3L50A

The crystal structure of human glia maturation factor, gamma (gmfg)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
SMVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Glia Maturation Factor, Gamma (GMFG)
rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Glia maturation factor gamma
total genus 35
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3l50A00
1H1VG 1P8ZG 3EGDA 2MP4A 5KYUB 2MV2A 1SVRA 2KVKA 1M2VA 4JD2H 1QPVA 2W0IA 3DAWB 1TMWA 1YVNG 1V6FA 4LIZA 1EQYS 3A5LS 5IVUA 1PD1A 1CFYA 4PKHB 2XFAA 1D4XG 2NUPA 4CBUG 5KYNA 2L72A 1X67A 2FGHA 3EFOB 2FF3A 1T3YA 1JHWA 2MOTA 3A5MS 1Q8GA 1AK7A 1J72A 2LXXA 1WNJA 5KYYA 1F7SA 3EFOA 1M2OA 5A1MA 5FAEA 2NUTB 5DD2A 1KCQA 3Q2BA 2I2QA 2LLFA 4S10C 1C0GS 3EH1A 1MDUA 1M4JA 3EG9A 1ESVS 1VKKA 1PCXA 1T3XA 1AHQA 5KYXA 1NM1G 2VILA 1NMDG 5KYUA 2VIKA 5KYXB 1M2VB 1NPHA 2XF1A 2D8BA 1VFQA 2FH2A 3EGDB 3CJCG 3FFNA 3A5OS 3EGXA 1TVJA 3FG6A 1YAGG 3EH2A 4PKIG 4Z94G 3L50A 2NUPB 3EGXB 3CI5G 1UDMA 5FAFA 4CBWG 1T44G 2HD7A 1T2LA 1C0FS 1AK6A 1SVQA 5KYWB 1WM4A 1CNUA 1WFSA 5HVKB 3CJBG 3FFKA 1RGIG 5KYYB 2FH3A 1PD0A 1NLVG 5HVKD 1DEJS 5KYWA 1HQZ1 1P8XA 3A5NS 3CIPG 4CBXG 2FF6G 2QTVA 4KEFA 1Q8XA 4BEX1 4PKGG 1D0NA 1COFA 5L6WC 2NUTA 4KEDA 1SVYA 3TU5B 2FH1A 3FG7A 4KEEA 2VACA 2FH4A 3EG9B 2LJ8A
chains in the Genus database with same CATH superfamily
1H1VG 1P8ZG 3EGDA 2MP4A 5KYUB 2MV2A 1SVRA 2KVKA 1M2VA 4JD2H 1QPVA 2W0IA 3DAWB 1TMWA 1YVNG 1V6FA 4LIZA 1EQYS 3A5LS 5IVUA 1PD1A 1CFYA 4PKHB 2XFAA 1D4XG 2NUPA 4CBUG 5KYNA 2L72A 1X67A 2FGHA 3EFOB 2FF3A 1T3YA 1JHWA 3DA7A 2MOTA 3A5MS 1Q8GA 1AK7A 1J72A 2LXXA 1WNJA 5KYYA 1F7SA 3EFOA 1M2OA 5A1MA 5FAEA 2NUTB 5DD2A 1KCQA 3Q2BA 2I2QA 2LLFA 4S10C 1C0GS 3EH1A 1MDUA 1M4JA 3EG9A 1ESVS 1VKKA 1PCXA 1T3XA 1AHQA 5KYXA 1NM1G 2VILA 1NMDG 5KYUA 2VIKA 5KYXB 1M2VB 1NPHA 2XF1A 2D8BA 1VFQA 2FH2A 3EGDB 3CJCG 3FFNA 3A5OS 3EGXA 1TVJA 3FG6A 1YAGG 3EH2A 4PKIG 4Z94G 3L50A 2NUPB 3EGXB 3CI5G 1UDMA 5FAFA 4CBWG 1T44G 2HD7A 1T2LA 1C0FS 1AK6A 1SVQA 5KYWB 1WM4A 1CNUA 1WFSA 5HVKB 3CJBG 3FFKA 1RGIG 5KYYB 2FH3A 1PD0A 1NLVG 5HVKD 1DEJS 5KYWA 1HQZ1 1P8XA 3A5NS 3CIPG 4CBXG 2FF6G 2QTVA 4KEFA 1Q8XA 4BEX1 4PKGG 1D0NA 1COFA 5L6WC 2NUTA 4KEDA 1SVYA 3TU5B 2FH1A 3FG7A 4KEEA 2VACA 2FH4A 3EG9B 2LJ8A
chains in the Genus database with same CATH topology
1H1VG 1P8ZG 3EGDA 2MP4A 5KYUB 2MV2A 1SVRA 2KVKA 1M2VA 4JD2H 1QPVA 2W0IA 3DAWB 1TMWA 1YVNG 1V6FA 4LIZA 1EQYS 3A5LS 5IVUA 1PD1A 1CFYA 4PKHB 2XFAA 1D4XG 2NUPA 4CBUG 5KYNA 2L72A 1X67A 2FGHA 3EFOB 2FF3A 1T3YA 1JHWA 3DA7A 2MOTA 3A5MS 1Q8GA 1AK7A 1J72A 2LXXA 1WNJA 5KYYA 1F7SA 3EFOA 1M2OA 5A1MA 5FAEA 2NUTB 5DD2A 1KCQA 3Q2BA 2I2QA 2LLFA 4S10C 1C0GS 3EH1A 1MDUA 1M4JA 3EG9A 1ESVS 1VKKA 1PCXA 1T3XA 1AHQA 5KYXA 1NM1G 2VILA 1NMDG 5KYUA 2VIKA 5KYXB 1M2VB 1NPHA 2XF1A 2D8BA 1VFQA 2FH2A 3EGDB 3CJCG 3FFNA 3A5OS 3EGXA 1TVJA 3FG6A 1YAGG 3EH2A 4PKIG 4Z94G 3L50A 2NUPB 3EGXB 3CI5G 1UDMA 5FAFA 4CBWG 1T44G 2HD7A 1T2LA 1C0FS 1AK6A 1SVQA 5KYWB 1WM4A 1CNUA 1WFSA 5HVKB 3CJBG 3FFKA 1RGIG 5KYYB 2FH3A 1PD0A 1NLVG 5HVKD 1DEJS 5KYWA 1HQZ1 1P8XA 3A5NS 3CIPG 4CBXG 2FF6G 2QTVA 4KEFA 1Q8XA 4BEX1 4PKGG 1D0NA 1COFA 5L6WC 2NUTA 4KEDA 1SVYA 3TU5B 2FH1A 3FG7A 4KEEA 2VACA 2FH4A 3EG9B 2LJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H1V G;  1P8Z G;  3EGD A;  2MP4 A;  5KYU B;  2MV2 A;  1SVR A;  2KVK A;  1M2V A;  4JD2 H;  1QPV A;  2W0I A;  3DAW B;  1TMW A;  1YVN G;  1V6F A;  4LIZ A;  1EQY S;  3A5L S;  5IVU A;  1PD1 A;  1CFY A;  4PKH B;  2XFA A;  1D4X G;  2NUP A;  4CBU G;  5KYN A;  2L72 A;  1X67 A;  2FGH A;  3EFO B;  2FF3 A;  1T3Y A;  1JHW A;  2MOT A;  3A5M S;  1Q8G A;  1AK7 A;  1J72 A;  2LXX A;  1WNJ A;  5KYY A;  1F7S A;  3EFO A;  1M2O A;  5A1M A;  5FAE A;  2NUT B;  5DD2 A;  1KCQ A;  3Q2B A;  2I2Q A;  2LLF A;  4S10 C;  1C0G S;  3EH1 A;  1MDU A;  1M4J A;  3EG9 A;  1ESV S;  1VKK A;  1PCX A;  1T3X A;  1AHQ A;  5KYX A;  1NM1 G;  2VIL A;  1NMD G;  5KYU A;  2VIK A;  5KYX B;  1M2V B;  1NPH A;  2XF1 A;  2D8B A;  1VFQ A;  2FH2 A;  3EGD B;  3CJC G;  3FFN A;  3A5O S;  3EGX A;  1TVJ A;  3FG6 A;  1YAG G;  3EH2 A;  4PKI G;  4Z94 G;  3L50 A;  2NUP B;  3EGX B;  3CI5 G;  1UDM A;  5FAF A;  4CBW G;  1T44 G;  2HD7 A;  1T2L A;  1C0F S;  1AK6 A;  1SVQ A;  5KYW B;  1WM4 A;  1CNU A;  1WFS A;  5HVK B;  3CJB G;  3FFK A;  1RGI G;  5KYY B;  2FH3 A;  1PD0 A;  1NLV G;  5HVK D;  1DEJ S;  5KYW A;  1HQZ 1;  1P8X A;  3A5N S;  3CIP G;  4CBX G;  2FF6 G;  2QTV A;  4KEF A;  1Q8X A;  4BEX 1;  4PKG G;  1D0N A;  1COF A;  5L6W C;  2NUT A;  4KED A;  1SVY A;  3TU5 B;  2FH1 A;  3FG7 A;  4KEE A;  2VAC A;  2FH4 A;  3EG9 B;  2LJ8 A; 
#chains in the Genus database with same CATH topology
 1H1V G;  1P8Z G;  3EGD A;  2MP4 A;  5KYU B;  2MV2 A;  1SVR A;  2KVK A;  1M2V A;  4JD2 H;  1QPV A;  2W0I A;  3DAW B;  1TMW A;  1YVN G;  1V6F A;  4LIZ A;  1EQY S;  3A5L S;  5IVU A;  1PD1 A;  1CFY A;  4PKH B;  2XFA A;  1D4X G;  2NUP A;  4CBU G;  5KYN A;  2L72 A;  1X67 A;  2FGH A;  3EFO B;  2FF3 A;  1T3Y A;  1JHW A;  3DA7 A;  2MOT A;  3A5M S;  1Q8G A;  1AK7 A;  1J72 A;  2LXX A;  1WNJ A;  5KYY A;  1F7S A;  3EFO A;  1M2O A;  5A1M A;  5FAE A;  2NUT B;  5DD2 A;  1KCQ A;  3Q2B A;  2I2Q A;  2LLF A;  4S10 C;  1C0G S;  3EH1 A;  1MDU A;  1M4J A;  3EG9 A;  1ESV S;  1VKK A;  1PCX A;  1T3X A;  1AHQ A;  5KYX A;  1NM1 G;  2VIL A;  1NMD G;  5KYU A;  2VIK A;  5KYX B;  1M2V B;  1NPH A;  2XF1 A;  2D8B A;  1VFQ A;  2FH2 A;  3EGD B;  3CJC G;  3FFN A;  3A5O S;  3EGX A;  1TVJ A;  3FG6 A;  1YAG G;  3EH2 A;  4PKI G;  4Z94 G;  3L50 A;  2NUP B;  3EGX B;  3CI5 G;  1UDM A;  5FAF A;  4CBW G;  1T44 G;  2HD7 A;  1T2L A;  1C0F S;  1AK6 A;  1SVQ A;  5KYW B;  1WM4 A;  1CNU A;  1WFS A;  5HVK B;  3CJB G;  3FFK A;  1RGI G;  5KYY B;  2FH3 A;  1PD0 A;  1NLV G;  5HVK D;  1DEJ S;  5KYW A;  1HQZ 1;  1P8X A;  3A5N S;  3CIP G;  4CBX G;  2FF6 G;  2QTV A;  4KEF A;  1Q8X A;  4BEX 1;  4PKG G;  1D0N A;  1COF A;  5L6W C;  2NUT A;  4KED A;  1SVY A;  3TU5 B;  2FH1 A;  3FG7 A;  4KEE A;  2VAC A;  2FH4 A;  3EG9 B;  2LJ8 A; 
#chains in the Genus database with same CATH homology
 1H1V G;  1P8Z G;  3EGD A;  2MP4 A;  5KYU B;  2MV2 A;  1SVR A;  2KVK A;  1M2V A;  4JD2 H;  1QPV A;  2W0I A;  3DAW B;  1TMW A;  1YVN G;  1V6F A;  4LIZ A;  1EQY S;  3A5L S;  5IVU A;  1PD1 A;  1CFY A;  4PKH B;  2XFA A;  1D4X G;  2NUP A;  4CBU G;  5KYN A;  2L72 A;  1X67 A;  2FGH A;  3EFO B;  2FF3 A;  1T3Y A;  1JHW A;  3DA7 A;  2MOT A;  3A5M S;  1Q8G A;  1AK7 A;  1J72 A;  2LXX A;  1WNJ A;  5KYY A;  1F7S A;  3EFO A;  1M2O A;  5A1M A;  5FAE A;  2NUT B;  5DD2 A;  1KCQ A;  3Q2B A;  2I2Q A;  2LLF A;  4S10 C;  1C0G S;  3EH1 A;  1MDU A;  1M4J A;  3EG9 A;  1ESV S;  1VKK A;  1PCX A;  1T3X A;  1AHQ A;  5KYX A;  1NM1 G;  2VIL A;  1NMD G;  5KYU A;  2VIK A;  5KYX B;  1M2V B;  1NPH A;  2XF1 A;  2D8B A;  1VFQ A;  2FH2 A;  3EGD B;  3CJC G;  3FFN A;  3A5O S;  3EGX A;  1TVJ A;  3FG6 A;  1YAG G;  3EH2 A;  4PKI G;  4Z94 G;  3L50 A;  2NUP B;  3EGX B;  3CI5 G;  1UDM A;  5FAF A;  4CBW G;  1T44 G;  2HD7 A;  1T2L A;  1C0F S;  1AK6 A;  1SVQ A;  5KYW B;  1WM4 A;  1CNU A;  1WFS A;  5HVK B;  3CJB G;  3FFK A;  1RGI G;  5KYY B;  2FH3 A;  1PD0 A;  1NLV G;  5HVK D;  1DEJ S;  5KYW A;  1HQZ 1;  1P8X A;  3A5N S;  3CIP G;  4CBX G;  2FF6 G;  2QTV A;  4KEF A;  1Q8X A;  4BEX 1;  4PKG G;  1D0N A;  1COF A;  5L6W C;  2NUT A;  4KED A;  1SVY A;  3TU5 B;  2FH1 A;  3FG7 A;  4KEE A;  2VAC A;  2FH4 A;  3EG9 B;  2LJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...