3L5IA

Crystal structure of fniii domains of human gp130 (domains 4-6)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
290
structure length
290
Chain Sequence
EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-6 receptor subunit beta
total genus 51
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5iA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5iA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l5iA03
3VWJD 5ITFA 3VFWB 3NZ8A 2BMKB 4ERSH 4QCIB 4WI8A 5H8DA 4CL7A 3DYOA 4NQSB 1A9BB 3CFDA 5D7LD 3BHBA 4JY4A 4PJIF 1MAMH 3AFLA 5DK2B 3WFEL 5SWZA 1R3LB 4XP9L 3MUHL 3S88L 1XF1A 1P84J 1QQDA 4JDVA 4X0KA 4XP5H 4PJ8D 4MZ3A 2AI0L 3MJ9H 4LSSL 5ESVA 3NGBB 4HUXA 5IVXE 1N8ZA 5HYQA 4ZUSB 4HK0B 2WM0A 5GQBA 3DNKA 4PRAB 2FH6A 4L4TB 2V5YA 4KKLD 1E0OB 1BJ1J 3CK0L 1ZVYA 3GMNA 4YBQD 4YPJA 1G6RL 5C0JB 4S0SD 4LNRB 2VLRB 4U7MA 3MLVL 4ZG1A 5BS0E 5E8PB 3MOAH 2IWGA 4S10A 3WFCH 3VWKD 4HULB 1INQA 2OL3A 3BW9B 4EUPB 1UJ3A 2A1WH 3VI4F 4ZUVA 1M71B 2NX5E 4JFXA 4MAUL 1HOCB 5C0AB 4HKJA 4JPVL 3PP4L 5D93B 2EE6A 3BAEH 1T2QH 2CR6A 2WWKO 2C7UA 2OL3L 2J7LA 4TUOA 1MIMH 2BVTA 1A0QL 5DYOA 3OV6A 4YR6B 4AEHL 1YJDL 3MRNB 1TTGA 3LH2H 4JKMA 4ZO9A 5DD5L 5EOQH 1RZFL 4I3SL 4LKCA 2FB4L 2NLJB 4KQ4L 1TVHA 3CUPB 4AEEA 1JYXA 1U92B 2QADD 3L3HA 1MEXL 4WFGE 4Y16B 3V5HA 4J3WA 3IDIA 3KGRA 1DQDH 3C60C 3SE3A 2ZUQB 3Q6FB 3ULUH 4JDVB 3T1WA 3MV9E 2HT2C 1MRFH 3T0BA 4PB0L 1U8MA 2LAAA 2Z31C 2QEJA 2WUBL 1EEZB 3R8BB 1IKFH 4JFOA 5C2UB 35C8L 2CKNA 5E24E 3G5XB 4F7PB 3IAGC 2YRLA 4L4VA 3SDCB 1YY8B 4XC1L 5F1IA 5IJVA 4HT1H 3NMEA 2D9QB 1ACYH 4Y19D 4JAMA 4NP4L 2ITCB 2NY0C 2VDLH 4PGBA 3SO3C 1U58B 1UWEL 1JWSB 2WP3T 4LSVL 4J2XA 1CR9L 1CU4L 1DBKH 1JHLH 5KJRL 3AC0A 3O3AA 1G0DA 2AJVL 3MA9H 2YMXH 4B50A 4U6HA 5C0EA 1NDMA 4YNYB 4WEBH 1XIWA 4OZHA 2Y5TA 4BFEA 3FHAA 4J1UA 4PV8B 3P0VH 4Z0XA 1DBMH 1YYML 1MCNA 4JFDB 4JG0L 3QIWB 2IH1A 2UYLB 4X7TA 3STBA 2YN5A 2JJTC 3T8XB 5I75B 4Z7UF 5HHNA 4XBEL 5DFVD 1WEJH 2Z92B 4IRSA 2IQ9H 3KJ6L 1KG0A 4ZAKD 4NKMA 3MNZB 1JE6A 3B9VA 2LTQC 2C1OA 3H3KA 2LAGB 1Z2KA 2BVPB 4P9HC 1D6VL 4HKJB 4UV4H 5D7SL 4MWFB 3RWCA 5F88A 4H25B 5IIEB 5GGUB 4UTAL 1U58A 1MCBA 5IQ9B 4PJ8B 1CT8B 1MJUH 3QZWG 1RUAL 4Y2DC 1SYSA 1LO4H 2Z31D 1JCKA 1I9RL 4ONHB 3ZTNH 2D03L 3TBTA 5HHQA 5CJXC 1MCRA 4JANB 2VLJE 5DC4B 5T1KB 4YDIH 1F2XK 2ICWB 4YDIL 4L4VD 4X98A 1OAKH 5J3HD 4ZNEE 2QQLH 5JOFB 2WMPA 2FGWH 5F1KC 5B39B 4PJBE 1XZ0A 1T21B 3ILPB 1YY9C 2AV1B 1BZ9A 3NA9L 5HHXL 1S3KL 1KN2L 4G6JH 4Z8FH 3BE1L 4HS8L 2X4SB 4K7PY 2Y9RT 1XH3A 3AGVA 5A3ID 3X11A 4OV6F 3DSFH 5F9WB 2XG5A 3VXPA 2ZCHH 1OM3L 1CICD 2B1HH 3ARUA 4MDJA 3SDXE 1JNJA 4KMLB 1PGRB 3C6SA 2DQHL 1Q1JL 4X5WB 5DQDH 3QNXB 1HDMB 4NQDA 1W0WB 4MCZA 3K2UH 1OAZL 3L1OH 1NEUA 3ARSA 3C8KB 2NY1C 3GKWH 4F7TA 5C6WH 2YR3A 2LVEA 5KSUB 3BGFB 5DLML 1N3NA 3UJTH 4APQB 3QDMA 1A3LL 4Y0GA 3X14B 3MRCB 4HS6B 2J4WH 2OTUB 2YMXL 5IR1A 3HCVA 2VSDA 3LY6A 2IAMC 3R0MA 1A4JA 2ORBL 5DJCB 1D9KC 3A6BH 4GMTH 4LPYA 1JNHA 2P8PA 3H8NA 2Q3AA 4MVBC 2FR4B 4R2GB 1FZKA 3TA3D 2X40A 4IDJH 2CLVB 1TVBA 1CL7L 4XPBL 5EC2B 2X4TB 5TE4L 1NJ9A 4R26H 3BXNB 2VQUA 1P4IH 4XMPL 2FSEA 3V5DA 4AG4L 3V2AR 1F6AB 5HHMB 3GSNB 4K9EC 1VACA 4Y7MA 4Q9QL 3BZDA 3DUUB 3QDME 1AI1L 1HXMA 3MRMB 4NM4H 2P46B 1ZT7B 3QUZB 4OLYH 5D7JA 4E41D 3RHWK 4NNYB 2DKMA 1GZQA 2CLRA 1WZ1H 1OF2A 3OAYK 1R5IA 1V7NH 3OAZH 3M8OL 3DUSB 3WE6B 2VDRH 4EOWL 3GUTA 4TULH 5L2JB 1WFNA 2CIIA 3EZJB 1PJ9A 4N8CH 2W0LA 1VSCA 4LFHG 5DD1L 2XPGB 4MB4A 5HGDB 5HBBA 3AREC 5DF0A 2FEDD 2P48B 1KBGL 1YC8A 5MI0C 3MLYL 1EO5A 4XVJH 5T1DL 3VXMA 4YBLC 3ULUL 2B1AL 3LN4B 1CGTA 2OCFD 4V1DA 3BH8B 2C9AA 3NCJL 4N0RA 1YEIL 3CH1B 5IBUG 4N1CA 1KV3A 3SKMA 1A8JH 3C5ZD 1U91A 1EJ6A 4RAVB 3SQOL 1ES0B 2AABH 3PV6A 1HI6A 2LE9A 4F80A 1AKJD 1CICA 3CSBA 1MIEL 4J4PA 1H0DA 1HIMH 2O5YL 4NCC2 2Q8AH 4GAFB 2W60B 4LSUH 1JF6A 3V95A 5C0BE 3HE6B 5JW3H 3T2OA 2GKIA 3KPSD 1BIIB 3EOYG 1V05A 3VWJA 2V9TA 3W82A 4H8WH 1FFNA 4XI5C 5CP3H 1G7PA 4DKEH 3GNMH 3MMEB 4O2EA 4FFYH 4LEXH 3MXVL 3RRQA 1NBZB 3RWFB 2R56H 1GC1H 4BKLA 1LO0H 3TNNA 5C0IA 4OCRL 4GAYB 1I7ZA 3FQTA 3C2AL 5E8EB 4QRQA 5JZ7C 4OGAC 2VZSA 1T6WA 1YN7B 4RMVA 1MVUA 3K8MA 1Q94B 2Q7NA 3SE8L 2JCCF 3K80A 1BVKB 3UCRA 1N64L 2KQMA 3MLTB 2X4NB 3TT3L 1NCBH 2BC4B 4BH7B 4HH9A 5A16A 5MP6L 4J3TA 4YC2C 5BXFB 1RQ5A 4HIEB 2AXHA 5C09A 1FNAA 5E2UL 1HHIA 2X9XA 4HJ0C 1IFHH 3IDUA 2AJZA 4LHUD 5GGTH 2F74B 4PRDA 1WZMA 4JY5L 2BX5A 1TTFA 4S1QH 4KQ3L 3WSQL 1PDKA 3GSOB 4OZFB 3CPLA 2O5YH 4K2UH 1XT5A 4CVZA 2AJ3B 3U7YH 4XVTL 4OI9A 3KYMB 1FVCA 2H32A 2VXSL 5BCAA 4GRWB 2R0WL 1FN4B 3O2WL 1U41A 3SDDC 1GGTA 1ZLVH 2PTVA 1F90H 4XVUC 4UDTA 3PP3H 3QQ9C 1RVFH 5F6IC 2PTTA 1KJ3L 2F58L 2H45A 4LRIC 5TJWK 4JFQA 3SO5A 1LE9A 1KN4H 1HIML 3U82B 2UWEA 1FYTE 1JWUB 4R0LC 4NQCD 4BZ2H 4XCYB 1A1MA 4TULL 2VN4A 4UV4L 5DSCA 2KL6A 3RWHB 4YGAB 1P7QD 3LD8B 3ZSTA 1QSFB 5FO7B 1YEGL 4PJXB 1TETH 2BSTA 1KPVA 2IBZY 4LKXA 3D85D 3LQAC 1IGYA 3L3DA 5CKAA 4KJPD 1RZ7H 5FEBA 2AEPL 4Z7WB 4QOKB 4ZOEA 4R97C 2MQCA 5C0BD 3FKUS 2F19H 4TVPE 4YEFA 5ERWA 2ZZUT 1B3JA 1MCDA 1ZHBA 5CJOH 1Q8MA 1Q9KA 3MBED 4K94L 4NNPH 4RQQB 1P4IL 5HGGS 2AAVA 1VFBA 5FF6A 5LAXB 4JKPL 3KYAA 4JB9H 2VL4A 3IDGA 4Z7UE 1BOYA 2HAZA 3R8QA 4JZOA 3DX8A 4DN3L 3VFSA 4P57A 5DMIL 3C5ZB 4JHBA 3VXOB 4OIBA 2IPUG 3QH3B 3LVEA 1NCCL 1RUQL 1A14H 3ZKQD 1PKQE 2EDFA 5F7UA 2YRPA 1BQLL 4ODWA 4HH8A 1RUKH 2DI9A 3D2UA 4PJ9B 3VFOA 5CD3A 2X1QA 2Q7YB 4X5XA 2W0FA 5GHWH 4C4KO 5I17A 3VXNA 3IU4H 3UTTE 3P40A 3RWEA 3PWPA 2VXQH 1O7VA 4OZ4B 3TFKD 2NY5H 1C7TA 3MR9B 2YUXA 4N8VB 1R3HB 3TIDA 5J6GB 4MJIB 5IG7B 4JHAL 1OGAD 1IRAY 5ID1B 1ORQB 3BT2H 1X4ZA 1YC7A 4XMLL 3PQYD 4X6BB 5F3HA 4OD3L 3RGVB 1SEQH 1WCBA 3ZE0F 4RBPH 1CLOH 2PTUA 5AEAA 3KAAA 1I4FB 3PWUB 3PGDA 1Q9OB 4EUPG 1KULA 1LWRA 4ZSOB 1UM4L 3QUZC 4QXGL 3SY0B 3OKMA 1EZVX 1T7ZA 2R2HA 2NY7L 1T66D 3CSYA 4OT1H 2XA3A 1B6UA 4X83A 4AL8H 5HVFB 4JGUA 1KB5L 5E9DA 5K9KB 5LAXA 5FF6B 4X7DC 2J8HA 3VW3L 1I1AD 2H2PD 5IJVB 3EJZC 1XF2A 2JE8A 2IAMA 4KMQA 2E7HA 5B3NA 1WK0A 2N56A 4DWHA 1F4XH 1PY9A 4WY7H 5BVJA 5J7CC 3P30H 3IDMA 3QO0B 4OD2B 3O41B 3IS1X 5IB3A 3QHFH 4RCAA 4P4KA 5EN2A 1QSEE 3TT1L 1BFVH 2OR9L 3I50H 4WW1B 1ZA3B 3CGTA 2X2YA 4BK5A 1S78D 1M4KA 3ROOA 2B2XL 2AP2A 5FM5O 2XWBB 2GY5A 2NNAA 3SE4C 2APVA 3AS3A 1FAKT 2GTZA 5E2TH 2YPLD 4ZS7L 2O61A 1FL5A 1QFUH 2IBZX 5I73C 4APQC 1O7SA 2XQYG 3KXFB 4J4PC 5B8CC 4JN1H 4QRTB 3CD4A 4QTIH 3QDJA 1JHKH 4Q6IC 4E0RA 1AO7B 2DWEB 3QPXL 4TOYH 2Y23A 1LP9A 3QFJD 4JPIB 5IIEA 5JOPE 1FE8L 4H0HB 4HWZA 4OSUL 1UWXK 5E03A 4DGIH 3WLBB 4XCEB 1B4RA 5DQJA 3FO0L 4LLDB 1XGPB 2ZCLH 4NRYA 4NN7B 3U4AA 3KG5A 4EVNA 3PL6B 1TNNA 1JV5A 1MHEB 2D0FA 5I16B 5JW4R 1MFCL 4FNLL 3BWAB 3CX5K 1YPZA 1R3JB 1KLUA 1UCTA 3QI9D 3PWLA 1FO0H 3GSXA 3MBEB 4I8DA 4X9BA 3O9WA 1ZLSL 2PCPB 3IVKA 3S6CA 1PVHA 1QP1A 3FHQA 2VWEE 4KKBC 2WQ8A 3PL6A 3QUXC 1S7RA 2R1YB 1YNLH 4TVPD 3TVMD 4D9QE 5I1CH 2VXTH 1K8IB 3VFGH 5BVJB 5CGYD 3F12B 1QFWM 2X10A 3DECA 1CLZH 4LLYA 4XNUL 5CWSA 4P5MB 2D7NA 5EA0L 3MV8E 4G6JL 3R1GH 1EHNA 2VUOA 4JY4B 3VWJC 5A2LH 3MO1B 1NCDH 3K46A 3ZE1E 4Q9RL 2H26B 3WEXB 3KJ4B 4WTXA 3HUJF 3WXVL 1FL5B 2R9HC 3FOLB 4HIIB 3RAJH 2DLGA 3I6LD 3H3BC 5HYEA 4OFYA 3W11C 4IM8A 2OR9H 1A47A 4PJAE 4X99A 3TT1H 1A7RH 2NW2B 2P5WB 5EBMA 1IE5A 3SDAB 2AEQH 5BZWB 4QOKE 5LGJA 1MHHA 5JPMB 4W4OA 3D2UD 1G7IA 1OSPL 3FRUB 5DUPH 1BAFH 5SWSA 8FABB 1DQJB 1ZHNB 4P3DB 1AXSA 5DUBA 3WIFB 5ADPL 3BUTA 3V52L 1LP9F 1MCHA 2DBJA 3ALPA 5K9JL 4LKCB 3UMTA 5FDWA 4HBCL 3RVWD 2HRPH 1RAMA 4B7IA 5KS9E 4KU1A 4KC3B 3ZKNC 1RHHB 2HG5B 4BSWA 5HPMB 3DXAB 5IB3B 2FD6L 2I25N 1KYOK 4UILL 5J4MA 3L7FA 2JJUA 5E08H 3EYOA 5F1NB 4QXWA 3QIUB 4GKOA 4GRWE 1CGUA 1KJ2B 2HJKB 2G9HA 4R7NA 3HMXA 3KYOA 5HVGB 1G84A 5J6HA 3F6IA 3GK8H 3UPAA 2WAHA 3C5JB 2NY4B 1XFPA 2H2SC 4PRPD 4PJFE 3C6LD 1H3XA 5BQ7A 5C0FA 5SWQB 5SX4H 4Y19E 1XMWA 1OW0A 3O4LB 4EDXB 5I18L 1YUHA 1S7SB 3BX7C 3PQYE 3KYNA 4M6NH 3GO1H 2HJFA 4EVNB 3QEQE 2E9IA 2VLJB 2E27L 4GXVL 4OF0A 4KV5F 5C07D 4ISVB 3R06B 3OL2A 2KH2B 4NQED 2IC2A 3MROB 1QVOB 3AAZB 2DOCA 3HZYA 3AM8A 4HX1B 4QLRA 3WUZA 2Q76B 3CC5B 3ZKMD 3U0WL 4OI8A 2HT2D 3JV0A 4V1DB 1Z6JT 4ZUTB 2ICEB 4OKVB 3WNKA 2EIEA 3BKYH 1IM3A 1SMAA 1N4XH 3Q1SH 3RWGA 2ADFH 1J1PL 1DR9A 5DK3A 3BEVB 2BZDA 1P1ZB 1HQRA 4Q6IA 1XGYL 2ZNWA 1ZANH 3GSRB 4WJ5B 4PJ5E 3GIVB 4P2YA 1HYSD 2IPKB 4F7MB 2IPTH 2C3HA 1EFQA 3BP4B 4MNGB 2QR0A 5CEZH 2CKBH 4GXUM 5J9PA 3UTTD 1CXKA 1MCPL 4R8WH 4W4NA 3VA2C 2CUHA 5D2LB 1UH4A 4W6YB 1CIDA 1A5FH 2XRAL 3LKSA 4POUB 1NGYA 2XTJC 3DO7A 3T3PF 3IKCA 4X80H 5B8CB 3FFDB 1SVZA 2AEQL 5KN5B 4DUWA 2FATH 4N5ED 1LK3H 1E27B 2OJZL 4Y1AE 4X6CA 2C26A 4WFGD 5DUBB 1KELH 4I77H 4PLJD 5HHVH 4P4KC 3QXDA 3P9MA 1NAMB 4LAJH 1OT2A 1I7UB 3RZCB 4E41A 4ZYKA 5KTEH 5L6YL 5DJ6A 1Z3GH 3QZWB 3PDOB 5E6IB 5LGJB 4NQEA 1BJ1H 4MNHA 4AT6A 1LD9B 4XP9H 5GS1B 3FT2B 4QNPF 4CW1A 3GMOB 1RUPL 5IHZA 1WWCA 3ULVD 3QRGL 2E9WA 1YNLL 3CCHB 1A1NB 2OMNA 1RZKH 2NYYC 4CUCA 1AD0B 2VIRB 3L5WA 2YBRB 5C92A 2W65B 3H7BB 4O00A 4PJHE 5GRWA 4MXVF 4O9HL 2YD7A 4KJPC 5CD3B 3SEPA 4G8EA 2GYSA 1UWXH 4ODWB 4MJIE 1OP9A 4MJ5B 2MJWA 1E28B 3C5JA 1ZTXH 3QJFB 4QRUA 5J9PB 4GBXB 3LQMA 3C2AH 2EH8H 3FO9A 3QO0A 5CSZB 4JRXB 2X4SA 1U91B 2VJXA 1AR1D 2CD0A 2PW2B 1KJ2H 4NJ9H 3WJLA 3WS3A 3ETBF 4RGNE 1ZXQA 3V4UL 4TNVF 2NY4D 3HAEG 1I7RA 1JRHL 3WV0A 1MNUL 3O9WD 2D9CA 3ZE2F 5F7LB 2QHRL 4YK4B 4UB0L 2VLKD 1I7TA 2UZYB 1ZHBB 1B0GA 3LEVL 3EJJX 4I0PD 5HYIA 4NM8L 1NCAH 4O51B 4K3EL 4FXKA 3IFPB 3RY6A 1I9JL 4HUKB 4IMKA 2DDQH 5C0AE 2VLJD 2F53A 4NFCA 3U4BL 2FX8L 2H8PA 4DUXA 1UB6A 1REIA 2YWZA 1OP5K 3JWOC 5C0IB 4UT6H 1ZGLM 3HC0B 5HYJA 2QHRH 2C4XA 1DVFB 4G43A 4N0CD 1G7HA 3HZKA 4PTTB 1TZGL 3JV4B 4ZDHB 3FCTB 3CFIC 3DROA 1A6AA 2BSRB 3E6FA 2MMXA 5E99H 3MZTA 4XNZC 2PR4H 4ODHL 4PJCA 1NL0L 4E42A 5HYFA 5E00B 3H0TA 1RVFL 1QSEA 2B5IC 4NN6C 4I48A 1H3UA 4I18C 1N6UA 2YD5A 5C0CE 1CXIA 5KVFL 4JPWL 4QXGH 5C09E 1TQCB 4BH8B 5B3JF 4KAQH 2EE2A 3TJEH 3CPLB 4OJFL 1N64H 3FB6A 3BW9A 4Z7WE 4EUPA 1IM9B 3ELAT 4QRTA 2H3NA 1U9KA 3PIQB 1UM6H 4XMLH 1FNSH 5D2NE 3EOBA 3KXFA 4KMTH 3JWDC 1YNKH 4HPOH 1PKOA 3HUJE 1K8DB 4XTRD 3V7AG 1F3JB 3BIKB 1SHMA 5C0DB 2FL5B 3RU8H 1MH5B 1A6VL 4LLYB 3IU4L 3QCUL 4FFWD 5MI0B 1XGPA 3MLZL 1EMTH 4K55A 5BV7B 3DGGB 1G7IB 2MKLC 4G6FB 4OLUL 4YO0A 3HPLA 4EDWH 4U6YA 1TENA 4ZO6A 5SX4I 4QHMA 4KKLC 5DSCB 1OAXH 4OF8A 1INEH 4KVCL 5J06A 3EYUL 3NFSL 3OKOA 2EDDA 3ESUF 3F5WA 1KB5A 2XNAB 5CAYB 3C8DA 4YHZH 3LHPH 5ICYB 1BZ7B 4Y19A 3MV7E 1MCPH 1FFNB 1ZAGA 4JO3L 4LEOB 5IVZA 3QJHA 5ETUA 5T3XH 4MA7L 4PIRF 3OX8A 5E94A 2Z91B 2A2QT 4DGYL 1T1ZB 4M6AA 3MXWH 5FM8A 5I9QB 2VWEC 1CG9A 1Z0MA 2YPKA 3IDYC 1A7OH 2DQTH 4UOW0 5MEPB 3LN5A 3ZDZF 1YN6B 3H3PL 1ZA6B 2P1YA 4X80L 2XZQL 4LVHC 3PV7A 2NTSP 4Z0BL 1S3KH 3X11B 5JORA 3DBXB 3NFNB 1JZ7A 4KI1A 1IKNA 3MRBB 4DFIA 2IF7A 3G6AA 3OAZK 4M3KB 5DEFA 1A7PL 2CDGA 5DJAB 1TQBC 4WCYH 4KDTC 1FO0B 1T1XB 2PKDA 2XN9B 3V5KA 1NGWA 4M6OH 3SJVE 1RK0A 3MBEA 1FORL 2YD9A 1EGJL 2A6JA 2ED9A 5E2VL 4ZFGH 4UUJA 3G6AB 3UO1L 3GSNH 3SDDA 3EZ8A 3KYOB 15C8L 1N8ZB 4Y4KA 4P3CH 4XHJC 1MHPL 4O58L 1QRKA 2XTJB 4LLUA 5FYKL 1KJVA 4NQDE 3WJLC 3PWVB 4XPAH 4YJZL 1R3LA 1Z9SA 1LK2A 1G7JA 4XCYA 2EEDA 5HPMA 4NQSA 2BVPA 1BJ8A 4XWGH 3OPZL 2NY3C 4D0BA 5A2JH 4LVOC 4OGAD 3GSNA 1BREA 2ZJSH 3X3GL 3RZCC 3DROB 4AG4H 2CDFA 4P59H 5BRZE 1KCUH 3VI3F 4JQIL 4NFDA 4WO4B 5JMRA 1BPVA 4UU9A 4OZGA 2OK0H 3BPOC 3C8HA 2P8PB 1RIHL 2R0KH 1MFAL 1DEDA 3WNPA 2FRGP 3IB4A 2P7TB 4MQ7B 5FYKU 4NOBA 4I0KA 4GG6F 5IF0B 3QIBB 5KZCD 2HRPL 2F5BL 4WHDA 1MH5A 5D96B 4M6OL 4XX1E 4JFZL 3DRTA 1K6QH 5IVZB 1JPGB 1NMBL 1X7QB 2I24N 3QNZB 3OJMB 3DVNB 4X7SH 3MV01 3CFBA 4MSWB 4ZPTA 5CGYC 5C09D 2DBLL 1ZHLB 3NA9H 5F7YC 1NFDF 3G5YB 7FABL 4IMLB 3QUXD 3V4VH 4EXKA 5C0NC 1ED3B 1U0QA 4CN6A 4PJBA 4I77L 1RULH 4S1RL 1RSFA 2NZIA 3L9RB 2DLTA 4H8WL 3CFCH 4WUKH 4NSKB 3MRRB 4FQ2H 3VGDA 1H3WM 3WXWL 1UM5H 3DUSA 4P57B 1MI5D 3JTTB 3WL9A 3QHFL 1BBJB 1W0YT 5F7NC 4MQXD 3NZHL 5JLZA 2YKLH 4F15C 1LO4L 2A1WL 3VXME 3NN8A 2QQQA 5CCKH 2GI7A 4D9LH 3MGOB 3P11H 7CGTA 3VMOA 4I13B 3HFML 4NQVB 3MRMA 5BW7A 3G9VA 2EYSA 5HDQL 4MNQB 1S7XA 3W9DB 4G8IA 1OAYH 2LABA 3BN9C 3V6BR 5D7LE 3OBAA 1SJHB 4ODVH 3QBTB 3LDBB 2BC4A 2X4TA 4QKXB 3RAJL 1OT1A 1Z5LA 1I9RH 1AP2A 4XH2A 1NAKL 1FJ1B 2D3VA 2GQHA 1H0DB 1BM3H 2KQNA 4XC3L 5CIPH 1LP9B 3L3HB 4FTVE 5E6IA 2LV4A 2VAAB 3AUVA 3N1QC 1N4XL 3OTTA 2OR8A 4U3XA 3DVGB 4YHLH 2DTML 3MCKB 4XCFH 3HC3H 2ZUTA 5AZ2H 1G9NL 2IALA 4OZFG 1QNZL 5GRYA 3VFPA 1HCFX 4HV8A 4ZMAT 1RZGB 2XKNA 1ETZB 3G04B 5ICXB 4QY8B 1IJ9A 4OBRA 1LD9A 1CYGA 4MNHB 1B0WA 1HHIB 4AT6B 5FGBA 3KPTA 4G7VL 2VAJA 3GMQA 1O5DT 3U7AA 4XAKD 2PW1B 3B5GA 5BRZB 4YFLI 4I3GA 4MD4A 4HC1H 5DURB 3HE6A 3RL1A 4AENB 4KZEH 1RUKL 4N90E 5J1SC 4KZEL 1ZK9A 1GZPA 4A6YH 2UY7A 4M6ML 4POYA 1QTYT 2EDLA 1DBKL 3C60B 4G7YH 5F6HJ 5IBLC 5KVMC 4LLMB 1R5VA 4X4XA 3QUYA 4LRIA 3ZO0A 4ZXBD 2AV1A 1I7ZB 5LCVL 1OQXA 2Z4QB 3L95A 2HFGH 1HNGA 5FXCH 5CSGA 1SJVA 1U8JA 3BKML 5EPMA 5JHDD 3WJJA 3AREB 1I9EA 5ADPH 4OM1L 4ENED 4FZ8H 1IGJB 3AXLA 1F42A 3EO1B 4JEGB 1C5CH 4X4MA 3WS3B 3TBTB 3L7EB 3WO3B 1KN4L 4P2QB 1AIFA 2AKRB 3BVNB 4HGWB 2AJXL 2V7HB 5JNYA 2YEZB 3FQTB 3BMWA 1AQDB 4YHNA 4MJ5A 4JFEE 4LVOB 1FFOA 5HGHA 4I1NB 3L3OA 3NGBC 2XZAL 3V52H 3H6JA 4DAGL 2VLJA 1E27A 2OZ4H 2J8OA 3MV7A 4HS8H 5ACZA 1KG0B 3E6FB 3RKPA 1S5IL 3IU3A 5ESQA 3HA0A 1R5WA 3LEXB 1JTPA 3TJHD 3ULVH 3CCHA 1IGCH 3QNXA 4HEPG 1U36A 4NZDA 3QUXB 4JY5H 4WDIB 4LAQH 2EDOA 4YE4L 2VLME 2DQFA 2BNQB 5FCSH 2Z8RA 5ENWA 3WD5H 2AGJL 4POZC 4G80B 1QZ1A 5F1SA 2G9HB 4OIAA 4NKDB 3U36B 3QIUA 3H2WA 3VXSE 2JB6A 4Q6IB 1U8KA 1QA9B 4PGEA 5B39A 1E4KC 1QBLH 4KVCH 2HJLA 5D1ZB 5TQ2H 3RX7A 4WFED 3T65A 1N3NB 1J7VR 3VG0H 1MCOL 1VA9A 5EBLB 4HKZA 1EFXA 2QSTA 1DBAL 2VDNH 3MLZH 3U48A 4Z7WA 4OSUH 2Z8VC 5K9OB 2DI7A 3WE6A 5IK3B 1R5VB 4X4XB 1T03L 1I3VA 4MXQD 1KELL 1GCFA 3T2NL 4PYHA 4GKZB 1QQDB 5GJTH 4K94C 2BY2A 1PLGH 1ZT7A 3QUZA 1F11B 4JR9L 1FZJA 4NOFA 1KTKE 1M6OA 3MRKA 1MAML 2N4IA 1OTSD 3TO2A 3LSOB 1GJIA 4OI7A 2R4SH 1C1EL 3QAZC 1AD0A 5GISL 2VO5A 1A64A 1LO0L 4MCYA 4KROC 3TNMA 1A5FL 1YMMB 4PLKC 3ULUD 4XNMA 1GGCL 3KPRE 1DANU 3KPOB 1QFPA 2ICEA 3LRSA 3KYKH 4YHNB 2BXZA 1A2YB 3BKJH 4XPHH 3RVUC 3PGCB 1CF8L 1PKQB 1QVOA 4PS4H 3KWWB 5T33L 4CVZB 2ZSVB 1W8NA 3QXDB 1JGVL 3MGTB 1INQB 4Y5VB 2VLKA 4NDMB 4X8XA 4Y4FB 5I75C 1T04A 4P2CG 3U0PA 2P4AB 5LXGL 5ALCL 3VFRB 3HAEB 2YA1A 4JFPB 5B8CA 5D6DA 2DD8L 1MEXH 3CDCA 2ATPA 3ZLQC 3QUYB 1E4WL 3U2SA 1KB9J 3BH9A 2G60H 5D7IA 2VDQH 5E5MA 5MEOB 3MLRL 1IC1A 4FTVD 4YHPB 4P2OA 4M61A 2EC9T 4JFOB 2ZG3A 1JV5B 4M5ZL 1EHLL 4UDUB 2ZSWB 3MFFA 1INEL 1BVKA 5MEND 3HNSL 4MMZC 4NJAH 5HYQB 4K3EH 1IC4L 3VGBA 3KPNA 2C3VB 4KJYB 4GO6B 4YHKL 3LMJL 4GG6A 1ZHKA 2E9JA 4NPYB 5KSBE 4R97B 2ZUSA 2GSIB 2OSLB 3JWOH 4PJ9C 1AO7A 2WW8A 4LHJB 4NHCH 1DL7H 5L9DH 1FNEB 2QQNL 3VGAB 3T04D 1EPFA 5FV1L 3QUYC 4YBLB 1GGCH 1D5IL 4BSVA 4OGXH 3EYVB 4NKMB 4HJJH 1P84K 5I1DA 3FONA 4PLKD 3RWDA 3PL6C 4XNZB 4L4VB 1BVLA 4LARH 5K93A 4U1MA 1HHKA 3RVTC 3C5ZC 3W81A 4BYHA 3NIDE 1ZVHA 1ACZA 5DJYA 3TBWB 5IWLA 4NYLA 2FJGB 4C54A 1P7QB 2DWEA 4WW1A 3VD7A 3WKMH 3O3BA 3C87A 1V3MA 3BO8A 3JV6B 1HZHH 4JO2H 5IFAH 4JPWH 5D5MA 4U05A 5BZWA 3RNKA 3MNZA 4F57L 4JHZA 2MCPH 4X9IA 5FECB 1RHFA 4H88H 4IRJA 4GOSA 2K7PA 5IHBA 4GKNB 1KUMA 2ZCKL 1FNSL 1WC7A 2FCBA 2RFXB 4P4RB 3ARQA 1CTNA 4M5ZH 5ECJE 4JFHE 3TO4D 4CNIB 5KSAA 4LVNC 3WCYA 2G75A 5JUEL 1K4CB 2R1XA 3D9AL 4PJEE 4ONHA 8CGTA 3B8SA 4Y16D 4OCYL 4WFFE 2XWTB 5DI8A 4KK5C 3O3AB 4DAGH 5DGQA 5HJ3B 2APWA 3EFDL 4EN3A 1R24B 1SQ2N 1WITA 1WF5A 1UEYA 4AEIL 3ARPA 4YWGH 2O26U 1UGNA 4MLSA 2RAMA 5DK2A 1P6AB 1RZJL 2IBBA 5IFJA 5DUMH 1G7MB 3DARA 4PRHE 2JJWA 3NIGF 3G5VA 2AXFA 2PCPA 3IVKB 4JQVC 4IRSB 3MUGA 2GEEA 4RAUB 4FTVA 1OCWH 1B0RB 5I1KL 5BV7C 1CZ8H 4NO5B 3BZ4B 2CKBL 2PUQT 3O0RL 1FCCA 5IW1B 4JFFE 5I1AB 2XA8L 4HCRH 4Y1AD 4HWEL 3EDFA 5FV2A 3IRZA 4K71C 2J8UF 4N0UA 4PBWD 2A9NH 1X3DA 4FQXD 3TH4T 1YMME 4X0KB 4N5UA 2Y25A 4A2LA 3T4AB 4YC2B 2MQ3A 4FOMA 5FOBB 2E7LA 2ARJQ 4Q0XL 3HRZA 1A6ZB 2DICA 3U6RB 3RNQB 4WRLA 2NX5B 5HI4D 4P46A 3C6LA 4JY6A 5E9DD 3T0EB 4KDWA 2Q6WB 4PRBB 1T03H 4RGOL 2VLRA 4FG6D 3QDGA 4TUOB 2RCSL 3TIEA 3QI9A 3LRHA 5L2JA 1NBVH 4JG0H 3CFEB 3SHSA 1S7VB 3UJJH 4Y88A 1MWAA 1M71A 2NW3B 3VXPB 5HI5C 1N0LA 4Y5VC 3N06B 1KIQA 3O4LE 2IMNA 2WQRA 2X70A 3N1GC 4IOIA 5FYKD 1RPQA 1QFUL 1DVFC 2J8UB 1NBYA 3OXRB 4GRLA 4ZS7H 1K4DA 1DCLA 2EO1A 3GHBL 3ZKMC 3VXRE 2CKBB 2WWMC 1XF2B 2EH7H 1V8HA 5KSAB 2DLFH 5GRUL 1JF5A 4N1HB 1HH6A 3SQBA 1PEZA 3N1MC 3BH9B 1BFVL 1EFXD 2KZWA 4RMRA 3UTZB 3S36L 4S2SB 4NP4H 1Y18B 3SGJA 1ACYL 3P77A 3OXRA 3U79A 4OZGE 2AJSH 1BD2E 2OMBA 3VCLA 3KR3H 5EU6A 3C08H 3KS0J 4YPGB 5EU4B 4XNYH 4NCC1 5AAMA 4XP4H 2BHYA 5FUZH 1S7WB 4HIXL 4L9LA 4Y4KD 2XXMB 1N59A 1EHXA 3SDDD 1WAAF 3DX8B 2AXGB 5C6PB 2B1AH 2DYPA 3VFVA 4XPFH 5ICYA 2H6PB 2G75B 3L3GB 3CXHJ 3HNSH 2Q6WA 2BP3A 1UKQA 3B8YA 4I3SH 3UAJC 2CUIA 3TVMC 1NGZB 3WUWG 4JPKL 3O4OC 4HAGA 1OTSC 4Y5XA 1QR1B 1S7UA 1WBXB 3INUL 1UWGH 5DD0L 4G6ML 5INCB 2Q7YA 4ALAH 5C8JA 5HDOA 5IV2A 1NEZB 1HILA 2NY6C 5TH2B 4ZUWB 2AXFB 3O2DL 3T4AA 3O6KH 4JFEA 1L6ZA 4N8PA 4WI5A 2EKJA 2FX7L 3JV6A 4S1RH 1T5XB 3EGSB 3EYFA 3JXAA 2UV3A 3QWRA 1JNLH 4R2GC 1YYMH 4PGBB 2NXYD 3KLHC 3D0VB 4R9HA 2GK2A 4NO5A 4GAYA 5DFWH 1IBGH 5I2IB 4KUCD 5GRZA 5F96H 5L8KB 4FXGB 1OB1A 4H1LB 4RX4D 3H9HA 4IOFD 4OFYD 3EDKA 4XPBH 5HI3C 5AD0A 4HPYH 3VXTB 4LCWA 4Z95H 3PGDB 2WK2A 3RX8A 3QUZD 4F15B 3IDYB 4HHAA 4ZO8A 1YEKH 1FZMA 4WHYH 1I7RB 1YEKL 1TJHL 5DMKB 4L1HA 1AI1H 1Q9LA 5C0RH 5ACMA 1FSKC 2Y06H 5LGKA 3FO9B 3KLDA 3QXTA 43C9B 2BNQA 4PY7B 3MYJA 3X3GH 1NMAH 3B2UC 3LPFA 1P7KA 2ZCLL 3FO0H 3KPLB 4JQVA 2Q86B 4BZ1H 5I15L 3H7BA 5E2VH 3HTLX 1N5YH 1G7HB 4HIEA 1UXWB 4JG1H 1YEGH 3D69B 1MJ8L 1MLBA 3ES6A 5CMAA 5C08B 2FO4B 4NQTA 1IGML 1U93B 3MRLA 3UDWA 3RJDA 1S9KC 3RX5A 4YDJA 5IMLB 5TPWL 4AIZB 4RISH 3W0WA 4MNQE 3FB7B 2P24B 3UZQA 3O3DA 1R3KA 2AK4E 4WO4C 4XP6L 1I1AA 5KSBF 3KPMA 5JO5A 5I1EL 4Y2DB 1OAZH 3RZCA 1BD2B 5K33A 32C2A 1F4YL 3S37X 2DF3A 1UKTA 5KOVC 2HN7A 2OTWA 3WHE1 4YQXH 1D6EA 4XBPB 4Y5YC 4QHKI 3BD4A 4M61B 4PJ8C 2AJZB 2HVKB 4FG6C 2NY7H 4UIMB 3HE7C 1HHJA 1GOFA 5LKNA 4QYOB 2CSPA 3QXWA 1QO3A 4P2RB 3V5DB 3MACH 2BERA 1HN1A 3S96A 5ANMA 3PQYA 4LKXB 5C07B 1FH5L 4NPYA 1T04B 4C55A 2AQ2A 2J6EH 5GGSB 1W0VB 2V2XB 3JTSA 4HUWA 4U1SB 4GKZA 2V17L 4NNXA 1OAKL 4KKAC 5CJQH 1NSNL 4P2OB 1ZS8A 5BV7H 5E5MB 4RX4A 5FUZL 5I1IH 3CDGB 4Y5XC 2FSEB 4F37F 1P2CB 3VGFA 3DVIA 2I5YL 2JIXB 3D18A 1M1SA 5EU5B 3QDHA 4FQHB 1J5OL 2HN7B 4M1DL 4HKBA 5FO9A 1HKLH 2LVCA 4JLRB 1UZ8A 3H9SB 4ZPVB 4PV9A 1B4JH 1RMFH 3QHTC 4D9RE 5EWIL 4L9LB 3UTTB 1R0AL 2XI9A 1LO2H 1JUFB 1A6VH 5CBAB 1T0NA 4NKIH 4YLQT 4G7YL 1ES0A 2V5SA 3G6JA 4K3HA 5I30H 5IR1B 2EDQA 3AB0B 5CEZD 5HY9B 1ZSDA 1L0XA 4FZEH 4LSSH 1IAIL 4X9HA 6CGTA 4JJHA 4O58H 3RGHA 2PYFA 5F6IB 3IFNL 1OPGH 4NBZB 4DEPC 3T08A 1DP0A 4UIMA 4S1DC 2VE6B 1LQSR 2PR4L 3BGMA 1T0PB 1N5AB 5SWQA 5C0FB 1H15B 4NUJA 1DBJH 5I66B 4GKSB 4XWGL 3MTRA 1F8TL 4OAWB 4PG2C 4HWEH 1J12A 1X9QA 4FFVD 3UBXG 1E4WH 4RGMB 4FQ1H 3IT8D 1W0VA 3JTSB 3KPMB 1P5UA 1WZKA 4U1IB 1G7MA 1VFUA 4R7DA 3HC3L 4JFYB 2NY3D 2WLYA 5DMKA 1PY4A 2AKRA 3H9SA 2BMKA 1GZQB 1A3QA 1EVTC 1K3ZA 4D3CL 1F13A 4GKSA 35C8H 1KBGH 3EHBD 4Z0BH 4JFED 4ODHH 2XWTA 5DI8B 4QT5B 4C4KT 5CEXA 4GG8B 1NAKH 2I9LA 2AEPH 4OKVA 1YQVL 4NKOA 2F15A 3F65A 4EBQH 4R90L 1NPUA 2PO6A 4RA3A 5IEHB 3CU7A 3GMLA 3MRIA 5GSRB 1QA9A 2D7OA 3S35H 4QHUA 5JO5B 1MJ7L 2CH8A 5C0GB 4PJAF 3T0XA 4X6CE 1CFQA 5K9QG 4DZ8B 3UYRH 2GFBA 1HQ4A 4K2UL 4U3HA 3LQAH 5ISZD 4WV1B 4HSQA 3HNVH 4EI5B 3S36X 1XEDA 2APFA 5ANMB 1MIML 3IFNH 5FK9B 5I8EA 5C3TA 4HBQA 4Z77B 2X9WA 4R96B 2ZKHL 3CLEL 5GRUH 2ITCA 4PV8A 3FQUB 1FP5A 4XXDA 1GGUA 2IANA 1LO2L 1WIUA 5HHQB 3HE6C 2VDNL 1ZS8B 43CAB 1S9VA 2VLMD 4OZGF 4XCNB 3NFPB 3CX5J 1U8QA 5IB4A 4NC0B 2BJMH 3RWCB 3HC4L 1ZVSA 1FL6B 3IRPX 1YEDA 2Z35A 1QBLL 5DMGD 1X5XA 3QFDA 4I2XA 4PGJA 5LBSL 2DLFL 5KTEL 3GMRA 1U8OB 2ESVD 3C9NA 4H20H 1OTUC 1VGEH 4Y4HB 5GJSL 2VE6A 4ZNCD 5IBLD 3WKML 1G7LB 4MAYD 1DL7L 4J3VA 5L9DL 2GTWB 5GGSY 1KTLB 4OCSH 2AI0H 2DQHH 3MJ9L 3CFBB 1NANI 4F7PA 2ENYA 2JIXD 5EZJA 1W2KT 3DRTB 4HK3J 5FUCE 2VDPL 3WLWC 4JN2A 5HYJD 2GIYA 3QWRD 8FABA 2FHFA 1XIWB 1K4DB 4OZHB 4AEFA 4FMFA 1EDQA 3DX9B 1KNOA 5HHXH 3RKDC 1QRNE 4X6DE 3FT3A 5ALBH 2NY2D 2P7TA 4LEXL 2GFBB 3NACH 3TH3T 1TJGL 3CLFL 5C2BH 1EERB 3T2QA 1T22B 4RGOH 3MV8D 4F2MA 3DO3A 5DK0B 3DV4B 1Q0YH 2IAMD 2EDEA 4HIIA 5GRVK 4M7KH 4RGND 3MCG1 4JKWA 5ID0B 3DX9A 5HDBF 1NFDB 5BVPH 1MI5E 3KPQB 2E7CA 3C8KA 3IDXL 1F45A 1KLGB 2CR3A 5D1XD 4JY6B 4O4YH 4LRNH 2IALB 5FDYA 3GFUA 3MCKA 3MLRH 4J1UB 5TQ0H 3LEVH 5D7SH 3PWPE 3F12A 1OLLA 1I3GH 5D7JC 1D9KB 2XZAH 1IQWH 3MJ7A 3FOMA 3BN9D 5TF1H 1MWAL 2IPTL 2IANE 4N0YH 1Z5LB 1KNOB 2FX9H 2Z35B 3P73A 4YIQB 2D2OA 3ILPA 4LSPH 2HFTA 2Y4SA 3O2VH 2E27H 3DI3B 1B0RA 1DFBH 3VXTA 3QI9B 1C8PA 5M94B 3H9SE 2GTWA 1P4LB 4L29B 4PJ7F 1S9WB 2AK4D 1NGPL 3H9ZA 5D7IF 1FGVL 4GRLD 5EIQA 4AJ0A 2HT3C 5CHNB 3DVNA 3OQ3B 5MP6H 4OLXH 4A2MA 2SEBA 1P69B 3NACL 4PJAA 4AM0A 3VRLE 1J9CT 4OF3A 4FHBD 3FFCB 5C6TH 3I6KB 3V0VA 3PWJA 1WCBB 1FSKB 2ILLA 1KB9K 1RIVH 4F9PA 5I8KH 1CDIA 1ED3A 1MPAH 3T2PA 2XY1A 5CUSL 2L7JA 5F96L 2G5BB 5FGCE 1J11A 3TIDB 4YHOL 5JW4N 5J6GA 4QNPE 3QCTL 4U6TA 2HT4D 1JNNH 1OL0A 3HE7A 5CLWA 2X44D 3U1SL 1G9EA 4N0CC 4PY7A 2ORBH 4MJ6B 3NFNA 5MENE 3DPBA 2YN3A 2DM3A 3CVHH 3CAFA 2ZPKL 2DJ4A 4PJGE 1IAMA 3OB0H 3RTQC 1YA5A 5MEPA 2V7HA 3ZDXF 5JNYB 1CK0H 1NMCB 3WFHA 2JB5L 5DMYA 5E8PA 5AUMA 1L7IL 3TZVB 3HMWH 1GHFH 2CGRH 5IWLC 3GEWB 3PE9A 3OHXB 3BRFA 2AERT 2ZKHH 1GSMA 3AXLB 2OP4H 3EO1A 4ODVL 1P4LA 4L29A 3UTPE 2B4CL 4CNIA 1EBPA 4MXWL 2CIKA 5FA4B 4L8SB 4P46B 4XVJL 5DD6B 5T1DH 1MCEA 1VEMA 5IP4A 3GGWB 4EKXA 1NGWB 4PRAA 1DQMH 5JQ6H 3EYFB 5J56B 5ID1A 3QIUC 1U42A 3K1DA 1J10A 1G7QB 4BFIA 5I73B 4F7CB 1AC0A 2VLLB 1T83C 1D3CA 4ZAKA 1CLZL 2DQFB 4CVXA 3BMVA 5DRWB 4UI2A 2NW3A 2R4RH 1XF3B 3ARFD 1MJ8H 4XB7A 4JG1L 4HZAA 3HB3C 1DQLL 2XIDA 1YQVH 4IJ3C 2PYFB 5ISZE 4PB9L 3SJVD 1FPTL 3MREB 2EDKA 4GS7C 1ADQH 5EUKB 4RISL 4K3JH 5IMKA 1WT5A 4FZ8L 5TFSL 1GAFL 4ODSH 5I18H 3V0VB 5C0CD 3PUCA 3SKNA 1MFDH 2LU3A 4B0MM 4OB5L 1SY6L 1QOKA 4NZJA 3VG9B 3NCBB 2VKWA 4P23B 3EUUA 5DVKA 3QZWA 4LP4A 3KYMA 3BRGC 2VAAA 1I7UA 2A83A 5B3JE 3I3BA 4HUWB 4U1SA 5FO9B 4K7PX 4Q9QH 4XPAL 4F7EA 2P5EA 5IB1A 3RHWF 5J1AB 2A6KB 2W1NA 1B0GB 1ZLWH 3MV7D 2DQUL 2YD4A 2E7BA 4PJDB 2HLFC 2F74A 4PRPA 4NQCE 3OKLA 1NLDL 4M48L 3DIFA 5KVEL 4FQJL 5ITBH 3HG1A 4IEFB 5FGCB 1JN6B 3TGXA 4IOIB 2IH3A 4GW5B 2X89A 3FOMB 4OLVL 2OX5A 1H8OA 1OARH 4FFZH 3ALWA 4X6CF 1QNZH 1D5XB 3BPOB 1I9IH 3VJ6B 1A1OB 3ARTA 5T5NG 4YHPA 3V6FB 1YN7A 4NSKA 2EXYD 4N0FB 1KOAA 1LEGA 4QYOA 4I18A 3MJGX 4CN1A 3JZ7A 4NZTL 5C7XH 4U1LA 5FYLD 4HFUL 4ZFFB 3HE7D 5CGMA 1A7OL 2DQTL 1FORH 3UTSB 5CGTA 3HS0B 3VI4E 1ONQB 12E8L 1WV7T 1KC5H 1CXEA 4UQ3A 2M2DA 2A38A 2QHLA 5L2KD 3SO3B 1DVFA 3V4VL 5L8JB 4ONOA 1S7WA 4DKAA 2GSGA 4GBXA 5A43C 3VXRB 3ULVF 5DQ9A 1U8NB 2HVJB 1KENL 2X42A 3MACL 1QEWA 4QRRE 4XH2B 4I48B 4BQ9A 3D48R 3SDCC 5JIIA 3CVHB 5IK3A 2CXGA 3DX6A 5D72H 5BOZG 3MNWB 4KRNA 1S7SA 2ATPB 2IQ9L 3KJ6H 3PABB 3UTOA 3OGOE 5E8OB 4HXAL 3LSOA 4PTTA 3BFOA 3NABH 2JB5H 1XCTA 4XZUA 1J1PH 2NR6C 4PRNA 1DLFL 5T3ZH 4Y5VA 2NTFA 5BS0B 2VXUH 1BD2A 4XCCL 4Z7OF 3F62A 2EYRA 4HD9A 3T0EE 2UWEE 2DLEA 3O3UN 3IDJB 2PW2A 4QXTA 5I1JL 1LEKA 2EC9U 1V3KA 3WBDA 3O4OB 2Y06L 3WFEH 1L0YA 4L1DA 1IQDB 1H5BB 1F4WL 1CQKA 1UB5B 5SWZD 1VGKB 3LAFA 1N6QL 4U7KA 5LQBL 4UT7L 3WDHA 3S5LB 1MCLA 4R3SB 2IGFL 2R0LH 2WWKT 4A6YL 4WEMB 4J23A 4YHYC 4KJWD 5H35A 5I71B 4OM0H 1YNTB 1JZ6A 5HHOE 4Y4FA 1MLCB 3HZYB 1TXKA 2XTJE 2BOCB 3CZFB 5FYLL 1RUQH 4H0GA 1JUFA 4PB9H 2R0ZL 2Y36H 1FZKB 1KACB 1QRNB 4X6DB 4F7CA 4PLNC 2XG4A 4UQ2B 3BJ91 4OZHE 4S11A 4XHJD 4N0YL 3SCMC 1NFKA 4O2CB 3ZKXB 2ZG2A 2APBA 2YPKB 5D1ZD 4NO0B 4UT6L 4GRWH 4BZ2L 5LGHH 4KKAD 3I75A 15C8H 1DFBL 5ESAA 2HWZL 2GW5A 2VXVL 3F7YA 3RJQB 5A40E 1FFOB 5HGHB 5JMOC 2CIIB 5E99L 5D7IE 3KPSA 3EYSL 3VW3H 4E5XB 2RB8A 5IKCA 1TVDA 4IIQB 3A6CL 5FYLE 1Y6MR 1H3PL 3WS6C 3BVNA 4H26B 4UMGA 3THMH 3UBXB 3D6GA 4TYUA 1WFTA 2IH3B 1FNGB 2BCKB 3R06A 1BFSA 3QEUA 2YA0A 4ZQKA 3PWPD 4WU7A 4X6CB 3RPIB 1OSPH 5BRZA 2GY7B 3QUKA 4L8CA 2HFEB 3SCMD 4OCLC 4D9QD 2EC8A 2I07A 5TDOA 1U3ZA 3BUYB 3QI9C 4X6EB 3VFRA 4HWBA 4JR9H 4TTDD 2HLFD 3WIHH 3JUZA 3CK0H 3QDGB 1N7MH 4UB0H 1T1XA 4HMCA 3VGHA 2HJLB 3KDMA 4WI4A 2HLAA 3N9GL 1RULL 5KSVA 3A6OA 2P8LB 3X12B 2X09A 3WJJC 1QHOA 4X7CC 3BESR 3CMOL 3RTQD 3RU8L 3FFCA 1J1XL 3MRRA 5ENWB 4B53A 4F7MA 4P48A 5BOPA 2ZUVA 2X4OA 4PJGF 4KRPD 3HUJB 3TP4A 3ZTJH 5DZOA 4EDWL 5EU5A 1TJIH 3OX8B 5E94B 3F7VB 2V9RA 3DMMC 1C16A 4OLVH 3U1SH 5EOCJ 4DVBB 4TVPH 2J3SA 1JYWA 3EYVA 1F3DJ 5DJ0A 1BIHA 2DQCH 1RIHH 2R0KL 1RV6X 2UYLA 2FEDC 4XAKE 1MELA 4PBXA 5MENB 2JF1A 5F9DC 2R23B 3LCYA 5ADOL 2ZJSL 2X70B 3O41A 1BZ9B 1SJEA 2H9GB 3VD3A 3GZKA 5DVLA 4WEUD 4QEGA 4GRWF 1TETL 3W9DA 4GMSH 1MWAH 4G5ZL 3O0RH 5T1KA 3RUGE 3LKQB 3LKOA 5DEGB 1KIRA 4L4TD 4WCYL 3DETC 2RFXA 4P4RA 3P0YL 4Q2ZA 5I2IA 5IESH 5CJOL 2RHEA 5IMOA 1BWMA 1NCWL 2WUCH 3TA3C 2AXJA 2CLZB 2D0HA 4MWFA 3X13B 2FHBA 2VN7A 1ZMYA 2FJFB 4HIJA 3IJSB 1VESA 4RZCB 4DCQA 4Z78A 4QRRB 1YEEL 4NO2A 2HFFB 1DN0A 3UDWC 3STZA 4NYLB 4PG2A 1NGZA 1CDYA 3H0TB 1F4XL 3DTXB 1FQ9C 1X7QA 3NFSH 3EYUH 1FVEB 1VKXA 5CP7A 4WIQA 4HAFA 3EO0B 3NPSC 2AK1H 2NY1D 1X5ZA 3K81A 4NN6B 2B5IB 3P4OB 3TF7C 2IBGA 3BKYL 3RNKB 1XAUA 4BSVB 4NO2B 1DUZA 5F7FA 3M8OH 5GS3A 4ZFZB 2W0PA 4Z18A 5KW9L 2DKSA 1F3RB 4P5TA 4J3UA 1EAJA 2VXSH 1M05A 4HG4J 2IFFH 1FZMB 4UT9L 4FQPA 3HR5B 1B6DA 1FJ1A 5TE6H 3O6ML 3RKDD 2EXWC 1RUMH 3RVUD 1YDPB 4BUHA 3ARBB 5HHMD 3RDTB 1JF1A 1OB1B 4H1LA 1URLA 3SGEI 5E5UB 2DQIL 1S7XB 3F8UB 3LKQA 3LKOB 3MRQB 3JWDL 3L3IA 4OIIH 1IC7L 4YEEA 3I02A 2DIBA 2XN9A 4ETYA 4BZYA 3GRWL 4KAQL 1DJSA 4I9WE 4UT9H 3VFNB 2J88L 1IT9H 3WD5L 3QCTH 1XF4B 2IJ0C 4ZUUA 2PXYB 5JW5B 2W91A 5CINL 3EOAA 5C08E 4ELMA 1D5MA 3GI9L 3GMMB 3LKRB 5TQ2L 3MR9A 1NKRA 3FTGA 3DYPA 3QWOB 5D2LF 1RK0B 3T0ED 3LDBC 1CFBA 3VXSA 1P1ZA 3QG6A 1PSKH 4ZOCA 2ARJA 1OGTB 3Q3GA 4XVUD 5FYJH 1C5BL 3QT2A 5J89A 3BZEA 4FQQB 1EUTA 5KOMC 5IW6B 4PJ9A 1T1YB 3VFOB 1LDPL 1HH9B 1JWMB 3ARDC 4D0DB 1I4FA 2OL3B 3VXUA 1U3HD 2NYYD 4PJHF 1LO3L 1NGXB 3B5HA 1FH5H 1AIFB 3HG1D 4GH7B 4KY1L 4PJEB 2R1WA 3PGFL 3T09A 1R3HA 3P4OA 3Q5TA 3RIFK 4QHNB 3L3KB 5D7KE 5IB5B 3QDGE 4LCWD 4V1DE 1HYRC 2GTZB 1EFXB 2GJZB 1U8JB 5EPMB 1OARL 3ULUE 3MV9A 4ONGL 3L5XL 1LE5A 4TNVK 3S34H 1BFOA 1WWBX 1N5YL 4EEEA 5FFLA 4OCXH 4J8RB 1VPOH 1YMMD 3NCCB 3T0DA 4YO0B 2R2HB 3RFZC 4P5KB 2YK1L 4Z78B 3QA3B 2AV7B 5DHYB 5MEQA 1AXIB 4WEBL 1UB5A 5TPWH 2OJEB 4OKDA 1MVUB 1YN6A 3C60D 3LS4H 2BVUA 1CLYL 1AY1H 5JHLL 4JFFA 3GSRA 4LSRL 4WJ5A 1JWUA 3O3EA 2EIBA 5D2NB 2ED8A 1BOGB 2EYRB 4LEOA 2M8XA 3T0EA 4OB5H 1YEFL 3IFLL 4ZS6C 1DQTA 3H42L 2NX5A 3WFDL 4HPYL 3AMKA 5ESAB 5ACLA 3FQRB 2ADJA 3TBSB 2CJUH 5KANI 1AD9B 2HTLD 5T5NF 1EX0A 3VRIB 2NXZC 2XZCH 5F89A 5HYSG 2YZ1A 4MS8C 3FN3A 3SBWA 1IAOB 4ESKA 2QLVB 4KKCC 5DD3H 3ZHKA 3TYGL 3QDAA 3CMOH 1CD0A 3L3OB 2BRRH 3RUGA 3BPNB 5F21B 1U3HA 5GJSH 5JIHA 3BP7A 2AJ3A 2ERJB 3TCLB 1U8NA 4OZGB 1NUDA 1FE8H 2B2XH 5IW1A 2H8PB 5K9QI 3QRGH 2OJZH 1MHHB 5JPMA 1A1MB 5IVNA 1JGUH 1WLHA 5EO9B 3RQ3A 3VE0A 5L2KA 3SDCD 3VFSB 3VGAC 1RURL 3ZMRA 4HKZB 5F72S 2PTTB 4KHXL 5EZIH 2FEEI 3F7RA 3RVWC 2I5YH 5GSVA 4JVUA 1LO3H 4FFYL 1U3JA 2P5ED 5JXAL 1RD6A 2VZUA 4HXAH 4PJEF 1JGLH 1UT9A 3QULA 3UROR 2HKHL 2OR7A 1JHTA 4M1GL 1GHFL 2CGRL 3IFPA 3IDJA 4QXTB 3IETB 3EYOB 2FIKA 1GZPB 3UEZA 3ME0A 4GQPH 5MEOA 1X5YA 3NIDF 1CFTB 1G6RA 3I2CH 4R8WL 4RMQA 3KPRD 3QB7C 2VIRA 3NCJH 4QY8A 4AIOA 3BKMH 3WXWH 1WUNT 1MJ7H 4JFHD 3HZKB 4A6YA 2YC1B 4IRJC 5D5MB 5I1CL 3RWJA 3A6CH 4GRLC 1FVDA 3TO4B 4QHNA 3BO8B 2D03H 4PJXA 4Q9CA 2OZ4A 4WU5A 1T7WA 4BH8A 1U3HB 1DEEB 3DHMA 4GXVH 5EO0B 4ETQA 4UNUA 1OSZA 1CDGA 1XGUB 2J12B 3IKKA 2V6HA 3K4ZA 4HFWB 3RA7H 3T77B 4ZTOH 4U1MB 5DJCA 1NMCC 2E7MA 2X1XR 5E8NA 4PGCB 2XQBL 3QEGH 5F7EH 3QAZB 3IXAB 4JRYA 2DRUA 4QF1A 5KVDL 4OUUB 2XKUA 3RL2B 1RJYA 5FYJU 3TCXA 5JR1L 1LHZA 3F5WB 5B38B 2X9YA 1OGTA 3Q3GB 1F8TH 1K2DA 2VQTA 4WENB 1EUUA 1OGAB 5KVEH 3W2DL 2VDLL 2FBJH 4JFFD 4KK8D 5F97E 2P47B 3RGVC 4ZAKC 3HPLB 3DX7B 2R9HD 2W60A 1KCUL 4PP2A 3IDNB 1ZA3A 2C1PA 5E08L 5E8DL 1QSZA 4RFNC 2GITB 1S9XA 5I9QC 4UNVA 5FHBH 1U8IA 3SN6N 2PYEE 4P2RA 2X6MA 3U2SB 3CH1A 2FO1A 3I85A 4MQTB 5DT1L 4HCRL 2GJ6A 2EYTB 3MV9B 1DN2A 1G6RB 1NBZA 4V2BA 2NX5D 1ETZA 3VXQA 3PJSA 3CNKA 1NGYB 4YXKH 2M1KA 2DQGH 5E9DB 2XT1B 3L6FB 3MV8A 3MUY1 2XWJB 3MLXH 2Q20A 3P11L 1S7QB 3VWJB 3DBXA 4QGTA 4MNGA 3NABL 1OP3H 4AIZA 1J8HA 3PWUA 4CMHC 4LIQH 4LLVA 5I6XC 4MGXA 1WCQA 3L5XH 2LFGA 4WHCA 1OY3B 1FL3A 4DKFL 3RWFA 5CIPA 1T1ZA 4YHIB 4PY8J 1WAAE 1R6VA 4G8GD 3RWJB 4YXLH 4G9DB 4MJIA 4W68A 3EJZD 5IG7A 3S4SB 4YHZL 5DS8B 1A7PH 1H3GA 1X5LA 2G2RA 3PGFH 1CS6A 5LJYH 4FA8A 3PABA 4OFIA 4D9LL 3W9EA 2P44B 3SDXF 4JO4H 3TO2B 3LN4A 4I0CC 1FNLA 5SV4A 2Q3ZA 1G9MH 4YX2L 1JPFA 2FGWL 1KJMA 1K6QL 5EC2A 4RGMC 1J87A 1DN0B 5EUOA 5FIEA 2OP4L 3LIZL 1KGCE 1LK2B 4ONFL 5DJ6B 1AHWA 3P4LA 5CSBA 4LIQE 3MLWL 5FYJD 1T5WA 3BJLA 1HINH 3T3ME 2FIRT 1QPXA 4JM2F 4Z7VF 5GRXG 5AG8A 1JWSA 3SDDB 4POZD 4Z7UB 3AU1B 4DZBA 1G0YR 4KQ3H 4QOKD 4PJ5D 4IRSC 3GSQA 3UXFA 1MRDL 2VDPH 4PJBF 3OKKB 5EORH 5IHUL 1KIRB 3UJJL 4L3EE 1T83A 3KPRB 4H88L 4UBDC 1YEFH 3I6GA 1F6AA 4ZODA 3ILQD 1G7JB 1X5FA 4DK3A 3FQNA 4BQ8A 2X1PA 4PP1C 3B9KC 3D5OF 2COQA 3LPGA 3EOAB 3QIBA 4CGTA 4MQ7A 1QBML 5LBSH 4NNYA 5DHVB 1TITA 2R1YA 4ZFZA 3LMJH 1U8LA 3PG2A 4LPUA 4IRZH 5JHDE 1L7TH 3MJ7B 1RIUL 4Y5XB 3LV3A 4PJCF 4WGWB 5CILL 4M7LL 3BZ4A 3QO1B 1G6VK 1MCWW 3LQAL 2V2TA 2XY2A 4KVNL 1K5NA 3ROLB 5D70L 4PJ9D 4Z5RA 2OTUA 1XGRA 2IH1B 5CKGA 3BZFB 2EDNA 3DTXA 3Q2CA 3OKYA 4LGSB 5J13C 3SDAD 1JF1B 1PQZA 1U3HC 4JDTL 1FGVH 1IQWL 3VXSD 1OCWL 4JN1L 4XCEA 2WLZA 4GBXC 4YHKH 4PRPE 4ODUB 4HK3N 4KY1H 4X5WA 1OD7A 1WQVT 4LLUB 4JREB 5JQ6L 5F9WC 4XVSL 3E8UH 1XCQA 2ESVB 3UP1A 3W39A 1CXFA 2PXYA 5IW6A 1A6UL 5LVEA 4GAJL 3RGVD 1S78C 4HXBL 4G8IB 1J0IA 1YEJL 5I19H 3HZMB 1YEJH 5GZND 5I19L 4PJ5A 4QHLA 3T8XA 4NN5B 5FYJL 2A77H 3L3IB 4JFDD 5TQ0L 4EBQL 4X98B 1W8OA 2B20A 3ZZ1A 2VNCA 3S37H 4D9RD 1OP5H 1NGQL 3I9GL 5FUCC 3V4PL 4FABL 4YAQA 2EH8L 3ZKXC 4W6WB 2R2BB 4NHUA 1UYWH 2CK0L 3GMRB 2O5ZL 3O3BB 1QSFA 3MOBH 3QRFM 1RK1B 4X8JB 4F3FB 1NKOA 1T66C 3GDBA 4ODUA 4JPVH 1KCKA 1C5BH 4X99B 2MPAL 4IIQA 1A9BA 4L8SA 5DD6A 1AQKL 4Y2DD 5IQ7H 4TVPL 2ZOLA 1QR4A 3TLRA 4N8VG 1GVIA 1QD0A 5T1KD 2JJVA 3FQWA 3MJ8A 2R39A 1A6AB 2BSRA 4DTGL 1CGWA 2EE3A 3DV6B 4QGYA 3JV4A 3STLA 1DQJA 2X89D 5DJXB 3BP7B 4P2QE 4E9LA 5I74B 3QHZH 5L0QB 2R23A 4RFNB 1BLNB 3QFJB 5B21A 2ZUXA 4PRHB 1DBBL 1CE1H 1KXVC 2VR9A 1NGPH 3VRIA 3VG9C 3BSZL 5L8LB 2OS7A 4LASL 2R69L 3PHOA 3LEYH 2MQ0A 2XN9E 4PJ5B 4QHLB 2GJ6D 2AEIT 5J0BA 1XR8A 3I9GH 3V4PH 2EDRA 4L4TA 1G7LA 3DO7B 4PJDF 2R8SL 2RCSH 5D1QD 4AIXA 2NY6D 4LU5H 3GI8H 4GXUN 1SM3H 1YDPA 2BVEA 4H1LH 3QEQB 3K2UL 5BV7L 3IETA 3D39E 1AFVH 4FQCH 12E8H 2F8OA 2VABB 2CLZA 3MYZA 3TVMB 3HI1A 4I3RH 4WNQA 5SWSE 3HNVL 4PJ7A 4G9FB 1ZGLB 1S9VB 3HHRB 4U1GC 4UV7L 1NGQH 4JAMB 3S37L 1R3IH 4G8EB 4CMMB 2XRAH 2DM4A 4GQ9H 5HGBA 1Q38A 3REVA 3TC9A 4K7PH 3DUUA 2DQGL 4XB8A 3GBMH 3G5XA 1OAQL 4CVWA 1TCMA 1CDUA 3QWQB 2ICWJ 4EQ2A 1WZ1L 3VD5A 4FQ1L 4UOJA 3RZCD 3RGVA 4NRYB 1FFPB 3X17A 3FZUD 4JRXA 3AAZA 1A6UH 3UYPA 1C08B 5F7DA 2P5WD 5GS0C 1E6OH 1IKNC 4HIJB 4ENEC 3QPQC 5DQ9B 5L7XH 1JI2A 5I1GH 4UTAH 4E0RB 3ZT7A 4U1HA 1FO0L 1BBDH 4OM0L 1CF8H 1MLCA 1T1YA 1UA6L 3GM8A 4MJ2A 3U0WH 1AD9A 2YD2A 3AY4C 4LCUA 3SJVA 4YR6A 2JTDA 1A1NA 5FYJE 2O61B 2PO6B 3GI8L 2EDBA 5T1MB 4YDKL 3WFBL 4PGEB 5I15H 4Y8AA 3LKPB 4BZ1L 4HW6A 1AGEB 4X8JA 4F3FA 1T7VA 3T77A 3PDOA 4IMKC 1S7TA 2H32B 4XPGH 5JIKA 3GO1L 5CZXC 4ZYKB 2JJSC 1ZT1B 1IGYB 3L3DB 2VL5A 4ZTPL 5EBGA 2J4WL 3SE4A 4H5SA 4LLWA 5HD8C 1J5OH 1NC4D 1SMOA 3QJFA 4TNWF 5FO7A 3ZKSD 4PREB 2X4PA 4G7VH 4HDIA 1A7NH 3HG1E 1TDQA 3QQNA 2NXZD 3CVIL 4JO2L 1F6LL 3A6BL 4GMTL 1N5AA 1QFWI 1EIBA 1RHHA 2W65A 2UZIL 2E7LC 1EO7A 1AJ7H 1PX4A 1T21A 3BPLB 2P8MB 3V6ZB 1RZ8A 2R4RL 3B9KA 3U0TA 3S35X 3U0PB 3O2DH 4P2RD 5IT2H 3HRPA 1L4IA 4Q74A 4L8DB 3LS5H 2IEPA 1P7HL 3FB6B 5AZEH 3IAPA 5JDSB 4U2YA 4LLVB 4H26A 3J8F7 3QH3A 3C09C 3NPSB 3BHBB 3WIIL 4ONFH 1FLRH 1P9MC 5CEZL 1A7RL 1Y6NR 3MRPA 5IFHL 1QYGL 4PRHD 4U31A 5MERB 4XXDB 2BFVL 3M17B 4HS6A 4A6YB 2AJXH 3I75B 1S9YA 3W9EB 1AGDA 2ADFL 4FFWC 4JRYB 1BAFL 4Y4HD 2NNAB 5DUPL 4LCWE 4V1DD 4ZDHA 5DD1H 4MAYB 4NN7C 1JL8A 1MSPA 4JM4H 3SDYH 2E9BA 3KPLA 2OZ4L 1HDMA 1WGOA 4NQDB 1QFWL 2NY6B 4ETQB 3S5LA 3RVVC 4LSTL 4P5MA 3RWIA 1TQBB 3MBXL 5DJ2A 3HC0A 5HYJB 4XPFL 1WBZA 3ILQC 3Q5OA 5CD5D 2N7AA 4YNYA 4OBSA 1V7ML 5D7JD 4PD4J 1XF4A 4LVHB 4ELKB 2NY2B 1QBAA 1CFVH 3C08L 1QUNA 1HHGB 3DGCR 4PJCE 2V5TA 4K8RD 3W11D 5D1XC 3ZYZA 3GSQB 3M45A 4HMEA 3PXJA 5IEHA 1RZGA 4S1DD 3A0OA 4YFEA 1IAIH 3VDCA 3BWAA 1IGMH 1JPSL 1RU9H 1FFRA 3P3YA 1NCCH 1HSAB 1V3JA 4LSQL 3FB8A 3EFFB 4HUVA 1NCNA 4M8VA 1OOAA 4U1HB 1U8PA 1MCKA 4KRLB 1ZHNA 4LSRH 4P3DA 3VXRD 5BZDB 2R4SL 2X4UB 2ID5A 3FB7A 4M6MH 3DI2B 2X1WL 3ARXA 4XAWH 5ICZA 4WW2F 3EGSA 4OZIF 1AP2B 3RWIB 3HNTL 3QDJB 4GW5A 1QSEB 5FCUL 1Q72H 4YHMH 1FHGA 2WBWB 2NY5C 4K94H 3MLSL 5TE4H 5IOPB 3RA7L 4D8PB 1IGTB 5EU6E 3GJEB 3P2TA 1NEZG 1DLFH 1KGCD 3D69A 5T3ZL 5E95B 3BH8A 1BQUA 1CR9H 1MQ8A 1S9YB 1FYTA 5DRNB 3MC0A 5EO9A 3S4SA 1H8SA 4KKCD 2Y72A 3WUWB 2FBOJ 4CKVX 4EQ3A 1P7KB 3QDMD 2GK0A 4ZOAA 1TVBB 5JPNB 1IMHC 5D72L 5DTFB 5BMFL 1BOGA 3DSFL 2Y5TB 3AVEA 1EO8L 4PGCA 2V17H 5HGDA 4P4KB 4FQIH 3LRGA 5CZVL 3P30L 2WIIB 2FD6H 3I6KA 2BVQA 4L5FH 4RMUA 1UZ8B 1IEBB 4U6VH 3GBNH 1OW0C 2MKWA 3X13A 4NGHH 1OF2B 4LGRB 3OJ2C 1FFQA 2BNRB 1ROWA 3MRCA 4AH2B 3PJSB 1QBBA 5GSVB 3JUYA 4UINL 4Q2ZB 3ALXA 3ZE1F 5DEGA 1OAYL 1KF9B 4HGMA 3O9WB 3MO1A 5DVOA 4HFUH 3DX6B 3DLQR 4XMKH 5K59E 1LP9E 4ELKA 2NY0B 5EOQL 2EIDA 2A6KA 1A21A 2DQJH 4QRUB 2HKFL 1QRND 1U8MB 4C56D 5DO2C 2OXGA 3B43A 4YGVA 4LLWB 2JJSA 5CS7A 3O8XA 3VXRA 5IT2L 4XP1H 1NUGA 4HUXB 3IF1A 4FQXA 1WISA 1LDPH 4QRQB 5HYSB 3PQYB 4WO4A 5KANG 1IAIM 3JWNC 4JE4B 2EH7L 3CSGA 5C0ND 4MQSB 3NAAL 4OCYH 3L5IA 4NBYB 1MJUL 1NCBL 1I1AC 2H2PC 1AGBB 4YZFF 3TYGH 1QSFE 1C5CL 2BVYA 2VOTA 3CVHL 2PF6A 4J3SA 4F8QA 2V2WB 5DQJB 4FQIL 2Q76A 3CC5A 3HNTH 4Y5YA 2ADGA 1LEGB 4JFZH 1W0WA 1VDGA 4M1CD 4JM2D 5JDSA 1E4JA 3ISWA 4MB5A 1NCTA 1X6NA 3ECBA 4HJJL 1X5AA 4LCCB 1M05B 3NVQA 1PYWA 3QCUH 3DWTA 4HJ0D 2ZUQC 5DDHA 3X3FL 1G9NC 2V7NB 4PJXE 2D7TL 2BHUA 5FYKH 2F54B 4L9LC 2HTKC 4N9GB 4AQ1B 1BQLH 3GGWA 1JGEB 2H1PL 1Q9KB 3DMMD 3FTGB 3QWOA 5BXFA 1I8LC 2X5PA 3ZSSA 4J6RH 3STZB 4KHTL 1AXTL 3OGCA 4HZLB 4RWHA 4ZFGL 4LSVH 5JXEC 3OPZH 4HUUA 2F5AH 1RZIA 2VLLA 1WFOA 5AAWA 2VC2H 1DQDL 4ZUUB 4I4WB 3WFHB 2YHGA 3TPUA 4TUJB 2HMIC 4K23H 3T0AA 5E6IC 1J05B 3QCVH 4XNQB 1DUYB 1MFBL 1GOHA 4KI5F 4M3JA 4P5TB 5IB4B 1ADQL 2NTFB 1IC4H 5BS0A 4G6FD 4GUPB 4K8RH 5IKCB 2Y7QA 5DD5H 1ITCA 2FJHA 1T3FA 3KVQA 3SBWC 1ZHLA 1UG9A 4U1JA 5DZLA 1MVFA 1T0MB 4QRSA 2H41A 2IANB 3BYYA 3OF6D 2FECI 3P0YH 1FZOB 3ARBA 5T1LB 3RDTA 1BFTA 2VDQL 4G9FE 3CXDL 1QLRB 3FT4A 1PZUB 2K9UA 3PF2A 3SE9L 3SPVB 1AXSB 3WIFA 1U95A 2BSSA 4TVSa 3CMGA 3HMWL 4IRJD 1LO5A 1I3GL 3QQ3A 4QWWD 5I8EB 2JK5B 5E1AA 4ELMB 3VH8A 1JVKA 4PY8I 3VU2A 3CIQA 1L0QA 1G7QA 4BFIB 2J2ZA 2EDXA 1C1EH 2F58H 4Y4FC 4GW4B 5KSBA 4ZUWA 3IAQA 5C8JB 3GSWA 1KPRB 3MXWL 1I8KB 1QKZL 2W0KA 4F57H 1A4KA 1QHPA 3T3PE 4ZFFA 1PSKL 3V4UH 2ZOKB 3L3GA 2ARWA 3VFVB 3ZHDA 2E6JA 1KCLA 5ERWB 2E5EA 3LS5L 4M4RA 2X4RA 1OAXL 2BJML 3BPNC 4CVUA 5GGUA 2XOTA 3QEHB 5C3LD 1TCRA 1AHWB 1UJ3B 3FN0L 3RIAK 2XTLA 2BSTB 4OGYL 5DRXA 1NBVL 4RMTA 1RUML 2XFXB 4QRRD 2X05A 2WBJB 3F58H 4K07A 2VH5L 2HYMA 4GS7B 5MENA 1BFOB 1FBIL 5D71L 4DJMA 2IG2H 4YK4C 4RQQA 4LQ1A 5J12C 3WS6A 2Z93B 2YZ8A 5CJQL 4JZNB 5CBEB 5D2NC 4JQIH 1FYTD 2G2RB 3BGFC 4G43B 2DL9A 4NJAL 4HK0A 2YPLA 3G6JE 3CFJA 3BE1H 4ERSL 2V7NA 4OLZH 1CBVH 1RZ7L 1EBAA 1KT2B 4Z9KB 1JYVA 3UC0H 1ZVSB 4N5EC 3MGTA 4S1SL 1CG9B 4FQXC 2QQNH 2Y07L 2X4RB 1YEIH 4LCCA 4MYWB 3FQWB 3MJ8B 1VHPA 1QKZH 3BQUC 4OLWL 5EUKA 1BZ7A 4Y19B 4RMWA 5EU7E 5DYOB 5J1TC 1RJLB 2D7MA 3ZE2E 4LRNL 3UO1H 4LSUL 1ORSB 3D18B 4LOUD 2YUWA 1WZLA 4RFEA 3C6LB 2H32H 1S5IH 3DV4A 5C09B 1FN4A 2BRQA 2BNQD 4NZRL 2HFFA 4Z76B 1HOCA 4OF7A 4PG9B 5D4QA 1YZZA 4X9FA 5C0CB 2AJYL 4X7EC 1MREL 1VFOA 1Q0YL 5FOJA 4GW4A 5CSZA 1CD1A 5DXWA 1A1OA 9CGTA 5KSBB 2WBJC 3C9NB 1U8OA 1FZJB 2VLRE 3Q6FA 4KTYA 2A74A 2WP3O 3P9WB 4K7PL 4HXBH 4I5BA 2MHAB 2Q8BH 1Q94A 1WEJL 1GXEA 1UJ3C 4HJGB 1MCSA 4CN4A 5GGSA 4P5TD 4O4YL 3QIWD 5IVXF 4AY0A 4Y16C 5C07A 3RP1A 3CDFA 2BSED 5EZJB 5C70A 4I3RL 3HZMA 2BDNH 4LMQE 5MHSD 3REWB 1FGNH 2IAND 5B38A 1F4AA 3EOBB 1PLGL 5DMJB 1Z0NA 3OJDA 1D6EB 4XBPA 2KZ1B 4CW1B 1NAML 2MFNA 1PZ5B 1VGEL 3VFUB 3RY5A 1HE7A 3OAYH 1T0NB 1DBAH 2R8SH 5JW4M 4M43L 4LPCA 5EO0A 1LEKB 5IGXL 1B4JL 1TJIL 4K3GA 3VD4A 1KCRH 1NAMA 4DOHE 1MRDH 1KTDA 3SDXB 4K7FA 5E8DH 5JDJA 4XWOC 1FVDB 2WZPD 5CP3A 5HVWA 4O5LH 3MFGB 1EMTL 5F70A 4WWKA 1OTTC 5E8OA 4LCYA 2AVGA 5JHDA 2HA1A 3WUWA 1YMMA 4J7RA 3OJVC 1MCFA 4WW2C 1CFTA 4QRRA 2NZ9D 1YMHB 4U6HB 3CLEH 5CIPB 3AS1A 4BH7A 4KJWC 4P9ML 3MLTA 4LAQL 4NWTL 5L88H 1CICB 1UCBH 4AMKL 4ALAL 3U4EB 3INUH 1LVEA 1EZVY 3CZFA 3HFMH 2Q8AL 5EFIB 1JZ8A 3M1BB 5E2WH 4O51A 4CJ1A 1FIEA 4DQOL 4JREC 4KRPB 3H9YA 4R3SA 5C0JA 1Q1JH 4DKFH 3V79C 3TBYA 5F1IB 1UFUA 4JQXC 4RRPG 5K9JH 4KK6D 5A1AA 2O5ZH 1FLRL 3MNVB 1HNFA 4QWWC 3ZTNL 1OAUL 1U8HA 4MAUH 4FMKA 2P42B 2VSCA 3PWNA 2E8YA 2Q1EA 1D5BA 4L3CA 3E3QE 1CT8A 1U8IB 1KPVB 2XXCB 4WUUB 1TPXB 5FKAB 3LZFL 4TSBL 4R4BB 4IS6B 3NIGE 3MRDB 4P2QD 2IQAA 5GS0H 3BKJL 4XPHL 4GJTB 5J12B 4O2FA 5SWZB 4P9HL 1NC4A 4MMXC 3G5ZA 5C9JA 4L3EA 3FB5B 4OLYL 1NEZA 3EO9L 3ZT5A 4R90H 2PW1A 1YUHB 3HLAA 5FHAL 3F7YB 1QR1A 1I3UA 1EEYB 2R0ZH 1JGVH 1AC6A 4FQJH 5IW3A 3S4SG 3HI5L 3WHXA 5D9SA 1ZGLP 4UDTB 2H1PH 5CEXB 4XRCA 4HV8B 2PXYC 1MUJA 2VDKH 2VLKB 5FGSA 1J0YA 3O3EB 4FN0A 4XNUH 4XGZA 3W5NA 5MHSE 3OSKA 1QSVA 1H3VA 2VC2L 3VWKB 1CIUA 3UTQB 2XKSA 2YS4A 2FLBT 4WI6A 3SE3C 1DSFL 4KK5D 5C0AD 3F7QA 4ODXA 3MA7A 3HCVB 1IGFL 1MUJB 2VZ1A 1FC1A 4NO0D 1JN6A 3LS4L 1D5ZB 4QTIL 1JZ4A 3QXAA 1RJZA 2DQUH 4IRZL 5D7KD 2C3WA 2VISB 4OQTH 2VDKL 3BUYA 4X6EA 5B22A 4OQTL 4GG6E 4S2SA 5GZOD 1I8MB 1IARB 5FA3A 3UJTL 4IDJL 5DLMH 3FAWA 3GSNL 3H42H 4N1EA 3F7PC 1IL1B 3D0VA 5EBWB 3PNWB 2A9NL 2CRZA 3K3QA 5IBTH 1NH6A 3K0WA 1DSFH 4NC2B 5F44A 4OQTA 3GM0A 2QADB 2BK8A 2A6IA 2J5LC 1SYSB 3DX7A 4IS6A 5KVDH 3BDXA 4WFHE 3KNBA 1CZ8L 1D9KA 4KDTA 4Y16A 4NFBA 1HQRB 4M93C 5EBMB 3S8WA 4P5TC 4HHAB 1L6XA 3VRLF 2BVOA 5BO1L 1S7VA 1I3RB 4TPRL 4WTWA 3TIEB 3ULUC 2EDYA 3MRNA 3NZHH 5INDA 1JJUA 3HPJA 3AROA 5D9SB 3V8CA 5TGBB 3VI3E 4ZD3H 3S7GA 3VGGA 1OTUD 2E8ZA 3LIZH 2Q86A 3QNZA 2MSPA 2FATL 2QJDA 3TH2T 3ULSB 3CVHA 4P23A 1R3KB 3WIIH 3FQXB 2EXWD 4KTDH 4DQOH 1QG3A 3D9AH 4PJFB 2N7BA 5JUEH 3L3JB 2JELL 3QP3A 3R0NA 2YWYA 4XMKL 5E5RB 3RPKA 5F89B 3BPCB 3CDYA 4ZXBB 5CJ5A 4NWTH 3WDJA 4M9PA 2ICCA 5E1AB 2JK5A 1Y18A 3IFOA 4R0LB 1JIBA 3B9EA 4F9PC 5JHDB 1T2QL 4WGVB 2XYCA 4MA8H 2X4QA 4LDLB 2JCCA 4R6UA 4U1LB 1X5GA 5IBTL 3QHZL 5DWUL 4NQVA 3TBYB 4QRPD 2OK0L 1JHTB 1U6AH 3P0VL 3MZGB 4KHXH 3AM8C 5KG9A 2IMMA 4IDLA 2ENSA 1EEZA 3BP5B 1PD6A 4LLAA 1SEBA 4PJHA 2ATKA 3SKUD 5C6TL 1LGVA 1D5IH 5F7MC 3V5HB 1UWEH 1HILB 2RQ8A 4ODTH 1S7UB 1WBXA 2A0LC 3AB0C 4GRMB 4FS0A 2VLRD 5IVXA 2GJZA 3DETD 4MAYC 3TZVA 1NBQA 2A6JB 3OKDB 4JFDA 1WTLA 1INDH 1FLTX 4P3CL 2AJVH 1YNKL 4HPOL 1UH3A 3HRZB 5HY9A 4KGLA 2R1WB 4XAWL 5KAQF 2HVJA 1FPTH 4Y89A 4FABH 1DLHA 1MF2L 4DW2H 2OQJB 1X5KA 1JNLL 3IDMB 4OD2A 3WFBH 4HIHA 5GIRA 3L3JA 4LDEB 3VH8B 4ONGH 4ZPVA 3ULUF 2HH0L 4NRZB 2FECL 5INCA 4JLRA 1TNMA 5EU6D 3D0LA 4HS3B 1NDGA 1QFWH 5EUOE 4JJ5A 3FOLA 2PNDA 1TQCC 4RFOH 4JO1H 1MHPH 1CICC 1BVLB 4KXZH 2BDNL 4OCMC 5D5MF 5M7QA 2H6PA 3ARGA 5H94B 2GT9B 1T20B 3HI5H 1F4HA 3LH2L 4UV7H 3SDCA 5GGQH 1IKFL 1YJDH 4MCZB 5EU7C 4KRMB 5I8CB 1ZWIB 2KBGA 1AO7E 2NR6D 1NC2B 4M1GH 2I27N 2OJEA 3BN3B 2FX9L 4RIRA 3AS0A 5F9AC 5HI3D 4AEIH 1QYGH 4CVXB 4KJQD 3I50L 4XNQA 1AFVL 1N0XL 2QTEA 4FQCL 5JW5A 4MQXC 1XH3B 2MHAA 5GPRA 2N1KA 1B2WH 2NXYB 4MJ6A 1CK0L 1DLHB 2W9DH 3LZFH 4J8RA 4TSBH 1QPPA 3P77B 3MRFA 1X4YA 3ARBD 3RDTD 1BF8A 4JGJA 4GLRH 4R2GD 4U1NB 4RDQG 3QIBD 3I02B 1A02N 4RIRB 1A6TB 3TN0B 2HMID 2R69H 5H37H 4HLJA 4IRSD 5GGRA 5IFHH 1JPTH 4HJGA 2VLKE 4ZUSA 5T3XL 3BPCA 3RZWA 4KUZH 2C5DC 3K4AA 2DJUA 2DYPB 2P5EE 3HUJA 4EI6B 4AH2A 3PIQA 3QFDB 1PFCA 4I2XB 2ATKB 4K9EH 1EEUA 5IROA 5TDNB 5E7FA 3KR3L 2YXMA 1I1FB 4MB3A 2A73B 3T0WA 1X5IA 1BQHB 5JA8B 4LASH 4KMTL 4DUVA 3X12A 2FLRT 3D87B 3P4NA 3V7MA 3CX2A 2CDEB 4F7TB 4OCSL 5INDB 1YYLL 4IOFC 1ZLWK 4PJCB 3WNOA 4E42B 1FIGH 4JKKA 1C5DA 3GNML 2YA2A 3O45A 3IFOB 1F00I 1XF3A 2VH5H 2VRAA 5GHWL 5HHOA 3CU1A 4YHOH 1BMGA 4XP5L 4DKDC 2OSLA 4K7FB 4CDGC 4MA3A 5JW4Q 1KEML 1BQHG 1F3DH 1X44A 4M03A 4WI2A 1I1YB 2C3XA 5GRJL 4BSJA 4OCXL 1R24A 5TE6L 4QCIA 3MRJA 1ZWIA 4LCWB 5K9KA 5CFHA 5ITFB 2XA8H 3KLSA 4Z7NF 4NHCL 4AK1A 2VZOA 1K4CA 2R1XB 4G8GE 4UZGA 4AZ8A 1K8DA 2C3GA 3NH7H 4D0BB 5KSAD 1Z9MA 3G5VB 1P4BL 1T0MA 3LQZA 1BEYH 1KPUB 3IS0X 3NCMA 4KFZC 3D0LB 4HS3A 4NC1E 2VXVH 3O11B 1MHCB 2XZQH 5DK0A 3C09B 1A9EB 3MLXL 5FECA 1CFSB 1TPXC 1OWWA 4PJGA 1EEQA 1EXUA 3G08B 5I76B 1JK8B 1HHHB 2R2BA 4NHUB 1T1WA 4GT7A 2R0WH 1MREH 2YOCA 2W38A 3EO0A 1SBSH 2FJGA 4N0UE 4WY7L 3GJFK 4LU5L