3L4YA

Crystal complex of n-terminal human maltase-glucoamylase with nr4-8ii
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
864
structure length
863
Chain Sequence
b'VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 272
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4yA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4yA01
5EB8A 2VL4A 3TA9A 3EMQA 4FF5A 4YN5A 3LPFA 1PSPA 2WMHA 3VMNA 2WANA 3U5YA 1E6PA 2W66A 2CKSA 2E9LA 3AROA 4AZ6A 1EHAA 1QPKA 1JYWA 1RD6A 1UKTA 4GI9A 3BAXA 4AYGA 1UZ4A 1HKIA 3NUKA 2DPEA 2JEPA 2D23A 4YHEA 3WY1A 3WUEA 2QLYA 3BMVA 1X6NA 4GXPA 1UD5A 3CZ8A 3WH8A 4JZ5A 3VGDA 3ARXA 4PMUA 1UHVA 5JBEA 3S6TA 2WLZA 3DX2A 1UWUA 1TQWA 3RMEA 1WDQA 4KGJA 4BQ4A 5D9PA 3MMUA 2AAAA 4S3KA 4UFHA 3MS8A 5HDRA 1DWFM 4CVWA 4ATDA 1PS2A 5EFFA 4PRWA 2EPOA 1I1XA 2CIPA 3BC9A 4JL2A 1KTBA 2VCBA 2PWEA 2YKKA 4ZE4A 1VBUA 4MADA 1PZ2A 1GZJA 5HOSA 1CEOA 4GZJA 4TVUA 1SR0A 5JUVA 2J25A 2WVVA 3EDFA 3BCFA 2YA1A 4PN2A 3UR7A 5A8MA 4DO5A 3ARVA 2GVYA 3VGBA 4HZ8A 1KBKA 3QHNA 4NRSA 4W7WA 1QI3A 3ZJ7A 4EANA 2ESCA 4J3SA 1BAGA 4MAZA 1CECA 1FP8A 3D4YA 1SFSA 1JDCA 3U7BA 4F79A 1UD8A 4ZE5A 3FNDA 4B16A 1H0GA 4UFKA 1F4AA 1XCWA 3B9DA 4PMQA 5HNNA 1ISVA 1OGBA 5AYIA 1E1FA 3T0BA 2NW0A 4TX8A 1D2KA 1CXIA 1JDDA 3LXBA 4J7RA 1GQKA 2XFRA 1JF6A 3NYDA 3L4VA 3BVVA 4DM2A 4MB3A 2BFGA 2ZUTA 4AXNA 3BVTA 3VILA 2A3AA 1CGTA 4AD1A 3WY4A 4BQ2A 1MFUA 2VI0A 2FYVA 1OGSA 4Z2LA 1OSEA 3D50A 1UR0A 2VRKA 4PMVA 4ZFMA 4NRRA 3VX0A 2W62A 2WW5A 1V0KA 1G94A 1E70M 3OIHA 2VX4A 4H7VA 4D6DA 4TOQA 1L0PA 4H8HA 2D3NA 3VSTA 2CYGA 3A5VA 3CV5A 5DT7A 3AI0A 4XX6A 4MNJA 3BVWA 4V28A 1U30A 4HMCA 1KQZA 1JXJA 1BVNP 3BUQA 3UCQA 3ZM8A 2QMKA 1WB0A 5ECUA 3WH5A 1XHGA 2CEQA 2WHKA 3BAKA 3WDIA 1C8QA 2WVTA 3WFZA 5A3HA 1XCXA 2DIJA 2WYSA 3WBAA 3GBDA 1J01A 2DT2A 1GVYA 4WLCA 3SCRA 3EJPA 3ZO9A 4HOXA 1Q4NX 1E0WA 1EOKA 1EQCA 1E40A 3W0KA 2EPNA 3CGTA 4U5KA 1ECEA 1EXPA 1TUXA 1ESWA 3CUJA 4H41A 2UWFA 4AD5A 3U57A 4RE3A 1EDGA 1BHGA 4KRUA 1QHOA 3KL0A 1CXFA 1NM9A 1E0XA 1TVPA 4QLLA 4A3YA 5HBFA 4Z2GA 4AZBA 4NI3A 3SCQA 3PZQA 2ALWA 4AIOA 4NXSA 1C7TA 1W9PA 5CSYA 4CKQA 3MUZ1 1FHDA 1GUVA 2UY5A 3MI6A 4BCEA 2PWGA 1PJ9A 2YL6A 3A22A 1SMAA 1W9VA 1QBBA 3PZVA 1VFUA 3VD4A 4UQDA 4UQCA 2WHMA 2CXGA 1HKMA 3IAPA 1ITXA 1UWIA 7TAAA 4CVUA 4HA4A 2D3LA 4LPCA 5A8QA 3AIBA 3DYOA 1QWNA 4P8VA 1KXHA 1GOMA 5A8NA 1OT1A 1XSKA 2CKRA 2XHYA 4TXEA 2E3ZA 3POHA 2WKGA 3D4ZA 4EKJA 1B3ZA 4PMNA 1JAKA 5CXPA 2DEPA 4D6FA 4ACZA 1E55A 4U3AA 3D51A 1QNRA 3DHUA 3VD9A 3AS3A 2VX5A 1HL9A 4FNTA 3WNKA 3QHOA 4CN6A 2G4FA 3AZRA 2WC4A 3GM8A 2WLYA 1R8LA 1RP8A 1UWRA 2VJXA 1CTNA 4BS0A 5ABGA 1JI1A 2EAEA 1VIWA 3VGHA 1UD4A 3ARUA 4HZ7A 1JIBA 3VO0A 1K9DA 1KWKA 3VGGA 4V27A 4PMXA 2CBIA 2J75A 4RL3A 2W61A 1G01A 2J62A 3AMLA 4KH2A 3TP4A 4UTFA 1K6AA 4Y7EA 3WD2A 4UFJA 2Y8KA 4DWSD 4TX6A 1DWJM 4AW7A 2WZIA 4ACYA 1CGVA 2PC8A 5D9NA 1HXKA 3HN3A 3TV8A 1DWAM 3VIIA 1H11A 4OBSA 4ZENA 1V6XA 2WSKA 2X0HA 4CU6A 1TG7A 2IUZA 3FAWA 5C70A 1K9TA 1WDRA 4IISA 4F8XA 3WNNA 5E09A 2VT0A 1PX8A 1QVBA 4PMZA 2W5FA 4JHZA 5IHRA 4GQRA 1V3KA 5JIPA 1UZ1A 4AISA 1EQPA 3WH9A 1E3ZA 3HU7A 1NARA 2V3DA 2OSWA 1UKQA 3VIMA 3AHYA 4TVCA 3KE0A 3B9EA 3L4WA 4KGLA 3CHCA 3VKKA 3OZOA 1E71M 5ABHA 4UOQA 3PZIA 3IANA 2WXDM 3AIRA 4CU7A 1C3FA 1LG1A 5LYRA 1RPKA 2DIEA 5CZKA 3A47A 2XFYA 1HIZA 5BROA 3PZGA 1CDGA 2OYKA 4HA3A 4M29A 4JHOA 5BXSA 4J28A 1HNYA 1B3VA 5AC4A 3VD7A 4MJ2A 2VQUA 4PEEA 4EE9A 2BHZA 1WKYA 3MU7A 1N82A 4WKFA 1D3CA 1EDTA 1FOBA 1R34A 2QF8A 1ZBKA 2X1IA 2EQDA 2F7OA 2ZUSA 4AZGA 3ZT5A 4AZ7A 7A3HA 3GNPA 3BH4A 1HJSA 3B9AA 2Y24A 3EJTA 3RCNA 2YA0A 1DHKA 2NSXA 2W63A 1FH7A 2V38A 2VC9A 3WKZA 1ZBCA 5C71A 3K8KA 3L4ZA 5EFDA 2BVYA 3EDDA 5FL0A 3EBVA 2J7CA 3SUWA 1PCPA 5IFPA 2WM0A 1JFHA 1UWTA 3ZT6A 3VGFA 4PMYA 3TTQA 2BVDA 1UG6A 3LMYA 3BAIA 1LF1A 2X09A 3GH7A 4ATWA 1UH3A 3GTNA 2X8RA 3DDFA 3BVXA 1NOWA 4MJ4A 3LXCA 1AQHA 3W37A 2YA2A 4RE2A 2O9PA 2D1ZA 3ARPA 5A6SA 5M5DA 2G3JA 1E6NA 4Q7NA 3ZR6A 1TQUA 3K4DA 2WMIB 1OWQA 1XH0A 3WD0A 1C8YA 1LWJA 2CITA 4Q22A 3H55A 1VB9A 4FNUA 1H09A 2QPUA 5AYBA 2XFFA 2BHUA 4XZWA 3WH7A 3LPOA 4Z2HA 2G3NA 1QNQA 1CXLA 2ZXBA 1QI4A 2GJPA 1GVIA 2ZUVA 2F8QA 1PAMA 2D20A 3IJ7A 4IM4A 4CCDA 2XN1A 1BTCA 3WIJA 3HG5A 2XGBA 1MQPA 1VAHA 2XN0A 3DECA 1BG4A 1Q6DA 4MNMA 2WMFA 2FGLA 1LWHA 1DWIM 3BVUA 2F2HA 4H2CA 2JIWA 5BXTA 4DWSB 5DF0A 1HKJA 4AD0A 2A3EA 1UH2A 1X6LA 1UWSA 1J0YA 2BHYA 1CXEA 3HG3A 4PMRA 4BQ3A 1XSIA 1R46A 3CUGA 1GOKA 3N15A 4AD2A 2VVSA 4MAVA 2JE8A 4F9JA 3ALGA 1OCQA 4JCMA 1JZ4A 3VTRA 4JKMA 1I75A 2G3MA 3LRKA 1RH9A 1W9BM 4D6CA 5GNZA 3O6AA 1NOUA 4HZ6A 4AC1X 3UETA 1Q6CA 3PZOA 3WL1A 1XD1A 2G41A 3AIWA 3VNZA 3WDQA 2J7BA 3IAQA 4DUWA 3I3DA 1V6VA 1E6QM 1MXGA 3VGEA 5KZ6A 4W84A 2J7EA 2Y8VA 3CTTA 2CPUA 5I23A 1JI2A 4HA1A 2MANA 1UOKA 1HVQA 2XVPA 3W27A 3WL0A 1UKOA 1VEMA 1HT6A 1CBGA 4AWEA 1WZAA 3VU2A 1QX1A 3M07A 4ML4A 4UQBA 1YQ2A 2WMIA 4Z2KA 3RJYA 2CBUA 2PBOA 5A95A 4W93A 2RGMA 3U7VA 1EDQA 5CQ1A 1DEDA 4M8UA 1OD0A 3LRMA 3GXTA 1IT0A 2J47A 3EDKA 2X2YA 3W25A 2XWEA 5A6BD 4WIWA 4PTVA 1OIMA 3DYPA 3BLBA 4JFTA 3EDEA 3W6LA 3OGVA 1OB0A 4AD3A 4HU8A 4W7VA 3ZJKA 4X0VA 3RM8A 3S2CA 1EA9C 2X2IA 3RO8A 2DQXA 1BPLB 2BY1A 3BAJA 3KWXA 4TTGA 4NZJA 3QR3A 2V5DA 4D6JA 3AIVA 4ZEPA 2V3EA 1J10A 5JBFA 4Z2IA 5DEZA 1I1WA 5GQBA 4DWSA 1HP4A 4HOWA 3E1F1 2WWCA 1M7XA 3DDGA 4AY1A 5I79A 1JZ8A 5E9AA 1E4IA 3PTQA 1H0IA 8A3HA 3WDPP 1NOFA 2ZXDA 1OT2A 1PX4A 4J27A 2C7FA 3S5ZA 2WB5A 3WENA 2BXYA 2D0FA 1W3LA 3CC1A 4LQ1A 1ISYA 5HPCA 2VTFA 2GJRA 4WSKA 3BAYA 5A8OA 1B3WA 1ODZA 1R33A 3VMPA 3M6DA 2GJXB 5FCZA 1R7AA 2F18A 3FHAA 2XGIA 1H2JA 4DO4A 1BVZA 1UD3A 1KCKA 2GK1A 2A3BA 4FNPA 2WMKA 3L4TA 1J12A 4A4AA 4LXFA 3WF2A 2Z1SA 1QOXA 2WHJA 2WC7A 3WEMA 1E6ZA 4N0RA 7CGTA 3QGVA 3IGUA 1GOOA 5FD0A 4DUXA 4MNLA 4CUCA 3WQVA 2WMGA 5A6JA 2QV4A 4GO9A 3IJ8A 1ZB5A 4TUFA 1JZ2A 1V0MA 5CPQA 1UKSA 2O92A 3F5KA 4ACZB 1TQSA 1ZS2A 3K1DA 1RP9A 1FP9A 1V3JA 4B9YA 3AOFA 1UA7A 2VCAA 2DSKA 4QDMA 4P7NA 4OUEA 3CZLA 4OKDA 2OSXA 4AIEA 2F1AA 1UYQA 2ZWZA 1SMDA 2DH3A 3FW6A 1ZU8A 2YL5A 2VR5A 3MANA 2JEQA 4H04A 1CIUA 4D6EA 1WO2A 4HOZA 5ABFB 3AJ7A 3N1AA 3PHAA 4U3CA 1E1EA 2ZICA 2VVNA 2ZXAA 2YJQA 1V02A 4CCEA 3T2PA 2XVKA 3BMWA 3DX4A 2WWDA 4CD8A 3WDRA 1J0IA 3GBEA 1FH9A 4M82A 1BG9A 4U5IA 4R27A 3J7HA 3VIPA 1F4HA 3AHVA 1QHPA 2JIEA 3WQ6A 5A2AA 1VRXA 3S5YA 4PTWA 3SCWA 2GSJA 1TR1A 1OINA 4W89A 1V0LA 4PCTA 3VVGA 1R87A 3SCVA 3CLWA 1CGWA 5DO8A 4J3VA 1HL8A 1R47A 4FNQA 1PZ3A 2O9RA 1JNEA 2DSZA 3VOCA 3EDJA 1VJZA 1C93A 4V2XA 2VZUA 1QWUA 5ABEA 1KQYA 2GJXA 3UG4A 3FY1A 1EH9A 3T0DA 1JFXA 2F61A 1DWGM 3MSDA 1E9LA 2XM2A 3WUBA 3BSHA 5GNXA 3OGSA 1VFMA 3AICA 1WDPA 4C7DA 3DX3A 2PBGA 2XVNA 3SURA 4AMWA 1GONA 1W9DM 4JCLA 5FKYA 3AFBA 3QHMA 3AS1A 3CBWA 3W81A 4PUEA 1KCLA 3CUFA 4WKAA 1BYDA 2ZE0A 2ZX9A 1QI2A 4GINA 2EEXA 4OGZA 1W1PA 4W85A 4U2YA 1UR2A 1W1YA 3SCUA 2WZHA 2VZTA 4J3WA 1JD9A 1BGAA 3LXAA 4UQAA 2YDQA 1JG9A 3EMCA 4KRTA 2NT1A 1AMYA 1W9XA 3GXMA 3WF3A 1W3KA 5JBDA 3ZJ8A 3OA5A 3MV11 2JF7A 4JFUA 3TTSA 1V3IA 3F5LA 1O6IA 2HISA 2J74A 2J7HA 3WY2A 4QCEA 3VIGA 3DHPA 4HPGA 1B9ZA 3VDHA 3ALFA 3WMCA 3ARQA 5ABFA 3RIKA 5A2BA 2ZWYA 4NZCA 2XN2A 3A4AA 1MW0A 2IXVA 1EHNA 1FFRA 1V02E 2J4GA 4U2ZA 4PTMA 1NWTA 1ISWA 4CU8A 3T2OA 2YBTA 4UQEA 1OBAA 2X2HA 3AYSA 4D1JA 1JGIA 3ZJ6A 3BXWA 3JUGA 2Y5EA 1V6YA 1K9FA 1E0VA 3WQ8A 4P7LA 1OGGA 4W8AA 4C7GA 4MDOA 1E4MM 4UOJA 1HKKA 1NQ6A 3THCA 2E0PA 3SCPA 3OZPA 1GCYA 3CPUA 3ZR5A 3MMWA 5A2CA 1H3GA 5A6BA 2VO5A 1DWHM 1CPUA 5D8ZA 3W29A 1K9EA 3CHDA 1W2VA 4CCCA 4AMXA 4OOZA 2QMJA 4FNSA 2VOTA 4MB4A 3W82A 1E4LA 2ZX5A 4YHGA 3SCNA 2A3CA 2FGZA 3BLPX 2PF0A 2D0HA 1GQJA 2X0YA 2JFEX 1O7DC 4W5ZA 2EACA 2EO7A 4Z2JA 1HP5A 2F7PA 4HPHA 4UNIA 2CHNA 2FH8A 4UQ9A 3BGAA 3WD1A 3II1A 4JKKA 3OGRA 4WJXA 3A21A 3ARWA 2WCSA 3QOKA 2OYMA 1T0OA 4W87A 4OOUA 5FOOA 2ZOXA 1GPFA 1XRVA 4RE4A 5CG0A 3CHFA 5BCAA 4URIA 1HJXA 5LA0A 2EABA 3NCOA 5D9MA 1IZJA 1XYFA 1MVYA 3SUUA 2AOSA 3W53A 1LL6A 3KLLA 2WSPA 1VEOA 2YFNA 1H4PA 5CGTA 1MQRA 2XIBA 1XD0A 4FNRA 3VINA 4PMOA 4CD7A 5EMYA 5I3DA 5A69A 4CD6A 9CGTA 1PIGA 3OLGA 3AMCA 4BZYA 1JZ3A 3AISA 1MWOA 5AY7A 4D6IA 5DFAA 3VIFA 3UEQA 1E9TA 3N04A 4MNKA 1ZJBA 1OIFA 4QCFA 1KR0A 4J3XA 4B3LA 3IK2A 2BVTA 1O7AA 1HVXA 4L4PA 3WEZA 3L2MA 4UFIA 1CENA 1TQVA 8CGTA 1MQQA 3B8SA 2OW6A 3ZT7A 1M53A 1PS3A 2E4TA 3WF1A 5CPTA 5I6SA 1NP2A 3BUIA 4GPNA 3VIOA 2DT1A 1HJVA 2UY3A 3WNMA 1NWSA 3VUPA 3ARRA 4YPJA 4QAWA 3H54A 4GQQA 4D72A 3LX9A 2WZEA 2YBUA 1CGUA 4P7OA 3AYRA 4UR9A 5CLTA 2A3HA 4BQ5A 2WBKA 1GOWA 2PWFA 2WMJA 3WNLA 4UOZA 4D71A 1JDAA 1GNXA 2E8YA 3ZSSA 1TCMA 4GIAA 1MW3A 3ARYA 1UH4A 3VIKA 3A4WA 3SIMA 3T08A 3N9KA 5FIPA 1QNPA 5A8PA 6TAAA 1FFQA 1DTUA 4K68A 1G1YA 1VBRA 5I78A 1NP0A 4WF7A 3A4XA 1BYCA 1BYBA 2DH2A 3VDCA 3DX0A 1S46A 4IPLA 3WUGA 1IV8A 3GXNA 1LJYA 1CLXA 1ZBVA 4R5EA 2OWXA 2C8NA 3F5JA 1H49A 1HJWA 1E56A 1JYVA 3PZUA 1E4NA 3PZ9A 4EAMA 5BXPA 4PSRA 3FHQA 3N18A 4HTYA 3EJUA 4J3UA 2B31A 3FXYA 4GZIA 1EO5A 2FE0A 2D0GA 1KB3A 5I24A 4HP5A 5A6KA 1V6WA 3WMBA 1XSJA 3W24A 2ZX6A 1W3HA 1QI0A 1WDSA 2WHLA 3THDA 3GXPA 2X05A 4PTXA 1TQTA 1H41A 1JYXA 2J7FA 2WVSA 1J0HA 1TVNA 5E1QA 2GK1B 3WNOA 2XTKA 1KR1A 3WQWA 1TZ7A 4P8WA 1ZJAA 4AZIA 3ARZA 3AHTA 1V0NA 4W7UA 1NWUA 4H8UA 1KGXA 3UG5A 2PI6A 3OB8A 1TMQA 1NWRA 4X9YA 2XSBA 3T0AA 3FN9A 4MB1A 1SZNA 1ZL1A 3CZKA 1E72M 4W5UA 1MW1A 2IGTA 1OD8A 3RM9A 2YL9A 2O9OA 1UR8A 1JXKA 4LX4A 1E6RA 3BSGA 2W92A 2F7RA 1WP6A 4JL1A 1HJUA 4D6HA 2PB1A 3TONA 1WZKA 4KMQA 5D4YA 2OWWA 1V3MA 5CJ5A 2Y2WA 1B90A 2F7QA 2VNCA 3PZNA 4HMDA 1HX0A 3OLDA 5KEZA 4AMCA 5M3WA 1PPIA 1V6UA 4TVDA 3OBAA 2V3GA 5F7UA 1QHZA 1AVAA 3W28A 4FMVA 1JZ7A 1V3LA 1W2PA 2ZUMA 1WCGA 2J77A 1CNVA 2BXZA 3AMKA 3EJQA 4AIUA 2VX7A 5DMYA 2JALA 1KTCA 2DGAA 1KGWA 3SCOA 3H53A 3ZQ9A 3EMZA 3N12A 3BLKA 1Q6GA 2GFTA 2ZUNA 3CO4A 3NIYA 2C0HA 3DX1A 1GHSA 1A47A 1WPCA 2EBNA 3CH9A 2E40A 3SUSA 1HTYA 2VRJA 1J11A 4U31A 3N11A 4IUGA 3PZMA 3GH4A 4ZXOA 1QBAA 3CIVA 4FLQA 3GNRA 4DUVA 3PZTA 5D8WA 1QW9A 3KZSA 2DSWA 1NH6A 1E73M 1BSIA 3AIUA 4FK9A 2ZX8A 1LG2A 3MV01 1C90A 5CPSA 1E43A 3W38A 1WNOA 5BWFA 4FLOA 3ECQA 4NXKA 1CLVA 3MUY1 5GNYA 3LPPA 1VFFA 2YLAA 3MUAA 1E5JA 1J0ZA 2XM1A 4XB3A 4W8LA 4AYSA 1VENA 2BV9A 2WKLA 2VR4A 4JFVA 4JIEA 3VD5A 3UG3A 5AC5A 3NSNA 1KGUA 4XUYA 3KL3A 4CD4A 3NJ3A 1MFVA 4P7RA 3AS0A 4J3TA 1BFNA 2YDRA 5CLWA 2XIIA 3LRLA 3CZJA 2DDXA 1PX3A 1KXQA 1MW2A 2PSPA 1CGXA 3L4YA 5TD4A 3VM7A 3CHEA 4L4OA 5I2UA 3BUPA 1CGYA 2D2OA 2WAGA 3F4VA 1C91A 3DC0A 1XYZA 3T09A 4ATLA 1GORA 1E15A 4W8BA 1JAEA 3QOMA 2XUCA 1BF2A 1HXJA 2IXUA 3AMGA 3UERA 1TFVA 1Q6FA 3WQ5A 3RPMA 2BNJA 3SUTA 1VEPA 3BUDA 1LL4A 1EO7A 3SCTA 5M17A 4UFMA 1KXTA 3CUHA 1ODUA 2RGLA 4UCFA 5HPOA 3WD4A 3A3HA 2F1BA 1GJWA 4W88A 5C8BB 2W4XA 2DT3A 3VD3A 1UA3A 1A3HA 1J18A 4S3JA 1W91A 5E6ZA 4AEEA 1SYTA 2J79A 2ZIDA 2XVLA 1H5VA 4XV0A 2XPKA 3AHXA 2Y4SA 1KXVA 3OLEA 2OLHA 5A6AA 3W6MA 3MO4A 3GDBA 1DP0A 2HVMA 2PWHA 1JZ5A 4A3HA 2XVGA 1W1VA 2WVUA 3D3AA 2E8ZA 1Z32X 3K46A 3AZTA 3A23A 5E6YA 5E0FA 5A6MA 2YOCA 1UASA 3OG2A 1VJSA 4E4PA 2WNWA 4CN4A 5A6LA 2FDMA 2O9TA 4MDPA 5LA1A 5D9OA 4LYPA 1UR9A 3VSVA 2J7GA 3KL5A 2YIHA 2J8FA 5IXEA 3AMDA 1HI7A 1B3YA 3W26A 3A24A 5I77A 3N17A 3RDKA 5IFTA 2YFOA 4XZBA 5BRQA 3OLIA 2D24A 3VMOA 4NSBA 4N42A 4QLKA 1B0IA 1EGZA 3AIQA 3ZIZA 1V3HA 4KWUA 4PSPA 2DT0A 4B15A 3VDBA 2XG9A 3WH6A 2EPMX 5A94A 4JAWA 4P8XA 4FLRA 3WF4A 4WK9A 4LYQA 2ZUWA 1WZMA 3L4XA 1MXDA 3HG2A 3WSUA 2FHCA 1Q6EA 2CNCA 2OYLA 1HWWA 1XH1A 1U33A 4E2OA 1GW1A 1QNSA 1XH2A 3ZSTA 3GZAA 2V5CA 2OSYA 1H1NA 2CBVA 2XJ7A 3ARSA 4U33A 1UWQA 1LLOA 3VDAA 1R86A 3WQ4A 3AS2A 4JKLA 3WNPA 3POCA 3VIJA 3G6LA 3ZMRA 1XGZA 3U5UA 2AMGA 1G5AA 3WF0A 3UR8A 4F66A 2QPSA 4PMDA 3TTYA 3D5HA 2DSUA 1JZ6A 3WBEA 4PYSA 2J78A 3VX1A 2EJ1A 5E0CA 3GXDA 1V08A 1CXHA 5CSUA 4UZUA 2OW7A 3AXXA 4BF7A 3CZNA 3D52A 4H8VA 3L4UA 4HMEA 1M04A 1UQZA 1XC6A 1B3XA 5BYWA 4NX0A 3BCDA 2EXOA 3AZSA 3K4AA 4OJYA 1LQ0A 3KLKA 2CERA 3ZOAA 2WBGA 2D22A 2ZXQA 3HZ3A 3WEOA 1VF8A 4DO6A 1FA2A 2UY4A 1TA3B 4OIFA 3RM4A 1JYNA 4CN1A 4GZEA 3I3BA 1W9UA 3APGA 2E9BA 3G6MA 3CUIA 3HMCA 1JL8A 1E6XM 2E9MA 3VNYA 1B2YA 1CXKA 1BQCA 4OBRA 1UD2A 4PBGA 1P6WA 1E6SM 3MKKA 3MSGA 1JNDA 4F9DA 3AXHA 1LL7A 2YLLA 3CZEA 1EOMA 2YL8A 2FHBA 2PWDA 1GJUA 3WELA 4P8UA 5I0DA 4QFUA 6A3HA 2CETA 5A1AA 4DM1A 4DWSC 1E5NA 3PN8A 4D6GA 3GXFA 1CZ1A 4FLSA 3WDJA 3EJSA 1J9YA 1PE31 1WZLA 3WY3A 6CGTA 4M56A 1X1NA 4MB5A 1WAWA 2WK2A 2V3FA 1BLIA 1J0JA 3IJ9A 3N13A 2VQTA 5HXMA 5CGMA 3VPLA 3MUIA 5FL1A 4GO8A 1AQ0A 3SEPA 5M03A 1B30A 3PTMA 1UUQA 1PEZA 5BXRA 2VX6A 1UR1A 2FH6A 4B9ZA 4AD4A 3M46A 3MMDA 2J7DA 4GI6A 3VSUA 4OZOA 4AZCB 1J0KA 5IDIA 3AIEA 3CMGA 3GYCA 1JD7A 1ITCA 1G0CA 1CYGA 1M03A 2ZX7A 1PBGA 1MYRA 2G8ZA 1CWYA 1B31A 4QP0A 2YDSA 3GH5A 3VIHA 3TTOA 3WD3A 2GDVA 2X2JA 3PBGA 4UZSA 2EPLX 4ZXLA 1ISXA 1JF5A 4M24A 4NZFA 3GXIA 2VZSA 1C7SA 2VRQA 1ZBWA 2VMFA 1Y7VA 1BYAA 3K8LA 2Z1KA 5DT5A 2GDUA 1M01A 2OWCA 1GOIA 3BUBA 3GNOA 2QHAA 3WFLA 1KWGA 1GOQA 1W32A 1WE5A 1HN1A 2BY2A 4BA0A 1GQIA 2Q8XA 2VZOA 4GKLA 2CCRA 2CESA 4LGXA 1US3A 1QNOA 4GI8A 1GHRA 1KBBA 1FH8A 4MTVA 4PCSA 4E8CA 1TA3A 4P7QA 1AQMA 4W86A 4JFSA 3WUFA 2NT0A 1KFWA 4B3KA 1EIBA 1C8XA 4C7FA 1UQYA 1U2YA 4X0NA 3M7SA 1R7OA 5EBAA 1QW8A 1D7FA 4D1IA 1HJQA 1BGGA 1W1TA 2W67A 1G9HA 4LYRA 1TE1A 2UY2A 1FHLA 3W4RA 4NF7A 4UFLA 4M80A 4AZ5A 2GUYA 2XWDA 2G3IA 3SCSA 2WPGA 3WN6A 3L2LA 3BAWA 2VZVA 3HJEA 3CMJA 3EYPA 2XYLA 2VCCA 3HG4A 2FHFA 5BRPA 2WCGA 2J8GA 2CHOA 4AZHA 1XV8A 3LPGA 3I3EA 2WCAA 3UESA 3NDZA 2WC3A 1PIFA 2W91A 4MPKA 3A6OA 4M81A 3KEHA 1VFOA 5I5RA 5E70A 2WVVB 1OM0A 4EK7A 3WMSA 3O2LA 1L8NA 5GPRA 4TTUA 2EADA 2JF6A 4WSJA 1YHTA 3SUVA 2EPKX 4CD5A 3NSMA 4AEFA 4AZCA 3CZGA 1GQLA 1ISZA 1UR4A 3T2QA 4QLJA 1UD6A 3NSXA 2BY3A 3EJRA 2CBJA 2DSVA 2XSAA 3AQUA 4IPNB 3DYMA 4PUDA 1W3JA 1R75A 1E3XA 2BY0A 5LA2A 4M1RA 5JIWA 3WDHA 3K8MA 5IHSA 3RJXA 2TAAA 3PTKA 1QI5A 3AHZA 1IZKA 4JFWA 3AXIA 3NDYA 3TOPA 1V03A 1HF6A 2VURA 2VUYA 4E8DA 4CGTA 1B1YA 1R85A 3O9NA 4HU0A 2ZUUA 1C92A 3ARTA 1UKPA 2BS9A 4WKHA 2D73A 3VM5A 3RILA 1US2A 3CZSA 3FAXA
chains in the Genus database with same CATH superfamily
5AECA 2I5QA 4N4YB 3IDNA 1T6WA 3FSTA 1BWWA 4OLZL 3D39B 5E99L 4DP1X 5D7KE 2AXGA 4J12A 1J5DA 3D4GA 1JFQH 2VKXA 3KBHE 3VXNA 4LY8A 5AW4B 5DVLA 4B5WA 2FNWA 3MTWA 3S6TA 5CFHA 3GC5A 1AGFA 2IAMC 3N9GL 4FE9A 2JI3A 2WSRA 1NBVH 1YTEA 1ZTXL 3QUXD 3IPFA 5GS0H 3FHEA 2FQEA 2CIPA 1Q2RA 4DPQA 2I7SA 3QUKA 4PUNA 5REQB 1CEOA 3FTUA 4YTRA 1JK9A 3U0WL 1H9DA 3EDFA 4FXTA 3TN4A 3C2OA 3LCXA 1LO4H 3LZLA 4XC3L 2OCCB 4PD4K 4UTAA 4HAKA 1BAGA 1BLNB 4LSTL 5JQIB 3QQ0A 3ETTA 3LEXB 3WKQA 2VDLB 1OK6A 4LZKA 3DIFB 4F8QA 4IMDA 4MBOA 4GXUM 2HPIA 1OD9A 4E5XA 1ISVA 4M6PA 2V7HB 2OMUA 4GRWB 4PW9A 3HTWA 3MLXH 4L29A 1OC5A 4JS3A 1NQKA 1B6DA 3WLJA 3UAEA 3MJ8A 5I76A 4YS1A 4OSUL 5DXXA 3EYVA 1RZJL 3TLQA 1XLIA 5IW1A 2GWNA 2VI0A 3UJJH 4L3FA 1OSEA 1WGOA 5KWYC 1A0QH 4EAEA 4GAFB 2A4CA 3OIHA 4TOQA 4OJAA 3VFUA 3L3IB 2X88A 4Q0XH 4UINL 2UXTA 3NTCH 3S2NA 1WB0A 1TNMA 4NERA 1MLCA 4JFEB 5U4NA 4PJHE 2OFQA 3HS0A 2AERT 2BNUA 4PL2A 1JJUA 3GRWA 2AK4E 1ZP3A 1O5DT 4P3DA 3QCTH 3S8FB 1ONRA 3PJXA 3RFZC 1INQB 1T03L 2PRMA 2OMVA 3N41F 1MAKA 4KRUA 3KL0A 3C3UA 3CQQA 1TVPA 9RUBA 2QUUA 2XV0A 2VFGA 1D7CA 2ONEA 3PULA 1DVZA 3MI6A 4BCEA 5CN2A 3RVWD 2AJYL 3TBSA 1FFPB 4QXIA 5D2WA 1UWIA 3NAAL 1KGYE 2XZ9A 4P8VA 2ICEB 3H6AA 1PD1A 5A8NA 1OT1A 1XSKA 3H9YA 3HGOA 3KVPA 4GK8A 5CXPA 3D39E 3T8QA 1IGFL 3I6LE 3P14A 5C2CA 1HL9A 1T6VN 3F64A 3ENEA 3RVUC 4Y9CA 5EA0L 1UWRA 2WZPD 3FF7A 3ERPA 4YHIA 2RTTA 3VO0A 5GHWH 4V27A 1YDPB 2W61A 4NLAA 4DH2A 5GRYA 3HQ1A 2A6NA 2WUCL 1FFTB 2PDLA 4TX6A 3UROR 4AKOA 3LEYL 3EYOA 2TYSA 1ZA6A 2C3WA 2WQWA 1V6XA 3FAWA 2VDMH 3BV7A 3EBGA 1YUKB 3WH9A 1E3ZA 2LT9A 3R2GA 1I8IA 5D9SB 2K45A 2LAAA 1FCCA 4IU2B 4PR4A 2NX5B 1CE1H 1QU4A 2J8UA 1QA9A 4ADGA 1N12A 2J56A 2Z2BA 1PD0A 4AVOA 1FOBA 5IEHA 3MV8D 3OF6A 5IROC 1R3IL 1ADOA 2ZUSA 2PDNA 1TT6A 3S47A 4NYLB 4UAHA 4X6EB 3QRFM 3GNPA 4P9MH 5J1AB 4QHNB 4XAWL 1EEZA 1FH7A 1AGEB 4BI7A 1DV7A 5TF1L 2NUTA 2H2SC 5FL0A 2CZ5A 1V7MH 3MJMA 5HR7A 5DEGB 1T89A 3P0XA 4Z1CA 3S36L 1J9RA 4XTRD 3JXAA 3CHQA 4JFEE 2FR4A 2ZRVA 4MZ3A 2CIKB 3QZWA 1FWTA 3LXCA 4NKDB 3BQ6A 1KRBC 3CG8A 1YEYA 2B1HL 2KLRA 2XLLA 5HI3D 4IZGA 3VH8G 4AY8A 3PL6A 4EXKA 5INCB 3LHUA 2EXYD 5JOEA 1IEQA 2VW6A 3E9AA 4EVNA 1ZXKA 4N8VA 2VLKB 2ZXBA 2QIWA 1RVFH 3PQYD 3RE0A 3IJ7A 3HMXH 2XN1A 2X1QA 3GSRB 2J8HA 3HG5A 4RBPH 3PFUA 4RNFA 3VNDA 5HDQL 3IGKA 1OSZA 5LAXA 3QRGL 2P8PB 1XF4A 4I18B 2EHHA 3DEQA 4B5SA 5LXGL 3HRZA 5T3XE 1ZRUA 2TSBA 2ISWA 1IU1A 3WIHH 3I50H 4DK3A 3DXIA 2CAKA 3O2DH 1XXFC 3RKPA 1A0EA 4PYHA 2R1PA 5GRWA 4TNEA 3IEAA 5HNUA 2YBGA 4XAKD 2NTFB 3ZTNH 5H35B 3SDDD 2FATH 4JRYA 1J5HA 1QO5A 1J2WA 1QLFB 4M8UA 1OD0A 4LCYB 2ZOKB 4HEMA 5FA3B 4LNVA 1T21A 3G5ZA 1IT0A 2GBTA 2COVD 1WUFA 4I13B 4A66A 1IR2A 4OGYL 3EO9H 4X0VA 4PREA 1BPLB 2BY1A 1A80A 3B7TA 4LESA 1GVOA 4LSDA 1T5KA 3KHQA 4F7EB 4GUOA 1MCEA 4AOFA 4QROA 3C60D 3NEXA 1Q7MA 1ZT4A 4LSPH 4CMMB 2ITEA 5E2VL 1AI1H 4F3FA 2F5BL 4ORGB 2DBLL 5F1NB 3VMPA 3RWHB 1A3LL 3G5YB 3C5JA 3KCWA 5IMLB 3FO0H 1Y6NR 4DXXA 4JO1L 2TPSA 4LXFA 2ZSWA 4H9YA 3VWKC 1OE2A 4GMEA 3AQYA 3KXFD 4OGAD 5J5DA 4XP1L 5F89B 3QEGL 1LUCA 3UXDA 3TBTB 1V0MA 2QBWA 7XIMA 4G8GA 4XN7A 3P73B 5F97E 5CEXA 1NCTA 1TQSA 3EGSB 4KKAD 1LTXA 1MNSA 1MSPA 1BMGA 2ZVIA 2YMXH 5KYNA 4CQAA 2VLKE 1ZU8A 5AFAA 3RWDA 5L2KA 3NQVA 1Z3RA 4O58L 4MUPA 4KNTA 3GG7A 1A2YA 1WA2X 2BZDA 2ZXAA 2YJQA 1O7DE 1DQJB 5L0QB 5JIHA 3BOLA 3AHVA 4KX7A 2BRRH 4XMXA 2PXYA 4J8QA 2WMPB 2RDTA 4PCTA 2JKSA 3CFBB 1X5HA 1G4TA 3S42A 5DO8A 2KLSA 4FNQA 3QTGA 2E7CA 4UUJB 3QDAA 1O6SB 2BNQE 5HQMA 3W6YA 3V5HA 1MFNA 1S9WA 4FIRA 4PRIE 3P4OA 3F5WB 5L7XL 1MFDH 1EFXA 3T42A 1P5UA 5CZ0A 3SCUA 4WI4A 3S8HA 3LXAA 2EXSA 3CQIA 1Q72H 5ICXA 4KRTA 1AHWB 2APFA 2E7HA 3F5LA 2ERJB 2PPEA 1LQ2A 4HPGA 5M1TA 3C8KA 1QYGL 1A4MA 3ARQA 1PU0A 1A7BA 2X4SB 1TPFA 3TUUA 3MP5A 5ANHA 3V3WA 1ZT1A 1OBAA 1RJLB 4Z3JA 3JUGA 4WGKA 3S35L 3RY5A 3QZBA 4MJ5B 5DA4A 2UZYB 1IM9D 1EB3A 4C7GA 2NYYC 2DQTL 2E76C 4O12A 1BEXA 5TQ2L 2BBFA 2QULA 1Q6LA 4HPJA 3NIFB 3OKDB 1CPUA 1NIDA 3HE6D 1E4LA 1TSHA 5INDB 2D0HA 1OZTG 2IANB 3UWWA 1WWWX 1XR8B 1JF1A 3NL6A 2A9ML 4NSKA 1SHWA 5E9DB 4ES8A 4R4NC 5GIRB 2ZOXA 4RCXA 1B9BA 1GPFA 3VFLA 4MXVF 3TMQA 2KPWA 4JR9H 1AW5A 3AM8C 1GGIH 1FGVL 3CCHA 1EUAA 3N2JA 3GHEL 3IXTA 1CCWB 3GUTB 1X7QB 1FH5L 2O6DA 4YTTA 2AEPH 2AQ1A 3LN4B 1GYCA 4PMOA 1OT4A 2G95A 3HHRB 4IG2B 5C2BL 3HM7A 2HFFB 1YAIA 1ZJBA 3KWTA 3UIZA 3G04A 3QJUB 3DUSA 3SYOA 1M53A 1PS3A 2OQHA 2DZPA 3BUTA 1OCJA 4JTUA 1CICA 4S2SA 3RB5A 4M8QB 4R96B 3KTCA 4O1AA 5DJ2B 4NNAA 1AG0A 1I3UA 4ZAKA 4UR9A 2X9WA 5DMMA 2IPKB 4GSUA 1S3RA 1SSDA 1C8PA 5EF0A 4GIAA 4DB7A 4S10A 3VE0B 4WF7A 5DZ9A 1NP0A 3DVFA 2BWGA 1YADA 1D5ZB 1IVTA 3I02A 3F00A 2B9AA 1F76A 3V5OA 3OL2A 4KZEH 3VA2C 2AK1H 1PZ5A 3M44A 4OCYH 3P77A 2XYBA 1EO5A 3X3FH 4OCWH 3SJVB 1Q94B 3GXPA 5HUPA 1VPOL 3QNXB 2CDGB 3STFA 4XPAH 1JPGA 3MRNA 4HJGA 3U1SH 4W7UA 4H4NA 1QHQA 2ENJA 2HDJA 1ZL1A 3VFTA 1MW1A 5DFTA 3SDAA 1M71A 2HKHL 3W7NA 4R90H 2C1HA 2J9XA 4AG4H 4H20L 1NAML 1TWDA 1MJJA 1RJYB 4NQCD 5M3WA 5DMLA 5H8MA 3NIFE 3DBPA 4WU5B 2BTMA 1RZQA 1W5OA 3OAWA 5EKYA 2MJWA 3LVTA 4PLKC 5CEZH 3VRIB 2FT8A 5GRXG 3U9PL 4N5ED 5IK3B 2GI7A 4OD1H 2IDFA 3BSZL 5E9DE 3M17B 1QR7A 2FBOJ 4L1LA 4K3DH 2VRJA 5D4HA 4IUGA 4ZXOA 2E25A 4JKWA 4I3SH 3K5RA 3RZCD 4Y88A 3HBZA 4PG9A 4I77H 5K4XA 1ECYA 5GNYA 1MUJB 3O6LH 5LCVH 1OC7A 1P9MC 1DQUA 1EZSA 1LEIB 2Z25A 2VR4A 3QUXC 3JU2A 4U3XA 2R0LL 3FCGA 3G3LA 2X4UA 2YLHA 2QQKH 3GVVA 5IB3B 4IRSB 3N50A 3CZJA 5MEQB 1DXFA 4PB0H 1PX3A 3DJRA 5G2IA 1OX5A 2LHAA 3FB8A 4DEPC 3DK0A 2PDKA 4L4OA 5JVLA 1TNNA 4HPOL 3INPA 3UVAA 4PJ7A 1BF2A 3TA3B 3AMGA 3UERA 1RLCL 1TFVA 1LD9A 4FOUA 4LTSA 3MO7A 3NFSL 5EUOF 4CC4A 4FX5A 4HJIA 4RW5A 4G5AA 4YPGB 2NY5H 2DJSA 5EF3A 2RDXA 4LBAA 2WAHA 1QNZH 2P5WD 1SUJA 3SY0A 3UGRA 3SCMB 1J5SA 3SJVE 1OGTB 5JMRA 1W1VA 3MDWA 3K46A 2P47B 5E0FA 4Q4PA 5IR1B 1IL1A 4MYPA 3VTTA 1XIGA 1P4UA 1HSBA 1PG7L 4YX2H 1CE6A 1TV2A 2HLAB 2B4CH 4M61A 1MI5D 1ZHBB 5GJSH 3IDIA 3KL5A 2VLRD 1S9KC 1W6WA 4LBSA 1NBQA 4DPAX 5ENWA 4H1LB 4PRTA 4F7PB 4NSBA 4PWHA 1X9QA 2P3EA 4PSPA 2NQLA 3MJ7B 1P5VB 3QMTA 4RQQA 1DN0B 2IDCA 4EN3B 1A4CA 3I9GH 4BDVB 3WSUA 2I14A 1HWWA 2BW4A 3U2IA 1QG3A 3ABRA 2Z4TA 5EDSA 1Y1DA 4HUUA 2CHZA 4NT6B 2JJTC 3VXUA 1GVFA 2EIZA 3T3PF 3H0TA 3V5KB 4LLVA 3UR8A 1SZEA 3KR3L 3RVWC 1JFQL 2J78A 3GXDA 2CJSA 2OW7A 3MGOA 2ID5A 2FUTA 4HKZA 4Z1BA 3RBGA 2X7VA 1RCYA 3VQ2C 5KSAC 4NX0A 3ULUF 3D06A 1NBVL 3AZSA 4EXPX 3PIQB 1TYEB 4GH1A 5E5RB 3E2HC 1ASPA 2J1YA 2HKAA 4CMHC 4YSOA 5GGTH 4WFEE 5IHBA 2I5IA 1GS8A 1O7SA 1NBZB 3WLTA 1LO4L 3WXVL 4E3TA 4KVPA 1LEKA 4F9DA 2FEJA 1A7QH 2V2TB 3CH0A 3BVDB 5EU5A 5C3IA 2DP3A 2OJEA 4HIXH 4E2BA 1XYMA 4X6CB 2XZ7A 5HHXH 2DQJH 1E9IA 2V3FA 4NRXA 3DDMA 4FULA 2XHNA 3C6SB 3IU4H 1XH3B 4GRSA 3U1QA 5I8OL 1MFAH 2Z65C 4OM1H 2W80C 3UJJL 1RCXB 2CZEA 4TL4A 3MZNA 1GCFA 1A0QL 2Z7GA 3HBQA 2CXEA 4HBCH 4XO5A 1CUOA 1IFHH 4MSWA 1A22B 3UXLA 4UQ2A 3BPNB 3NN8A 2NOYA 3VC5A 1X5GA 1GOQA 2YWZA 1F8IA 2Q8XA 3NTCL 4JGUA 3B5GA 1A6AA 4ONFH 1UM4H 3U0PA 2VM9A 4YDKH 2BSEA 1X7IA 3QCTL 1CT5A 5MEOB 1G9HA 3RU8X 4S11A 5IB5B 3PR2A 2OSLA 3BAWA 4HBKA 4AYDC 4XTRC 5IESL 2Y5TA 5LNGA 4UM8A 3NM1A 2JCWA 3G1AA 3NZ8A 1JQVA 1VFOA 5HI3C 1J9QA 1HHJA 5BZAA 4HZLB 3ULUL 5JHDD 4IPPA 1YNKH 4TTUA 2JF6A 2FGWH 2EPKX 3IIZA 3NSMA 5D7IA 3OKNA 5HGBB 4RDWA 1Q8AA 4LGSB 5DEFB 1YMMB 3NL2A 2DZVA 3ZXAC 5JQHC 3K8MA 3NDYA 2OOGA 3G0XA 3R12A 4OAWA 4HYTB 1C92A 2VXTH 1XRSA 4J23A 1US2A 3VFWA 2FTPA 1DQMH 1J1XL 3NNTA 5IJCC 1N0LA 1BFTA 5DZAA 3LSOA 4KKNA 3AROA 1CTOA 1MQ8A 5DYOA 3BAXA 3JWOL 1PZCA 3L9CA 2VDML 1V8EA 1W5NA 4ZUTB 4EQ3A 3G1FA 4JZNB 4AQLA 4QYAA 1WDQA 4GXFA 3DLQR 4WKZB 4MJ6A 3BIKB 1MOEA 1PS2A 1K03A 4NY2A 1FHUA 4G2DA 5EZLB 2YKKA 4B5VA 2PTDA 1VRSA 2XISA 3OF6D 1EF3A 4X6CE 3NEEA 5ITFA 3HC0A 4HLZH 2ZCGA 3P0VH 3U6XA 1A3QA 3IIOA 1NFDB 1TQCB 4FQPA 4AIZB 3VGBA 3MGAA 4Q8BA 4LAUA 4PCKA 1MCRA 5FO9B 4WHYH 4EI5A 4B92A 1NAKH 2H41A 4ZSOA 5C0BE 4EQ2A 4B16A 3VE7A 4JQ1A 2VQ1B 5HNNA 5DJZA 1UZGA 3QDJE 1P43A 5BOFA 1DR9A 1T0MB 1POKA 4BSWA 1H3UA 3J2PA 1DUYA 4PI2A 5IVXB 1FCQA 1CXIA 4MIMA 3L4VA 3V18A 3C60C 5MI0C 4A6YH 3PL6D 5B1JC 2XUWA 4Z6AT 4NB7A 3NGBC 2FYVA 2Q0ZX 3WFCH 3CWNA 2XICA 3D9AH 3GMOB 2CKNA 5G4NA 1NPJA 3MSPA 1NTDA 3URNA 3DRQA 1L0QA 1U30A 4XD6A 4GP5B 1AZ2A 1E8YA 1ZLWH 2QMKA 4PJGB 4X83A 3WDIA 1E5BA 1MJUL 2Y0FA 1REQB 1RVFL 3FBKA 1GVYA 4OGAC 3HMXL 3IT8D 4G71B 1OWRM 1E0WA 4MZ1A 3RJDA 5GS1B 3FU3A 2EPNA 4YZFF 2HG5B 4F9PC 4FFVD 4JTCA 3CUJA 4H41A 1QTSA 1XGRB 5KG9A 1XR9A 5DS8B 1UJQA 5IBLD 4XMPH 3TA4D 2DRUA 1C7TA 5CKGA 4NXSA 3VI4F 2DUZA 3NQ6A 1XF2A 4GG6F 2PWGA 2CLVA 5FGBA 1JXFA 2WHMA 3FEQA 3WIHL 3PQYA 2VDKB 1RALA 3I50L 4L0YA 4ODXB 3FGCA 4ZW3A 3O2DL 3MUJA 1HNGA 5LUMA 2ISFA 3KM8A 4LPYA 4JRYD 4LB4A 4YDLC 5EOCH 3S37L 1B3ZA 2Q8ZA 4XMWA 2MQCA 1ZLUH 1Z8AA 1ILUA 4HIQA 1ESOA 1QNRA 3ZTNL 4NKQB 4FNTA 1UQSB 4HUCA 5IMOB 2FATL 4NJIA 1I31A 3BAEH 4MUZA 4QE4A 2W65B 2OXGB 1CYWA 2ZP8A 3P4MA 2XI9A 2EECA 3T8MA 4JIRA 2PEVA 1DWJM 4ACYA 4YAQA 5DJCA 3GTFA 4CU6A 1WFIA 2OR2A 4YXGA 2Y7EA 3CFJA 5IHRA 3QEQB 1R3KB 1NFDE 3N2OA 3SDDA 3WLOA 5I1KL 1NARA 1A25A 4PJ5B 4E0RB 5EU3B 1ZY9A 4MMYB 3Q06A 1IWBA 3CHCA 3FCPA 5EN2B 4LC8A 3NOIA 3PZIA 4UTWC 3IANA 2XH7A 4LSPL 4M03A 4XPFL 2EDDA 4HS3A 3ZRCC 4WEMB 2FL5A 1A5BA 1HNYA 4FO4A 5JLZA 4YDNA 2Z7KA 3T81A 5IVXE 4JFXB 2PYFB 3EJJX 3KWVA 3FEMA 3FO0L 4JRWA 1GGTA 4FA6A 2WNXA 2R2HB 4G8GD 3JZEA 3WKYA 1U3ZA 2F7OA 3AWNA 4DQAA 1AGBA 2AGKA 4ZT1A 4GKOA 4G6JH 4L1WA 3UTSB 3UACA 4IGHA 2E09A 4RLDA 5F1UA 3WKZA 4Q33A 3K8KA 2PMQA 5L2KD 4ZFOB 1MY5A 1A5KC 1RFDL 1EBHA 4UIKL 1FZOB 2AQRA 4RCAA 3HE6C 1OF0A 1I8LA 4PJGE 2F6UA 2YMXL 1O95A 5D1ZC 3GTNA 2UZIH 4FCAA 1MKFA 2PXYD 1N6UA 4MQ7A 2GSEA 4QHLA 2FLIA 3PAYA 1UA6H 3QNYA 3PHOB 4HU2A 1JCXA 2C5DC 3M64A 1HSAB 1IEBA 1YLVA 4XO3A 2BRRL 2UY7A 5T3ZD 4P5UA 4IIFA 5AYBA 2HWZH 4LCUA 2L3BA 1AS7A 2EDRA 3PWJA 3WI9A 2E1DA 3URAA 1QI4A 2GJPA 4JM4L 1F45A 4JEGB 3WIJA 3S1GA 4Y16A 3BW4A 4I9JA 1A4KA 1JPFB 2FGLA 4PY8I 4HSHA 2F2HA 1EV2E 4ZVJA 3ZU8A 3D34A 3ZJAA 4AD0A 1Q9WB 4JDTH 4WV1A 4X7FC 3S4SG 2O5XL 2R83A 1MFDL 5D1XB 4KK6C 5C0AA 3ZL1A 2CRZA 4OLWL 4FQLH 1OGPA 5AVVB 1OCQA 2PRLA 2CG9X 3KPPA 1PYFA 3U46B 3IJSA 4HZ6A 4AC1X 2WYZA 2X89A 4NZ5A 3IAQA 4NO0A 3DO7B 4KZDH 1MXGA 3IWPA 1ONEA 2RJMA 2CPUA 1JI2A 3FRPG 1J05B 2XVPA 2K6ZA 1CBGA 2L0DA 1KTNA 1KCVH 4L7ZA 3TCLA 5DGQA 2RGMA 5CU5A 3QEQE 4UI2A 3QC0A 4KX9A 3DBXB 1Q13A 1FL3A 3I85A 2QPXA 2X6UA 3K72A 2ZZ3A 4PJ5E 5IW3A 3SGZA 5DR5H 1UTDA 5I71B 4FMFA 4ELMA 1KBLA 1H3VA 3WLNA 4GJTB 3EFFB 2WXJA 1E9PA 3UW6A 1IXNA 1K8IA 3TXVA 1FSKB 4JFDB 4L0PB 4LP5A 5D72H 1SXZA 2ATAA 2Z4QA 4QO1A 2X40A 2A5HA 2I32A 4GISA 4U1GC 4XD5A 1G7MB 1UWYA 5IBTH 2QEZA 3FTWA 3EBIA 4L61A 3DDGA 5C9XA 1AFVH 5KMYA 3WFHA 2J6WA 5JW4M 3UTSE 4FTDA 1IM9A 5FFGA 3GS7A 3R0NA 5A8OA 4Y96A 3E2VA 2DTMH 3LHYA 4DUOA 2BX7A 2PA6A 4JR9L 4F7MA 1SN0A 4OJEH 2A7PA 3V4UH 3T1WA 2QCNA 3DMMB 2GIYA 1Y65A 3RLHA 5I1LB 4OVUA 1RJCA 2AEPL 3SDXB 4RZ4A 5E1AB 5AZ0A 4MZ8A 1SFLA 4Z1AA 1JN6A 4G43B 1G7PB 1DJHA 3CH1B 4JFPB 5TK2A 1F8TH 1CICD 3RZCC 5IP4A 5CGBA 1XDMA 3EOBB 1T04B 3O6FB 2QQQA 3QJHA 5B7FA 4ZAKD 4AWTA 1AXSB 4XXDA 5EZPA 1W16A 2PP8A 1JPHA 3AJ7A 3M4HA 1CQKA 1VJIA 3NYKA 1MHEA 5AYYA 3IUDA 2EXWD 4PJCB 3RTLA 1RJQA 4ZJ9A 1XX9C 1I4FA 3S5YA 4RETB 5I1DB 3EADA 1R2RA 2ALAA 4IL2A 3LG3A 3EUDA 4F2MB 4NO3A 2C1PB 2HJLB 5AVHA 5D1XE 3MRHA 1H5BB 2Z7ZA 4NASA 1JNEA 1R5IA 1C5DB 4MHHG 4AV4A 1KB5A 2DS4A 4KZEL 2AK1L 4J35A 1EGJH 1ORSB 5F0PB 5GNXA 1TO5A 3X3FL 5DUPL 4OCWL 4U49A 1GR7A 3ZFHA 4A7VA 4JY4A 3MI2A 4PL1A 5I3JA 3T1GA 2KZ1B 2X4RB 3NQ2A 3K2GA 5JXQA 4S1SH 2IPWA 3QV8A 3SDAD 4XPAL 2WXGA 2IKHA 4LCWA 1A65A 3WX7A 3U1SL 3IETB 2CJ3A 5C08A 3GKAA 1ZPTA 3CV1A 5GRVK 1DVFB 1EEYA 1BD0A 3QORA 3EBAA 5DJXA 4OZIA 4GY0A 2J74A 4LLYA 1HAUA 4R90L 3DHPA 4AG4L 5A2BA 2N1KA 4JFDE 3EH2A 1EHNA 3LS4H 4MWAE 4PTMA 5HGAB 1NWTA 5F7EH 3LBMA 5D09A 5BRZA 3QEHA 4U6VL 2AL1A 3TS8A 4Y4KB 4MM1A 3LKSB 1G7IB 4ATTA 5CEZL 4XI5C 4A21A 3W1XA 1KNWA 3RX8A 1HWGB 3UPRA 4OD1L 4F8OA 4X5QA 4X7DC 2KH2B 4EUPH 2EH7H 5E2JA 2Q3RA 4QX4A 1PJWA 3GB7B 3SRKA 1HQ4A 1R17A 4P3CH 4XVTL 4NQCA 5D8ZA 5ID1B 1XIIA 4AMXA 3TO2B 4I3SL 4FNSA 4I77L 1VKFA 3DPBA 4LSSH 2OZ4L 2CO1A 1G7UA 4OFYA 4Z2JA 3O6LL 5LCVL 1ZGDA 3GIZL 1JK8B 3EOAB 5DVOA 1JVLA 1HQTA 3CJPA 4W4QA 4M7LH 5I3GA 2A2IA 2RUSA 1SFHA 3BWAB 1NANI 3CT7A 1EX0A 5FF6A 2QQKL 5IQ9A 5C7XH 5F1OB 5H6HA 4L37A 2NXYB 5DQPA 2ZG1A 4PB0L 4BJLA 1KYFA 3FTGB 2PLKA 2W0FA 1UBPC 3CPLB 1R3RA 4PJCE 1MWOA 3K5SA 4Q2ZA 2W0KA 4GYJA 4WQOA 1BYNA 3N1GC 1M2VB 1HILB 4I7ZC 3P2VA 3B8SA 3O45A 4LIQE 2B16A 4F2ME 3RFAA 2NY5L 4GPNA 1YO4A 3HAEG 3HKZA 4IWWA 2GTWA 2B7OA 1I7RB 5DX7A 4GQQA 1NGWA 2BW5A 4PTUB 5HWMA 1ML0A 4EOUA 4CW1A 2WBKA 2F9BT 1GOWA 2H1LM 2WSQA 5TTRA 1EZUA 2QEJA 1FZKA 4UTBH 3STZB 4MKSA 4AX7A 2Z31A 3HS0C 4F15C 5E2UH 2VC2B 4YX2L 3RLUA 2AEOA 4L9YA 2B4CL 4PJHB 5IOBA 5GJSL 2ATMA 4B91A 2K9FB 2OWXA 4HTYA 3OKOA 3L3OB 5KS9B 3L08A 4S3BA 2JKNA 3VWJB 1VCBC 3GSUB 4FFZH 1E4KA 3VXUD 2WVSA 3W7HA 3I9GL 1K8ZA 1F3JA 2QCEA 4K7PX 3WQWA 1DVJA 3QGAC 2P5EE 3VJ6A 4K0OA 1OF6A 4C1NA 4R9OA 1RSCA 3NJNA 2G2NA 3N43F 3V4PH 3S3GA 4ZUVA 1GGYA 1NFGA 3L13A 1BVKB 1MHPH 1MPAH 2VNCA 3IACA 3UBPC 4XGZA 4XSLA 1R3TA 4LVAA 4O2FA 1XINA 1PPIA 2DLFL 2V3GA 1RZ8A 3BEVB 1F3EA 1M1XA 2CDFB 3KCPB 5I07A 3W2DL 1UT1A 5GGTL 4I8DA 1FCVA 4IGNA 1B3IA 5D4JA 1XGYH 4ELDA 3D2TA 4WZ9A 5CZRA 4MYWB 1A47A 1WPCA 3GIQA 3AY4A 3V4VB 3QH3B 1HE7A 5GXBB 1HTYA 1A7QL 4KDVA 1IIKA 4DUVA 3I6GB 1HHKA 5IY5B 2DSWA 1NH6A 3BV4A 2K6YA 4HIXL 4CNOA 2Z92A 5HHXL 2DQJL 2X4NB 2D2CC 4AEHH 4KFOA 4FR1A 3W9DA 2DVUA 2XWJA 3IU4L 5DQ9A 2YUVA 1JHKH 1K7XA 4OM1L 5GGUB 2NMSA 1RY0A 3U4AA 4XUYA 3SGDI 3WMQA 3N6YA 3HG1B 2XIIA 4HBCL 3KRUA 5DRIA 4WTWA 1IFHL 3M1ZA 5BXFA 4L9ZA 1EP1A 1XB8A 2BSED 2D4FA 5B1AB 4RDYA 2BNRD 4XWOD 3V7AG 4NQSB 1M05B 4Z7WE 5I74C 4WR3A 1GORA 4NAEB 3IRSA 4ONFL 1UM4L 1T89C 3SUTA 5CWSA 4PJDA 3WLBB 3SCTA 3SQRA 32C2B 2APWA 3SKJH 2OODA 4HWBA 4S1FA 2ZCHH 2J79A 3PL6C 3AHXA 1H8SA 4X5PA 3DIDA 5HJ3B 3AG4B 1QZNA 5KS9E 2OLHA 3ZS4A 4GIPD 1JZ5A 4XP5H 4OLVH 4PRHE 3MVSA 3U83A 1YNKL 3HB3D 2FGWL 4M1DH 2KDYA 3FKKA 4HSCX 2EG7A 3RDKA 1ML1A 5IFTA 4HKPA 2R2EA 3VMOA 3QXUA 3WQFA 2Z26A 4OHQA 2L7JA 3CLMA 2P28B 3QIUA 4FLRA 1TZHB 1XUUA 3HRZC 2ZUWA 1WZMA 3DGGA 5CUSH 1PS9A 4FFVC 2VXTL 1TFHA 2E7FA 2BIIA 1M6JA 3R1ZA 5SWUA 4C57C 2XJ7A 4JJHA 4JIPA 5JHDA 5IBLC 4WD0A 1LJMA 3WTXA 4FHKA 3GPSA 4JKLA 4R2GB 2AMGA 1TVBB 2DSUA 1KPRA 1IQ8A 5H37A 1XF5B 5KVDE 1T5AA 4WNQB 4BF7A 3FUNA 3L12A 4OIIH 3EGXA 1BAFH 3OAYH 4P05A 3RX3A 5F71A 3TFKD 1F1DA 3HFYA 4DN4L 3ARBA 1EIXA 3I3BA 4EI5D 4U1JB 3G6MA 4LY4A 1JL8A 1E6XM 4W9LC 3P0VL 1KGIA 3Q7JA 4O14A 5DLMH 3EKCA 1CFSA 1NGYA 4P99A 2X28A 1M9WA 4M8VA 1XYAA 4KETA 3GVGA 3E3QC 3X14B 1MY7A 5FUCE 3EJSA 3HG1E 2ABAA 1UB6A 6CGTA 4H6EA 2XU9A 4BCZA 1CLKA 3B9OA 1WF5A 4EXQA 1M2OA 3MUIA 5AB3A 1LK2A 1UUQA 3FN0H 3L9BA 4A6YL 4JANB 3ROOA 3AIEA 3M0JA 3IGLA 3BW9A 4GC3A 4DP0X 1B31A 2J8OA 4N2YA 3BURA 4ZODA 1XRTA 2X2JA 3T8XA 3D9AL 4NQXA 3P4LA 1JF5A 3GXIA 1Y7VA 3QY6A 5LIUX 4LH8A 3PGCB 1WHOA 2NTSP 1HN1A 1L8PA 1QNOA 4KROD 1IIIA 3KZPA 3WIFB 3U36B 2V9DA 1HCZA 3C2FA 2V8ZA 1TTRA 5K39B 4D2JA 4ZPTB 1RJZA 3L9YA 1EXUB 1W1TA 1FL5B 3GMRA 2ADGB 5DTFA 4KI5E 3TURA 4XMPL 1PG7W 2WTRA 1F58H 3L3JB 4WTXA 1PZAA 1QFOA 3GUFA 3E0IA 3DOHA 1AZ1A 1G0DA 2JMRA 3IJQA 3W7IA 1Q85A 1BIHA 3LB6D 4X5WA 4NNYB 5K93A 4UT6A 1O5RA 3KXQA 5EOCL 3CVHA 1OZQA 1UR4A 2WLMA 3AQUA 1ZHNA 5DLCA 4TL5A 3Q3GA 1I82A 4ZNEA 2QCFA 2Z91A 2CUIA 4S3CA 1ITUA 3I7QA 2AVGA 3AXLB 1ASOA 2BNQB 1NMCC 2IQ0A 3UR5A 3L9RB 3BAEL 4M48H 1TPXC 2LU3A 3BUYB 4ZDHB 3UCCA 3KPNA 4ADIA 4PRIB 4F0MA 2ZUUA 4BFIB 1H51A 1P5UC 4WCJA 4YN5A 1A5CA 4HC1A 5C0GB 3U5YA 2ZOLA 1ICTA 3F03K 5FR3A 5IJBC 2YO3A 4BIKA 5IKCB 5FOBA 4Z0SA 4YHEA 3BMVA 2XWTB 5LG1A 1YNTB 4KGJA 1FLRH 4RGNE 3AU0A 1N68A 1OP5K 2PPGA 1DWFM 5AZUA 3C8HA 4AIXA 4ZI8A 2VCBA 4N2KA 2PWEA 5D7JA 2K6WA 3HZVB 1G43A 4G8FB 3EXTA 5AVXB 4Y9GA 3T4AB 1VFBA 3CWGA 1I2PA 4F33B 2QJMA 2DZTA 3HUJF 1W37A 3L95B 2AKMA 5FECB 4M62H 3MNWB 5ERWB 4R6UA 1H0GA 1WBZA 4G6JL 3FJ6A 2WO4A 3DUUA 2D2HA 3WU1A 4A22A 4JTLA 3T0BA 1ADQH 2FT6A 3T07A 3ZE0F 4JY5H 1PZ1A 3WTSA 5H2BB 4DELA 3B4YA 3LA4A 1Z0NA 2CWNA 1MFUA 4HUXB 4Z2LA 2CUMA 3L6FA 4DEUA 1UA6L 5ID0A 1V0KA 3U30C 1E70M 3UTQB 3WLQA 1FV1B 3RCYA 4MCYB 3QQ1A 3CV5A 1NDGA 5FKAB 2L7EA 2H1XA 2HWZL 1BSLA 1WISA 4Y16D 4MAYB 1F7BA 2UWEB 2H9GA 6PCYA 5IB4B 5J5EA 1D7BA 1NOAA 4AQAB 1EUUA 3ZVVA 5L6YL 1EOKA 1EQCA 4DSYA 5DMIH 3CGTA 5C0AD 1CICC 4AYBA 5I75B 3KDMB 2RHEA 4QKTA 4RMRA 4JDTL 4A3YA 1AHKA 4ENLA 3GF8A 2PGRA 5KYWA 2O1AA 2XOTA 1AR1D 4ZAKC 4LAZA 2QXWA 3VZXA 2X89D 3FT4A 1JCVA 3BLLA 4NO0D 3DURB 2FX7H 4FQLL 1UB5B 4KRPB 1W9VA 3VD4A 1U93B 2CXGA 5DRZA 1HKMA 1IQWH 2YXWA 2EXWC 3FO2A 2MQGA 3DYOA 1BM3H 2P50A 1E7VA 2HBXA 1D9KB 1XBXA 3F2DA 1YEIH 2CKBB 1E55A 2YD1A 1OG0A 3SSJA 1LRTA 4TM9A 5EEUA 5CCGE 4I2XA 5KSBF 4CN6A 3HQNA 1KCVL 3GM8A 4JPIB 4HHPA 3WUWB 1K3ZA 3ZUCA 1PHQA 4BS0A 2GUUA 2KI6A 4TXVB 3QC5X 5I26A 2EYSB 5DR5L 4KH2A 2Y62A 3WG6A 5JIQA 4DP8X 4GRLD 1M7DA 2OR9H 5FUZL 4ORIA 2GYIA 1OJXA 3HCVB 3N25A 4JFFA 4GKSB 5D72L 2X0HA 4YSDA 3WNNA 2NUPA 4PJEA 3LN9A 2JQMA 2OJ1A 5IBTL 1T20A 2RHGA 1P4IH 3L4WA 4G6KL 3I6SA 4NN5B 2ZAGA 1AFVL 3AIRA 1YRKA 4P2OA 5BROA 2HBVA 4M29A 1VLXA 2H3KA 4IJ3B 4E8GA 3JVAA 2DTML 3CN1A 1N0XH 2VXVH 1WKYA 5LGHH 3MU7A 1N82A 4QCIA 4GUPB 5E00B 1TEYA 1NFIB 2O6EA 1W15A 4XKYB 3BH4A 3FPYA 2GJZA 2J12B 1GOHA 1TXKA 4BJHA 4F40A 4R7DA 2VXQA 2JNZA 1T4KB 4HDIB 1MCCA 1J1PH 3VAEA 3ULVE 2VWTA 1JFHA 3WEXA 2JKAA 4P5TB 1SJAA 2UWEE 3O15A 2J24A 2H32A 5IBUG 1NOWA 3ASWA 3BG3A 4M7LT 1VFSA 3ZR6A 1KIUB 4K8EA 2VM4A 3L7EB 5DWUH 1C8YA 3P11H 5DK2A 2CITA 4Q22A 1J48A 3X3GH 5BOZG 5EO0B 1Q9KB 3KS6A 3DRTA 2G3NA 2Z35A 4YE0A 4KFNA 1E9OA 1NUDA 1JJKA 3EXRA 1FH2A 4RMQA 5BMFH 5DMGD 3GJEB 4CC4C 1LTDA 4JPWH 3G9VA 4OZHB 3BE1H 4WDTA 1A9BB 1GVEA 1EGJL 2LAGB 3IGHX 3EB3A 4LCWD 2P0IA 1XIMA 5DF0A 4DRSA 3V9CA 5C08D 4O51A 1E67A 4NQQA 5FDWA 4Z7VF 1R46A 4S1SL 1GOKA 4KF1A 5HDBB 3QORD 4ZL1A 1I7UA 5FYKH 3LRKA 2PTTA 4JDVA 5DJAA 1SEBA 3RWCB 1S7WB 5BOEA 3I7SA 4F2TA 4FKHA 5BUAA 1DCLA 5G1TA 4KEZA 1V6VA 2OGYA 4NQDD 5BRZD 4Z7QF 4WHYG 1MAJA 3CFNA 3W1NA 4TVPE 4UR8A 5B7EA 1E6OL 2HVKA 5D02A 4FJZA 4JRXB 3C5SA 1U3HA 1U8LB 4GI4A 3LS4L 4ADJA 1YQ2A 4EAYA 1AC6A 1BVLB 3ME0B 4BKLA 3C2AH 4QI3A 5TDPB 1WCBA 2HCVA 1L6GA 5TGBB 3Q2LA 4PY7A 4NUGH 4KAQL 1PDYA 3GZQA 4FIQA 3VOJA 4OFYD 5ESAB 4P3CL 3ECWA 3GMMB 4I1NB 3EJZD 2MPAH 3IVTA 1EUTA 4G72B 4KJYB 5BV7L 1MCPH 4HHMA 5I79A 4LSSL 4GUCA 1E4IA 1QTYT 2I9TA 1MCJA 3D2UA 2WJEA 1WFMA 3S5ZA 2QS8A 4PJXB 2XQYG 4QLWA 4YHNA 4M7LL 1YN7B 1B3WA 4AJYV 1GW9A 4XZ9A 1R3SA 1R7AA 3LQMA 5AFDA 5T1MA 2IF7A 5C7XL 1QFWI 4X80H 2AQ2A 3A67H 5B38A 1AHMA 5F7KC 1JUKA 4N0RA 3QGVA 1AZZC 2AC0A 4IHOA 2X4OB 4B5NA 2ITCB 4P2YA 3ZYOA 1URLA 3GU9A 5J13B 2V5JA 2Q8BH 2CDEA 5H4ZA 1FP9A 2CK0H 4YCPA 2YGYA 3II2A 2Q2LA 3R1GH 5JYMA 2B8OT 4F0LA 4OUEA 1XJBA 2VEFA 2EYRB 3FA4A 2DH3A 1TO3A 4YGVB 2CFFA 1U8IA 4KJPD 3CM4A 1CIUA 4G8EA 3JVFC 1ZVSA 1MCWM 4HKJB 3F2BA 5I06A 1S2AA 4OZHE 2Z31D 3EAUA 1ZSDB 3O4LB 4WW2C 2GZXA 1OQOA 2X0SA 4D0BA 5D1QA 2DDQH 3GSVA 3EEGA 3EZ8A 1QHPA 2JIEA 3MA7B 1TR1A 3LLFA 3RWJA 4UTBL 3LKQA 3OXRA 3QZMA 1TR9A 1JGDB 5CIPB 5HDBE 1I45A 1GZ1A 3H8AA 3LSCA 3T05A 4HUWB 4F91B 2IOIA 3PWNB 4XWOC 3FONA 4PLNC 5L88H 4ZQPA 1N70A 3DFPA 5CGQA 2JV6A 1WDPA 4QRSA 3EB4A 4NZ4A 4YO0B 4LVHB 1XZ0B 3DJZA 4TLTA 1QACA 4FFZL 4LNRA 1JV5B 1UOZA 4YNYB 3SDOA 5A2IH 4JRXE 4CNTA 5E5MB 4W85A 4WUUA 1YECH 3E5BA 3W85A 1EBGA 1W1YA 1EUNA 3KWWB 2WIMA 1EJWC 3KPOB 1P2CB 3QI9B 1DVYA 5SWZD 3SPJA 5E94A 2VLJB 4NKIH 3U0TB 1XF3A 3V4PL 4P2QA 2ATPA 3HI1B 2VDQH 3EWZA 4OZFH 3MMEB 1UWEH 4Q6JA 3KYOB 3T44A 4GRMB 1MHPL 1MPAL 2ZWYA 4ZX6A 1FFRA 1GTNA 3T2OA 3S5SA 1THAA 4PUWA 3FIGA 3OKEA 1PL9A 2FZ8A 1TJ2A 3SBQA 1XIBA 3IE9A 1E2WA 4GW4A 2WQAA 1P7QA 1XGYL 3GIPA 5BO0D 5JIIA 3T2NH 5F6IC 5GS0L 4PJXE 2H6UA 2ZQ0A 4K71B 3CPRA 1SLXA 3ZR5A 4BUGA 2WV3A 4ZFZB 3UC2A 1X5LA 4JFOB 4M5TA 5LIXX 4KESA 1W2VA 3S5NA 2YD8A 1PKNA 3FDKA 1VQTA 3BLPX 1HXYB 1L3NA 4AEHL 1QEWB 4ZZKA 4OQVA 1MZZA 5IF0A 5CF3A 5F70A 5I1AA 2FH8A 3QZNA 3V6OE 1UZ6E 2REQB 1JRCA 1L9SA 1T6BX 2NUWA 4NQEA 1JHKL 3HFTA 1CL7H 3MNDA 3U0HA 3GSNB 3TC3A 3TFKC 3RU8H 5D2LB 4R97C 3GK8H 3MLXL 3KOWA 5FF0A 3ET9F 2B7DT 4EI5C 2ZYHA 3O0RH 4X98B 1R3LA 3M0VA 4NL1A 3TM6A 4FNRA 4PWIA 5C0BB 4E9LA 2DQWA 3OODA 3A5FA 2WJZA 1NUGA 3O4LE 5BVPH 4D6IA 3QDJB 5B3SB 1E9TA 1VZIA 1AGCB 4L8DB 5C9KA 1O7AA 3D0CA 4L3AA 2BIQA 4CVZB 3GG0A 4ODSH 2D7MA 1S2TA 4ONHB 4Q0XL 3BEWA 4HA0A 2P8BA 1PUDA 4DXVA 3SKJL 2DQIH 2VWEE 2WGXA 3GFUA 3JUYA 1RHHA 4RNRB 4MJIA 4D72A 2ZCHL 2NV1A 4IIEA 2BNRA 3K2MC 5ICUA 3LMJH 4WJKB 4ZOEA 1HOEA 4OLVL 4WGWB 1UC4A 4GVFA 4JNYA 6TAAA 5KUMA 3FT3A 2V7NA 3A4XA 1IBFA 4M1DL 3QIUD 2PLCA 5FKPB 5F1IB 1RVKA 3T7VA 4ACPA 2EEAA 6ENLA 1HJWA 5JPNC 4DVBA 2VLJE 4PGDB 3KYAA 3EJUA 3V8OA 1WAUA 2E67A 2OM5A 3VXMB 3TKFA 3DX8A 5FYKU 1XSJA 4TNVK 2EXYC 2MCPH 2Z93B 3CZUB 5CUSL 3INUH 3LGDA 1BECA 3BQUB 4QOKA 3ARZA 5CPLA 5FGBC 3S4TA 3MB9A 4H8UA 3L3HA 2R6OA 1ZXQA 4MB1A 1AMKA 4LHUD 2VN5A 1ZHKA 5HUOA 4D8ZA 3M0MA 5GHWL 2VDHA 3KEDA 5D4YA 4UMSA 1EDHA 3ARBD 2XWXA 4OIIL 1E9QA 4EDXB 1BAFL 5TFSH 4B5ZA 3FO1A 1AVAA 1EJ6A 2OEKA 4H40A 3W0WE 3FOMA 2OO0A 4GC4A 4UMCA 1AE6H 2ALDA 2AANA 5FYLH 3LN5B 5CBBA 3NZSA 5DLML 4OLEA 3NESA 2XPGA 5AOUA 4WTZA 1Q38A 5JDSA 4FL4B 4DWDA 3L4CA 1CE1L 4Z7NF 1H3XA 4ZTYA 3N11A 5D2LE 2CZNA 1SN5A 1CDHA 3PBMA 3SDDC 5L8JB 2XZCH 5HA7A 3W7LA 4NDMA 3WYRA 3QPYA 3DPDA 2G75B 3LPPA 4N90E 1SY6H 3DXAA 5KETA 3WLSA 1A4BA 3FN0L 3RXZA 5I02A 4P9ML 3SO5A 3IDGA 3PS7A 2RFXA 5C86A 4N2CA 1Q63A 4JGNA 3LH2H 1HU8A 3ELQA 1BVWA 3E1ZA 1V7ML 4WJ5B 3VZZA 1P7TB 1SO3A 2OULB 4QR7A 1RJRA 5EPMB 2OL3A 2LQRA 3VQ1C 3NQDA 4NAQA 3CX5J 1CGYA 2NRDA 4LL9A 2WAGA 5HHPA 1QSZA 3HQOA 1JAEA 3HN5A 5HJXA 1I9CB 2CWXA 4AK1A 3LBOA 2PURA 3CFCH 1OSYA 3RZWA 1I8LC 4KNQA 2HA1A 4G7EA 4M6VA 2EG8A 1MSSA 2FRGP 4Y5YB 3KPRB 3R58A 3QV6A 2DT3A 3AY2A 3PB2A 1F58L 4BSVA 25C8H 3GHBH 3TBVB 3VXME 5FHBH 3F4NA 4KKAC 3OKLB 2Y9RT 5A6MA 1SSGA 1D2OA 3QJFA 3GMQA 2AEIT 5JH2A 2J7GA 1VIZA 1HI7A 4EUPG 2V82A 4XAZA 3OIXA 5I77A 3GHTA 2AABH 4N42A 1XDTT 4DVRH 4B15A 3NRPA 2AFNA 5F3FA 4NNXB 5E23A 4JTHA 4M48L 1MHHB 4AXWB 3GO1H 1E4HA 1FFNB 4OLXH 5I2IB 1MWAB 1Y5VA 3GVRA 2IDQA 3WQ4A 1IFGA 4X5XA 4Z0XA 4I88A 5I66B 1LBMA 1XGZA 5D04C 2N0MA 3Q5YA 4R4BA 4HJEA 3GPEA 5D7JD 4UZUA 3LKOB 3MLUH 2F19H 3EO9L 2E59A 2ZNWA 3Q8AA 5I5MA 1Y1UA 1EL3A 1OCBA 2CERA 3WTVA 2DWTA 2D22A 2FWUA 3UPAA 4POUB 2A6KA 1I2QA 4RK8A 2F53B 3RUGF 1B2YA 3OZ9H 4KWSA 4M62L 2HEJA 3BP6A 4JHBA 4HKXA 3CZEA 2GPZA 4PWGA 1QWGA 4Y5XA 3RG6A 1AI1L 5BJTA 4QJ5B 3MQIA 5I0DA 2CU9A 2XN9B 1UB3A 4FX6M 5A1AA 4M7JH 4QPEA 3MGTA 1TPEA 3HZKB 1MJ8H 3GI9H 3ANUA 4PD4J 5EWIH 1I9RH 1COBA 5HXMA 3VPLA 1ADQL 4ETQA 4YBLB 4JY5L 3SPGA 1L3WA 1KM1A 1XLJA 1G0CA 1NCOA 1M03A 1MYRA 1AKPA 3NJMA 2X1UA 1N9PA 3VIHA 2GDVA 3M1CA 1DQKA 3IBOA 1GKOA 3ZZ1A 3PNRB 3K8LA 5FO8A 5DT5A 1H63A 4HZ1A 3KPRE 3MBEB 4AF0A 1PSKH 2APTA 3SPIA 1KWGA 4O28A 4L1HA 5JNYA 5G4WA 5F2LA 4BA0A 1GHRA 2ZVRA 3UH8A 3ML9A 1IO4C 2NT0A 5GGSA 4KNUA 1YY8B 3S1UA 3BGFC 1S2EA 3O2WH 3VGAC 2P48B 4M00A 4NF7A 2OMXB 1B0GA 4X6DB 3G6JA 4P0DA 1ODAA 4ADTA 2A7NA 1KFJA 4UTLA 3E2RA 2PWUA 3B6SA 4PJAA 2J8GA 3LPGA 2FX7L 4K23H 2KZKA 3CUXA 1E2VA 1IQWL 4M81A 3MRMB 4OUUA 1R30A 5C6PB 4EK7A 1BF5A 1KLGA 1BM3L 2R8SH 4WSJA 4M5YH 2IWFA 3CUPA 3CZGA 1YRRA 1M7IA 2G60H 5DHYB 3R8RA 1Q72L 4C6EA 2QKFA 1GKRA 1F07A 2W8CA 5DMGC 4LMQI 4YFLF 4FTVD 4JFFD 2AI0H 2BS9A 1EPXA 4WKHA 1GS7A 4EOWH 3LHPH 3APFA 3LPFA 3QUHA 1B4TA 2WMHA 2Q8LA 2OR9L 5A2LH 1QPKA 4ZMYA 5KVGH 1S7VA 1JYWA 4QQUA 4AWUA 3QORC 2A9NH 3WLWD 4HIJB 1HKIA 1A9VA 2DPEA 3VXRE 3WUEA 2F53E 2ORBH 4EMZA 3VGDA 3ILPA 3D5OF 4LEFA 2WLZA 1A1NB 2VZ1A 4P2OD 4US5A 3F62A 5FM5M 1CFQB 1S7SA 4OD2A 5F7AA 3LEVH 4MWAB 2XN9E 4JL2A 3S96B 4U1KA 4E2DA 2ZZ2A 4GRLA 3FH8A 5D32A 1VS1A 3MR9B 4U1HA 3NDZE 4JG9A 3UZ5A 3BL3A 1N0XL 2D9QB 3WN5B 2VXVL 2Q09A 4MDRA 5LGHL 4AEOA 2W9LA 5DDHA 4DO5A 4RRPA 3ARVA 4NQ1A 1TCDA 5ANMA 4FXSA 2LOEA 2QJDA 4YEFA 8PAZA 1AQKH 3N73A 4RE0A 4AHPA 3P0YH 4M1GH 3CQKA 2BM3A 4L9LA 1GGIL 4U1SA 3RVTD 1J1PL 4V2BA 3RNKA 4J9JA 2EILB 5F7LB 4LVNC 4TX8A 5A40E 1JPKA 3EJZC 1TIUA 4JQAA 1GZQA 2XFRA 4N5EC 3V75A 2VISB 7ENLA 2DWEB 1TB3A 2IXQA 2KL6A 5FEZA 4MOZA 2QAPA 4NRRA 5LBGA 3CASA 1RXOB 5DWUL 3GMLA 3P11L 1FNLA 3ES6B 4NUMA 6REQA 4HMCA 3FOKA 1K02A 3BUQA 3X3GL 4X6DE 5T1LB 1B0RB 3WH5A 4XC1H 3T77A 3VXSB 2DIAA 2GT9B 5FIEA 2QSCH 1JUFA 2DWDA 5BMFL 5EULV 4JPWL 3U6RA 3SKUD 2EDBA 2HLFD 1UXLA 3W0KA 3WJWA 1LO5B 4WDWA 4Z7UF 1U5JA 3GGWA 4DF1A 4TMCA 4FXKB 3WJMA 3FU6A 2OBGA 1UIOA 4O02A 2X10A 4AZBA 1WITA 2X3CA 3IE4A 4HFWB 1VGKA 4PFEA 5JA8B 4ZB5A 4OCYL 5FYKL 1MH5A 4UQCA 3GTIA 1EERB 2Z31C 5LO7A 3SDCA 5BNXD 3GDTA 3VCCA 5GGRB 1KFAH 1U3HD 2V5MA 4V1XA 2WCPA 3CTLA 2CKRA 3V52H 5IHHA 3P1VA 4A3UA 3NO1A 4ACZA 5DRNA 2XWRA 1EJXC 2ZXWB 5HNTA 2A1YA 4Q6IA 1RP8A 4IKJA 1E4KC 1MHCA 2D2GA 2OMZB 3C2AL 3BPLB 4L9DA 4JLRA 2O4MA 2CBIA 4RL3A 4G6FD 3O6CA 4ZMQA 2P5EB 1PZSA 3QQ4A 4A2DA 4NUGL 2GAZA 4AW7A 4NQDA 4X8GA 4JTSA 1MG3C 4K1GA 5F4SA 1X5FA 4B9CA 5HHMD 3EFDH 3D2UD 1WDRA 2W5FA 2E56A 1V3KA 4FA3A 2MPAL 2Q3XA 2G3XA 4KTEH 2V3DA 3D8MA 1MCPL 4AL8C 4KXZH 4RUBA 3TR9A 4PH6A 3AHYA 5BW7A 4HNOA 1C5CH 2MHAB 3IU3B 4GQ0A 4K3DL 2C3VA 3Q37A 1M56B 4YTSA 1R1CA 3I65A 1JNLH 4HCRA 1CO1A 2VQUA 5CGYD 3TSDA 3QUYA 4KIRA 3RI5K 3MRJA 1IEWA 2E46A 4X80L 3A67L 3AY4C 3P67A 3EYUH 1JHTA 4RAHA 4AZ7A 4Q97A 2D03H 5FYJH 2HH0H 4RVBA 3KYKH 5EO9A 4Z78A 2Q8BL 2O61B 2CK0L 2Z6FA 3WEAA 3SUWA 3R1GL 2DKSA 5IFPA 3H9SB 1E3FA 4PMYA 3VFVA 1UG6A 3LMYA 1UH3A 5D1QD 3UTZB 3VXSE 1CFTA 2OVLA 4UB0H 4ZG1A 1R0AH 2O9PA 1L6XA 3LHWA 4GX8A 4PRNB 3B97A 1TE6A 2XV3A 1QD0A 2WMIB 1OWQA 2FTYA 2C4FU 2DDQL 1TTUA 1PWLA 4FQXB 4J8RB 4FNUA 1AZNA 4WFGE 3S5LA 5BOOA 5LIYX 4P9HC 1YE4A 1CI1A 2BHUA 3BO8A 2NY7H 5EL1A 1BQHG 1F6FB 3LPOA 3OJMB 2PDPA 5JHLA 1J88A 1QNZL 4K9JA 4Z7WB 4A2RA 5T91A 4ZMVA 2JCCB 2X4QA 4XBEH 5LDUA 3SQSA 4XZIA 4JBRA 1I1YB 3WTUA 3UWUA 5L88L 2DMKA 2C14A 4JFYA 2NW2A 4WUUD 1A21A 4DWSB 4Q14A 3PU7A 4XZ4A 3FMGH 1BVNT 4NPYB 1XISA 1EP2A 4V1DB 1J6OA 4P2QD 3R25A 3N15A 3D18A 4J3OH 1YECL 4Y8FA 4M3KB 3N6HA 2HAZA 3QAZB 3OXSA 2F9RA 4NKIL 4QYOB 4PRHB 1S9YB 3E12A 1LE9A 2GGJA 4Z1DA 4BRJA 4W9HC 3SQMA 2VDQL 2H0FA 1UWEL 2C26A 2V37A 5J6HB 3HOJA 1CGSH 4HJ1A 3PAJA 1R24B 4FYQA 4GX9A 4Q3MA 4HMNA 5CP3H 3VTAA 4E5TA 2WXRA 1IGYA 3QIUC 2OX5B 2CCVA 1G84A 1P7QD 4YHYB 4W93A 3BH8A 2CNYA 2XFXB 4QR6A 5F9WB 1T3FB 5SWZA 3ZHFA 5T8GA 2JVUA 2D2JA 2YEZA 3S2CA 3SQOH 3T2NL 4QDWA 5E6IA 5FW7A 4RKAA 3CS2A 2EG6A 1I1WA 5E7BA 4ILSA 4NQED 3E1F1 4NKOB 4ZGYA 5D4IA 1F3DJ 4XB7A 3WDPP 5F7NC 3SBPA 2JIXB 5CCHE 1YDOA 2WIIA 4BH7B 3V6ZB 3ARBC 1W3LA 1AACA 3LDBC 3B04A 1CL7L 4LBUA 2VDNH 1A9EB 3QW4B 2IPTH 3HLAB 3H9SE 3LGEA 3FK3A 1H2JA 4IMFA 3GK8L 2NY4B 3UY8A 4K38A 3NZRA 3M7WA 4M9PA 3O0RL 1FY6A 4JPKH 2X87A 1TPH1 1MFAL 4OR1A 1ND0A 2F8IA 1UATA 4GO9A 3E2QA 1D5BB 2DYSB 1U8HB 2DF3A 5BVPL 5JDJA 4DJEA 3HHSB 3K4ZA