKA 4LCSA 4K8GA 5DQJA 3NFSL 3ULVF 4HFUL 2EEBA 3BDKA 3P7YA 3O2WH 5IBUG 2C14A 4AG4H 4PR5B 3FSVA 2ITEA 4I87A 2NXZB 5HYJA 2YBGA 2IQ0A 3CC1A 4GUJA 3EGXB 4L1WA 2Y7OA 2CLEA 4MB3A 4A67A 4HJJH 4UTAL 4IBLT 2W9DH 5KJ4A 3MGTB 2B3IA 1UG9A 2HFEB 4ICWA 2YZ1A 1BTCA 3WF0A 4BQ4A 2B15A 5FHBH 3U1QA 1R3QA 2X7LA 5DUPL 1JHLL 2VJ0A 4MBRA 1M05B 1ETZB 1WJ3A 3US1A 3VMOA 4IFRA 1G7MB 5ALCL 4AKOA 2X1PA 4ZFGH 3GBDA 1IILE 1JUFB 3BHBB 2DVXA 2FB2A 1NLDL 3LY6A 3F7VA 3APGA 4OJFL 5EBUA 4FQJL 1Y6NR 4OGAC 3QO0A 2Z2UA 5F70A 3N17A 3RUGE 2FQEA 1Y8BA 4XNMA 4XO3A 4ODTL 4N5ED 2V30A 1JD9A 4HHWA 3HN3A 1NFDF 4XXCC 3QNZB 2XQBL 3CUGA 1DTUA 3RX4A 4QRQA 4GQZA 4M8VA 4KO5A 4FFYH 4OGXL 1VIWA 3DXIA 3B43A 1QFPA 5DA4A 2Y5EA 4B50A 2ISVA 3KPSD 3LTVA 3DX7B 3ES6B 3JSSA 4OJAA 3TT3L 1F3JA 1OIFA 3N3TA 2X4PA 3ULVH 1V6TA 3DX2A 3SN6N 4HZ1A 1ACYH 3PAOA 2YBTA 1MRDH 4YN3A 1BGGA 2AEPL 3K80A 3ZR5A 1ZPTA 5FOJA 4P7NA 2R1NA 1W3NA 3PM6A 2LFEA 2XWBA 4XXCA 1LLWA 4PRBA 3JUGA 1J1OH 1XV8A 4L4TB 3SKJL 3M1ZA 4HD9A 4M9OA 2MCPL 3NJMA 2AQRA 1OGTA 2ZAIA 3WMCA 1E4MM 5HANA 4PB9L 3OKMB 1QNRA 1VKXA 4YXKL 4UUJB 3CC5B 3T4CA 1Q4NX 1E6QM 1S1RA 2FZDA 3P2VA 2Q7NA 4ONVA 2A1WL 4E41A 1Q85A 2ZYHA 1ZZMA 1VS1A 2OO6A 5CXPA 3MO4A 3KBPA 5F7AA 4XMKH 5JPMC 4YGAB 2UZPA 3MUY1 3KP0A 4PMDA 4KRPC 1BMWA 1QSEE 4O2EB 2ZWNA 5A8PA 2JEPA 3IV8A 1OGSA 2FWLB 3TBVA 1PHWA 1B4LA 1CLZL 3EJRA 4KVCL 4WSHA 1WP6A 4G8AC 4H8NA 2X1XR 1DSFH 4D9LL 3UWQA 3K13A 2VLKB 3UAFA 2VP8A 3VGFA 1E6NA 3WOVA 2HS6A 4YSUA 5JPMA 1IEBA 3CZJA 2AAAA 4GO6B 3VKCA 2VEGA 3TPKA 1PQZB 3DOHA 4PS4L 1UC5A 2P5NA 4P4KA 4GBXD 5ICZB 1K6WA 4ZJ9A 3R2GA 4U1HA 5BQ7A 4M8UA 1EMTL 3GM8A 2C15A 2CIKA 2NCMA 4H7CA 3ZO9A 1VJSA 1SOXA 3WQ8A 1QUNA 4MA7H 1MI5E 1KYOJ 3RLSA 1C8QA 2RAGA 4HV8B 3EMZA 1FFNB 4C6OA 4XWGH 4TM9A 3QVAA 1RUSA 4PMRA 2VXQL 3KLDA 2J1XA 1F18A 3EO0B 4P7QA 1T21A 2R27A 3QEGH 3NQ2A 1YEHL 1GYWA 1NCWL 4G6JH 3QJHA 3V4PH 1NAMH 1MN4A 1QAPA 4K23L 1AQKL 2NDGA 3IF1A 3LHZA 4JDZB 1CTOA 5BCAA 4D8LA 2BGNE 2GJNA 2IPJA 5CJ5A 1RZMA 1U91A 1X9LA 3R0MA 4HDIB 3MBXL 4WCYL 4L4VA 2XA8L 3SY6A 4IS6B 1ISZA 3RL1B 5BROA 1DO6A 1OAKL 3VXSB 2N7SA 3EYPA 4KTYA 2Q86A 4OLWL 1BKHA 3CUZA 3R8GA 3L23A 4HEPG 4K94C 4HOZA 2B0SH 4PUUA 2HSAA 3TC6A 2ZUUA 3K6FA 4L9LC 2A79A 1NDYA 3JV5A 5F3BA 3S46A 3EX6A 3E8UL 4TF4A 7PAZA 2NSOA 3H9HB 1GQKA 4I77L 8XIMA 2EDWA 5G2IA 4EUPG 4HNUA 1X6LA 2OZNA 2R23A 1YUKB 5KVFH 2IBGA 3PIQA 3MUIA 2G60H 2WJ7A 3SRHA 1ZGDA 4KAQL 1J5OL 2DBLL 1B9BA 3FUMA 5HNNA 4NPYA 1CECA 1TZIA 2R9HD 2F8OA 4LBEA 2E6FA 5C2BL 4L9LA 1IGMH 4HIIA 4NKCA 4BWLC 3OAZK 1IEAA 2YRBA 3L7EB 3W2MA 3F65A 5EU6D 5IQMA 3IBEA 1MLBA 2TMDA 2Z65C 3U4KA 2MKWA 3FUFA 2W67A 2APXA 5B38G 3N06B 4Q8TA 1OP4A 1MFNA 5FKAA 4BWLA 1I7RA 2AVFA 4N9GA 4XPHH 4MDRA 5DFVD 3UBXA 3CTLA 4J27A 4J1UB 2Z31C 5FUZH 3ZKMD 4FR1A 2E46A 2H3XC 5GJTH 3O6ML 2ZUMA 4X4MA 1M7XA 2E59A 4LP5A 4XSLA 4NZUH 3TO4D 4X5RA 3CH8A 4IRSB 1MJ8L 2NMSA 4JHZA 4Y2OB 3FSZA 3UEZA 2OO0A 1XZ0A 1MW3A 4Q8BA 3GDTA 1IR1A 5GRWA 1XGUA 4XMVA 2QHAA 1LO4H 4U1KA 3FQUA 3LV3B 2Z31A 5BMWA 1R30A 2APFA 3II1A 1FO0A 5DURD 4S2SA 4TYUA 1EYEA 2R15A 3PNUA 3S3GA 3ARBD 1WO2A 2VLRB 3QAZC 1E0TA 2DVUA 4QXGL 1QW8A 5D9SB 1WZ1H 1JG9A 3B9NA 4OLXH 2CM5A 5LXVA 5FO7B 4G56A 4ZYKA 1Q1PA 1KKRA 3FN3A 3Q8EA 4MZYA 1G4RA 7ODCA 2DMHA 4UOW1 1NFPA 1AJ7H 3R19A 1NCJA 5DTFB 2B3RA 5I6NA 5DLML 3IGHX 5EFIB 2XPGA 5KVMC 2DM4A 4WIQA 3WXVH 1QNPA 1PZCA 3CVHL 2DLIA 1DEEA 1NBVH 2PTZA 3C2AL 1TO3A 1NGPL 2CK2A 1NGXA 1Q3NA 2QEZA 2D4FA 5JQ9A 4CBPA 3PAYA 3B8TA 3WNLA 5IJKC 2JWYA 1HHIB 2O9OA 3LBCA 5DRXB 3JWOH 4IU3B 4ALAH 3FTYA 3SJ3A 3DHFA 5I16A 4GMTL 1XXFC 6ALDA 1I9CB 2PDCA 1HNFA 4Z8FL 3I02A 1VFHA 1Y0LB 2OL3A 4NKMB 1DVSA 1EGJL 4ZMAT 1I2RA 4JFOA 4EKXA 1N5AB 4YTUA 2NTFB 5A2FA 4LEFA 2YXOA 5IJKA 4MJHA 4HPYH 1VFFA 4DQOL 4JO3L 5J5RA 3IETB 3WJXA 5D7LE 4ZW5A 3NTCL 4FJ6A 4CNIB 1H3PL 3T0XA 2XI9A 3XISA 3PB2A 1QI4A 15C8L 3WBXA 1JS4A 5LN8A 5EF3A 4XBJA 5DWUH 1SMOA 4A6GA 2EIDA 3O45B 4NNXA 2WKOA 1EX5A 1EDGA 2X09A 4RRPM 2DL9A 3GO1H 4QFUA 4US5D 3UTQB 3PWLB 3QQDB 4KRMB 3E0LA 2Y70A 1WBZA 1ACZA 4O57A 4PYSA 3V0GA 1KRCC 4GBUA 1XDJA 3RJQB 5TIMA 2OTUB 1CR9H 5FECB 4PJ6A 1NMCC 3S2CA 4YHYC 1TTUA 1H6EA 3QQWA 4Q8NA 1P4IH 3DJ9A 1N0XH 5CZTA 2GK1B 4WEMB 4WWKA 4AWJC 1I3GL 1MJ7H 1J01A 3FRPG 2BOFX 1EJTC 3LZ5A 1K7FA 5E5MA 4TSCL 3AREC 2EDMA 4X7DC 3DBXB 4JFUA 4WI8A 1SJEA 2MRYA 1I60A 3WDPP 1N3NA 1FDLH 1K9EA 4UT7L 5FDYA 2A0NA 4YK4C 4NRZB 3DSNB 3O05A 3HLAB 1CFNB 4S1RH 3O6KL 4Y4HC 1YMHB 3V5HB 1MSPA 3LG3A 1KWGA 3TOYA 2HX9A 1FRGL 2CNYA 4F57H 1K9FA 2YQ2A 2YAFA 2HVKB 5FFGA 4MWFA 5HYJE 3PDOA 4DHGA 3AREA 1Y5XA 4GNJA 1TCDA 4GAGH 4WFFD 2O55A 1IZKA 4Y5XC 5D7KD 4Y4HA 3AXHA 4Z77A 1IC7L 4QY8A 3VG0L 3EKGA 1EXUA 3LTYA 2R14A 1O94A 1I1YB 1QWGA 2ZUQC 5BUAA 3SKNB 1KB9K 1PE1A 5B8CC 2D7NA 1EANA 3GRBA 4U4BA 3PU7A 5DBTA 1TG7A 4ZSOE 5E0KA 2D7QA 5CWSB 3IACA 2BVYA 3GVVA 2VDLB 4ZTOL 3U9UA 4LUIA 1YDPA 5AC6A 3TNMA 1IVTA 1N67A 3WSQL 1OVZA 4MB1A 3BIKA 3M0HA 3KW8A 3F03K 1YN6A 4HZLB 1ZLVK 4OI9A 3VFPB 4IL2A 4BWTA 3CYJA 1IC0A 5B8CA 3QMSA 4NZJA 3W86A 3Q5TA 4V1XA 1UWXH 1KBIA 5AW6B 4KJYA 4LESA 3BEVB 5LNRA 3EBIA 5C8JB 4ONOA 4B0MB 4LMQE 3F5KA 4P9HH 3TT1H 1XGQB 4FG6C 1KFGA 4Q8MA 1NWSA 4ZI8A 3W7IA 5CMAA 1BEXA 1YO4A 5IVNA 2VABB 3DBNA 4WUUB 1PZUB 1V93A 2C1PB 5LB1A 4CL7A 4GSDH 1AJZA 1QBAA 1NDVA 2P28B 1FGNH 1DQQA 3NJ3A 4RR4A 4MZ2A 4CQAA 2HUHA 5FOBA 5BUPA 3NQVA 1G6RB 3LN9A 3SQSA 1GK8A 4JZJB 2AK1L 2PRHA 4YTSA 3ZJ8A 3OLGA 4Y5YB 3EYVA 2J56A 3KXFA 3LZNA 4L1TA 4E41E 4LEOA 3FT1A 5EEVA 2R59A 3MNWA 1U8CB 1UJTA 4HYTB 3MLXH 4IMCA 1XRTA 1KJVB 4XMPH 4ERGA 4PD4J 5ADPL 2VX7A 4GOSA 4LQFH