3L5WI

Crystal structure of the complex between il-13 and c836 fab
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
101
Chain Sequence
b'STALRELIEELVNITQAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C836 LIGHT CHAIN
publication title Human framework adaptation of a mouse anti-human IL-13 antibody.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 26
structure length 101
sequence length 104
chains with identical sequence J
ec nomenclature
pdb deposition date 2009-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 3l5wI00
3HMXB 2IL6A 2INTA 3VA2A 5C7XA 1BP3A 2O27A 4PS4A 4FA8E 3NCFA 1INRA 4GRWA 4NI9A 3UX9A 3UF2A 2D9QA 1IARA 3G9VB 1PY2A 2H24A 4DOHA 1HWHA 1M47A 4J4LC 4ZS7A 1Z7CA 4ZF7A 2D48A 1PGRA 4YUEC 1M48A 4O6KA 3SE3B 1HULA 1ITFA 4YPGC 2Q7NB 2LMSA 1AU1A 1ITLA 1V7MV 1J7VL 3MZGA 3UEZE 1RFBA 1KF9A 1LK3A 2L3YA 1EVSA 4Z5RD 3WCYI 1V7NV 3EJJA 1HGUA 3LB6B 3Q1SI 1M4BA 1WU3I 3S9DA 3HHRA 1RHGA 1BCNA 2GMFA 1D9GA 3LB6A 1A7MA 2Q98A 3BPNA 1VLKA 3BPOA 4X51A 3NCEA 1YKBA 3QWRB 1CN4C 2L3OA 4O9HA 5LQBA 1Z92A 1ETEA 3NCBA 1IK0A 1F6FA 5D72A 1AX8A 1HIJA 1EKUA 5D70A 2CYKA 1NBPA 1F45B 1FG9A 2HYMB 3N0PA 4NEJA 1IRLA 4NI7A 1CYLA 3SE4B 1AXIA 2B91A 4WRLB 3QAZA 1BUYA 1EERA 4YDYI 2B8YA 1IL6A 1QVNA 3BESL 2ILKA 3QB1A 3INKC 1RW5A 2B90A 1JLIA 5D71A 3D48P 5L6YC 4RS1A 5KNHI 1I1RB 1ITMA 3PIWA 3DGCL 1B5LA 4MHLA 1BGDA 1BBNA 3G6DA 1LKIA 1CD9A 4CNIC 5E4EA 4I77Z 4YQXA 5D22A 1M49A 1GNCA 2B5IA 3D85C 1M4AA 1M4RA 1CNT1 1M4CA 2B8XA 2B8ZA 3D87A 4NEMA 1A22A 3NCCA 1PW6A 3DLQI 1N1FA 2LAGA 1CSGA 1HWGA 1Y6NL 3B5KA 3L5WI 3N06A 1FYHA 3OQ3A 3BPLA 3UF5A 1GA3A 1RCBA 2E9WC 3DUHC 3EW3A 1PVHB 1HUWA 1Y6KL 1BGEA 2O26A 1ALUA 2B8UA 3NPZA 3QB7A 5FUCA 1EXZA 1P9MB 5D28B 1HZIA 1SCFA 1ILKA 1EMRA 1LQSL 1IJZA 3L5XA 5FHXA 1D9CA 2KZ1A 1ITIA 1Y6ML 3QT2C 4NKQC 3PIVA 1HIKA 2ERJD 1BGCA
chains in the Genus database with same CATH superfamily
2IL6A 4JR9A 5C7XA 1BP3A 4IKVA 3HOZD 3UF2A 5A2NA 3I4ND 2H24A 4DOHA 1M47A 4BBRD 4XNIA 2JA7D 4ZF7A 1PGRA 3WDOA 4O6KA 4YPGC 1ITLA 1RFBA 2L3YA 2JA8D 3EJJA 3I4MD 3LB6B 3HOXD 1BCNA 1D9GA 4D2DA 3BPNA 2R93D 4X51A 5IYDD 2Q14A 1PV7A 5IYBD 5LQBA 5FLMD 4IKWA 4BY7D 2CYKA 1FG9A 3N0PA 5C3ED 4YDYI 1QVNA 3BESL 4ZYRA 3INKC 4D2CA 5D71A 5KNHI 4A3ED 1B5LA 1LKIA 3OG6A 4YQXA 5EQIA 1M4AA 1CNT1 2B8XA 3D87A 3HOUD 1A22A 3HOWD 3NCCA 1PW6A 3OQ3A 4YBQA 1HWGA 3L5WI 1FYHA 5C65A 4GBYA 3EW3A 5TS9A 1BGEA 2B8UA 4IKZA 3NPZA 5D28B 2B63D 1HZIA 1EMRA 1LQSL 3AYHA 5FHXA 1D9CA 2KZ1A 1BGCA 3HMXB 4QIQA 3VA2A 4FA8E 4PS4A 3NCFA 5C4XD 3UX9A 1IARA 4JREA 1HWHA 5IP7D 4ZS7A 4BBSD 2D48A 4GC0A 4IU8A 3O7PA 4XNJA 1AU1A 4LDSA 1V7MV 1J7VL 3MZGA 3UEZE 1KF9A 4JA3A 1EVSA 5D6KA 1V7NV 3DI3A 2R92D 1M4BA 3HHRA 3O7QA 1VLKA 3NCEA 1YKBA 3QWRB 2L3OA 5D72A 4NN7A 1HIJA 1EKUA 1NBPA 5EQGA 1CYLA 4NEJA 1IRLA 4NI7A 1AXIA 2B91A 4Q65A 4APSA 2B8YA 4D2BA 1IL6A 3HHCA 5D59A 4BXXD 3PIWA 4MHLA 1BGDA 5A2OA 4I77Z 4LRLA 2B5IA 3PO2D 1M4RA 2B8ZA 5D58A 4DKFA 3DLQI 1CSGA 2V8NA 1Y6NL 5GXBA 3N06A 3BPLA 3UF5A 4GBZA 1HUWA 1Y6KL 5IYCD 1ALUA 5FUCA 1P9MB 4W6VA 4A3GD 1IJZA 1ITIA 1Y6ML 3PIVA 2XQBA 4A3LD 2INTA 2O27A 1INRA 2D9QA 2OQPA 1PY2A 4J4LC 4IKXA 4ZWBA 1M48A 3SE3B 4ZW9A 4LEPA 4EXNA 4A3ID 3WCYI 2Z3RA 4ZWCA 3H0GD 3H3VE 2VUMD 3S9DA 3LB6A 1A7MA 2Z3QA 3BPOA 2O6IA 4O9HA 1Z92A 1IK0A 5D70A 2R7ZD 3SE4B 4WRLB 1Y1WD 3QAZA 1BUYA 1EERA 2CFQA 2ILKA 3QB1A 5EQHA 2B90A 1JLIA 3D48P 4RS1A 4IU9A 3DGCL 3G6DA 3PO3D 2PSMA 4A3DD 4TPJA 1GNCA 3D85C 1Y14A 2CFPA 4YB9D 4NEMA 3FKID 1N1FA 3Q1SI 1GA3A 3OG4A 1RCBA 1PVHB 4U4VA 3IRHA 4EXPA 1PV6A 4OH3A 1WCMD 2ERJD 4DKCA 4GRWA 4NI9A 4A3FD 4BY1D 4A3JD 3G9VB 4DKEA 1Z7CA 4YUEC 3HOYD 1HULA 1ITFA 2JA6D 4OAAA 2Q7NB 2LMSA 4A3CD 1LK3A 4Z5RD 4NN6A 1HGUA 4A93D 1WU3I 1RHGA 2GMFA 2Q98A 4TPHA 1CN4C 4UVMA 1ETEA 3NCBA 4U4TA 1F6FA 1AX8A 5C44D 1F45B 2HYMB 4A3BD 5IP9D 4PYPA 2C35A 4DKDA 4A3MD 1RW5A 2Y5YA 5L6YC 1I1RB 3HOVD 1ITMA 1BBNA 1CD9A 4U4WA 4CNIC 5E4EA 5D22A 1M49A 4TPGA 1PW4A 1M4CA 4A3KD 2LAGA 3B5KA 3TGXB 2JA5D 4NN5A 2XUTA 4IKYA 2E9WC 3DUHC 2O26A 3QB7A 1EXZA 1SCFA 1ILKA 4GS7A 3L5XA 4J05A 3DI2A 3QT2C 4NKQC 1HIKA 1Y1VD
chains in the Genus database with same CATH topology
3HMXB 4BY7D 2IL6A 2INTA 3VA2A 5C7XA 4DKCA 4A3LD 1BP3A 2O27A 4PS4A 4FA8E 3NCFA 1INRA 4GRWA 4NI9A 3HOZD 5C4XD 4A3FD 4BY1D 3UX9A 3UF2A 2D9QA 4A3JD 1IARA 3G9VB 2OQPA 1PY2A 4DKEA 2H24A 3I4ND 4DOHA 1HWHA 1M47A 5IP7D 4J4LC 4ZS7A 1Z7CA 4BBRD 2JA7D 4ZF7A 4BBSD 2D48A 1PGRA 4YUEC 1M48A 4O6KA 3SE3B 1HULA 3HOYD 1ITFA 4YPGC 2JA6D 2Q7NB 2LMSA 1AU1A 1ITLA 1V7MV 4EXNA 1J7VL 4A3CD 3MZGA 3UEZE 1RFBA 1KF9A 1LK3A 2L3YA 4A3ID 1EVSA 4Z5RD 4NN6A 3WCYI 2JA8D 2Z3RA 1V7NV 3EJJA 3H0GD 3DI3A 3I4MD 1HGUA 3LB6B 3H3VE 4A93D 3Q1SI 2R92D 1M4BA 1WU3I 2VUMD 3S9DA 3HHRA 1RHGA 3HOXD 1BCNA 2GMFA 1D9GA 3LB6A 1A7MA 2Q98A 3BPNA 2R93D 2Z3QA 1VLKA 3BPOA 4X51A 3NCEA 1YKBA 3QWRB 1CN4C 2O6IA 5IYDD 2Q14A 2L3OA 4O9HA 5IYBD 5LQBA 1Z92A 5FLMD 1ETEA 3NCBA 1IK0A 1F6FA 4NN7A 1AX8A 1HIJA 1EKUA 5D72A 5D70A 2CYKA 5C44D 1NBPA 2R7ZD 1F45B 1FG9A 2HYMB 3N0PA 4NEJA 1IRLA 4NI7A 1CYLA 4A3BD 3SE4B 5C3ED 1AXIA 2B91A 4WRLB 5IP9D 3QAZA 1Y1WD 1BUYA 1EERA 2C35A 4YDYI 2B8YA 1IL6A 3HHCA 1QVNA 3BESL 4DKDA 2ILKA 3QB1A 3INKC 4A3MD 1RW5A 2B90A 1JLIA 5D71A 3D48P 5L6YC 4RS1A 5KNHI 4BXXD 1I1RB 3HOVD 1ITMA 3PIWA 3DGCL 1B5LA 4MHLA 1BGDA 4A3ED 1BBNA 3G6DA 1LKIA 2PSMA 1CD9A 3PO3D 3OG6A 4CNIC 4A3DD 5E4EA 4I77Z 4YQXA 5D22A 1M49A 4LRLA 1GNCA 2B5IA 3D85C 1M4AA 1Y14A 3PO2D 1M4RA 1CNT1 1M4CA 2B8XA 2B8ZA 3D87A 4NEMA 4DKFA 3HOUD 1A22A 3HOWD 4A3KD 3NCCA 1PW6A 3DLQI 3FKID 1N1FA 2LAGA 1CSGA 1HWGA 1Y6NL 3B5KA 3L5WI 3N06A 1FYHA 3OQ3A 3BPLA 4NN5A 2JA5D 3UF5A 1GA3A 3OG4A 1RCBA 2E9WC 3DUHC 3EW3A 1PVHB 5TS9A 3TGXB 1HUWA 1Y6KL 5IYCD 1BGEA 2O26A 3IRHA 1ALUA 2B8UA 3NPZA 3QB7A 5FUCA 1EXZA 1P9MB 5D28B 2B63D 1HZIA 1SCFA 4A3GD 1ILKA 4EXPA 1EMRA 1LQSL 4GS7A 1IJZA 3AYHA 3L5XA 5FHXA 1D9CA 2KZ1A 1ITIA 1Y6ML 3DI2A 3QT2C 4NKQC 3PIVA 1HIKA 1WCMD 2ERJD 1BGCA 2XQBA 1Y1VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMX B;  2IL6 A;  2INT A;  3VA2 A;  5C7X A;  1BP3 A;  2O27 A;  4PS4 A;  4FA8 E;  3NCF A;  1INR A;  4GRW A;  4NI9 A;  3UX9 A;  3UF2 A;  2D9Q A;  1IAR A;  3G9V B;  1PY2 A;  2H24 A;  4DOH A;  1HWH A;  1M47 A;  4J4L C;  4ZS7 A;  1Z7C A;  4ZF7 A;  2D48 A;  1PGR A;  4YUE C;  1M48 A;  4O6K A;  3SE3 B;  1HUL A;  1ITF A;  4YPG C;  2Q7N B;  2LMS A;  1AU1 A;  1ITL A;  1V7M V;  1J7V L;  3MZG A;  3UEZ E;  1RFB A;  1KF9 A;  1LK3 A;  2L3Y A;  1EVS A;  4Z5R D;  3WCY I;  1V7N V;  3EJJ A;  1HGU A;  3LB6 B;  3Q1S I;  1M4B A;  1WU3 I;  3S9D A;  3HHR A;  1RHG A;  1BCN A;  2GMF A;  1D9G A;  3LB6 A;  1A7M A;  2Q98 A;  3BPN A;  1VLK A;  3BPO A;  4X51 A;  3NCE A;  1YKB A;  3QWR B;  1CN4 C;  2L3O A;  4O9H A;  5LQB A;  1Z92 A;  1ETE A;  3NCB A;  1IK0 A;  1F6F A;  5D72 A;  1AX8 A;  1HIJ A;  1EKU A;  5D70 A;  2CYK A;  1NBP A;  1F45 B;  1FG9 A;  2HYM B;  3N0P A;  4NEJ A;  1IRL A;  4NI7 A;  1CYL A;  3SE4 B;  1AXI A;  2B91 A;  4WRL B;  3QAZ A;  1BUY A;  1EER A;  4YDY I;  2B8Y A;  1IL6 A;  1QVN A;  3BES L;  2ILK A;  3QB1 A;  3INK C;  1RW5 A;  2B90 A;  1JLI A;  5D71 A;  3D48 P;  5L6Y C;  4RS1 A;  5KNH I;  1I1R B;  1ITM A;  3PIW A;  3DGC L;  1B5L A;  4MHL A;  1BGD A;  1BBN A;  3G6D A;  1LKI A;  1CD9 A;  4CNI C;  5E4E A;  4I77 Z;  4YQX A;  5D22 A;  1M49 A;  1GNC A;  2B5I A;  3D85 C;  1M4A A;  1M4R A;  1CNT 1;  1M4C A;  2B8X A;  2B8Z A;  3D87 A;  4NEM A;  1A22 A;  3NCC A;  1PW6 A;  3DLQ I;  1N1F A;  2LAG A;  1CSG A;  1HWG A;  1Y6N L;  3B5K A;  3L5W I;  3N06 A;  1FYH A;  3OQ3 A;  3BPL A;  3UF5 A;  1GA3 A;  1RCB A;  2E9W C;  3DUH C;  3EW3 A;  1PVH B;  1HUW A;  1Y6K L;  1BGE A;  2O26 A;  1ALU A;  2B8U A;  3NPZ A;  3QB7 A;  5FUC A;  1EXZ A;  1P9M B;  5D28 B;  1HZI A;  1SCF A;  1ILK A;  1EMR A;  1LQS L;  1IJZ A;  3L5X A;  5FHX A;  1D9C A;  2KZ1 A;  1ITI A;  1Y6M L;  3QT2 C;  4NKQ C;  3PIV A;  1HIK A;  2ERJ D;  1BGC A; 
#chains in the Genus database with same CATH topology
 2IL6 A;  4JR9 A;  5C7X A;  1BP3 A;  4IKV A;  3HOZ D;  3UF2 A;  5A2N A;  3I4N D;  2H24 A;  4DOH A;  1M47 A;  4BBR D;  4XNI A;  2JA7 D;  4ZF7 A;  1PGR A;  3WDO A;  4O6K A;  4YPG C;  1ITL A;  1RFB A;  2L3Y A;  2JA8 D;  3EJJ A;  3I4M D;  3LB6 B;  3HOX D;  1BCN A;  1D9G A;  4D2D A;  3BPN A;  2R93 D;  4X51 A;  5IYD D;  2Q14 A;  1PV7 A;  5IYB D;  5LQB A;  5FLM D;  4IKW A;  4BY7 D;  2CYK A;  1FG9 A;  3N0P A;  5C3E D;  4YDY I;  1QVN A;  3BES L;  4ZYR A;  3INK C;  4D2C A;  5D71 A;  5KNH I;  4A3E D;  1B5L A;  1LKI A;  3OG6 A;  4YQX A;  5EQI A;  1M4A A;  1CNT 1;  2B8X A;  3D87 A;  3HOU D;  1A22 A;  3HOW D;  3NCC A;  1PW6 A;  3OQ3 A;  4YBQ A;  1HWG A;  3L5W I;  1FYH A;  5C65 A;  4GBY A;  3EW3 A;  5TS9 A;  1BGE A;  2B8U A;  4IKZ A;  3NPZ A;  5D28 B;  2B63 D;  1HZI A;  1EMR A;  1LQS L;  3AYH A;  5FHX A;  1D9C A;  2KZ1 A;  1BGC A;  3HMX B;  4QIQ A;  3VA2 A;  4FA8 E;  4PS4 A;  3NCF A;  5C4X D;  3UX9 A;  1IAR A;  4JRE A;  1HWH A;  5IP7 D;  4ZS7 A;  4BBS D;  2D48 A;  4GC0 A;  4IU8 A;  3O7P A;  4XNJ A;  1AU1 A;  4LDS A;  1V7M V;  1J7V L;  3MZG A;  3UEZ E;  1KF9 A;  4JA3 A;  1EVS A;  5D6K A;  1V7N V;  3DI3 A;  2R92 D;  1M4B A;  3HHR A;  3O7Q A;  1VLK A;  3NCE A;  1YKB A;  3QWR B;  2L3O A;  5D72 A;  4NN7 A;  1HIJ A;  1EKU A;  1NBP A;  5EQG A;  1CYL A;  4NEJ A;  1IRL A;  4NI7 A;  1AXI A;  2B91 A;  4Q65 A;  4APS A;  2B8Y A;  4D2B A;  1IL6 A;  3HHC A;  5D59 A;  4BXX D;  3PIW A;  4MHL A;  1BGD A;  5A2O A;  4I77 Z;  4LRL A;  2B5I A;  3PO2 D;  1M4R A;  2B8Z A;  5D58 A;  4DKF A;  3DLQ I;  1CSG A;  2V8N A;  1Y6N L;  5GXB A;  3N06 A;  3BPL A;  3UF5 A;  4GBZ A;  1HUW A;  1Y6K L;  5IYC D;  1ALU A;  5FUC A;  1P9M B;  4W6V A;  4A3G D;  1IJZ A;  1ITI A;  1Y6M L;  3PIV A;  2XQB A;  4A3L D;  2INT A;  2O27 A;  1INR A;  2D9Q A;  2OQP A;  1PY2 A;  4J4L C;  4IKX A;  4ZWB A;  1M48 A;  3SE3 B;  4ZW9 A;  4LEP A;  4EXN A;  4A3I D;  3WCY I;  2Z3R A;  4ZWC A;  3H0G D;  3H3V E;  2VUM D;  3S9D A;  3LB6 A;  1A7M A;  2Z3Q A;  3BPO A;  2O6I A;  4O9H A;  1Z92 A;  1IK0 A;  5D70 A;  2R7Z D;  3SE4 B;  4WRL B;  1Y1W D;  3QAZ A;  1BUY A;  1EER A;  2CFQ A;  2ILK A;  3QB1 A;  5EQH A;  2B90 A;  1JLI A;  3D48 P;  4RS1 A;  4IU9 A;  3DGC L;  3G6D A;  3PO3 D;  2PSM A;  4A3D D;  4TPJ A;  1GNC A;  3D85 C;  1Y14 A;  2CFP A;  4YB9 D;  4NEM A;  3FKI D;  1N1F A;  3Q1S I;  1GA3 A;  3OG4 A;  1RCB A;  1PVH B;  4U4V A;  3IRH A;  4EXP A;  1PV6 A;  4OH3 A;  1WCM D;  2ERJ D;  4DKC A;  4GRW A;  4NI9 A;  4A3F D;  4BY1 D;  4A3J D;  3G9V B;  4DKE A;  1Z7C A;  4YUE C;  3HOY D;  1HUL A;  1ITF A;  2JA6 D;  4OAA A;  2Q7N B;  2LMS A;  4A3C D;  1LK3 A;  4Z5R D;  4NN6 A;  1HGU A;  4A93 D;  1WU3 I;  1RHG A;  2GMF A;  2Q98 A;  4TPH A;  1CN4 C;  4UVM A;  1ETE A;  3NCB A;  4U4T A;  1F6F A;  1AX8 A;  5C44 D;  1F45 B;  2HYM B;  4A3B D;  5IP9 D;  4PYP A;  2C35 A;  4DKD A;  4A3M D;  1RW5 A;  2Y5Y A;  5L6Y C;  1I1R B;  3HOV D;  1ITM A;  1BBN A;  1CD9 A;  4U4W A;  4CNI C;  5E4E A;  5D22 A;  1M49 A;  4TPG A;  1PW4 A;  1M4C A;  4A3K D;  2LAG A;  3B5K A;  3TGX B;  2JA5 D;  4NN5 A;  2XUT A;  4IKY A;  2E9W C;  3DUH C;  2O26 A;  3QB7 A;  1EXZ A;  1SCF A;  1ILK A;  4GS7 A;  3L5X A;  4J05 A;  3DI2 A;  3QT2 C;  4NKQ C;  1HIK A;  1Y1V D; 
#chains in the Genus database with same CATH homology
 3HMX B;  4BY7 D;  2IL6 A;  2INT A;  3VA2 A;  5C7X A;  4DKC A;  4A3L D;  1BP3 A;  2O27 A;  4PS4 A;  4FA8 E;  3NCF A;  1INR A;  4GRW A;  4NI9 A;  3HOZ D;  5C4X D;  4A3F D;  4BY1 D;  3UX9 A;  3UF2 A;  2D9Q A;  4A3J D;  1IAR A;  3G9V B;  2OQP A;  1PY2 A;  4DKE A;  2H24 A;  3I4N D;  4DOH A;  1HWH A;  1M47 A;  5IP7 D;  4J4L C;  4ZS7 A;  1Z7C A;  4BBR D;  2JA7 D;  4ZF7 A;  4BBS D;  2D48 A;  1PGR A;  4YUE C;  1M48 A;  4O6K A;  3SE3 B;  1HUL A;  3HOY D;  1ITF A;  4YPG C;  2JA6 D;  2Q7N B;  2LMS A;  1AU1 A;  1ITL A;  1V7M V;  4EXN A;  1J7V L;  4A3C D;  3MZG A;  3UEZ E;  1RFB A;  1KF9 A;  1LK3 A;  2L3Y A;  4A3I D;  1EVS A;  4Z5R D;  4NN6 A;  3WCY I;  2JA8 D;  2Z3R A;  1V7N V;  3EJJ A;  3H0G D;  3DI3 A;  3I4M D;  1HGU A;  3LB6 B;  3H3V E;  4A93 D;  3Q1S I;  2R92 D;  1M4B A;  1WU3 I;  2VUM D;  3S9D A;  3HHR A;  1RHG A;  3HOX D;  1BCN A;  2GMF A;  1D9G A;  3LB6 A;  1A7M A;  2Q98 A;  3BPN A;  2R93 D;  2Z3Q A;  1VLK A;  3BPO A;  4X51 A;  3NCE A;  1YKB A;  3QWR B;  1CN4 C;  2O6I A;  5IYD D;  2Q14 A;  2L3O A;  4O9H A;  5IYB D;  5LQB A;  1Z92 A;  5FLM D;  1ETE A;  3NCB A;  1IK0 A;  1F6F A;  4NN7 A;  1AX8 A;  1HIJ A;  1EKU A;  5D72 A;  5D70 A;  2CYK A;  5C44 D;  1NBP A;  2R7Z D;  1F45 B;  1FG9 A;  2HYM B;  3N0P A;  4NEJ A;  1IRL A;  4NI7 A;  1CYL A;  4A3B D;  3SE4 B;  5C3E D;  1AXI A;  2B91 A;  4WRL B;  5IP9 D;  3QAZ A;  1Y1W D;  1BUY A;  1EER A;  2C35 A;  4YDY I;  2B8Y A;  1IL6 A;  3HHC A;  1QVN A;  3BES L;  4DKD A;  2ILK A;  3QB1 A;  3INK C;  4A3M D;  1RW5 A;  2B90 A;  1JLI A;  5D71 A;  3D48 P;  5L6Y C;  4RS1 A;  5KNH I;  4BXX D;  1I1R B;  3HOV D;  1ITM A;  3PIW A;  3DGC L;  1B5L A;  4MHL A;  1BGD A;  4A3E D;  1BBN A;  3G6D A;  1LKI A;  2PSM A;  1CD9 A;  3PO3 D;  3OG6 A;  4CNI C;  4A3D D;  5E4E A;  4I77 Z;  4YQX A;  5D22 A;  1M49 A;  4LRL A;  1GNC A;  2B5I A;  3D85 C;  1M4A A;  1Y14 A;  3PO2 D;  1M4R A;  1CNT 1;  1M4C A;  2B8X A;  2B8Z A;  3D87 A;  4NEM A;  4DKF A;  3HOU D;  1A22 A;  3HOW D;  4A3K D;  3NCC A;  1PW6 A;  3DLQ I;  3FKI D;  1N1F A;  2LAG A;  1CSG A;  1HWG A;  1Y6N L;  3B5K A;  3L5W I;  3N06 A;  1FYH A;  3OQ3 A;  3BPL A;  4NN5 A;  2JA5 D;  3UF5 A;  1GA3 A;  3OG4 A;  1RCB A;  2E9W C;  3DUH C;  3EW3 A;  1PVH B;  5TS9 A;  3TGX B;  1HUW A;  1Y6K L;  5IYC D;  1BGE A;  2O26 A;  3IRH A;  1ALU A;  2B8U A;  3NPZ A;  3QB7 A;  5FUC A;  1EXZ A;  1P9M B;  5D28 B;  2B63 D;  1HZI A;  1SCF A;  4A3G D;  1ILK A;  4EXP A;  1EMR A;  1LQS L;  4GS7 A;  1IJZ A;  3AYH A;  3L5X A;  5FHX A;  1D9C A;  2KZ1 A;  1ITI A;  1Y6M L;  3DI2 A;  3QT2 C;  4NKQ C;  3PIV A;  1HIK A;  1WCM D;  2ERJ D;  1BGC A;  2XQB A;  1Y1V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...