3L4YA

Crystal complex of n-terminal human maltase-glucoamylase with nr4-8ii
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
864
structure length
863
Chain Sequence
VNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maltase-glucoamylase, intestinal
publication title New glucosidase inhibitors from an ayurvedic herbal treatment for type 2 diabetes: structures and inhibition of human intestinal maltase-glucoamylase with compounds from Salacia reticulata.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 272
structure length 863
sequence length 864
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00088 Trefoil Trefoil (P-type) domain
A PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31
A PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA04
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3l4yA05
2.60.40.1760 Mainly Beta Sandwich Immunoglobulin-like glycosyl hydrolase (family 31) 3l4yA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3l4yA03
4.10.110.10 Few Secondary Structures Irregular Spasmolytic Protein; domain 1 Spasmolytic Protein, domain 1 3l4yA01
1HTYA 4U5KA 2J7EA 3B9EA 4UQ9A 2WHKA 3UCQA 3DECA 5LA2A 4AZIA 3WQ4A 5AYBA 5CLWA 3MV11 4EK7A 4OKDA 1OBAA 5E9AA 3OGRA 5IDIA 1CDGA 2WLYA 4CN4A 1DWJM 3VGDA 4GI9A 3BMWA 2DSVA 5IHSA 5I3DA 3BAWA 4GQQA 2BFGA 3EMQA 1W1TA 1EA9C 2ALWA 3WDHA 1XCXA 1UZ1A 4DWSD 5BRQA 1R47A 5DMYA 2YDQA 4XZWA 1SMAA 2ZE0A 2X1IA 2Y8VA 4ZFMA 3ECQA 5A6JA 1OD0A 3MS8A 3GXTA 5CZKA 4PMYA 1PE31 3T0DA 4V27A 5DO8A 1JZ6A 2X2YA 1K9DA 3BUDA 2VI0A 1HVXA 4H8VA 3L4XA 1JNEA 2PWFA 2WC4A 1R46A 1W91A 2DSWA 5ABGA 1UWUA 4RE2A 4CN1A 4HOXA 1TQSA 4FLRA 1EDGA 1HKMA 5I79A 3VNYA 1VEMA 4C7FA 2J7HA 1KBBA 3W0KA 5A6MA 3HG3A 4XX6A 3AHVA 5CPSA 3CZSA 3AS2A 1HL8A 4AZ7A 4MDPA 1BHGA 1Y7VA 2Z1KA 5I5RA 1Q4NX 3VD5A 3PZVA 4D6FA 3VGHA 1HJVA 1UKPA 3VSVA 1E9LA 1E4LA 3FW6A 2CNCA 3HMCA 2EEXA 1ESWA 3MKKA 3AOFA 1QBAA 1XSKA 2XFFA 1TVNA 4PCSA 3CLWA 1OGGA 3AS0A 3WSUA 3ARYA 3GXDA 2PWEA 3EJRA 3L4TA 4W84A 1NP0A 1NWUA 3WBEA 3WFZA 2TAAA 5ABFA 1OD8A 2EPLX 3WF4A 3SCRA 4CD4A 2DIEA 2WB5A 1UH2A 4HMDA 4TTGA 2CERA 1QNOA 3VGFA 4MJ4A 1XHGA 4U31A 3VMNA 1QOXA 3PZTA 4JKLA 1JYNA 4LYPA 3KZSA 4AY1A 1I75A 1KXHA 3A4XA 4HMEA 4W88A 2WM0A 1SR0A 1GZJA 1JI1A 2Y2WA 4CN6A 4WLCA 4AEEA 3CUJA 1M03A 1CZ1A 2VT0A 1DWHM 2ZX6A 4AZHA 4PSRA 3GTNA 3CV5A 1QVBA 4GI8A 1GHSA 3AIWA 5F7UA 1VFOA 4AIUA 3VD7A 3ARWA 3EDFA 2ZOXA 3LX9A 4BS0A 4UFIA 4UOQA 2UY3A 3OLIA 1F4AA 3BLPX 1C7TA 1N82A 4FNTA 3AS1A 4XUYA 2QF8A 3AI0A 3OBAA 3D50A 5A6BD 2WWDA 3PBGA 5IXEA 1TQTA 2XUCA 4KMQA 5CGTA 2WZEA 3PTKA 5LA0A 1MFUA 3POCA 7CGTA 3VD3A 1W32A 3EJQA 4D6CA 5I2UA 3GH4A 2E0PA 2VRKA 3FHAA 2VQTA 4EE9A 2J25A 1QHPA 1W1YA 2VX5A 3VDAA 4QCEA 3VIJA 1JZ5A 4AD0A 3BH4A 2FH6A 5A2BA 5E6YA 4FNQA 4WKAA 3QHOA 2XN1A 1DP0A 3TTYA 1J9YA 3VDCA 1JD7A 1GOWA 1Q6CA 2O9RA 2NT0A 2ZUMA 1HT6A 5FOOA 3BVVA 4HMCA 4OOUA 2HVMA 2XG9A 3DDGA 3CZEA 2ZUUA 1J10A 3WQWA 1W9PA 1VEOA 3TTOA 3WUBA 3IGUA 4AD3A 4LQ1A 1JZ8A 1HIZA 1B3VA 5CGMA 2FHCA 1E0WA 2NW0A 1ZS2A 3WF2A 1E71M 3WFLA 1R8LA 4XZBA 2FGZA 5ABEA 1E4NA 4W86A 1TE1A 4F79A 2CKSA 4U3CA 4WJXA 2CPUA 1ZBWA 3W53A 1UH4A 2OYKA 1NP2A 5HPOA 1EO7A 3OZPA 1CXFA 3ZR6A 2XJ7A 5HOSA 3DYOA 2D0GA 2C0HA 5GNZA 2YKKA 4JCMA 1A3HA 2X0YA 4B15A 5BXRA 3D5HA 4P8XA 3SCWA 1VBRA 1JXJA 2VVNA 1BYBA 3CIVA 5JBFA 4AWEA 1JXKA 4HZ7A 4PSPA 1MQPA 3ZT6A 3GH7A 4PTVA 4ATDA 4B9ZA 1E72M 1WNOA 1VB9A 4A3HA 3BUQA 3JUGA 2E9BA 5D8ZA 3AXIA 4IPNB 3WUEA 4AZCA 1UD2A 3AHXA 4JHOA 2VRQA 2W61A 1UR0A 3BVTA 5DFAA 1EH9A 1UZ4A 3VX0A 1V02E 1C91A 3SUSA 3PZUA 3WELA 3VIKA 3LXAA 1HKIA 3PN8A 4U33A 4R27A 1E6SM 1EDQA 3F4VA 5BRPA 3IAPA 3AISA 1TQWA 1CXEA 4KGJA 4AYSA 4AD5A 4QDMA 4MADA 4HZ6A 2EPKX 5CQ1A 1EOMA 2XHYA 1UASA 3WD1A 3ARXA 2WCAA 2DH2A 3ZSTA 1ECEA 5DF0A 3VIHA 3VKKA 1UG6A 5DT5A 2MANA 4D71A 3S5YA 5A2AA 1UR1A 4AISA 4TX8A 3PTQA 1RH9A 4DWSC 4C7DA 1GOIA 1EGZA 1CLXA 4Q7NA 3W27A 2Y5EA 1BPLB 4CVWA 2BHYA 1FP8A 4M1RA 4XB3A 1C7SA 4J3SA 1X6NA 2CHOA 3EBVA 3DDFA 1LWHA 2BVYA 1U2YA 3AQUA 1MQQA 2J78A 3CMJA 3H54A 3N18A 1E56A 3O9NA 4JHZA 2CBJA 1M04A 3LPPA 3ARRA 2YOCA 1BYCA 1CXIA 2EQDA 2W66A 1E4IA 3AMGA 3FNDA 2F7OA 1OT2A 3RM9A 4EAMA 4DUVA 1PX8A 3CC1A 3T2PA 4JZ5A 2HISA 3S6TA 3DX0A 4BCEA 4ZE5A 3IJ9A 2XFRA 3SUTA 1W3LA 1DHKA 2D20A 2ZWZA 4NX0A 3F5JA 2J74A 2X8RA 5E70A 1W3JA 2NSXA 1OSEA 4ZE4A 1ISYA 1E9TA 4X0VA 1ISWA 3RM4A 2XVGA 1OIFA 4GQRA 1UD3A 2UY4A 1PZ3A 2WKLA 4W93A 1O7DC 2FYVA 1GORA 5CPQA 3VMOA 4D1JA 4TTUA 3LPOA 3AHYA 1KBKA 1GW1A 2O92A 1B3ZA 5GNXA 3OLDA 4Z2JA 3SCOA 3CTTA 1JIBA 5IFTA 1NOFA 1FFRA 3AICA 2F18A 4MNMA 2O9TA 1R75A 4EANA 1US3A 1HNYA 1XD0A 4H2CA 3E1F1 3SEPA 3MMUA 3OLEA 5CLTA 1X1NA 1XH2A 1IZJA 2WZHA 3ZJKA 2VUYA 2VJXA 4CD6A 4W8LA 3EDKA 4QCFA 4L4PA 1MW3A 2ZIDA 1NWRA 3WD3A 1OGSA 5ABHA 1UA7A 4BZYA 3WNKA 1GUVA 3D51A 4D6GA 4HA3A 4PTMA 3WQ5A 4HOZA 4KGLA 2WHLA 1CGXA 1KXTA 3AIBA 5AC4A 4JKKA 3VO0A 1IZKA 2QPSA 1QNPA 1V3KA 2WYSA 5I77A 3WH8A 1XGZA 3TOPA 2NT1A 2CEQA 1MW0A 4TVCA 5D9PA 2GUYA 1LLOA 5BYWA 2WMGA 1B30A 5A95A 5E0CA 1R7OA 1K6AA 1R86A 1UUQA 2QPUA 1EOKA 3FAWA 4JIEA 3CBWA 1BGAA 1FOBA 2WMHA 4IUGA 2XPKA 4PMXA 1CXKA 4AXNA 4AW7A 1E6PA 3GNOA 1US2A 4OUEA 1HXJA 2FHFA 4DUXA 3CPUA 4UTFA 1U33A 2QMKA 3BLKA 3WBAA 4D1IA 4FNUA 4PUDA 4J28A 1ODZA 2XSBA 3MANA 1J0JA 2YL5A 1GOKA 4QLKA 1PZ2A 4GZIA 3QHMA 4M80A 1JNDA 3WD0A 3CHFA 1I1WA 3IAQA 4BQ3A 3WQVA 3MMDA 2FDMA 1E6NA 2EAEA 3QOMA 4PMQA 4S3KA 2GVYA 3BCFA 3KE0A 4GKLA 3GBDA 4H04A 4UQCA 2BHZA 1J12A 1SFSA 2V5DA 1EO5A 2OYLA 3SCUA 3THCA 2BY1A 4EKJA 1QNSA 8A3HA 1FA2A 1WPCA 1V6VA 3VD9A 3TA9A 1WZKA 5CPTA 1R33A 1EDTA 1C8QA 4JL1A 2WMIA 2BVDA 1TCMA 2BVTA 2ZUSA 5BXPA 5HXMA 4GZEA 5M3WA 3LRMA 2WHJA 1NM9A 3CMGA 4URIA 3UG3A 4FNRA 5A8QA 4CVUA 5CXPA 1H0GA 1UKOA 2FE0A 1KTCA 1KWGA 1XRVA 5KZ6A 3ZJ6A 1V0MA 1XSJA 1WKYA 4UQDA 3DX2A 2G8ZA 3U7BA 1HJUA 3TONA 2XIBA 3HJEA 3MO4A 1TFVA 3BLBA 4Z2GA 4L4OA 2FGLA 1JYWA 4Z2IA 1QW9A 1JDAA 1CECA 1HI7A 1MW1A 3VIOA 1WAWA 3GDBA 4E2OA 3TV8A 3S2CA 4Q22A 3WKZA 3NUKA 3PTMA 3MUZ1 2VL4A 3EJPA 3UR8A 4QP0A 4PUEA 1O6IA 1CIUA 4P8WA 1PPIA 4P7RA 5DT7A 2VOTA 1SZNA 4V2XA 1J0YA 1LL6A 1AQMA 4WIWA 2X09A 5JIWA 1BYDA 3UR7A 3WIJA 4FK9A 1V3IA 3WDQA 1AMYA 1PS3A 4J3TA 5BCAA 3VGEA 1DWFM 1BVNP 3WY3A 1R34A 3DX1A 3VIPA 3W81A 4J27A 1E6QM 2GDUA 6CGTA 3PZMA 2YLAA 2J8GA 3B9AA 2EJ1A 1VEPA 3H53A 3BSGA 4NRSA 3BAIA 1BG4A 4GIAA 3SUWA 3A5VA 2DDXA 1WCGA 4HU8A 3VNZA 5A8MA 3ZJ7A 1UWRA 3VM7A 2XYLA 3NIYA 1ITXA 1QI2A 2WW5A 1TA3A 3UERA 3G6MA 3WH9A 4HP5A 4D6HA 1OGBA 3EDEA 1ZBVA 4D6JA 5LA1A 1MXGA 4PMDA 3AIQA 5FD0A 2WAGA 4N0RA 3WF1A 2E8ZA 2WKGA 2XFYA 3AS3A 5A69A 1UKSA 1HKKA 1XD1A 4AZ5A 1O7AA 1UWQA 4AZ6A 1KQYA 1LF1A 1CGWA 2J7BA 4CD8A 1B3WA 3L2LA 1HVQA 2VCCA 2XM2A 3DYMA 3THDA 5EFFA 4QAWA 3EMZA 1PIFA 1HX0A 1MXDA 3FN9A 3GZAA 3ZSSA 3WUGA 4PCTA 2XM1A 2YFOA 5HPCA 1UD6A 3ARPA 3WUFA 5JIPA 1NOUA 2JFEX 3BUIA 1R85A 1TUXA 5CG0A 1JFHA 2ZUVA 3KLLA 4UCFA 3L4ZA 4DO6A 4W7VA 2WHMA 3GBEA 4W85A 4UOJA 2PWDA 1E5JA 1UWIA 1QHZA 1H1NA 2V5CA 5CSYA 3L4UA 2W62A 4K68A 5ABFB 4GO8A 1C8XA 5A6SA 2QV4A 1JAKA 1QWUA 1UKTA 1D2KA 3LRLA 1UA3A 1LL4A 4FNPA 1GJWA 1NWTA 3UG5A 2DH3A 1WDPA 2C7FA 2G41A 1CYGA 4DM2A 3VX1A 4ACZA 4ATWA 2VC9A 1DEDA 2J8FA 3O6AA 2BXZA 4M82A 5I23A 1LG1A 1E43A 1ITCA 1XH1A 3F5KA 3CZGA 5GNYA 1K9EA 1HJXA 3T09A 2V3FA 2WMKA 1W9DM 3WL1A 3CZ8A 3U5UA 1W1VA 1A47A 2ZUTA 2YBTA 3ARSA 1TMQA 1VFUA 2BHUA 1Q6DA 3VIFA 1KXQA 2CCRA 1GPFA 4JCLA 5JBDA 2DSZA 4LXFA 4KRTA 2J79A 1M01A 2E9LA 4P7QA 4W8AA 5A6KA 1H0IA 1YHTA 1XCWA 3D52A 4GZJA 3UETA 1IV8A 1GQLA 2GDVA 1W3KA 2EO7A 2E40A 1K9FA 2CBIA 5D9OA 4CCCA 3LPFA 4WSKA 1BAGA 2WZIA 3AMCA 3PZQA 1OIMA 2F7PA 1GQKA 1LQ0A 5AY7A 1BTCA 4DO4A 4W8BA 4JKMA 3OLGA 3G6LA 2YA0A 2PB1A 5E6ZA 3LRKA 3GM8A 3SIMA 4MB4A 3SUVA 4AMWA 3VOCA 2PC8A 3VTRA 3GXIA 4ACZB 3D4ZA 2GK1A 1GVYA 3H55A 1PBGA 3MSGA 4KWUA 5FL1A 1QNRA 5A2CA 1Q6GA 1UR8A 1GOMA 3W38A 3U5YA 2O9PA 1MFVA 2J7CA 3A47A 1KR1A 5A6AA 1FH8A 3WD2A 2F8QA 4W5ZA 1IT0A 3J7HA 1KQZA 3ZJ8A 4U2YA 2W67A 2Y24A 3CZLA 4C7GA 3DX4A 4MTVA 1HKJA 5BWFA 1MWOA 4AIOA 2IGTA 2A3BA 4X0NA 1D7FA 5D4YA 3IANA 3AMKA 1EQPA 5HNNA 3GYCA 3K1DA 2D0FA 7TAAA 3U57A 2GJPA 2BNJA 3PHAA 1EXPA 2OSYA 1CGTA 1HJWA 4UFHA 2CXGA 4UFKA 1V0NA 4ML4A 1CEOA 2YL9A 3BUBA 3OIHA 5BROA 3AMDA 4Y7EA 5IFPA 3N15A 2YA1A 4OIFA 1WZLA 3PZGA 4NXKA 2J77A 1C93A 1QI3A 2J62A 3RMEA 1C3FA 1Z32X 2J47A 1KFWA 3VVGA 3CZNA 3EMCA 1ZJAA 1AVAA 3VGGA 4AZCB 4UFJA 4AZGA 5A8NA 1M53A 2YJQA 1RPKA 1SYTA 2YIHA 1UR9A 5A6LA 3AZRA 3SCVA 4P7OA 2D1ZA 4D6IA 3RCNA 1HJSA 1PEZA 4V28A 3MI6A 5EB8A 1CXLA 3MSDA 3D3AA 3W25A 1HP5A 1PSPA 3ZT5A 1NWSA 1WDQA 1NARA 2F2HA 3VUPA 3A4AA 2VURA 4MNKA 2PF0A 4QFUA 2UY2A 1CXHA 1C90A 2XGBA 2WSKA 1OM0A 4YPJA 3DHPA 4DO5A 1TG7A 4LGXA 1U30A 3CUFA 2CYGA 1TZ7A 2O9OA 1B3XA 2GJRA 1GOQA 1OWQA 1UQZA 3NCOA 1KGXA 1E0VA 2XWDA 2IXVA 3ARUA 3WMBA 3RJYA 1FH7A 1CTNA 1MYRA 3CUGA 5C70A 1GCYA 1XC6A 3AXXA 3PZ9A 2QMJA 3WNOA 4ZEPA 3ZO9A 3AIEA 3AZSA 3BXWA 1WP6A 1MW2A 2OYMA 3WEMA 2JALA 2W91A 1BFNA 3FAXA 3ZOAA 3L4YA 1GONA 1TQUA 3GXPA 1E70M 2WWCA 5HBFA 1HXKA 1JDCA 4AMXA 3L2MA 1VFFA 3A21A 4F9DA 2WVSA 4A3YA 1J0KA 5AYIA 2ZXQA 3KWXA 3WNNA 1E6XM 1VRXA 1UD4A 3WQ8A 3K46A 4CKQA 3RJXA 4MB1A 3ARQA 1VIWA 1XYFA 3W4RA 2A3AA 5CSUA 4KH2A 2FHBA 1C8YA 4M8UA 2UY5A 2DT0A 4F9JA 2A3HA 3SUUA 1JZ3A 1I1XA 1B2YA 4WF7A 3BMVA 3W37A 1M7XA 3ZR5A 5GQBA 4D6DA 3K8KA 6TAAA 2VNCA 3TP4A 1G5AA 4GI6A 4WKFA 3EYPA 2J7GA 2G4FA 1HF6A 3FHQA 3VIGA 1PCPA 3TTSA 1E1FA 2F7QA 3KL3A 4MNLA 1V3JA 4E8DA 3AYRA 3BVWA 1W3HA 3AFBA 4OJYA 2PBGA 1JFXA 1CWYA 1JYXA 2ZXBA 3ALGA 3VDBA 3BVUA 3W26A 3K4AA 4FLOA 1HP4A 1H2JA 2XVNA 4UFLA 2VMFA 2QLYA 2VZTA 1B1YA 3CUIA 3VINA 3N12A 1QWNA 2OWCA 2D23A 2J7DA 3WD4A 4XV0A 2J7FA 2W92A 1VBUA 2XTKA 4UZUA 1UQYA 1HL9A 4MNJA 3PZOA 3HG5A 5A8PA 2CETA 1FH9A 3AXHA 4KRUA 1GHRA 2OW6A 2DT2A 1JDDA 4CD7A 3SCPA 3A23A 1H3GA 3B9DA 1V3HA 3WF0A 3WL0A 4JFTA 4TVDA 1LL7A 2CIPA 2E3ZA 2ZX5A 1GVIA 1G9HA 1J01A 3BVXA 3WNMA 2ZX9A 2BY2A 2E4TA 1KTBA 3NSXA 2WC7A 3BAKA 3A6OA 2XSAA 1B0IA 2Y8KA 3OGVA 4AC1X 4H7VA 4ZENA 1UD5A 3I3EA 3W24A 3WEZA 2WCGA 3BUPA 1GQJA 3AHZA 4IPLA 1JZ4A 3M6DA 8CGTA 2BS9A 3WH5A 5GPRA 1JZ7A 3MU7A 5D9MA 1UR4A 1KGWA 5ECUA 2PSPA 1H4PA 4HOWA 3QHNA 2YDRA 4DWSA 4J3VA 3M07A 5I0DA 2GFTA 1V08A 2CESA 2A3CA 2WSPA 3BAYA 4ACYA 5FL0A 1JF6A 3M7SA 3L4WA 1DWAM 1OB0A 4R5EA 4GO9A 4RE4A 3WDPP 5FKYA 4NXSA 1VAHA 1HWWA 3VIIA 4M24A 1VFMA 2WXDM 3T08A 2W5FA 4UQAA 4Z2KA 2BXYA 2FH8A 4CU7A 2C8NA 1CBGA 3NDYA 4J3UA 5CJ5A 4BQ5A 3BGAA 4MJ2A 2RGLA 4M29A 4QLLA 1BF2A 2EPMX 2WMIB 3CO4A 3AHTA 3EDJA 1VF8A 4AZBA 2OWXA 4WK9A 5EMYA 2BV9A 3UESA 2YFNA 2WVVA 3CHCA 3VGBA 2VO5A 2DQXA 4TOQA 5BXSA 3T0BA 4CU8A 2PI6A 1V0KA 3CHDA 1E6ZA 2VRJA 3ZM8A 1PAMA 2VVSA 3T0AA 3OB8A 4F8XA 3N13A 1H41A 3OG2A 3ZQ9A 3QOKA 2EACA 1QBBA 2VZSA 4DWSB 2XGIA 1T0OA 9CGTA 4D72A 2G3NA 3K8LA 1V6YA 4CU6A 4E8CA 2QHAA 2J4GA 3AZTA 1W9VA 2F1BA 4WSJA 1V6WA 4MAVA 1SMDA 3WN6A 4YHEA 1DWGM 4E4PA 1W9BM 1G01A 2V3DA 3D4YA 4M56A 4FLQA 3PZNA 3ZMRA 4CUCA 3VD4A 3AIUA 5HDRA 3WDRA 2V3EA 5IHRA 4NRRA 4FLSA 3HG4A 1L0PA 2PWHA 2D3NA 3ARTA 1NOWA 1LG2A 2JIWA 4AD2A 2ZXAA 5BXTA 2WMJA 3KL5A 2WVVB 1OT1A 1Q6EA 2DPEA 2V38A 3MUY1 3SCTA 1ZB5A 3DC0A 4QLJA 1V3LA 2OSXA 2D24A 2WCSA 3I3BA 1J0HA 1JGIA 2AAAA 5A3HA 1ZU8A 5EFDA 4GINA 2WVUA 3GNRA 1CNVA 4HPGA 3BC9A 3KL0A 1GQIA 2GJXA 4PRWA 1BGGA 4PMOA 5A6BA 2V3GA 1HJQA 3WNPA 4MPKA 4AEFA 5D9NA 4NZJA 3A4WA 1FP9A 2XVLA 4B3LA 2XVKA 3BAXA 5E1QA 4PMNA 1MVYA 1E1EA 1PX3A 1UR2A 2WVTA 4CCEA 3W6MA 2E9MA 4CCDA 1AQ0A 1JF5A 4U2ZA 3LXCA 2WK2A 1TA3B 4TUFA 1QPKA 4B3KA 3EDDA 1B90A 1V6XA 2VCBA 3HZ3A 7A3HA 1KB3A 3I3DA 4HTYA 2CBVA 4AIEA 5E09A 3CZJA 3RDKA 3K4DA 5I6SA 4LPCA 1ISZA 4WKHA 3N17A 1V3MA 1WB0A 1RP9A 1QNQA 3GXNA 3LMYA 3WH7A 1EIBA 1Q6FA 3IJ8A 3ZIZA 3RPMA 4OZOA 2JEPA 1H11A 3AIRA 3VM5A 1FFQA 2DSKA 3T2OA 3WY2A 5M17A 4YHGA 1KCKA 1UH3A 1E4MM 3N1AA 1VJSA 2X2JA 3WDJA 3ARZA 2W4XA 4P7LA 4W89A 3RIKA 3WQ6A 3W28A 3BCDA 4NI3A 3VSUA 1CGUA 3PZIA 2VZOA 2PWGA 4FNSA 2EBNA 2AOSA 2GJXB 4U3AA 1F4HA 2Y4SA 3AJ7A 4B16A 1RD6A 4HU0A 2YL8A 2X05A 3GH5A 1KWKA 4J7RA 3M46A 2ZXDA 2VZVA 1W2VA 5A94A 3WY1A 4DM1A 3NJ3A 3WH6A 3WF3A 3SCQA 3RO8A 2CHNA 3F5LA 2XN0A 1S46A 1B9ZA 1ZBCA 5AC5A 3VPLA 1W9UA 3AIVA 3RM8A 4H8HA 1XV8A 2OLHA 3IK2A 1KXVA 1NQ6A 3AYSA 2A3EA 3VMPA 2EABA 3CH9A 5JBEA 1H49A 4TXEA 2BY0A 1H09A 4PTXA 1VENA 1R87A 1XYZA 2CITA 1TQVA 4W7UA 1WZMA 2D2OA 3RILA 3SCSA 3SURA 3TTQA 1LJYA 5I24A 1KCLA 2D0HA 3OZOA 1KR0A 1YQ2A 1UYQA 2DIJA 3T2QA 2IXUA 4ZXOA 5LYRA 2WNWA 4BF7A 3UG4A 3NSMA 1WZAA 1L8NA 3EJSA 4S3JA 3LXBA 1BSIA 1BQCA 2X2HA 2Z1SA 4GXPA 1PS2A 5D8WA 2XVPA 1V0LA 1JZ2A 3O2LA 1DTUA 2BY3A 3GNPA 4OBRA 1PIGA 4UNIA 3AROA 4N42A 1TR1A 4RE3A 1V03A 4PMUA 1RP8A 1G0CA 4GPNA 2WC3A 1QW8A 1QI4A 4P7NA 3A22A 4JFWA 1ISVA 1PJ9A 3BSHA 1EHNA 4PMZA 4UQBA 5FCZA 1BG9A 2VR5A 1BVZA 2DT3A 1EHAA 4OOZA 2ZICA 1WDSA 1JG9A 2EXOA 1JI2A 2GK1B 3FXYA 4AMCA 3ALFA 4FF5A 3QR3A 3MV01 2ESCA 3L4VA 1JL8A 3W6LA 3N9KA 2YDSA 1J0ZA 4A4AA 3HG2A 2ZWYA 4LX4A 1J0IA 2B31A 1E3XA 2CBUA 2VX7A 1JAEA 3SCNA 1E3ZA 4J3WA 1E5NA 1MQRA 1GJUA 1QI5A 3WEOA 2RGMA 2F7RA 1CLVA 4W87A 1ISXA 2X0HA 4HA4A 4FMVA 3MUAA 4IISA 3ZT7A 3OA5A 2WMFA 2JIEA 3W82A 4AD4A 1ZL1A 5JUVA 2OW7A 2XWEA 3BAJA 3UEQA 1P6WA 2E8YA 1UOKA 3B8SA 4Z2HA 3POHA 2YL6A 2IUZA 4J3XA 4F66A 1W1PA 1PX4A 3N11A 2JF6A 2YA2A 2Q8XA 3OGSA 1OCQA 5TD4A 2JEQA 4NSBA 1GNXA 3DX3A 1CPUA 1ODUA 2ZUNA 3S5ZA 4CD5A 2WLZA 4HPHA 4B9YA 1UHVA 3GXFA 4HZ8A 5DEZA 5EBAA 2GSJA 1X6LA 5M03A 1CGYA 1AQHA 5I78A 3KLKA 2EADA 1ZBKA 2UWFA 4YN5A 5M5DA 4D6EA 1WO2A 5A8OA 4BQ4A 2YBUA 4JFSA 4PYSA 3U7VA 4HA1A 4IM4A 2XN2A 4JFUA 3WNLA 2VQUA 2VZUA 4H41A 4UOZA 3LPGA 2X2IA 1W2PA 2DT1A 4U5IA 4OBSA 5E0FA 4TVUA 4PTWA 5C8BB 3K8MA 4PN2A 4LYQA 1HN1A 4LYRA 3CZKA 1W9XA 1WE5A 2EPNA 2F1AA 3AMLA 3GXMA 3MUIA 1EQCA 1CENA 1QHOA 2ZX7A 3ARVA 2AMGA 1E40A 4NZFA 1E6RA 2F61A 2VX6A 4UFMA 2WPGA 1B31A 1FHLA 1G94A 2OWWA 4PMRA 2PBOA 2JF7A 3HU7A 4W5UA 2CKRA 1V6UA 4AYGA 3NYDA 3EJUA 4W7WA 1KGUA 3FY1A 3NDZA 2DEPA 4ZXLA 1TVPA 3DYPA 4RL3A 1C92A 2ZX8A 1B3YA 2VR4A 2YLLA 2EPOA 1ZJBA 1QI0A 1XH0A 1E73M 3APGA 3CGTA 1R7AA 4P8UA 3II1A 1LWJA 1V02A 2WBKA 4JL2A 3A3HA 3HN3A 3DHUA 4NZCA 1VJZA 4PMVA 2D22A 2G3IA 2DGAA 1J18A 3QGVA 1BYAA 4Z2LA 1E15A 6A3HA 1J11A 3CHEA 3CUHA 1E55A 3WDIA 4NF7A 4MB5A 1UD8A 3VDHA 3WENA 4CGTA 3WMSA 2WBGA 4H8UA 4TX6A 2D73A 4X9YA 1GOOA 3W29A 4BA0A 2D3LA 3VIMA 2ZUWA 3VILA 1E0XA 2W63A 3EJTA 4PEEA 1UKQA 1JD9A 3IJ7A 1NH6A 1XSIA 4UQEA 3NSNA 4M81A 1DWIM 4MB3A 4MAZA 2VTFA 2XIIA 3N04A 5FIPA 3VSTA 3KEHA 1QX1A 1D3CA 1OINA 4DUWA 2VX4A 5A1AA 1UWTA 3A24A 2VCAA 4OGZA 1JYVA 2J75A 4UR9A 4MDOA 1UWSA 1WDRA 1BLIA 4ATLA 4BQ2A 2OSWA 3VU2A 3WMCA 4AD1A 4PBGA 3WY4A 2G3JA 4JFVA 1H5VA 5KEZA 2JE8A 5C71A 1G1YA 2WANA 1K9TA 1FHDA 2DSUA 1CGVA 2G3MA 4P8VA 4UZSA 4JAWA 3MMWA
chains in the Genus database with same CATH superfamily
1HTYA 3EOSA 4O00A 3BVNA 4H6KA 1XGDA 3F83A 1FNFA 2Z26A 2Z7KA 3N14A 3MV11 5DCCA 5GS2H 2V67A 1GYWA 3DA0A 5IHSA 2ITDA 2ALWA 1GYUA 4OJFH 1Y5XA 4M7ZC 2Q1EA 1YQVL 4EZKA 5AC8A 1IHIA 2QHRH 4C4KT 2VWTA 5D7JD 8XIAA 3D85B 4V27A 3S35X 5IBLD 4YDJB 1R3KA 4RCXA 2WC4A 1F18A 2YN5A 1EX1A 3CYJA 2IG2L 2JMRA 2PR4H 12E8L 4GBXB 2R1YA 4U1KA 5C9WA 1OX5A 5A8GA 3B7TA 5I1KH 5IT2L 5GHWL 2GUOB 3MRHA 3VXPB 3GDRA 1LEGA 1FWWA 1X7IA 4QXTA 1EXBA 4RCAA 2WBJC 4LHQB 3CLWA 3C56A 4I18A 2C26A 3HR5A 4K7FB 3ZN6A 1XIWC 1V7YA 2V5BA 3SCRA 1UM5H 5TDPB 1QNOA 1AUSL 3QYSA 4KBPA 3IGAA 4JY9A 2NXZC 1FCQA 1FCVA 1SR0A 5BRZE 2CKBL 1R3QA 3U82B 4LIQH 1M03A 2VT0A 4G56A 4OCWL 4AZHA 1JWUA 1FI8C 4PJ5B 4GIRA 3DPBA 1KTRL 1XRSA 4ONVA 4BS0A 1TJRA 1RQ5A 1NIBA 1RLCL 4XNAA 3AI0A 4QRRE 3D50A 4NN6B 1H3WM 3LOWA 2KZKA 5F7EL 5H8PA 5KN5B 4NU7A 3TSMA 1NCOA 2Q5BA 1RV8A 2PCYA 3D1MC 4R0LB 4UNUA 3NJIA 1GTNA 3ZDXB 4I0PD 3TTYA 4HS6B 3OXRB 2SEBA 4R7DA 1F6PA 1B3VA 5JIHA 1V7NH 3O07A 3GE7A 3EH1A 1QUNB 5T1JA 4XZBA 1N59B 1LP9B 5LBSA 4RWHA 5CJ8A 1FN4B 3TA6A 1N8ZA 2E74C 3WMQA 3W53A 1DBAL 5DHMC 3MUGB 1HIMH 3SKOB 1NGXA 3VCCA 2GTWB 4U05A 4UV7L 1Q13A 1EJVC 4KTGA 5J3HC 2X0YA 2FT7A 4WCJA 5B22A 4P8XA 3MGOB 3ES6A 1IBDA 3R8QA 4PB0H 1K3ZA 1JZEA 2YPVH 3I2CH 2DUXA 4FKHA 5IV2B 3QNYA 4KKLD 4KI1A 4OZGA 5JXAL 3CAKA 1SOKA 2I16A 4RMRA 1FIGL 3WS6A 4XD6A 3XISA 1TIWA 1W80A 3LCWA 2YW3A 3EEZA 3SYOA 3SUSA 3LN4A 2C6QA 3VH8G 2PP8A 1NIEA 3C6CA 2CGRH 1DQQA 4P23A 1D2PA 1G84A 3W7PA 4FXTA 1HEJC 4MADA 3JYCA 1A2YA 2P8CA 2QPDB 1OGAB 1T6BX 3LNGA 4FG4A 3TBWB 4MWFA 3TU6A 5F3HA 5HD8D 4KKAD 4N9GB 2FMOA 1FAKT 2XV6B 4Q7NA 4IH3A 5GS1B 3U2IA 4CVWA 1AGCA 4XB3A 4PJ7A 1KZYA 3GI9H 2BFVL 4C6KA 4M02A 5ACMA 1M4KA 2P9RA 5DHVA 4MMXB 3W7OA 1I1AC 1J8VA 4V1DB 3PV6B 3SN0A 1BYCA 4NUJB 2QJJA 3AMGA 3KPQB 1OAJA 4EAMA 1TIUA 1IFGA 1IFRA 3FCTB 4X7CC 4JYFA 3U6WA 1NLBH 2D20A 1O0VA 2ZWZA 2REQB 2DDQL 4NZ5A 4Q2ZA 2Q8BH 4HWNA 1S5TA 1RZIB 2V17L 4GUPB 1IVLA 1ZRUA 2OTWA 5EC2A 4BF5A 3WLMA 2XTSA 1AZUA 4ADIA 2Z34A 4U6XA 3S9ZA 2P5PA 4PLKC 3L3GA 2MCPL 1R75A 4XNZC 1O9ZA 4D7PA 1AGEB 5EWIH 2P3YA 4JNMA 4YTRA 1UOVA 1XH2A 1FGNH 1NBVL 3GIZH 5GZNA 2YEVB 3CDFA 5IB5A 4F3HA 1QCWA 1OGSA 4MAYA 1GUVA 2NNXA 4GAGH 4O16A 3HPFA 1SN0A 4ZOAA 1ASQA 4NNYA 3EXTA 2LU3A 5LBSL 3TN0B 5I77A 1LJMA 3L95A 1X5XA 3HGSA 1FFOB 2NNRA 2M83A 3CBWA 1T4WA 5AVZB 1QTSA 3O6KH 2UXGA 1CXKA 3FZUD 3B3IA 4LCSA 1P9MC 3SDDD 2OQYA 4ABUA 4NCC1 3OJDB 3B97A 3BLKA 3VJ6A 1FPTL 4NZ1A 1I8LC 1CZ8H 4I7VA 1QLEH 4U7MA 1J0JA 1DQTA 1DO6A 3BICA 4RPPA 2W27A 1YDNA 1DLFL 3KRSA 3Q43A 4KUCD 3WD0A 5B38G 3OMAB 2PP9A 3QZMA 2VLJA 3A5FA 3F7VA 1U8HB 1I4FA 1QFPA 4UQCA 3WMPA 1AXTL 5HDBB 3OF6A 5AG8A 3H2AA 4PRDA 2ZSVB 1FVEB 1XINA 3VD9A 2BJMH 5CJOL 4BE5A 1WRFA 1I8IB 4KK9D 1FG2B 3RQ3A 1TB3A 1ND0B 4RZ6A 1IXQA 4PUKA 2QV2A 4CSSA 4Y9PA 2JI3A 4IRSB 4M9OA 1LO4H 2R91A 5H37A 4CVUA 3ZHNA 4BFGA 3FCBA 2R23B 5A7EA 5HVWA 3QV6A 2A6DB 1PVHA 4KUZL 3WE6A 3QYCA 3I6KA 4LK4A 3MN8A 4JK0D 3KWSA 4GXVL 1MSPA 5EOCH 2QIIA 3P3UA 4RX4D 1KMGA 4LSSH 3CVIL 2ZWKA 2PXYB 4QP0A 3APCA 2FJSA 1N7ML 3O1NA 1XWYA 4TVPL 4H9TA 2V9DA 3S98A 5E2UH 4YLCA 4HIBA 4LF3A 5A16B 5J56B 4E5XG 2XTLA 5IHUH 3RDJA 4JFZH 3UA4A 3OB0K 4ML9A 3EFOB 3E9UA 1J8RA 2EJ1A 4PJHE 2R4RH 1L9RA 2K6WA 3STLB 5AYUH 5BMFL 3MRPB 4KRPD 2ETWA 4BY3A 2NQCA 1OGBA 5ENLA 4XNUL 3RVXD 5C3IA 1XIDA 2CDEB 3KJ6L 2GI0A 3EO9H 4X7FC 5G2HA 2ZDSA 2XFYA 2GCYB 3GHUA 3ICJA 1T5XA 3SJVA 5IVZB 5LG1A 4O1DA 3CB3A 1TTJA 4J3OH 4NHUB 4QYOB 4TF4A 3QDGA 1DZBA 3NZRA 4PJ7E 3MLPA 4QHNB 1E9PB 2XBZA 2A4CA 2Y8UA 1AZZC 2YPLD 4UCFA 5F70A 4HD9A 3FFCA 1WD9A 2V9QA 4AGQA 3P73A 4NKOA 1VYRA 3D0LA 2X89A 4WJ5A 3FOMB 1R24A 3UJEA 1LD9B 2BXZA 4IGBC 5D71L 2FSEB 1XH1A 4HH9A 4BJLA 3IS1X 1PYWB 3TYGL 3C5ZA 4TVPE 2DZSA 3ARSA 5DYOB 5BZDA 1Q6DA 1OCOB 1A4AA 4PHZA 5IQ7L 4JO4L 3KDOA 1QP1A 2ZRWA 4J23A 1ZJHA 4P7QA 4IHBA 1FC1A 4KF1A 4NUMA 3KWWA 4TTDC 3C2RA 1ZDQA 2CBIA 3W56A 5EEWA 3QJSB 1OIMA 1GQKA 1LQ0A 4F33A 2AQ3A 2PPEA 1TG8A 4AUYA 3T0ED 3MLRH 2WP3T 1X97A 3T42A 4BK5C 4TUKL 1A4CA 3GPEA 2QULA 1HEHC 3ZDZE 4K36A 5FS5A 3W1PA 1I2OA 4M3HA 1Z5LA 4BFJA 2R1LA 4C7GA 2P5WE 3KYKH 2ACRA 5DT1L 1FFTB 3QGAC 3K1GA 3ITVA 4ZTPL 1Y5VA 2GJPA 4S0TD 1NKRA 3MX0B 5D2LE 1GZQB 3I7QA 4Y1AB 4FIQA 4OIFA 1KF9B 3B2DC 3VI3E 1XLMA 4WEVX 3GNNA 1XLEA 3WAJA 5CZJA 3RLGA 5A8NA 1WSST 1MCPH 5HAOA 5DHYA 1VCBC 4AXWB 4QJ5B 2HVBA 1XBYA 2WBJA 5FO7B 3IJ6A 1LO2L 5EB8A 3GSNB 4OHQA 4W9HC 2BRRL 4LWWA 3WYZA 1XIWA 3VFPB 1MFBH 4BZ2L 4CJ0A 5CSBA 2XGBA 4ABVA 4IRZA 5T1DL 4ODUB 3LQLA 3KBJA 1MQ8A 1RMFL 4TQTA 1TZ7A 4KKQA 4LSRL 2GJRA 3NCOA 2RAGA 2W80C 1E0VA 3MYJB 5D96C 4M7LT 3EFDH 4GYBA 1KYAA 3PWNB 1RZ7L 4PFHA 1MYRA 1GCYA 3W9DB 1XC6A 4U6YB 4TULH 1JRHL 2VERN 1MI5D 4ZOCA 3T55A 2RJHA 5EGRA 1DXEA 1EX5A 1ZT4A 2F2KA 2ADYA 4F24A 1YDYA 3D3FA 1ZFJA 1CE6B 1Q6OA 3P6LA 4BUGA 4MS8D 3GSNH 4MB1A 1XBRA 4G9FA 3W4RA 4S1FA 2YUZA 3S4SA 3PPEA 3FB7A 2BSDA 4YR6B 1QLRA 4I3RH 1DE6A 5I6MA 1UWFA 4Y8AA 1FKXA 3UYCA 4Z1BA 1S7UB 4DKAA 3WNIA 1UM4L 2QR0A 3CSFA 4I0KA 4MKSA 3MO1A 4Z7WE 2PMZA 4WUUB 1CGSH 3W1AA 4CMMB 3G1YA 1JFXA 4XVTL 4FLOA 2WLNA 3TSBA 5FUZH 4JFEB 2CO3A 1MQKH 4FKEA 4KI5F 5DEFA 1E9YB 4QAMB 3R0DA 2EDDA 2VYOA 3TK7A 1TPH1 3SDAC 3P77B 3QDJA 1G4SA 4AIXA 2H3XC 4MHHG 2BOLA 5D4IA 1H3GA 1G7IA 2CIPA 4A8IA 3SY6A 4EO5A 4GNVA 2C1GA 1SJEB 1KTBA 4JRXD 2C18A 3BAKA 1TZIA 2WXIA 1FNSL 1IWAA 2CO7A 1INEH 2MCAA 3CFBA 2R94A 4UINH 3KOFA 5EFIA 3M0ZA 5I73B 3O11B 4KO7A 1BKSA 5I19H 4QTGA 1ZGDA 1DVSA 3ZYIA 4YL2A 1JPTH 1VD6A 5IW6B 4HOWA 3M0VA 3F6LA 4AEHL 4GO6B 1E4WL 1CD1B 5DXYA 4WWKC 4I85A 4ACYA 2X7LA 1Z66A 1DWAM 1OB0A 5IFJA 4GO9A 4J35A 1D7DA 1IBHA 4U1IA 2P45B 4K07A 1QOPA 1I1AA 3MV9E 1WDWA 2Y88A 4IRZL 2OXNA 2RGLA 1Q9OB 1ZNNA 4F37F 2HH0L 3A6CH 1KM2A 4OM1H 1P6FA 2WLKA 3QEUA 4OGXH 1RLWA 4LBEB 3BGMB 3QOKA 4W6YB 4G1MB 1M68A 1T0OA 4C6DA 3B9VA 3H4WA 3ZZSA 5BOZG 3M0IA 4KO5A 3IYLW 2ISVA 1A7PH 3UPRA 2K4WA 2RBLA 1A1OB 2LT9A 2V82A 1N8OE 3PZNA 3GTFA 3BOXA 3KHJA 1ONRA 4FLSA 5GJNA 1YNLH 2D3NA 4JS3A 2JIWA 2I56A 4KFPA 3OQ8A 5DR5H 4GPVA 1M05B 5BZWB 3VYOA 2EUZA 4AVFA 3OTTA 1E1CB 3WUWG 3B0XA 4LGPB 2ARJB 1X7SA 3AY2A 1GPOL 3I3BA 4ESKA 5FEZA 4I3SH 3MRFA 2GJXA 3JR2A 3W7DA 5G4NA 3A4WA 1NCBH 2XVLA 3P30H 2GUBA 1HSBB 4PULA 5I74B 4NZDA 1SUHA 1KN4H 5AHFA 1P9MA 4TUFA 2ZQ0A 4LLWB 2X4PA 4HTYA 4LAUA 2C0AA 4AYFB 1I8LA 3GRBA 4NQSB 2Z8VC 4PWKA 3V5DB 3TW7A 2XG5A 2TPSA 2B1HL 3GZKA 3V0DA 1UH3A 1VJSA 3RIKA 3W28A 4JN1L 3SKMB 3O6FB 4JPKL 2OL3B 3UTPE 1SVZA 1IGCL 4K9EL 1JJKA 2A2IA 5CILH 2A6IB 3SPVB 2BSRB 2CIIB 3SY8A 1QFEA 1ZSXA 4DERA 4FX5A 4LLYA 3H2OA 3WY1A 3E0FA 3GFYA 3LD8C 1AL7A 3F5LA 1PDKB 1PEWA 1OOAA 5CHNA 3VMPA 5FYJL 2ROYA 4O10A 1EFZA 3BXNB 1R87A 1JXFA 4FA3A 3B2VH 1G7LB 2V0AA 4NZRH 1LJYA 1WISA 5IG7B 3CVBA 2CUAA 3VXSA 3IMSA 3S5LB 2IBBA 1WZAA 1BQCA 3HE6C 2PPGA 3LLDA 1PS2A 4H1LA 2FJFA 4BFAA 2YXFA 3U9PL 1AKPA 1JCJA 2BY3A 5LN8A 4N4QA 2J56A 1TTBA 4Y9GA 3CQQA 1XGEA 1K4HA 2OKOA 5AAPA 3RBGA 3UJIH 4OOZA 1JG9A 2P88A 5D1ZD 5DK0B 4PJIF 2EILB 1IWPA 2XTJD 4DP8X 3GBNL 7PAZA 4RGOH 1LO3H 3GDCA 1P84K 3AWGA 4QS5A 2NYYD 1ZIBA 1GJUA 5I07A 1YLBB 4C56B 1TJ2A 2W1NA 2ZOLB 4W87A 4F92B 3GMNA 2IMNA 3HC2A 1HKWA 4IMCA 2OX5A 3BAJA 1UOKA 3GG1A 3L65A 3ROOB 3R0MA 1S8DB 4TO8A 4YBLC 1FWEC 4KXDA 4XN1A 5KVDL 3S3PA 2ZJSH 3CS2A 3TQPA 3PWPB 5FYJE 3SBFA 2WLHA 2EADA 3SO5A 4W81A 5JPMB 2ATPB 4FYRA 4UOW0 1HS6A 4JFSA 5EEZA 5HHVH 1F3JB 1G6CA 5G55A 3PL6B 3WLLA 3W75A 4PTWA 2WZ6A 3VXTB 4PN2A 2FB4L 3WFEL 3UR2A 4G8AC 1ZLWH 1B4RA 5I17A 3GHBH 4JYDA 2DZBA 5LKYA 3UFIA 4IGBA 1B9KA 4UTUA 3EJUA 4AI7A 4UIMB 3RO6A 1QSZA 3MMTA 2VR6A 1T89C 3MAWA 4NC1E 4F40A 1SYVB 3S35L 4L4MA 3BP7A 4MXVF 5IWLC 5ESAB 1KTNA 5BS0D 3LKNB 3JRKA 3II1A 1LWJA 3A3HA 1RXOB 3C87A 4A1RA 3OKYA 3TNNA 1DBTA 3LQGA 1W6WA 3GAYA 3WIIL 2XSXA 3QFJD 1RK1B 4IGMA 2HKAA 2B2XL 2DBLH 1GOOA 4YXGA 5JHDB 1H7WA 5BO1H 4BA0A 4BK5A 3VIMA 1KLZA 5KVDE 4XWOD 4R7OA 4ZAKD 4MAZA 4JY4B 3L21A 1W0VB 4Y5YB 3K2GA 3KUMA 2G2RA 1UWSA 2OSWA 4PS4L 1Z42A 5T8GA 3DU0A 3BW4A 3MJ8B 4IIDA 4GIPD 4P8VA 1ILUA 1R3RA 4NIYE 1REQB 3GLEA 3P62A 4D2NA 2N7BA 1LEIA 5EZOL 1WCBA 1CFMA 2DW7A 1P5VB 1GGCL 4DWSD 5BRQA 4YVXA 2J1XA 2YDQA 2WLIB 4XZWA 4RNFA 4AVOA 1FO0B 1A7QH 5BWAA 4O0QA 1MI3A 2XSKA 1W91A 4MA1B 4HOXA 4JTTA 1EDGA 1X9QA 1ML1A 4NO0A 3K4ZA 4CNIA 3VTAA 4IG2B 3GQYA 3VGHA 3CH0A 2VUKA 1N9PA 3FW6A 4M00A 1XM3A 2Y63A 2ZAIA 1XSKA 4PCSA 3GGWB 3IVTA 5EA9A 7REQB 3REQB 3WSUA 3ARYA 4RZBA 2VXSH 5DJ6A 3DJZA 2EPLX 1IGMH 5ADPH 1P1VA 4I8DA 1NGYA 4CKVX 1NFGA 4ZO9A 4JKPL 3BEVB 4DZBB 2J43A 1JV5A 3WD5H 1LE5A 3LCXA 1MCOH 2Y25A 2RHEA 2F5AL 1FO0H 3VAEA 3CSGA 5EY5A 2JNZA 3IDYC 2NQ3A 3RFRA 4UBPC 5KJ7E 1A5FH 1HOEA 3NL3A 2VLRD 2X4NB 1VP5A 4IBSA 5H2BB 5L6YH 4FULA 4OZGF 1EZSA 4UFIA 4MA7L 2YCEA 3ABMB 4TYUA 4NY2A 1DVTA 4OZIA 3TXZA 3TN5A 3B03A 4B2DD 3FMGL 1ZS8A 1G6VK 3Q05A 2FVMA 5E8DH 2YK1L 2KS0A 1W32A 4L1SA 5DRZA 2J25A 3VIJA 5HHOA 3S3DB 1FORH 4YHLH 2XVBA 2V7NA 3EAUA 1QSFD 2MMXA 4TQHA 4FXFA 3SDAA 3REVA 1PFOA 4WWPA 2FHCA 5MERB 1QBLL 3WF2A 1TU2A 4RZ5A 5C0CB 1K7FA 4N9OB 5B1JC 1ZRQA 4TV6A 4HGXA 1KEML 3MBWB 3FGCA 4FQIH 2FEJA 1ZBWA 1MLCB 1PO9A 5FV2A 2PCPA 2I85A 2UYLB 2K78A 5CC6A 1KN2H 2C0HA 1FY6A 4YHZH 3UJFA 1BIIA 2VVNA 5JBFA 5GISL 4GZ7A 4N25A 4G7QB 1TWDA 3PF3A 3I84A 3U25A 4WWKA 2EIZB 4HKZA 4P07A 2F9BT 3AXIA 4R3SA 2X6CA 1T21B 5C09A 3V4VH 2FK9A 1Q6LA 3C5SA 3E5BA 1WK0A 4BQCA 5I8OH 4J3OC 5D2TA 4X6EA 1L7TL 3U7YH 3EG9A 1SJDA 4HZ6A 3FONB 4HSOA 2E9JA 2PU1A 3W5MA 4OBTA 1V51A 4IT1A 5DCBA 1U91A 4C6CA 1F58H 3JYBA 3S5YA 5IMLB 4TNGA 4JZJC 4OF0A 1ONQB 4C7DA 4PRIA 2GT9A 3ABXA 3ABLB 1XPGA 3NCYP 1RH8A 1U2YA 5FO9A 1F6LL 5FOBB 1ZVSA 3CWOX 1LM8V 2C3GA 4UQ3A 4FQJL 1LZOA 1GY2A 3AM8A 2BINA 2A0LC 4S38A 4QNWA 2A7BA 1CW2A 2V2HA 1G67A 3RM9A 1F9CA 4AENA 5C54A 4BCEA 4RAUA 3G1AA 4P2QB 1O1HA 2OQJB 3F7YA 4H26B 2OMVB 3SD2A 2NX5B 5E70A 1W3JA 4L6DA 3B37A 4IEFA 5E4OA 1AC6A 3T6ZA 4TL5A 4TNVK 1K5NA 3NAAL 4D2JA 1PZ3A 3SZKC 2BHFA 3H2MA 5CFAA 1GW1A 5GNXA 1XG4A 2XQYA 1NOFA 5TQ2H 1KTKE 2NDFA 1QFHA 2AEQH 3W88A 3MMUA 5KSAD 1W3NA 3R1GL 3BSMA 4N86A 5D7IA 1XXDC 1H7NA 4P61A 3K2UH 4M6NL 3UAAA 3C75A 2YXVA 1MW0A 4JHWL 4XZHA 4JDZA 1XZ0A 4N0FA 1UQSB 2VUOA 1HKLH 1R7OA 5T3XL 1PKYA 4LY8A 3IDIA 2FJUB 3BD3A 3GNOA 5DS2A 5EU4A 3HC0B 1YYLH 2DEXX 2ADGA 2HFGH 5EU5B 1WBXA 4EXPX 1UM6H 3SAZA 2BS71 5JW3L 2OELA 3CUPA 3QHMA 4BSVB 3V6OE 3P0WA 3VFGL 3L5XL 1I1WA 3WQVA 3DX8A 2EAEA 1HSAB 1UBSA 4F1SA 3FKRA 3TVMB 1EO5A 3HE6A 4N2HA 3Q3GB 2OODA 4CQ9A 1NGWB 5L0QC 1WF5A 3MRKB 4ODWB 1E8YA 3CASA 1Z7AA 2ZONA 2BSSA 1H3PL 3JUYA 4W9IC 3W11D 5SV4A 2F7IA 2J44A 2VDQB 5DMIH 4BJHA 3Q5OA 5LDUA 2YGOA 1H0GA 1UKOA 2Q2EB 3A67L 5HJLA 3MQIA 3ZJ6A 2N4IA 2R0LH 3SKJH 5GIRA 3CXHK 3QW4B 5JXEC 4P2AA 3VGAC 3K71A 4G6AD 4Z2IA 3BPLC 3D3VE 5IKCA 5C6PB 1F07A 3UPMA 2H3BA 1DLHA 3C8KA 3M7FB 3TH3T 4RX0A 1PPIA 4AITA 2WOBA 1AQMA 4MJHA 4U6VH 4LOEA 1UWGL 3BP5A 5CP7A 4L4VA 2ZXGA 2BSCA 1UWXK 3DX1A 1OPOA 2NTFA 4B3ZA 3QIWB 3PHSA 1M6OA 1JGLL 4KH9A 1OAZH 5C09E 4MQSB 4XBKA 3O4OB 1XL4A 4PYHA 4TKWA 2YWYA 3ZW3A 4UF7C 3FEMA 1V4YA 5H2ZA 1TA3A 1BVLB 3G6MA 4XMWA 2YGNA 2QDHA 1NC2D 4JKNA 1HXYA 3INOA 1GKEA 1NCNA 5AZ2H 4PCFA 4NQCB 1IUZA 3GKFA 1CD8A 1FBAA 2A9ML 1QNZH 2J7BA 3L2LA 3QY7A 5FW7A 3D9AL 1T89A 1T99A 3UC2A 2ZC8A 1UBPC 4KRPB 3ATYA 5IWLA 3V52H 2DMGA 3GSOA 3OD3A 2Q86A 3I9IA 4AQ1B 5CG0A 2NQHA 1P4BL 4UOJA 4W85A 5EO0B 3VFLA 5FHBH 1QWKA 3S37H 5A6SA 3TX9A 4WU5A 3ECWA 1UKTA 2VQ4A 3TBSB 3LRLA 3HAEG 1D5ZB 4OB5L 4AQEA 1XJBA 2C7FA 4M4RB 4DJFC 3K30A 2VELA 3LDBB 1ITCA 5GRZA 2BZ7A 3IT8D 2GBTA 4POCA 4XNBA 5JHBA 1BXXA 4P5KA 3ZXWA 3AITA 4CC0A 5JBDA 3UL4A 3HFYA 5CKGA 3G9VA 3VRJB 4X6DB 2PDCA 5ISZD 2XX0A 3OHXC 2Z4QB 2C14A 3HZYB 3INPA 1WFOA 3KM2A 3H6JA 2WZIA 4UDTA 3T6WA 4WV1C 4L3AA 2RACA 2ON3A 2I9LA 5IOPA 4HIEA 1PLGL 2PC8A 3KDMB 2I9TB 4GHRA 3HB3D 1UOWA 1YEJH 2F53E 1WS7A 1N8IA 2QJDA 1NQBA 2EIKB 4OQVA 3KYAA 1BBJA 3MGTA 1D9KC 4HT3A 3BE7A 3DX4A 3UROR 3T7VA 4N2YA 1MJUL 1XFPA 4W4NA 2VDLB 1R1CA 1F3DJ 1Q1PA 5I2IB 1UB6B 4N6RA 4PJCB 1EXPA 1CGTA 4UFHA 2H0JA 4ML4A 3JTSA 5GS0H 5BROA 4GMTL 4LVAA 1W8OA 5D7SH 3T1WA 3EGSB 1ZJIA 5E8OB 4NXKA 2P8LA 3B7YA 5HYIA 4LVHB 1RCXB 4C6LA 1KBGH 1CCZA 1RQBA 5T3ZH 3F58H 1L0XA 1SEBA 1ZA6A 3MRNA 1S9YB 4NO5A 4F7CA 4MSSA 2VDKL 4ZJ9A 2X4RB 1HP5A 4YSAA 4JUSA 1AQKH 3F3HA 1AD0A 3NABL 3UD6A 1I7UA 2KC0A 4HYWA 2VDLH 1KFKA 3ZKND 2QCDB 1E4XH 3IMVA 2DWEA 2BW4A 5KETA 4WI0A 3TIDB 2X7VA 2R0ZH 2D7MA 4BKLB 4K94H 3E3QC 4LT9A 4JPIA 4F7PB 3WK0A 1BJ1H 3LRHA 2J73A 2OYMA 3U6RA 5G1TA 2VW6A 5A5WA 5E03A 4MNHA 3BZEB 2IALA 5J5RA 4KI5E 4PJXB 3CK0L 4WZHA 5AB9A 1SW7A 1S39A 3IFLL 3CDZB 3WNNA 2WNNA 3QEQE 1A0QL 3O3EB 1MHEA 1G9MC 3FN0H 3PY2A 3RUBL 4LHUB 2HXUA 4UT6A 5KSBA 1G43A 4K1GA 3CWNA 5DJAB 3W37A 4MM1A 4MMYA 1G5AA 5I66A 3S1XA 5B1JA 4QY8B 1KG0A 2VXQA 3FHQA 1YVLA 4KQ4H 3NSJA 4H44C 4DN3L 4E8DA 1ZXKA 2VOMA 5E6SB 1FDJA 3QDMA 4KMLB 5C08D 4PLJD 4ZS7H 4N0YL 5A2KH 3MROA 5DJCB 2RJMA 3KXFA 4EKXA 1B1YA 3U2OA 2OWCA 4H7CA 1LL1A 3FT2A 5DUJA 5KUMA 3O8AA 2HXTA 3FRPA 1MRQA 4IDJL 3EB3A 4N2CA 4L8BB 1XCTB 4JFTA 1SLUA 3IIPA 3MR9B 4U1HA 4NQQA 1ENUA 1SY6H 1OFRA 5K5YA 3JTTA 1BQKA 3HPJA 5LNGA 4UCGA 3LDVA 1DJSA 2QCGA 4NQVB 5DJ8A 3DRQA 1ECQA 1S5IH 3CQ0A 2DJMA 2ZKMX 1YADA 1XGQB 3FTVA 4JZJA 5SWQA 5I0DA 3F4NA 2AKMA 4PVLA 3DGGA 1O68A 5IVNA 1YIXA 4ZTXA 4G7EB 5FYLE 3GINA 2DL9A 1U93A 2FT8A 1KJVA 4UNLA 4QTHA 1CBGA 1MLBB 3ORJA 1CX9A 1D5BB 4JN7A 4JO2L 1GZPA 1PAZA 1TO4A 5AW1B 4KVCL 2Z91B 1GZHC 4HJFA 1EEYB 3VXGA 4WTWA 5C07D 4PBEA 1SYSB 1ECYA 3RWIB 3CHDA 3NFPB 5PAZA 2AV7B 2VVSA 4OF3A 5IJDC 4F8XA 4M0XA 1O9VA 2FL5B 1HGYA 1OFDA 3L48A 4D72A 3CQPA 4EUPG 5DMKA 3UC0H 2J4GA 3R8RA 1COBA 4OKVA 3Q37A 3P5ZA 4MNQB 4BHUI 1FXQA 2J1KA 4DT2A 1X4YA 4UMSA 3GK0A 2Y2TA 5AWNL 2WB1A 5IHRA 4OGAD 2B7PA 4PB9H 2I24N 2W79A 1FHNA 2FEDD 1FYTD 4UT6L 3W7GA 2VR3A 1AO7E 1ZKAA 4QLJA 5EU9A 4R4NC 3F4WA 2HFEB 3FQWB 2FB2A 1HJQA 4UNKA 2CZEA 2APSA 2IV8A 1EX0A 3P8JA 5L2KE 1GOGA 3A13A 3ZGIA 4HWBH 4ZMLA 1L6ZA 2X4SB 4PJFA 1K2DA 2IPKA 7A3HA 2LU4A 4AIEA 1XXFC 4QT5A 3WN5C 3GXNA 5D1XE 2VSDA 1VADA 4HUVA 3AC0A 1U5VA 2EO9A 5LCVH 1FVPA 4DELA 3WQ6A 5FF6B 3BCDA 4QDGA 2B8OT 5A6TC 3NRQA 1PVNA 3RWDA 5C9XA 1MELA 3TVAA 5F3BA 4XMXA 2J5LB 3SBQA 3I6GB 3EJJX 3VRLF 5I1AA 3OAYK 2JCCA 2CLPA 2R4SL 2C9AA 1JGUH 1KYOJ 5A94A 4LPXA 3D12B 3L16A 4PJIE 4K2SA 4O8RA 5I9QC 3IFPB 5AYTA 2VJ0A 4DZHA 4WHCA 4YPGA 2K70A 4IUOA 1UATA 5F44A 3BQUB 4WJKB 3JQOB 4HU3A 5T1LA 2ATAA 1Y6NR 2X4UA 5JXEA 2GIYA 2WNWA 3UG4A 2EDEA 3NYZA 4R7JA 3S8GB 3RL2A 3QZPA 4AIZB 1D8CA 4TRPH 4YCOA 2DQHH 4HS3A 5E5LA 1PIGA 3KVLA 2WC3A 3W1QA 5LIKX 1PY4A 3T07A 5FCZA 1MEIA 4OM0H 4PGDA 5I00A 4PVNA 3EYQD 4AMCA 2BNRB 3K72A 1WKEA 1TIMA 3QPEA 1RUQH 1BOGA 4FEMA 4JREB 4WGHA 2YXMA 3H70A 5CN1A 1JAEA 1FA4A 3KP1A 4UDUA 5F9AC 3OMNB 4QROA 4ZFQA 2JLPA 1A4BA 1N5AA 2PDPA 5E7FA 3QIBB 4NFCA 4O14A 2JIEA 1ROWA 1T2JA 4ONFL 1ZCOA 1MCJA 4W4OC 4NWUH 4U3SA 1LE9A 3HHSA 4B60A 4PR5A 2XTJB 4JFYB 2H8PA 5MEND 3DUUB 4I8YA 4YYFA 3NFSH 4A7SA 3ULVH 2JF1A 3U4BL 2I07B 4EN2A 2WB7A 4I77H 1Z6KA 4B9YA 3HQ1A 5D8JH 2EUWA 4MXVE 3GVRA 5I6KA 3PGDA 2VZ3A 3QDAA 3MUCA 4O50A 2YAHA 3LZPA 5FKAA 3LPGA 1JNNH 4LVNB 2DT1A 4ODTL 4OBSA 1BFOA 4MX7A 3K8MA 5FEPA 3RX3A 4C58B 3OAUH 5CC7A 1A4KB 3QUYD 5B4MC 3MUIA 3I6LE 2OSLB 3KOXA 2WPGA 3IGKA 4MA8L 5KAQF 4DJFA 2FO8A 1DJNA 5FFLA 3E12A 3NYDA 1R0AH 1RQEA 3V4PB 2B08A 2XYCA 2CO4A 2X1WL 1B3IA 1M7JA 4J8RB 3ARDC 3HUJB 1T5AA 4A6GA 4KO6A 2OP4H 3NZ1A 1FHGA 2YLLA 2ZQKA 3CGTA 3DUHA 2PWUA 2DD8L 4OF5A 5LNRA 5D7LD 4WV1A 4XBGB 5E4AA 2QLVB 4ZQTA 4XN5A 1X5KA 5D4JA 1KBWA 4YIQA 3LB6D 1TYJA 2O7QA 4K4KA 2ZUWA 4LJ3A 3FO0L 4PEEA 1HHKB 3IJ7A 1J87A 4R90L 4N2GA 1C1EH 1D9KA 1KCUH 3SYAA 3CDCA 2X42A 2BOEX 1EAJA 4YXLL 5FESA 4DUWA 3SDCB 1UWTA 4BFIA 3A24A 1TV3A 4OGZA 2J75A 4NN5C 4B5WA 3B8VA 2R9HC 1KBIA 5T9CE 4Q8BA 4AD1A 3BKCL 5AFAA 3BW3A 1V8HA 4ADTA 1B3JA 4M43L 1TJMA 1EAPB 3QG7L 1MDTA 1CGVA 2G3MA 1Q1JL 1IAII 2JELH 1DJQA 1OTUD 1Q4WA 1SJHA 4Y16B 3X3GL 5J13B 4KVNL 1U21A 2HS6A 4CN4A 1UZ8A 1LROA 2OEKA 2R2EB 4AJVA 2AVFA 3BAWA 1BQRA 1EA9C 5J1AB 3FQUA 4XKYA 1KFAH 1TETL 3D06A 5DMYA 3DUGA 4JPWH 2ZE0A 2X1IA 1OD0A 4LFYA 1OY0A 1L3WA 4NM4H 3RWHB 3AT8A 1HVXA 2OOGA 1XQKA 1WVZA 3EGJA 4OZIF 3RGVC 3QSTA 1VLXA 5DZJA 4UTJA 1QAWA 4L2LA 3CFIC 1QFWH 2ZRVA 4PRPB 4OLWH 1IFHH 2J1YA 2R14A 2WZ5A 4WNQB 1NEZG 4OZGE 1HL8A 4TOYH 1AW2A 1BHGA 1Y7VA 4X42A 2AP2A 1T7VA 3MSRA 1E9LA 1O4UA 3VD1A 3MKKA 3WK3A 3DBNA 4NOBA 3DFPA 3G5YA 3EJRA 5ABFA 3SCMD 1BQGA 4KZEL 3O45B 4S1RL 1P1ZA 1VGEL 4AL8H 1JYNA 5C0FA 3IJEA 1GZJA 3JW7A 2ICES 3MV7D 2XWCA 1FWJC 1CZ1A 3K81A 3Q2NA 2IGFL 2YCLB 1ONXA 1ETZB 3IJDA 5E4IA 5JW4Q 1CWVA 4Z77A 2WXGA 4HF5L 2K1MA 4QGYA 3BLPX 5H94B 1OFPA 4OLZL 4WXZA 4LSDA 3Q4DA 3SGEH 5EULV 1BD2A 3L4CA 5CGTA 3QC6X 4NGHL 5I2UA 3NQDA 2D3VA 2CMRH 1UWEL 1RSFA 2VLRB 5EUKB 2IKHA 3TZVD 1RJQA 3FJ4A 2AFNA 1W2KT 5F7YC 2AXJA 4NO2A 3CZEA 4WXYA 1PDZA 2FGBA 3ASNB 2UWEB 4AD3A 2YO3A 3MHFA 5CJNA 4GISA 1EUUA 3GIPA 3OKDB 2EDNA 1AZNA 4L23A 1OEZW 3O6MH 2ZZ7A 1IEQA 1P5UB 5KYXA 3GPSA 2CKSA 3V8OA 3MRIA 4UIOA 4WJXA 4QSFA 1XYLA 4MNGA 2Z4TA 3TJ4A 3RB5A 3DYOA 3UJTL 2IXQB 1ZY9A 4XC3H 4PSPA 2HT3D 2FECI 2OR2A 1XF4A 4BCXA 4NQDA 3DJTA 1FVCA 2HJPA 3RCMA 3U6XA 1EEPA 3N6JA 5JIKA 3WELA 2PDYA 3S97C 5F0LB 3QW3A 3NJMA 1YNYA 3MCOA 3IAPA 4ZUUA 4KK8D 1GZHA 1KTDB 1WEJL 2CD0A 4AD5A 2GQAA 4ZZFA 3KLHD 1BF8A 2A77L 1FDLH 4ZMAT 2XWRA 3VKKA 3CBKB 5EOCJ 2EDKA 1PKNA 1I8KB 3R25A 4G5ZH 4JFFA 1OCWH 2Y5EA 5D7IF 2HV5A 2VLJE 3W7LA 4NKMA 4C54A 4RMWA 1I7ZB 1GW9A 2ODHA 4DJEC 5E9DB 4DGYL 1LO5A 1DJIA 4U1GB 1PCWA 3P81A 3LQZA 1E4IA 1G9ML 4MCZB 2KLSA 2XYBA 4FALA 1WA0X 4HT1L 4OCXH 3JT0A 2GWGA 4JM2F 3GLDA 3N41F 3SUTA 3F4DA 4RBPK 5E95B 5LQBH 4X7TB 2X8RA 2KZ1B 4ZE4A 1G9NC 1ISYA 1NFIB 3ENEA 2ISDA 2YD7A 1C9SA 5F2LA 4HHAB 1NDGB 4Z95L 2O5ZH 1BVOA 2O0TA 3N44F 4FG0A 3LI0A 4F37K 2YAFA 2R2CA 1JIBA 4Z3TA 5HNTA 2Y69B 1O1ZA 2FJKA 5J89A 5JQIB 4QIUA 3FQXA 2WO5A 3WN5A 2VJXA 3ZLFA 3VXMB 5F71A 3RWEA 3EPNA 1Z3GL 4PTMA 3WQ5A 4IMLB 4RZCB 5I0XA 1LTXA 1KIPA 4JAMA 3DX9B 1PLBA 3E3QE 2HWZH 2CEQA 3V5CA 2ABAA 1YYML 4CLMA 2FWLB 4NLAA 4R4BA 4LSUL 1E6PA 1Z3RA 2FHFA 4LLQA 1G7QA 3OPZH 4KHTH 4ZS6C 3OC5A 2BO0A 1ZLUK 4N2LA 1Y0EA 3SJVE 4O51A 1M1XB 3VI4F 3GBMH 3QJAA 4UM9A 4GRLB 1JXDA 4MQTB 5E8NB 4PMQA 3QDGE 1XIIA 3KPOA 2JJUA 5E2VH 3PP4H 1LMIA 2IDUA 3FFCE 3QUKB 3TA9A 5JR1H 5TIMA 15C8L 2XA3A 2YEZA 1WDAA 4NHCH 2XPZA 3M47A 5H8UA 4TSAH 3FCSB 2CLRA 3QS2A 2UZIH 1QJWA 4K55A 1YEGH 4X5XA 4ZQKB 2GIMA 3BIAX 1C5CH 3STZA 2BC4A 1T6WA 4Y2OB 2KKQA 2QUMA 1KC5H 4Q9CA 3SGKC 3U36B 2HVKB 5B1KA 4RDQG 1DUZB 1BQHB 4JO1H 1PIIA 3GR4A 5I16A 2FQGA 3A4JA 4W4OA 3PTMA 3CUXA 3MXWL 1VYSX 1UT9A 2C91A 2DZEA 1HE7A 1J0YA 1C16A 1HQ4A 1VCFA 3ARGC 3DOSA 2OOFA 4PA8A 5HA7A 1U42A 1F13A 3IE4A 1LDCA 3NOYA 3RGTA 4BZ1H 2VITA 1TUFA 1VPQA 3LCGA 2HRGA 2POZA 3PAVA 5KZCD 1MHHB 4GIAA 5TE7L 3DFOA 4PBDA 4MLRA 2DDXA 4UAHA 4WCYL 2VYRE 2CA3A 2QKIC 3QJZA 2DQGH 4GKNB 3EDEA 2ACSA 2HLAA 2YD8A 4ISVA 3LG3A 5INCB 1HKKA 3T3MB 4P06A 1WWWX 1EEXA 1U4FA 1KM0A 1BM3L 4EVNB 2FQIA 1IE7C 2ODOA 3K2KA 3VE0B 4GP8B 2JI1A 3M1ZA 3ARDA 4PCTA 4LSPL 5EDSA 1NL0L 2DORA 2XJLA 4ZPVA 5I26A 3GVQA 3TNOA 4MWAC 4QS6A 3UMNA 2P43B 2LLNA 1AJZA 5D5MB 2H32A 2UZPA 4M48L 1LL4A 4ZUSB 4GKSA 4WW2F 4B9GA 1DEEA 1WYIA 4JJ5A 1BYOA 3VX1A 3C12A 4OFKA 3BMXA 2VDMB 3LIZA 3F5KA 3TYCA 2R0KH 2P10A 3CZ8A 2BNQD 5LGZA 3GHEH 2NMSA 1Y07A 5K59F 4JTLA 1DVFB 3VIFA 1OOWA 3FB5A 5CD3A 3CHPA 1OCJA 4HN4A 3V0IA 1ES0B 1E0TA 3L1EA 4YSEA 3UZQB 2GDVA 4A3UA 3VWJB 1S9VA 3MA9H 4OTXL 1GVEA 3UZYA 1T03H 4XN9A 4W8BA 4JM2C 1BAWA 4XAGA 3VTRA 4Q8TA 1NTDA 4OT1L 3MT1A 2Y07H 2OI9B 3WLSA 4G9FE 4LL1A 4KQ3L 2WQ8A 2V5MA 3GWJA 4QOKD 3N4EA 4K73A 2VC6A 1EZWA 3VFUB 5D4QA 3UZVB 3QISA 4E9YA 1HKJA 2DY3A 1TPXC 3PV7A 5HUOA 3IEBA 3UA3A 2GKIA 3RGHA 4PH8A 1X7TA 4M7KL 2D0FA 2FZ3A 2XETA 4GCXA 3PE9A 4ZQRA 2DV0A 4M1CD 2DJUA 1PSCA 4YMPA 2OL3H 3W0WA 3NTCH 5CZXD 1J2WA 4E9RA 3RGVA 6ALDA 3IRDA 3TOYA 4O2CB 2YBRA 4GBXC 1AKJB 1S2EA 1QYGH 1QI3A 2DKUA 4HEMA 2C9VA 4I2XA 1Z32X 1ADQH 5J04A 2DN7A 4NJHA 5AC7A 2EIMB 2NW3B 3QDJE 3RY6C 1I3GH 4Z3EA 4L7ZA 3D39D 3MLWL 4KBXA 3JS3A 5KSBF 3MI6A 3AYVA 4HISA 5IHLB 5C7ZA 4XHQA 1RIVH 3ZT5A 1NARA 2DKMA 1WTGT 3DIVA 5BJTB 3GDLA 4YHPB 3TC3A 4RMSA 2IQ9H 3DX7B 3NK3A 2WSKA 3QBUA 4XAWH 3PUCA 4IBLT 2O9OA 1A5AA 5EBWA 1AL8A 3WTWA 1S3KL 2Z2UA 4GUHA 3QGKC 1UUNA 4H3DA 2KH2B 1A3RH 2E7DA 3G5ZA 4OV6F 3BXWA 4O1EA 3WEMA 4NN6C 4JNXA 1RZKH 4N0UA 4PAZA 3LIZL 4YAQA 5FI8A 3GB7A 1E70M 1S7XB 2IFFL 4A3YA 2QL1A 4J3OF 3EO1B 5HYFA 4M8RA 1R30A 5DJ2B 4Y4HC 1XYFA 3K7UA 3E6EA 4RAVA 4E36A 5I8CA 3TYAA 3L3JB 3MW7A 3BX7C 3D25B 3W7IA 3CN2A 4ERAA 1K8CA 4P2OB 4MDIB 5BZZA 1LORA 4JG0L 2BCKA 2OT0A 5F7DA 4WKFA 3EYPA 2QIWA 4L3EB 4PJ8D 1JTOA 3A6BL 3N3TA 3C2VA 5SV3A 5E5MB 1OFOA 1NDMB 4JFQA 2TSAA 3H7UA 3ALGA 3LSOA 4PP2B 2IC2A 2FO4B 3W26A 4LLDB 3REWB 5K9JL 4XIMA 1OFBA 4NYLA 2W92A 4OCNC 4UZUA 1UXWA 1U36A 3BE1H 3L1FA 4LASL 2W65B 1F8TL 3B9DA 3QXUA 1QT1A 3CFMA 4OF6A 1YUHA 1OC6A 4ANVA 4UAOB 2E4FA 3F8UB 2H6UA 3FO1B 2BX7A 4O28A 5CO1A 3NSXA 1PTZA 3S0CA 3URNA 1MJ7H 4MD5B 1M1BA 1WBYA 3EYSH 1MO0A 1A6ZB 1J9RA 4A8LA 1J1XH 3NH7H 4AYID 1MUJA 1FZOB 5EORH 1TQCB 3MJGX 1FX6A 2BS9A 4F2MB 3V95A 4HCHA 1HAUA 1U95B 3WQDA 3U46B 3UYPA 1V08A 3VB9A 5DJ0A 1X7QB 1IL1B 2DVUA 1D6VL 3EGDA 4K3JL 1JF6A 4LP5A 3L4WA 5GRYA 3HTLX 2J8UB 3PNWA 4DJEA 3CPLB 5FKYA 2PCEA 2FIQA 3MLVL 5JOPE 3QQ3A 2FH8A 1KIQA 1CT5A 3O6LL 2CU9A 5JHAA 4WW2C 3QWOA 5ICYB 1THCA 1LRNA 4G8GA 3HC3H 4MKMA 3AHTA 4PI0A 3BH9A 4EZLA 1VF8A 2DQEH 4PCKA 3NSCA 4PJFF 1JCYA 4XCCL 2DQXA 3TMLA 3G1SA 5BXSA 4B9IA 3EBHA 1EXHA 3RWGA 1EZVY 1YPZA 2N0MA 5F89A 1R3JA 5EN2A 5TAOA 1BXCA 3ZLHA 3VXSE 1EVTC 3GBLA 1WICA 2DJLA 3H23A 4GABA 5JOFB 3BI9X 3D69A 2Y6ZA 5D7JB 1AW5A 1A3QA 1V6WA 4X9IA 1U22A 3BOFA 2C9QA 3LA4A 4E4PA 5DFVC 2NVDA 3D4YA 4LLAA 1J6OA 3CU1A 3LNEA 3QMSA 1L0PA 2P8PA 4AD2A 5D6CA 2JCCF 1Z48A 2H0FA 2W0PA 2GWNA 2V38A 4MY9A 4GRWB 5F2GA 4M7SA 4UTBH 1CI5A 1SUXA 1BEXA 3TN0C 2QNEA 4W9CC 3VRLE 4PC8A 2V5KA 4ERSH 2YXXA 3ATBA 3FO9A 3T3PB 4MJID 2XFWA 5CBAB 1ZHLA 3EDDA 4HKPA 3CQFA 1B90A 2HTLC 3F04A 3HZ3A 4PTNA 4X0KA 3OYZA 2OR7A 1DBJL 1CF8H 3EWBX 1BQLL 3K4DA 2FLBT 4LPCA 3G1RA 3UTSD 4FABH 2PGEA 5M17A 2OTUB 4XPFL 4LVDA 1OM3L 1KT2B 3BN9D 3HNTL 4C4UA 3EHBC 5DRWB 4CCZA 2BVQB 2R1WB 3EAKA 4GRWH 3GM0A 3TJEH 3FU7A 1UVQA 1OKEA 4JQ3A 3I65A 4JJOA 1E9IA 1FBIL 3SODB 2INZA 1NA8A 2P5NA 4I0PB 3AIVA 5ABTA 2HDJA 1XV8A 1E4HA 3DXAA 5IB2B 3V9EA 2EDQA 1KRBC 3S34L 3U83A 4OUUA 2ESVD 1FL6A 2Q7AA 4YDMA 4JFOA 3Q1SL 5ELIA 3SGKA 4JGDA 1HWHB 1YECH 1EAQA 4A2DA 1UC6A 2IH1A 3ZE0B 4XPTH 2H3NA 4AL8C 4OVXA 4ZMGA 4WO0A 3FFDA 1AGDB 4K5NA 3TYFB 4ZX3A 1DQLH 4KDVA 3IB4A 4JN2A 4BSWB 2PXYC 4GQBA 4K8RH 4JVUA 2UY6B 3BSHA 4JR9L 4D9RE 1FNGA 1G9NL 1AZ1A 3OM3B 1EJWC 3MV01 3QNZB 1SPQA 3W6LA 3DFNA 3HG2A 5AQ0A 3E6FB 1SO5A 4NUGL 4PWJA 2F5BH 3SCNA 2VXVL 3UAFA 3UU0A 3PTDA 3WQCA 4MD0A 2R69H 3GZPA 1YXYA 3MUAA 1PLCA 4LNYA 1VJIA 1B54A 5CSGA 3W82A 2QKIA 1P6WA 5GGUB 1SNRA 4Z2HA 2BOFX 5JW4M 5T1MA 2YL6A 4RPQA 3N11A 4HHGA 1KA9F 3DX3A 4YXHL 4G80A 4CD5A 1WUNT 5CLZA 2OZNA 2GSJA 4X8JB 4OF7A 4JHAH 2V2TA 5FACA 4Y9BA 3MVTA 4GIOA 1CBVL 2JTYA 1ZSHA 1QK2A 4AHOA 3MBED 1PKQA 1EANA 4IM4A 4MWAA 2XN2A 4JFUA 3OW1A 1S7VA 3L3IA 1FLTX 4H41A 4Z78A 4MQ7A 3O3AA 2EDYA 3NVTA 1A4JB 3HA1A 4UYQA 4G8GE 5T5NG 1IXPA 3UWQA 5J57B 4QQUA 4HWEH 2AMGA 2HPOA 5TF0A 5FHAH 4Y19D 2ZYFA 1U8LA 4NQXA 4P3CH 3PF2A 1FL5B 2CKRA 4IOFD 5DJYA 4PREB 5E5UB 2I32A 5JW4R 3DVNA 3WQGA 4GC3A 2J9YA 4M93C 1B57A 2XQ0A 4F3FB 2DEPA 3LQAH 2JB6B 5I15H 1KZQA 3UBXB 1GJIA 5JIIA 4X9SA 3CMOL 4AY7A 1ORQA 4YXKH 3PWLB 4CC1A 4ZD3H 1B4JH 4IU3B 1XH0A 4J2XA 2UX6A 2WBKA 4YOKA 4PMVA 4HIHB 3MLXH 3PHOA 8FABB 1A1MB 1RUSA 3QUXD 1A9EA 1S2TA 4JM2A 2LAGB 3WENA 4JB9L 5SX5K 3WMSA 1OE2A 3G1HA 4WTZA 2DJ4A 3P3SA 4G5AA 5CSZA 2DFAA 2R7EB 4NAFB 5AD0B 4DP7X 3W2LA 2OX4A 3H6OA 3R11A 5CKSA 1YAZA 5D7KD 4MXQD 2GABA 3SDDB 4IQHA 2ABBA 5HQMA 1FP5A 5TE4L 4X83A 2V2XB 5FA3B 4KFNA 4PBVC 4ATLA 4OZIE 3FUMA 4IOTA 3QQNA 3M8OL 2R0WH 1CTMA 3WKNA 2DSUA 2AKZA 3LEXB 3HI1B 2GGEA 1KM4A 4GBXA 5HHOE 3FTGB 3QJXA 3TH2T 4FMKA 4XBSA 3QQ4A 3UTTD 1KGCE 2R8WA 3RG6A 5C2UB 2JFCA 2GUOA 4GAJH 4GNJA 3RY6A 3VXPA 1H50A 5BXFB 4H9MA 4RGND 5ESVB 4WAFA 5DLCA 4XVEA 1TZOA 2ALRA 3O4LD 4K3GA 5EZJA 2VGIA 1A6UL 2R2HB 5ERWB 1F41A 2ZXWB 2DI7A 2OGYA 2PP0A 3TF7C 5TDPA 3WKQA 1RVFL 1OF2B 2VLME 1H60A 2WNZA 1BA9A 3WJWA 5T3XE 3UWZA 3ABZA 1NGPL 2DTMH 2LFEA 5GGSY 4FLRA 3VI4A 1CU4H 1BPVA 1NIDA 1VEMA 4ZB2A 2NXYC 3ITGA 1KBBA 3W0KA 5EZIL 4F7MB 2MIZA 3BDXA 4JTIA 3VXRA 5KBDA 4FS9A 5SX4I 4XP6L 5DXXA 1WUEA 1UCWA 2VDQH 3WFCL 5LIYX 3WIHH 3E02A 2YPVA 1KO0A 5KN5A 4OJFL 3BQ5A 2BLFA 1ZIAA 3T9WA 2WB5A 2QHRL 1IBZA 4HUXA 1IGTA 3GZQA 3LS4H 1O7VA 4Y4HA 4HS6A 3FUEA 9RUBA 3RLUA 3ILEA 3TIEB 1JDFA 2V7HB 1BLNB 3F7PC 2GEQA 4PRIE 1P69B 2PR4L 1NEUA 3AIWA 1QLFA 3VD7A 2FNBA 4FO4A 2Q3XA 3LEVH 3P4MA 3ISYA 2ZOXA 4JQ2A 3OLIA 3X13A 4QG9A 5LHEA 3SPIA 5IREA 3QUHA 5LA0A 1OSZB 3QZEA 4G71B 4R5VA 3S96B 3HE7D 1QR1B 5CU5A 3BH4A 2NY2D 4I7ZC 3CDYA 5K9OA 1Z0MA 2P53A 5IV2A 2YGYA 4LDLB 2IKJA 2ZPKH 1TV4A 4N2OA 2YPLB 3T0WA 5M94B 1PKQE 4XPAH 3IGUA 5GGSA 4LIQL 2XQBH 4YCPA 3Q0HA 2XICA 5HYJA 4OIBA 5IROD 3ZTEA 3D4CA 1TE1A 2WXNA 3NN8A 4I0CC 4H6EA 4H25B 1EO7A 4GGBA 5MKGB 4A39A 3B8WA 4DBUA 3TBWA 3NA9H 3OR6A 1EJ8A 3VFOB 2G3XA 5D7IE 4N9GA 1XGRA 3E9TA 3HZMB 2RKXA 5TPWH 1Q9KB 3Q6GH 1G7PB 5IBTH 3PXJA 4K71B 3WLWD 1JZHA 4XNDA 3ZVIA 4XI5C 3BVTA 1BXUA 1B0RB 5AFDA 3PM6A 1CDYA 2Q8AH 2I9EA 3F7QA 1FDZA 4N5ED 1DJGA 5C9RA 4W6WB 1A65A 3IN0A 4WW2A 3DBXA 3T0EB 1NIFA 3PSVA 4OFYA 5DZNA 2YSWA 5ALBH 5FF4A 1HIML 2VC7A 2WXJA 4HJTA 4UUJB 4AAJA 1RZIA 3BGFB 4DGVH 1EGZA 1JPFB 2I26N 1IAMA 5KYWB 2OXGB 2YPVL 3I2CL 4H1ZA 3VFRB 2E1WA 3FU6A 4ZVJA 3UXIA 2VRAA 5EO1B 3ZE1E 3H54A 1DO5A 4XXDB 2C71A 1AGEA 4JHZA 1AS7A 4FI6A 2YOCA 3O41A 2FQDA 1P4IH 2AKRB 4MLSA 3DX0A 2CGRL 4AC2A 3FS9A 3OO2A 4NC2B 3ZDYB 3KCPA 2H9AA 1TPVA 3TN0A 2NSMA 5L6UA 5T9BG 2XVGA 3S8FB 1AP2B 2WQAA 3M44A 3T8XA 5CR1A 3K3QA 4MLJA 1KGIA 1O7DC 4IHOB 4YUEH 4EI0A 4DY1A 1FFOA 5I74C 1FCBA 5DZOA 4HFWB 2Q76B 3CTTA 1IEAB 4GAYB 3MNZB 3WBYA 4OVVA 1ZVNA 3GI9L 3V4BA 4C6IA 4OTKA 3C8FA 4IQEA 2BZNA 5C9KA 1XQLA 1ZVHA 3VI4E 4TX9A 1PKLA 4GYFA 5IUSA 3GTTA 3VYNA 1NBCA 4HA3A 4L4VE 1JCXA 2NR6C 4Z0XA 1YRRA 1CGXA 1AMKA 3VXRE 5BOPA 4F8QA 5HHMD 1MI5B 1NLBL 2DB8A 3RVVC 2HVOA 4DP6X 2NT1A 2Q8BL 1YMHB 2ZSVA 1SSDA 1FVEA 5BYWA 5A95A 2GY7B 4WGKA 2HT2D 1I8IA 4PMXA 2K4AA 4YHIB 1ND0A 4AUUA 4DUXA 2OK0H 3JV6A 4H9UA 4IX0A 4GVGA 3KD4A 1ODZA 4B9CA 4EIBA 1N3NB 2CWNA 3OZKA 4GZIA 3W85A 4FQQB 4Z3HA 4A35A 1FGNL 4M80A 2R23A 2HRWA 3GIZL 1YJDH 1BQSA 2A6DA 3IAQA 4AGPA 4IXHA 3JT2A 3PPGA 4GAGL 3CWGA 4Y0GA 4FEIA 1CLZL 4FFVC 1J12A 4XNYH 3THCA 2OYLA 1QATA 3UXFA 4AOFA 4LLVA 9XIMA 3VXQA 1FH5L 3KH4A 4FCHA 2OTPA 2PXYA 4CMHB 5CMAA 5CP3H 3TXAA 4KFMA 3BV4A 1IEBB 1X5JA 5HI3C 2ZUSA 2YARA 5BXPA 3TL5A 3AWOA 3UVIA 4U0RB 3DI1A 4DGUA 3CMGA 4N2IA 3VCNA 4CNTA 4X6BA 3AXLA 1RZKC 3RY5A 1CZ8L 4A2HA 3EFOA 1QLEL 3IEAA 1HUVA 3KWUA 4UIKH