3L6AA

Crystal structure of the c-terminal region of human p97
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
360
structure length
350
Chain Sequence
HHSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal region of Human p97/DAP5
doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 4 gamma 2
total genus 131
structure length 350
sequence length 360
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA01
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA02
1HU3A 1N52A 3EIQC 1UW4B 2RG8A 4B89A 5ANRA 2IONA 4CRWA 2VSOE 3L6AA 3D3MA 1N54A 3FEYA 4B8AA 4GMJA 1H6KA 1UG3A 4JHKA 2IOLA 4IULA 1H2VC 1H2UA 2HM8A 4GMLA 4JHJA 3JUIA 2IU1A 2ZU6B 2GGFA 2VSXE 4B8CB 1H2TC 2NSZA 1PAQA 4LUNU 4CT4A 3RK6A 2KZTA 3EIJA 4CEMA 2FULA 2I2OA 4C9BB 3FEXA 2KZTB 2IOSA
chains in the Genus database with same CATH superfamily
3QWPA 5G2NA 5ANRA 2B6CA 2DVWA 4UWLA 4FC8A 4LNUD 3RKVA 1O1SA 2LSUA 2DYRE 3BEEA 3AG1E 1KT0A 2XCBA 3AJIA 2GRLA 4LG6A 3FUFA 3LXUX 3PZDA 5LCWJ 2FULA 2UWJG 3MV2B 3CVPA 5FQ4A 2XRZA 1DCEA 5JJ7A 1TN6A 1SW6A 2J8SD 3HG0D 2GRQB 1YMPA 3PNTB 1OWOA 3D9MA 3S2AA 3ZGQA 2ILRA 5T8IA 4WNFA 2WXHA 4GYOA 4M3OA 3LYAA 2UY1B 1TNYA 5AQ7A 3LS8A 3EU5A 4ABNA 2RD0A 1NI1A 3I4GA 2GRMA 2IEJA 3ABME 2OVBA 3Q73A 3SFXA 3CGHA 4JPSA 3RU0A 1LTXA 2HYZA 1N4QA 4K5BA 3E4BA 5J90A 3MKRA 5KWDA 4MS6A 1TNBA 4JA7A 3HXBA 5FZRA 1HG5A 3SF4A 2GRPB 2JEKA 4OYSA 1OCCE 4DX7D 4N2SA 4CCAA 5A23A 2KCKA 2PNNA 1N94A 3MGBA 1RZ4A 2X6JA 5HS0A 4UI9J 4L2LA 2F8XK 3UPVA 1HF8A 1OY3D 4AIFA 3QDNA 1D9SA 2H6IA 3LKUA 1OWLA 5EYPF 1PC2A 3VLDA 3ZW3A 3CHOA 4DRXE 3ISMC 5G05J 1UG3A 3CVLA 4C48B 3ABLE 3WXXA 4I43A 2J08A 2BEDA 3E34A 5KJMA 3AS4A 2P9PG 1ELKA 2FI7A 3FY4A 4J8FA 1ZBPA 4WWNA 3RO3A 5FQ6A 4NURA 2OCCE 2CG3A 4E85A 1NA3A 4O1PA 4N3CA 3DSUA 2WQHA 3O4ZA 2VSXE 1H2TC 2WPVA 2X6IA 4BT8A 4EBAG 3LJ3A 3KSQA 4PH4B 4J8DA 2AJAA 3JUEA 2OVFA 3AAAC 3PZ4A 2EIME 4FP7A 2YINA 4HI9A 4KT6B 4Q96A 2IY0C 2Y0BG 4GMJA 4I2WA 4Z68A 2I1KA 3UI2A 2J09A 3CV0A 1Y6IA 4C9BB 3HXEA 1NL4A 1S0PA 4ATGA 4WWPA 3LY9A 2WB2A 4MKTA 4IRUA 4DX2A 1H0AA 3PUKA 1YYHA 3ASHA 2LUHA 3CIAA 1WDYA 3CVUA 1MZCA 3L54A 5JMND 1FT1A 4CDRA 1IHGA 2J4BA 2WXKA 4WNEA 2M63A 4RSYA 3JYSA 3Q79A 4YNDA 5HKPA 3S7BA 3ULYA 2YHCA 2DCPA 3FUNA 4PDXA 3BU8A 1BU9A 3KEZA 4XI0A 5EILA 5FJYA 5AQBA 4PUCA 3L22A 2P9KG 4CDMA 3CVWA 2LO6A 1X81A 4U8VD 3UM0A 5CRVA 4APOA 1HX8A 3DEOA 2AWIA 3ZYKA 2CFZA 1IKND 3PS6A 2FBNA 4K5CA 2WXOA 3FUMA 4B8AA 4EECA 2AW6A 2XRYA 1PY1A 4J0UA 4A1SA 1KZOA 2WXJA 2CHWA 2Y1LE 4GA2A 5KBAA 3MKQA 4JZYA 4GTOA 4HBDA 2ZIRA 4KZ0A 3SHFA 2PL2A 1A17A 3TWTA 4JHRA 3CVNA 3UX4A 5LCWC 5H7PA 4FJYA 3OXGA 2WXFA 2A5UA 2A4ZA 5EN5D 3NB2A 4HVBA 3D9IA 2KATA 1IXVA 5KNHD 2KM4A 4CRWA 2MYOA 1WY6A 3N71A 2ZXWE 4BEPA 1N54A 1H2VC 2JABA 3QKYA 2XZTG 3IXEA 4XX5A 3LPZA 4RG9A 4YVQC 4KYOB 3FTWA 4KVOA 3FH8A 3ASOE 3ONLA 3V2XA 1E8YA 3PZ1A 3IBEA 3R7QA 3TG4A 3SFZA 1G3NB 3Q9NC 3DBSA 2R03A 4HI8A 5EIDA 1NFIE 2XGOA 2HM8A 4BT9A 4CYMD 3AG4E 3UM3A 1KLXA 3CHRA 4GTPA 4LNBA 3RAUA 3TAXA 1FVHA 5FTPA 2RKKA 4CEMA 1V54E 4XIFA 3ML8A 3ZUVB 2HR2A 1N95A 3GZ2A 4TUMA 3MA5A 3VLFA 4H7XA 1ELWA 4AV7A 1Z3YA 3R7RA 3HVEA 1N4PA 3CHPA 1U2VG 5CRUA 3C3OA 4BWRA 3PDNA 2IJGX 3EU9A 5KJLA 3Q78A 3BG1B 4ATZD 4RLYA 3NF1A 4IULA 3L82A 3W9FA 4I9EA 4X8QA 2I2OA 3D9PA 2Y69E 3Q49B 2I6HA 1ZU2A 3ULQA 3RO2A 1TJFA 2XZDG 4ME2A 3ASDA 4XEIG 3PUJA 2GROB 1UOHA 2WXLA 5A6CA 3RIBA 3D9JA 4ZHBA 1PAQA 1WM5A 2WXRA 2BTDA 4LRZA 4DJAA 3PZ3A 1AWCB 5BW8C 4UQZA 2L0IA 4NIKA 5AJLA 3FU3A 3F6QA 2RFAA 3C72A 3UTMA 3V31A 3C98A 3PH0C 3D9NA 4DPRA 5D0QD 2Y4TA 5FQ7A 4JW1A 4A55A 2ETBA 3D9HA 3HDXA 3CSFA 4RVBA 5AJDA 4A1GA 3RRUA 2J49A 2VGEA 3EUVA 1XGWA 3I3NA 2XEVA 3HXDA 1OCZE 3CEQA 3E37A 3NBNB 5CERB 3UXGA 4UQYA 4BSZB 1QYMA 3FTZA 3JCKC 3Q5MA 3DSSA 2DZOA 4A63B 4IYPA 1K8KG 3KSLA 5LOZA 2IOLA 3CKCA 5ENNA 5JHAA 4APFA 3B7UX 4H7YA 4B8CB 3RRNB 5KJKA 1E8WA 3G2VA 4ANVA 4FLHA 3T9KA 3UQ3A 4G25A 3ESLA 1IQRA 2H6FA 4UQXA 5M72A 5BNWA 3CK8A 3L9TA 3FDHA 4YDWA 1INZA 3BQOA 3FWVA 3URZA 3RSEG 2LSVA 3G2WA 5KNGA 2DBAA 1TNOA 4EZJA 3U4TA 1O1RA 2UY1A 5G04J 3GZSA 3U9WA 3QJZA 3ZYLA 1BD8A 2FEZA 4U95D 4HRLA 5FIOA 3OXFA 5EX0A 2PQRA 3ZPJA 2J07A 3CVYA 4UWGA 3CLJA 4LUNU 4BERA 3L08A 5AIJA 5ENPD 4Y6CA 1UN9A 3SZ7A 4U04A 3DRAA 4OAVB 3U66A 1TR4A 1MQSA 2GRNB 4CGVA 3HIZA 2DIWA 2CG2A 3C3RA 1BLXB 1XNFA 2MHKA 4YDOA 5CCMA 3SY2A 4DLQA 1FVFA 3MYVA 2L0TB 5JJ6A 5D2MC 4JHJA 4CZ2D 2YNQA 4I6EA 3B7SA 2RFMA 3FH5A 5LFAA 3ONKA 5CMYA 3QK0A 1MHQA 1UJKA 3KD7A 4BX9A 3LVQE 2LXLA 4DX1A 3CVVA 1S70B 4G8LA 3IHVA 1QQEA 4UWKA 2J9QA 2VGXA 2YQ8A 5B3SE 4MLPA 5T3RA 4TRQA 2WXNA 4LNGA 3K9IA 3ZYMA 3QB2A 4J7WA 3E32A 3APFA 3ZXSA 2CHXA 5EIBE 3PE4A 2ZGDA 4L23A 4AP2A 3FFLA 1HS6A 1Q2ZA 4GZCA 2AVPA 4CT4A 4PS8A 2A5EA 2VGXB 3BUAA 3CKBA 4BESA 1H6PA 2EINE 5BPPA 2F0YA 3FTSA 5HI7A 2CFUA 3ASFA 3ABKE 1IYGA 2F8YA 2XPYA 4YDEA 2AXUA 1TNUA 5E76A 2EQXA 4RQIA 3CVXA 4M7CA 1D8EA 2FO1E 3B7TA 2VQ2A 4NACA 4LSZE 4BTBA 3CR3A 3LCAA 4TUUA 3JUIA 4FA6A 2OOEA 4DX5D 4RG6A 3TWWA 4FLBA 4I1AA 5BXOA 2NSZA 1MJ0A 1TNZA 1LD8A 3FTUA 2KXPC 2OEWA 4GZDA 5AARA 4Q69A 2ZISA 2Q7FA 1JCQA 3GYZA 3EHNA 1UN8A 4ILGA 1K3ZD 3NOCD 3Q75A 5BT1A 4KXKB 3L6AA 4GZ6A 4G1TA 4DI4A 3QC1A 1S64A 3FHEA 3HRAA 4AM9A 3P2BA 3IHYA 5B1BE 3GW4A 5BV0A 3CVQA 2IOSA 4E6HA 1V55E 4HOUA 1O5MA 1TYQG 1MX4A 2AXZA 3MCXA 2QYJA 3PREA 1FCHA 3I4RB 1KT1A 4CDNA 4FHJA 4AXHA 3UM1A 5JJTA 2XPZA 2ZGGA 2V4HC 4GTTA 1E8XA 4MBGA 3Q9UC 3U64A 4N5CA 5EDSA 2EIKE 5CEAA 1H6KA 3FUDA 3NAWA 1YCSB 2NXPA 3R9MA 3ZYQA 4HB5A 3L17A 3MKQB 3ZRHA 2BKGA 3CSTA 1H6OA 3VLEA 3JQ1A 4A3TA 2X38A 2R17C 2X6KA 4GTVA 1N4SA 3SO8A 3D9LA 4WAFA 5CCLA 2BUGA 1OCRE 3V30A 3RK6A 4BFRA 1U3CA 4I6GA 2C0MA 3ZHEA 3D9KA 5A7DB 2LXMA 4QQIA 4CGWA 5BXUA 4CT0A 3T8KA 2L6BA 1NP7A 2Y3AA 4BX8A 5FWQA 1OXJA 4I9CA 3EHQA 4HOQA 4DX6D 4GU5A 1TEZA 1HFAA 4UI9K 4GMLA 1N9AA 2WXPA 3LY8A 3EJNA 2P58C 3MZLB 5J08A 3ZHEB 4GTQA 1DNPA 4HRNA 3UT4A 4O6FA 2EILE 2X6HA 5ENSD 4B94A 1E96B 3KAEA 3IV0A 3KS2A 4FADA 2P2CP 5FINA 1EYHA 3AS8A 2PM7A 4URKA 4K5AB 3UKUG 1HE8A 3UIPC 2RG8A 5JA4D 4FHKA 4N39A 2OEVA 4TXRA 2PM6A 3CK9A 1MYOA 1D8DA 1OCOE 3AS5A 2X3MA 2E2EA 3BG0B 3IEGA 2IO2C 2XHEA 4W9RA 1VDYA 2J4DA 3UM2A 3PZ2A 4HOTA 3SD5A 2F37A 4JC8A 1TN8A 2QC9A 3O48A 2V5QC 3L13A 3T8MA 3TWSA 1Z6TA 2CHZA 2ONDA 3QWWA 1RW2A 2GRRB 2JLBA 3FEXA 5AN8A 4WWOA 3Q15A 2DYSE 4GTMA 3UUXA 2R02A 2ETAA 5CEDB 2QYUA 4HS2A 4EQFA 1SA5A 3VTYA 2KC7A 3UIOC 4GZ5A 3G2UA 4J8YA 1Z3XA 4KBQA 1BPOA 2WXIA 3ENEA 3DSXA 1HO8A 2VSOE 2BKKB 3ESKA 3HVEB 4GYWA 1JPLA 1JUQA 3CHMA 1HG2A 3TWQA 2DZNA 3HXFA 3DSWA 4UI9C 4U7EB 2XPIA 3VTXA 2HO1A 3MJWA 4QFVA 4YDYA 5EX3A 3DSTA 4FJZA 2V5FA 3OAWA 4JXTA 4HNAD 2XCCA 4F1PA 3ZFWA 3TGOA 5G05C 4N3AA 2WQ6A 2XENA 4L1BA 3LDZA 2XGMA 2KCVA 1DVPA 1HZ4A 2R2LA 1YA0A 2C0LA 3AG2E 2NYJA 5CHEE 2P9IG 3IKOB 3SI5A 4J8EA 4J8SA 3APCA 4ACKA 4ANUA 1UW4B 3PE3A 3X2QE 4F1SA 5EYLA 3D3MA 4UWFA 4U63A 4EPZA 3AU4A 1OWNA 4JHKA 4GB9A 4JEUA 3ASGA 3UKRG 3P1UA 1A5EA 3FU0A 3FUJA 3C5RA 5IY5E 4HLLA 3T5XA 3KEAA 2P9NG 2H6GA 3NZUA 4B89A 4HQDA 5T4YA 3TG5A 1OUVA 2IQCA 4JA9A 1QNFA 4F3VA 2XQ0A 3Q7FA 5AQ9A 2KCLA 3ASNE 3PVLA 2Y4UA 3FUHA 3QARA 4XI9A 3QWVA 4AEZC 1KPSB 3NOGD 4ILIA 4U0UA 4HXIA 2LNIA 3JXIA 1N4RA 2P9UG 1EDUA 4B93B 4ILHB 4A3VA 3V2OA 2ETCA 4BY6A 3PEVB 4GYYA 1O1TA 3T5VA 3TWUA 1HXIA 4B0ZA 4PS3A 1IQUA 1NA0A 4OVUA 2VGYA 5FT9A 2P9SG 3G2SA 5CBOA 1EF1C 1SVXA 3D9OA 3DWLG 1SQMA 1KZPA 3TWXA 3ZIMA 2PQNA 4UWHA 4U8YD 5LX8A 1X5BA 4FU3A 3V79K 5G55A 2V8SE 4GPKA 3GZ1A 4LERA 2E0IA 3HXCA 2IO3C 2XS8A 3EDTB 1OWMA 3FH7A 3DPYA 4UUCA 2XEHA 4U96D 3JXJA 4GTRA 2WMOA 2L9BA 2R5SA 1JCSA 3RRMB 3UMVA 4OAUC 3MV3B 5ENTD 4U0ZA 2VTBA 4ANWA 4DLOA 1S63A 5ENOD 1SZ9A 2YHEA 4L2YA 5JHBA 2VJ8A 1N0RA 3NZSA 3SNXA 5ITZF 3DXMG 4MRUA 1AP7A 2IONA 2XS1A 2WXMA 1QZ2A 3E30A 4DUIA 2DWZA 4BSXA 3OXLA 3AU5A 2I1JA 3QAQA 4K0RA 4GMRA 3B95A 4GCNA 1P5QA 4P29A 5FQ8A 3EHRA 3G2TA 3ZN3A 5HQ8A 5ARFA 4N5QA 3MX3A 3DSVA 3E33A 2QZAA 2GW1A 3EHMA 3ZU7B 4WNDA 5G04C 3PNLB 2I9CA 4C0EA 3TWVA 4U07A 1HH8A 4JVSA 2X6FA 3MEKA 1WAO1 3UINC 1HU3A 4JB8P 2WXGA 5AYWD 2V0PA 1SA4A 4EHMA 1JWFA 2FO7A 2IF4A 3FU5A 2VYIA 4TXQA 5FZSA 4Y6WA 4OVVA 4EBAA 1Z5SC 2VTBB 2ZU6B 5AENA 1DCQA 4GCOA 1BI7B 3ZXPA 4ZFHA 3CK7A 5EKQD 3B7RL 3FUEA 4GA0A 5FZQA 3ZNGA 3PRZA 5DBKA 4ANXA 3ULEG 1E90A 2VSNA 4AOFA 1GW6A 1SZAA 1E8ZA 4NRHB 4WUYA 4JEHA 1K1BA 5D66A 3R9AB 4NQ0A 4C0MA 4I17A 2XEEA 4G24A 1ZB1A 4N2QA 5KJNA 4HFGA 4XZ4A 4KZCA 3TXMA 3UT7A 3QNKA 5BUZA 3DPDA 1TJCA 1UJJA 4TXPA 2C2LA 2MOWA 3FTYA 1N11A 2QFCA 4BTAA 4J6IA 1JCRA 3TXNA 4DK5A 1H19A 2BF0X 5CMWA 5B1AE 4I2ZA 4FULA 3CHQA 3B7BA 1QBQA 1E7UA 5CECB 1DC2A 2XGSA 4TV3A 4F53A 2LAIA 5D0OD 4I6JA 3TJPA 3TWRA 2HE0A 3EIJA 4G2VA 4BETA 3S7FA 3J5PA 3HHMA 1LD7A 1E7VA 4G11A 1N52A 4G26A 2EIJE 3RJVA 4L9PA 4R7LA 4F7AA 5DIZA 2OV8A 3FTVA 1IHBA 4JL0A 5KCMA 4LEUA 3CHSA 3FTXA 4N3BA 1EPUA 3DEPA 3C3QA 3LEWA 5ENQD 3S7DA 4HOSA 3QOUA 4I1MA 2B0OE 3LJNA 5ARGA 2L6JA 1FT2A 4PS7A 3J5QB 2WXQA 2KZTA 4GPMA 4K03A 2MRIA 3SGHA 5BV1A 5LP0A 5C1DA 4F6RD 3WG7E 4KVMA 4XKCA 1H2UA 4KMOA 3UT8A 3Q7AA 4O60A 4HLEA 3FUKA 2KZTB 3L16A 4WNGA 2VSYA 3U3WA 1K1AA 1NZNA 1OWPA 3SBSA 3FULA 2P9LG 3SBTB 2KBXA 4ACLA 4GAAA 1W3BA 3LY7A 3APDA 4GA1A 4LCTA 2H6HA 5HRYA 3EIQC 4HRMB 5ANLA 5AAOA 3FUIA 4DI3A 3LVRE 2IU1A 2PZIA 2GGFA 4G23A 3DXKG 2WM9A 3ML9A 3ZKJA 1ELRA 4AJWA 1N0QA 1WG0A 1FPPA 4G8KA 5CBNA 4AVXA 4AY6A 4O1OA 3W9GA 3JQ0A 4YVOA 3CQCB 1B89A 2QY7A 4XKBA 3OTNA 3ZEFA 4JD2G 4V3IA 4U8HA 3CQGB 4EZKA 3Q4AB 4GZ3A 2R59A 4IN3B 1MX2A 4HORA 1TN7A 3Q47B 2LAHA 2AXVA 1MX6A 4U0SA 3I5PA 5AQAA 3SFYA 3NQPA 3TL5A 5ENRD 4XE0A 3ZVVA 3B13A 1U3DA 3PEUB 4EZLA 1BI8B 2WQ7A 2V4LA 2R05A 3HYMB 3S7JA 3FEYA 2IFUA 5E75A 3FP3A 4AY5A 1L5JA 1LF8A 1OT8A 5C2YA 2NC9A 3AG3E 3FU6A 2WVIA 4D10C 3SQVA 4GTSA 4Q94A 1JWGA 4L7TA 2WMNA 1Y8MA 2FF4A 4I1OB
chains in the Genus database with same CATH topology
2R5SA 3QWPA 3U64A 5G2NA 5ANRA 4N5CA 3RRMB 3UMVA 4UWLA 5EDSA 3MV3B 3GZ2A 4FC8A 3RKVA 3MA5A 4U0ZA 2VTBA 4ANWA 1H6KA 2LSUA 4DLOA 3VLFA 4H7XA 3FUDA 1ELWA 1SZ9A 3BEEA 4AV7A 2YHEA 1Z3YA 2NXPA 3R7RA 1KT0A 2XCBA 3HVEA 4L2YA 2GRLA 5JHBA 3ZYQA 3CHPA 3FUFA 2VJ8A 3NZSA 3SNXA 3LXUX 3PZDA 3L17A 4BWRA 5LCWJ 2FULA 2UWJG 3MKQB 3MV2B 3ZRHA 4MRUA 3CVPA 3PDNA 2IJGX 5FQ4A 2XRZA 5KJLA 3CSTA 3VLEA 3JQ1A 4A3TA 2X38A 2R17C 2IONA 3BG1B 2WXMA 1QZ2A 5JJ7A 2X6KA 3NF1A 4IULA 3PNTB 3D9LA 1OWOA 3D9MA 4WAFA 4BSXA 3OXLA 3AU5A 5CCLA 2I1JA 3S2AA 3ZGQA 2ILRA 3QAQA 2BUGA 4K0RA 4I9EA 3RK6A 4BFRA 1U3CA 2I2OA 4GCNA 3D9PA 4I6GA 5T8IA 4WNFA 1P5QA 4P29A 2WXHA 2C0MA 5FQ8A 4GYOA 4M3OA 3Q49B 3ZHEA 3G2TA 3ZN3A 3LYAA 2I6HA 2UY1B 3D9KA 5ARFA 5A7DB 1ZU2A 3MX3A 5HQ8A 3ULQA 3RO2A 1TJFA 4CGWA 4ME2A 3LS8A 2GW1A 3EHMA 4CT0A 3ASDA 3PUJA 4WNDA 4ABNA 1NP7A 2WXLA 5A6CA 5G04C 3RIBA 3D9JA 2Y3AA 2RD0A 3PNLB 2I9CA 4C0EA 4BX8A 1PAQA 1WM5A 2WXRA 2BTDA 4U07A 1HH8A 3I4GA 4JVSA 4LRZA 2GRMA 4DJAA 2X6FA 3MEKA 1WAO1 4I9CA 5BW8C 2OVBA 3CGHA 4UQZA 4JPSA 3RU0A 1HU3A 2L0IA 2WXGA 2HYZA 4HOQA 5AYWD 5AJLA 2V0PA 1JWFA 2FO7A 3E4BA 2IF4A 3FU5A 4GU5A 2VYIA 1TEZA 1HFAA 4UI9K 5J90A 3MKRA 4GMLA 3FU3A 4OVVA 4Y6WA 5FZSA 4MS6A 4EBAA 4JA7A 2VTBB 2WXPA 2ZU6B 3C98A 3PH0C 3D9NA 4DPRA 5D0QD 2Y4TA 3LY8A 3EJNA 2P58C 3MZLB 5FQ7A 5FZRA 5AENA 4JW1A 3ZHEB 4A55A 5J08A 3HDXA 4GCOA 3CSFA 1DNPA 1HG5A 4RVBA 3UT4A 3SF4A 4O6FA 5AJDA 4A1GA 3CK7A 2JEKA 3RRUA 5EKQD 3B7RL 2X6HA 3FUEA 4GA0A 4OYSA 2J49A 5FZQA 4B94A 1E96B 3PRZA 1XGWA 5DBKA 4ANXA 3I3NA 4CCAA 4N2SA 1E90A 2VSNA 3KAEA 1GW6A 4AOFA 2XEVA 5A23A 1SZAA 1E8ZA 4NRHB 2KCKA 3CEQA 3MGBA 2X6JA 4WUYA 4JEHA 3IV0A 4UI9J 4L2LA 5FWQA 3R9AB 4NQ0A 4C0MA 3KS2A 4I17A 4UQYA 4G24A 3UPVA 1HF8A 4N2QA 5KJNA 3FTZA 4HFGA 4XZ4A 4FADA 4AIFA 3QDNA 4KZCA 1EYHA 3AS8A 2PM7A 3JCKC 3TXMA 3LKUA 3UT7A 4URKA 3QNKA 5BUZA 3DPDA 1OWLA 1PC2A 1TJCA 1HE8A 3Q5MA 3CHOA 3VLDA 3ZW3A 1UJJA 2RG8A 4IYPA 4FHKA 2C2LA 2MOWA 4N39A 5G05J 2PM6A 5LOZA 1UG3A 2IOLA 3CK9A 3CKCA 5ENNA 5JHAA 4APFA 3CVLA 3B7UX 3FTYA 4H7YA 3WXXA 3AS5A 4B8CB 2QFCA 2X3MA 2E2EA 4I43A 2J08A 1E8WA 3RRNB 3G2VA 3BG0B 4BTAA 4J6IA 5KJKA 5KJMA 3AS4A 4ANVA 3TXNA 4DK5A 1H19A 4FLHA 1ELKA 2FI7A 2BF0X 3UQ3A 3IEGA 3FY4A 5CMWA 2XHEA 4G25A 4W9RA 4J8FA 1VDYA 3ESLA 4I2ZA 4FULA 2J4DA 1IQRA 1ZBPA 4WWNA 3CHQA 5FQ6A 3RO3A 4NURA 4HOTA 3SD5A 2CG3A 4UQXA 4E85A 4JC8A 5M72A 1NA3A 5BNWA 1E7UA 3O48A 3CK8A 2XGSA 4N3CA 2WQHA 3FDHA 3O4ZA 4TV3A 4F53A 2LAIA 2VSXE 5D0OD 3L13A 1INZA 4I6JA 1H2TC 2WPVA 2X6IA 3FWVA 3URZA 3T8MA 2LSVA 4BT8A 3G2WA 3TJPA 4EBAG 2DBAA 1Z6TA 2CHZA 3EIJA 4EZJA 3U4TA 4G2VA 2ONDA 3LJ3A 3QWWA 2UY1A 4PH4B 3S7FA 4J8DA 2JLBA 3HHMA 3FEXA 5G04J 3GZSA 3U9WA 4WWOA 2OVFA 3Q15A 1E7VA 4G11A 3QJZA 1N52A 4G26A 4FP7A 3ZYLA 2FEZA 2YINA 4KT6B 4Q96A 4R7LA 3RJVA 4F7AA 3OXFA 5EX0A 3UUXA 2PQRA 3ZPJA 2J07A 4GMJA 3CVYA 4HS2A 4I2WA 4EQFA 4UWGA 5DIZA 2OV8A 2I1KA 3VTYA 3FTVA 2J09A 2KC7A 3CLJA 4JL0A 3CV0A 4LUNU 5KCMA 4LEUA 3CHSA 3FTXA 4GZ5A 3L08A 5AIJA 3G2UA 4N3BA 1EPUA 1Y6IA 1Z3XA 4C9BB 4Y6CA 4KBQA 3LEWA 1BPOA 1UN9A 3SZ7A 2WXIA 4U04A 1S0PA 3ENEA 3S7DA 4ATGA 4HOSA 3QOUA 1HO8A 2VSOE 3U66A 4WWPA 1MQSA 3ESKA 3HVEB 4I1MA 3LY9A 3HIZA 4GYWA 4CGVA 1JPLA 5ARGA 2WB2A 2DIWA 2L6JA 4MKTA 2CG2A 4IRUA 1JUQA 1H0AA 1XNFA 2MHKA 3CHMA 1HG2A 4PS7A 5CCMA 2WXQA 2KZTA 3PUKA 4UI9C 4DLQA 4K03A 1FVFA 2XPIA 2MRIA 3MYVA 3SGHA 5BV1A 3ASHA 5LP0A 3VTXA 5C1DA 2HO1A 3CIAA 3MJWA 4QFVA 3CVUA 2L0TB 5JJ6A 5EX3A 3L54A 4FJZA 2V5FA 4KVMA 4JHJA 4XKCA 1H2UA 3OAWA 4CDRA 1IHGA 2J4BA 2WXKA 2XCCA 2YNQA 4JXTA 4WNEA 4KMOA 3UT8A 4I6EA 2M63A 3B7SA 4RSYA 3ZFWA 3TGOA 5G05C 4N3AA 3FH5A 2WQ6A 4L1BA 3JYSA 5LFAA 3ONKA 5CMYA 4HLEA 3QK0A 3FUKA 3LDZA 1MHQA 2KZTB 1UJKA 2XGMA 3L16A 4YNDA 2KCVA 4WNGA 1DVPA 1HZ4A 2VSYA 3U3WA 3S7BA 1NZNA 3KD7A 2YHCA 4BX9A 2DCPA 3FUNA 4PDXA 1OWPA 3SBSA 3FULA 1YA0A 3SBTB 3KEZA 3LVQE 2C0LA 4XI0A 5FJYA 4PUCA 3L22A 5CHEE 4CDMA 3CVVA 3IKOB 3SI5A 4ACLA 3CVWA 4GAAA 2LO6A 4J8EA 3IHVA 1QQEA 4UWKA 1W3BA 4J8SA 4APOA 3APCA 3LY7A 2J9QA 3APDA 2VGXA 4GA1A 4LCTA 1HX8A 2YQ8A 4MLPA 4ACKA 5T3RA 4ANUA 4TRQA 2WXNA 2AWIA 3K9IA 3ZYKA 2CFZA 3EIQC 1UW4B 3PE3A 3ZYMA 5ANLA 4F1SA 3QB2A 3PS6A 2FBNA 2WXOA 3APFA 3D3MA 3FUIA 3FUMA 4UWFA 4B8AA 4U63A 4EECA 3ZXSA 4DI3A 4EPZA 3AU4A 1OWNA 4JHKA 4GB9A 2CHXA 4JEUA 3ASGA 3LVRE 2IU1A 2PZIA 2GGFA 3PE4A 2AW6A 3P1UA 3FU0A 3FUJA 4L23A 4AP2A 4G23A 3FFLA 1HS6A 2XRYA 1PY1A 4GZCA 2WM9A 4J0UA 3ML9A 2AVPA 4CT4A 4A1SA 4PS8A 1ELRA 4AJWA 3T5XA 2WXJA 2VGXB 2CHWA 3CKBA 4GA2A 3NZUA 3MKQA 4AVXA 4AY6A 5T4YA 4JZYA 3TG5A 4B89A 1OUVA 3JQ0A 2IQCA 4KZ0A 3CQCB 4YVOA 4JA9A 3SHFA 1QNFA 2PL2A 5BPPA 1A17A 3FTSA 4F3VA 2XQ0A 1B89A 4JHRA 2QY7A 3CVNA 5HI7A 3UX4A 2CFUA 2KCLA 3ASFA 5LCWC 4XKBA 3OTNA 3PVLA 1IYGA 2XPYA 3ZEFA 4V3IA 2Y4UA 3FUHA 3OXGA 3QARA 4FJYA 4U8HA 2WXFA 2A5UA 2AXUA 4XI9A 5E76A 3QWVA 3CQGB 4AEZC 2A4ZA 2EQXA 4EZKA 3CVXA 3Q4AB 4GZ3A 2R59A 4IN3B 4HVBA 4HORA 3D9IA 2KATA 3B7TA 4HXIA 2KM4A 2LNIA 3Q47B 4ILIA 4U0UA 2LAHA 2VQ2A 4CRWA 1WY6A 3N71A 4NACA 4BTBA 1EDUA 2AXVA 1N54A 4U0SA 4ILHB 4A3VA 3CR3A 3I5PA 1H2VC 3NQPA 3TL5A 3LCAA 4TUUA 3JUIA 3QKYA 4FA6A 2OOEA 4BY6A 4XE0A 4RG6A 4FLBA 4I1AA 3ZVVA 3B13A 1U3DA 3PEVB 4GYYA 3PEUB 4XX5A 2NSZA 4EZLA 3LPZA 3T5VA 4RG9A 2WQ7A 3FTUA 1HXIA 2V4LA 4B0ZA 4GZDA 1IQUA 4PS3A 4YVQC 1NA0A 4Q69A 4KYOB 2Q7FA 4OVUA 3GYZA 3EHNA 2VGYA 3HYMB 1UN8A 4ILGA 3FTWA 4KVOA 5BT1A 3S7JA 4KXKB 5FT9A 3L6AA 3FEYA 3FH8A 4GZ6A 4G1TA 4DI4A 2IFUA 3G2SA 3QC1A 3ONLA 5E75A 3FHEA 3FP3A 4AY5A 1L5JA 1E8YA 1LF8A 1EF1C 4AM9A 3P2BA 3IHYA 3IBEA 5C2YA 3D9OA 3GW4A 5BV0A 1SQMA 3CVQA 2NC9A 3R7QA 3TG4A 2IOSA 4E6HA 4HOUA 3SFZA 3FU6A 3ZIMA 2WVIA 2PQNA 3DBSA 4UWHA 5LX8A 4D10C 1X5BA 4FU3A 5G55A 2V8SE 2XGOA 4Q94A 2AXZA 4GPKA 3GZ1A 2HM8A 4BT9A 4LERA 1JWGA 2E0IA 3MCXA 3PREA 1FCHA 4L7TA 3I4RB 1KT1A 4CDNA 4FHJA 4AXHA 2WMNA 5JJTA 3EDTB 1OWMA 1KLXA 3CHRA 3FH7A 3TAXA 1Y8MA 1FVHA 5FTPA 2XPZA 4CEMA 2FF4A 2WMOA 4XIFA 1E8XA 2L9BA 3ML8A 2HR2A 4I1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HU3 A;  1N52 A;  3EIQ C;  1UW4 B;  2RG8 A;  4B89 A;  5ANR A;  2ION A;  4CRW A;  2VSO E;  3L6A A;  3D3M A;  1N54 A;  3FEY A;  4B8A A;  4GMJ A;  1H6K A;  1UG3 A;  4JHK A;  2IOL A;  4IUL A;  1H2V C;  1H2U A;  2HM8 A;  4GML A;  4JHJ A;  3JUI A;  2IU1 A;  2ZU6 B;  2GGF A;  2VSX E;  4B8C B;  1H2T C;  2NSZ A;  1PAQ A;  4LUN U;  4CT4 A;  3RK6 A;  2KZT A;  3EIJ A;  4CEM A;  2FUL A;  2I2O A;  4C9B B;  3FEX A;  2KZT B;  2IOS A; 
#chains in the Genus database with same CATH topology
 3QWP A;  5G2N A;  5ANR A;  2B6C A;  2DVW A;  4UWL A;  4FC8 A;  4LNU D;  3RKV A;  1O1S A;  2LSU A;  2DYR E;  3BEE A;  3AG1 E;  1KT0 A;  2XCB A;  3AJI A;  2GRL A;  4LG6 A;  3FUF A;  3LXU X;  3PZD A;  5LCW J;  2FUL A;  2UWJ G;  3MV2 B;  3CVP A;  5FQ4 A;  2XRZ A;  1DCE A;  5JJ7 A;  1TN6 A;  1SW6 A;  2J8S D;  3HG0 D;  2GRQ B;  1YMP A;  3PNT B;  1OWO A;  3D9M A;  3S2A A;  3ZGQ A;  2ILR A;  5T8I A;  4WNF A;  2WXH A;  4GYO A;  4M3O A;  3LYA A;  2UY1 B;  1TNY A;  5AQ7 A;  3LS8 A;  3EU5 A;  4ABN A;  2RD0 A;  1NI1 A;  3I4G A;  2GRM A;  2IEJ A;  3ABM E;  2OVB A;  3Q73 A;  3SFX A;  3CGH A;  4JPS A;  3RU0 A;  1LTX A;  2HYZ A;  1N4Q A;  4K5B A;  3E4B A;  5J90 A;  3MKR A;  5KWD A;  4MS6 A;  1TNB A;  4JA7 A;  3HXB A;  5FZR A;  1HG5 A;  3SF4 A;  2GRP B;  2JEK A;  4OYS A;  1OCC E;  4DX7 D;  4N2S A;  4CCA A;  5A23 A;  2KCK A;  2PNN A;  1N94 A;  3MGB A;  1RZ4 A;  2X6J A;  5HS0 A;  4UI9 J;  4L2L A;  2F8X K;  3UPV A;  1HF8 A;  1OY3 D;  4AIF A;  3QDN A;  1D9S A;  2H6I A;  3LKU A;  1OWL A;  5EYP F;  1PC2 A;  3VLD A;  3ZW3 A;  3CHO A;  4DRX E;  3ISM C;  5G05 J;  1UG3 A;  3CVL A;  4C48 B;  3ABL E;  3WXX A;  4I43 A;  2J08 A;  2BED A;  3E34 A;  5KJM A;  3AS4 A;  2P9P G;  1ELK A;  2FI7 A;  3FY4 A;  4J8F A;  1ZBP A;  4WWN A;  3RO3 A;  5FQ6 A;  4NUR A;  2OCC E;  2CG3 A;  4E85 A;  1NA3 A;  4O1P A;  4N3C A;  3DSU A;  2WQH A;  3O4Z A;  2VSX E;  1H2T C;  2WPV A;  2X6I A;  4BT8 A;  4EBA G;  3LJ3 A;  3KSQ A;  4PH4 B;  4J8D A;  2AJA A;  3JUE A;  2OVF A;  3AAA C;  3PZ4 A;  2EIM E;  4FP7 A;  2YIN A;  4HI9 A;  4KT6 B;  4Q96 A;  2IY0 C;  2Y0B G;  4GMJ A;  4I2W A;  4Z68 A;  2I1K A;  3UI2 A;  2J09 A;  3CV0 A;  1Y6I A;  4C9B B;  3HXE A;  1NL4 A;  1S0P A;  4ATG A;  4WWP A;  3LY9 A;  2WB2 A;  4MKT A;  4IRU A;  4DX2 A;  1H0A A;  3PUK A;  1YYH A;  3ASH A;  2LUH A;  3CIA A;  1WDY A;  3CVU A;  1MZC A;  3L54 A;  5JMN D;  1FT1 A;  4CDR A;  1IHG A;  2J4B A;  2WXK A;  4WNE A;  2M63 A;  4RSY A;  3JYS A;  3Q79 A;  4YND A;  5HKP A;  3S7B A;  3ULY A;  2YHC A;  2DCP A;  3FUN A;  4PDX A;  3BU8 A;  1BU9 A;  3KEZ A;  4XI0 A;  5EIL A;  5FJY A;  5AQB A;  4PUC A;  3L22 A;  2P9K G;  4CDM A;  3CVW A;  2LO6 A;  1X81 A;  4U8V D;  3UM0 A;  5CRV A;  4APO A;  1HX8 A;  3DEO A;  2AWI A;  3ZYK A;  2CFZ A;  1IKN D;  3PS6 A;  2FBN A;  4K5C A;  2WXO A;  3FUM A;  4B8A A;  4EEC A;  2AW6 A;  2XRY A;  1PY1 A;  4J0U A;  4A1S A;  1KZO A;  2WXJ A;  2CHW A;  2Y1L E;  4GA2 A;  5KBA A;  3MKQ A;  4JZY A;  4GTO A;  4HBD A;  2ZIR A;  4KZ0 A;  3SHF A;  2PL2 A;  1A17 A;  3TWT A;  4JHR A;  3CVN A;  3UX4 A;  5LCW C;  5H7P A;  4FJY A;  3OXG A;  2WXF A;  2A5U A;  2A4Z A;  5EN5 D;  3NB2 A;  4HVB A;  3D9I A;  2KAT A;  1IXV A;  5KNH D;  2KM4 A;  4CRW A;  2MYO A;  1WY6 A;  3N71 A;  2ZXW E;  4BEP A;  1N54 A;  1H2V C;  2JAB A;  3QKY A;  2XZT G;  3IXE A;  4XX5 A;  3LPZ A;  4RG9 A;  4YVQ C;  4KYO B;  3FTW A;  4KVO A;  3FH8 A;  3ASO E;  3ONL A;  3V2X A;  1E8Y A;  3PZ1 A;  3IBE A;  3R7Q A;  3TG4 A;  3SFZ A;  1G3N B;  3Q9N C;  3DBS A;  2R03 A;  4HI8 A;  5EID A;  1NFI E;  2XGO A;  2HM8 A;  4BT9 A;  4CYM D;  3AG4 E;  3UM3 A;  1KLX A;  3CHR A;  4GTP A;  4LNB A;  3RAU A;  3TAX A;  1FVH A;  5FTP A;  2RKK A;  4CEM A;  1V54 E;  4XIF A;  3ML8 A;  3ZUV B;  2HR2 A;  1N95 A;  3GZ2 A;  4TUM A;  3MA5 A;  3VLF A;  4H7X A;  1ELW A;  4AV7 A;  1Z3Y A;  3R7R A;  3HVE A;  1N4P A;  3CHP A;  1U2V G;  5CRU A;  3C3O A;  4BWR A;  3PDN A;  2IJG X;  3EU9 A;  5KJL A;  3Q78 A;  3BG1 B;  4ATZ D;  4RLY A;  3NF1 A;  4IUL A;  3L82 A;  3W9F A;  4I9E A;  4X8Q A;  2I2O A;  3D9P A;  2Y69 E;  3Q49 B;  2I6H A;  1ZU2 A;  3ULQ A;  3RO2 A;  1TJF A;  2XZD G;  4ME2 A;  3ASD A;  4XEI G;  3PUJ A;  2GRO B;  1UOH A;  2WXL A;  5A6C A;  3RIB A;  3D9J A;  4ZHB A;  1PAQ A;  1WM5 A;  2WXR A;  2BTD A;  4LRZ A;  4DJA A;  3PZ3 A;  1AWC B;  5BW8 C;  4UQZ A;  2L0I A;  4NIK A;  5AJL A;  3FU3 A;  3F6Q A;  2RFA A;  3C72 A;  3UTM A;  3V31 A;  3C98 A;  3PH0 C;  3D9N A;  4DPR A;  5D0Q D;  2Y4T A;  5FQ7 A;  4JW1 A;  4A55 A;  2ETB A;  3D9H A;  3HDX A;  3CSF A;  4RVB A;  5AJD A;  4A1G A;  3RRU A;  2J49 A;  2VGE A;  3EUV A;  1XGW A;  3I3N A;  2XEV A;  3HXD A;  1OCZ E;  3CEQ A;  3E37 A;  3NBN B;  5CER B;  3UXG A;  4UQY A;  4BSZ B;  1QYM A;  3FTZ A;  3JCK C;  3Q5M A;  3DSS A;  2DZO A;  4A63 B;  4IYP A;  1K8K G;  3KSL A;  5LOZ A;  2IOL A;  3CKC A;  5ENN A;  5JHA A;  4APF A;  3B7U X;  4H7Y A;  4B8C B;  3RRN B;  5KJK A;  1E8W A;  3G2V A;  4ANV A;  4FLH A;  3T9K A;  3UQ3 A;  4G25 A;  3ESL A;  1IQR A;  2H6F A;  4UQX A;  5M72 A;  5BNW A;  3CK8 A;  3L9T A;  3FDH A;  4YDW A;  1INZ A;  3BQO A;  3FWV A;  3URZ A;  3RSE G;  2LSV A;  3G2W A;  5KNG A;  2DBA A;  1TNO A;  4EZJ A;  3U4T A;  1O1R A;  2UY1 A;  5G04 J;  3GZS A;  3U9W A;  3QJZ A;  3ZYL A;  1BD8 A;  2FEZ A;  4U95 D;  4HRL A;  5FIO A;  3OXF A;  5EX0 A;  2PQR A;  3ZPJ A;  2J07 A;  3CVY A;  4UWG A;  3CLJ A;  4LUN U;  4BER A;  3L08 A;  5AIJ A;  5ENP D;  4Y6C A;  1UN9 A;  3SZ7 A;  4U04 A;  3DRA A;  4OAV B;  3U66 A;  1TR4 A;  1MQS A;  2GRN B;  4CGV A;  3HIZ A;  2DIW A;  2CG2 A;  3C3R A;  1BLX B;  1XNF A;  2MHK A;  4YDO A;  5CCM A;  3SY2 A;  4DLQ A;  1FVF A;  3MYV A;  2L0T B;  5JJ6 A;  5D2M C;  4JHJ A;  4CZ2 D;  2YNQ A;  4I6E A;  3B7S A;  2RFM A;  3FH5 A;  5LFA A;  3ONK A;  5CMY A;  3QK0 A;  1MHQ A;  1UJK A;  3KD7 A;  4BX9 A;  3LVQ E;  2LXL A;  4DX1 A;  3CVV A;  1S70 B;  4G8L A;  3IHV A;  1QQE A;  4UWK A;  2J9Q A;  2VGX A;  2YQ8 A;  5B3S E;  4MLP A;  5T3R A;  4TRQ A;  2WXN A;  4LNG A;  3K9I A;  3ZYM A;  3QB2 A;  4J7W A;  3E32 A;  3APF A;  3ZXS A;  2CHX A;  5EIB E;  3PE4 A;  2ZGD A;  4L23 A;  4AP2 A;  3FFL A;  1HS6 A;  1Q2Z A;  4GZC A;  2AVP A;  4CT4 A;  4PS8 A;  2A5E A;  2VGX B;  3BUA A;  3CKB A;  4BES A;  1H6P A;  2EIN E;  5BPP A;  2F0Y A;  3FTS A;  5HI7 A;  2CFU A;  3ASF A;  3ABK E;  1IYG A;  2F8Y A;  2XPY A;  4YDE A;  2AXU A;  1TNU A;  5E76 A;  2EQX A;  4RQI A;  3CVX A;  4M7C A;  1D8E A;  2FO1 E;  3B7T A;  2VQ2 A;  4NAC A;  4LSZ E;  4BTB A;  3CR3 A;  3LCA A;  4TUU A;  3JUI A;  4FA6 A;  2OOE A;  4DX5 D;  4RG6 A;  3TWW A;  4FLB A;  4I1A A;  5BXO A;  2NSZ A;  1MJ0 A;  1TNZ A;  1LD8 A;  3FTU A;  2KXP C;  2OEW A;  4GZD A;  5AAR A;  4Q69 A;  2ZIS A;  2Q7F A;  1JCQ A;  3GYZ A;  3EHN A;  1UN8 A;  4ILG A;  1K3Z D;  3NOC D;  3Q75 A;  5BT1 A;  4KXK B;  3L6A A;  4GZ6 A;  4G1T A;  4DI4 A;  3QC1 A;  1S64 A;  3FHE A;  3HRA A;  4AM9 A;  3P2B A;  3IHY A;  5B1B E;  3GW4 A;  5BV0 A;  3CVQ A;  2IOS A;  4E6H A;  1V55 E;  4HOU A;  1O5M A;  1TYQ G;  1MX4 A;  2AXZ A;  3MCX A;  2QYJ A;  3PRE A;  1FCH A;  3I4R B;  1KT1 A;  4CDN A;  4FHJ A;  4AXH A;  3UM1 A;  5JJT A;  2XPZ A;  2ZGG A;  2V4H C;  4GTT A;  1E8X A;  4MBG A;  3Q9U C;  3U64 A;  4N5C A;  5EDS A;  2EIK E;  5CEA A;  1H6K A;  3FUD A;  3NAW A;  1YCS B;  2NXP A;  3R9M A;  3ZYQ A;  4HB5 A;  3L17 A;  3MKQ B;  3ZRH A;  2BKG A;  3CST A;  1H6O A;  3VLE A;  3JQ1 A;  4A3T A;  2X38 A;  2R17 C;  2X6K A;  4GTV A;  1N4S A;  3SO8 A;  3D9L A;  4WAF A;  5CCL A;  2BUG A;  1OCR E;  3V30 A;  3RK6 A;  4BFR A;  1U3C A;  4I6G A;  2C0M A;  3ZHE A;  3D9K A;  5A7D B;  2LXM A;  4QQI A;  4CGW A;  5BXU A;  4CT0 A;  3T8K A;  2L6B A;  1NP7 A;  2Y3A A;  4BX8 A;  5FWQ A;  1OXJ A;  4I9C A;  3EHQ A;  4HOQ A;  4DX6 D;  4GU5 A;  1TEZ A;  1HFA A;  4UI9 K;  4GML A;  1N9A A;  2WXP A;  3LY8 A;  3EJN A;  2P58 C;  3MZL B;  5J08 A;  3ZHE B;  4GTQ A;  1DNP A;  4HRN A;  3UT4 A;  4O6F A;  2EIL E;  2X6H A;  5ENS D;  4B94 A;  1E96 B;  3KAE A;  3IV0 A;  3KS2 A;  4FAD A;  2P2C P;  5FIN A;  1EYH A;  3AS8 A;  2PM7 A;  4URK A;  4K5A B;  3UKU G;  1HE8 A;  3UIP C;  2RG8 A;  5JA4 D;  4FHK A;  4N39 A;  2OEV A;  4TXR A;  2PM6 A;  3CK9 A;  1MYO A;  1D8D A;  1OCO E;  3AS5 A;  2X3M A;  2E2E A;  3BG0 B;  3IEG A;  2IO2 C;  2XHE A;  4W9R A;  1VDY A;  2J4D A;  3UM2 A;  3PZ2 A;  4HOT A;  3SD5 A;  2F37 A;  4JC8 A;  1TN8 A;  2QC9 A;  3O48 A;  2V5Q C;  3L13 A;  3T8M A;  3TWS A;  1Z6T A;  2CHZ A;  2OND A;  3QWW A;  1RW2 A;  2GRR B;  2JLB A;  3FEX A;  5AN8 A;  4WWO A;  3Q15 A;  2DYS E;  4GTM A;  3UUX A;  2R02 A;  2ETA A;  5CED B;  2QYU A;  4HS2 A;  4EQF A;  1SA5 A;  3VTY A;  2KC7 A;  3UIO C;  4GZ5 A;  3G2U A;  4J8Y A;  1Z3X A;  4KBQ A;  1BPO A;  2WXI A;  3ENE A;  3DSX A;  1HO8 A;  2VSO E;  2BKK B;  3ESK A;  3HVE B;  4GYW A;  1JPL A;  1JUQ A;  3CHM A;  1HG2 A;  3TWQ A;  2DZN A;  3HXF A;  3DSW A;  4UI9 C;  4U7E B;  2XPI A;  3VTX A;  2HO1 A;  3MJW A;  4QFV A;  4YDY A;  5EX3 A;  3DST A;  4FJZ A;  2V5F A;  3OAW A;  4JXT A;  4HNA D;  2XCC A;  4F1P A;  3ZFW A;  3TGO A;  5G05 C;  4N3A A;  2WQ6 A;  2XEN A;  4L1B A;  3LDZ A;  2XGM A;  2KCV A;  1DVP A;  1HZ4 A;  2R2L A;  1YA0 A;  2C0L A;  3AG2 E;  2NYJ A;  5CHE E;  2P9I G;  3IKO B;  3SI5 A;  4J8E A;  4J8S A;  3APC A;  4ACK A;  4ANU A;  1UW4 B;  3PE3 A;  3X2Q E;  4F1S A;  5EYL A;  3D3M A;  4UWF A;  4U63 A;  4EPZ A;  3AU4 A;  1OWN A;  4JHK A;  4GB9 A;  4JEU A;  3ASG A;  3UKR G;  3P1U A;  1A5E A;  3FU0 A;  3FUJ A;  3C5R A;  5IY5 E;  4HLL A;  3T5X A;  3KEA A;  2P9N G;  2H6G A;  3NZU A;  4B89 A;  4HQD A;  5T4Y A;  3TG5 A;  1OUV A;  2IQC A;  4JA9 A;  1QNF A;  4F3V A;  2XQ0 A;  3Q7F A;  5AQ9 A;  2KCL A;  3ASN E;  3PVL A;  2Y4U A;  3FUH A;  3QAR A;  4XI9 A;  3QWV A;  4AEZ C;  1KPS B;  3NOG D;  4ILI A;  4U0U A;  4HXI A;  2LNI A;  3JXI A;  1N4R A;  2P9U G;  1EDU A;  4B93 B;  4ILH B;  4A3V A;  3V2O A;  2ETC A;  4BY6 A;  3PEV B;  4GYY A;  1O1T A;  3T5V A;  3TWU A;  1HXI A;  4B0Z A;  4PS3 A;  1IQU A;  1NA0 A;  4OVU A;  2VGY A;  5FT9 A;  2P9S G;  3G2S A;  5CBO A;  1EF1 C;  1SVX A;  3D9O A;  3DWL G;  1SQM A;  1KZP A;  3TWX A;  3ZIM A;  2PQN A;  4UWH A;  4U8Y D;  5LX8 A;  1X5B A;  4FU3 A;  3V79 K;  5G55 A;  2V8S E;  4GPK A;  3GZ1 A;  4LER A;  2E0I A;  3HXC A;  2IO3 C;  2XS8 A;  3EDT B;  1OWM A;  3FH7 A;  3DPY A;  4UUC A;  2XEH A;  4U96 D;  3JXJ A;  4GTR A;  2WMO A;  2L9B A;  2R5S A;  1JCS A;  3RRM B;  3UMV A;  4OAU C;  3MV3 B;  5ENT D;  4U0Z A;  2VTB A;  4ANW A;  4DLO A;  1S63 A;  5ENO D;  1SZ9 A;  2YHE A;  4L2Y A;  5JHB A;  2VJ8 A;  1N0R A;  3NZS A;  3SNX A;  5ITZ F;  3DXM G;  4MRU A;  1AP7 A;  2ION A;  2XS1 A;  2WXM A;  1QZ2 A;  3E30 A;  4DUI A;  2DWZ A;  4BSX A;  3OXL A;  3AU5 A;  2I1J A;  3QAQ A;  4K0R A;  4GMR A;  3B95 A;  4GCN A;  1P5Q A;  4P29 A;  5FQ8 A;  3EHR A;  3G2T A;  3ZN3 A;  5HQ8 A;  5ARF A;  4N5Q A;  3MX3 A;  3DSV A;  3E33 A;  2QZA A;  2GW1 A;  3EHM A;  3ZU7 B;  4WND A;  5G04 C;  3PNL B;  2I9C A;  4C0E A;  3TWV A;  4U07 A;  1HH8 A;  4JVS A;  2X6F A;  3MEK A;  1WAO 1;  3UIN C;  1HU3 A;  4JB8 P;  2WXG A;  5AYW D;  2V0P A;  1SA4 A;  4EHM A;  1JWF A;  2FO7 A;  2IF4 A;  3FU5 A;  2VYI A;  4TXQ A;  5FZS A;  4Y6W A;  4OVV A;  4EBA A;  1Z5S C;  2VTB B;  2ZU6 B;  5AEN A;  1DCQ A;  4GCO A;  1BI7 B;  3ZXP A;  4ZFH A;  3CK7 A;  5EKQ D;  3B7R L;  3FUE A;  4GA0 A;  5FZQ A;  3ZNG A;  3PRZ A;  5DBK A;  4ANX A;  3ULE G;  1E90 A;  2VSN A;  4AOF A;  1GW6 A;  1SZA A;  1E8Z A;  4NRH B;  4WUY A;  4JEH A;  1K1B A;  5D66 A;  3R9A B;  4NQ0 A;  4C0M A;  4I17 A;  2XEE A;  4G24 A;  1ZB1 A;  4N2Q A;  5KJN A;  4HFG A;  4XZ4 A;  4KZC A;  3TXM A;  3UT7 A;  3QNK A;  5BUZ A;  3DPD A;  1TJC A;  1UJJ A;  4TXP A;  2C2L A;  2MOW A;  3FTY A;  1N11 A;  2QFC A;  4BTA A;  4J6I A;  1JCR A;  3TXN A;  4DK5 A;  1H19 A;  2BF0 X;  5CMW A;  5B1A E;  4I2Z A;  4FUL A;  3CHQ A;  3B7B A;  1QBQ A;  1E7U A;  5CEC B;  1DC2 A;  2XGS A;  4TV3 A;  4F53 A;  2LAI A;  5D0O D;  4I6J A;  3TJP A;  3TWR A;  2HE0 A;  3EIJ A;  4G2V A;  4BET A;  3S7F A;  3J5P A;  3HHM A;  1LD7 A;  1E7V A;  4G11 A;  1N52 A;  4G26 A;  2EIJ E;  3RJV A;  4L9P A;  4R7L A;  4F7A A;  5DIZ A;  2OV8 A;  3FTV A;  1IHB A;  4JL0 A;  5KCM A;  4LEU A;  3CHS A;  3FTX A;  4N3B A;  1EPU A;  3DEP A;  3C3Q A;  3LEW A;  5ENQ D;  3S7D A;  4HOS A;  3QOU A;  4I1M A;  2B0O E;  3LJN A;  5ARG A;  2L6J A;  1FT2 A;  4PS7 A;  3J5Q B;  2WXQ A;  2KZT A;  4GPM A;  4K03 A;  2MRI A;  3SGH A;  5BV1 A;  5LP0 A;  5C1D A;  4F6R D;  3WG7 E;  4KVM A;  4XKC A;  1H2U A;  4KMO A;  3UT8 A;  3Q7A A;  4O60 A;  4HLE A;  3FUK A;  2KZT B;  3L16 A;  4WNG A;  2VSY A;  3U3W A;  1K1A A;  1NZN A;  1OWP A;  3SBS A;  3FUL A;  2P9L G;  3SBT B;  2KBX A;  4ACL A;  4GAA A;  1W3B A;  3LY7 A;  3APD A;  4GA1 A;  4LCT A;  2H6H A;  5HRY A;  3EIQ C;  4HRM B;  5ANL A;  5AAO A;  3FUI A;  4DI3 A;  3LVR E;  2IU1 A;  2PZI A;  2GGF A;  4G23 A;  3DXK G;  2WM9 A;  3ML9 A;  3ZKJ A;  1ELR A;  4AJW A;  1N0Q A;  1WG0 A;  1FPP A;  4G8K A;  5CBN A;  4AVX A;  4AY6 A;  4O1O A;  3W9G A;  3JQ0 A;  4YVO A;  3CQC B;  1B89 A;  2QY7 A;  4XKB A;  3OTN A;  3ZEF A;  4JD2 G;  4V3I A;  4U8H A;  3CQG B;  4EZK A;  3Q4A B;  4GZ3 A;  2R59 A;  4IN3 B;  1MX2 A;  4HOR A;  1TN7 A;  3Q47 B;  2LAH A;  2AXV A;  1MX6 A;  4U0S A;  3I5P A;  5AQA A;  3SFY A;  3NQP A;  3TL5 A;  5ENR D;  4XE0 A;  3ZVV A;  3B13 A;  1U3D A;  3PEU B;  4EZL A;  1BI8 B;  2WQ7 A;  2V4L A;  2R05 A;  3HYM B;  3S7J A;  3FEY A;  2IFU A;  5E75 A;  3FP3 A;  4AY5 A;  1L5J A;  1LF8 A;  1OT8 A;  5C2Y A;  2NC9 A;  3AG3 E;  3FU6 A;  2WVI A;  4D10 C;  3SQV A;  4GTS A;  4Q94 A;  1JWG A;  4L7T A;  2WMN A;  1Y8M A;  2FF4 A;  4I1O B; 
#chains in the Genus database with same CATH homology
 2R5S A;  3QWP A;  3U64 A;  5G2N A;  5ANR A;  4N5C A;  3RRM B;  3UMV A;  4UWL A;  5EDS A;  3MV3 B;  3GZ2 A;  4FC8 A;  3RKV A;  3MA5 A;  4U0Z A;  2VTB A;  4ANW A;  1H6K A;  2LSU A;  4DLO A;  3VLF A;  4H7X A;  3FUD A;  1ELW A;  1SZ9 A;  3BEE A;  4AV7 A;  2YHE A;  1Z3Y A;  2NXP A;  3R7R A;  1KT0 A;  2XCB A;  3HVE A;  4L2Y A;  2GRL A;  5JHB A;  3ZYQ A;  3CHP A;  3FUF A;  2VJ8 A;  3NZS A;  3SNX A;  3LXU X;  3PZD A;  3L17 A;  4BWR A;  5LCW J;  2FUL A;  2UWJ G;  3MKQ B;  3MV2 B;  3ZRH A;  4MRU A;  3CVP A;  3PDN A;  2IJG X;  5FQ4 A;  2XRZ A;  5KJL A;  3CST A;  3VLE A;  3JQ1 A;  4A3T A;  2X38 A;  2R17 C;  2ION A;  3BG1 B;  2WXM A;  1QZ2 A;  5JJ7 A;  2X6K A;  3NF1 A;  4IUL A;  3PNT B;  3D9L A;  1OWO A;  3D9M A;  4WAF A;  4BSX A;  3OXL A;  3AU5 A;  5CCL A;  2I1J A;  3S2A A;  3ZGQ A;  2ILR A;  3QAQ A;  2BUG A;  4K0R A;  4I9E A;  3RK6 A;  4BFR A;  1U3C A;  2I2O A;  4GCN A;  3D9P A;  4I6G A;  5T8I A;  4WNF A;  1P5Q A;  4P29 A;  2WXH A;  2C0M A;  5FQ8 A;  4GYO A;  4M3O A;  3Q49 B;  3ZHE A;  3G2T A;  3ZN3 A;  3LYA A;  2I6H A;  2UY1 B;  3D9K A;  5ARF A;  5A7D B;  1ZU2 A;  3MX3 A;  5HQ8 A;  3ULQ A;  3RO2 A;  1TJF A;  4CGW A;  4ME2 A;  3LS8 A;  2GW1 A;  3EHM A;  4CT0 A;  3ASD A;  3PUJ A;  4WND A;  4ABN A;  1NP7 A;  2WXL A;  5A6C A;  5G04 C;  3RIB A;  3D9J A;  2Y3A A;  2RD0 A;  3PNL B;  2I9C A;  4C0E A;  4BX8 A;  1PAQ A;  1WM5 A;  2WXR A;  2BTD A;  4U07 A;  1HH8 A;  3I4G A;  4JVS A;  4LRZ A;  2GRM A;  4DJA A;  2X6F A;  3MEK A;  1WAO 1;  4I9C A;  5BW8 C;  2OVB A;  3CGH A;  4UQZ A;  4JPS A;  3RU0 A;  1HU3 A;  2L0I A;  2WXG A;  2HYZ A;  4HOQ A;  5AYW D;  5AJL A;  2V0P A;  1JWF A;  2FO7 A;  3E4B A;  2IF4 A;  3FU5 A;  4GU5 A;  2VYI A;  1TEZ A;  1HFA A;  4UI9 K;  5J90 A;  3MKR A;  4GML A;  3FU3 A;  4OVV A;  4Y6W A;  5FZS A;  4MS6 A;  4EBA A;  4JA7 A;  2VTB B;  2WXP A;  2ZU6 B;  3C98 A;  3PH0 C;  3D9N A;  4DPR A;  5D0Q D;  2Y4T A;  3LY8 A;  3EJN A;  2P58 C;  3MZL B;  5FQ7 A;  5FZR A;  5AEN A;  4JW1 A;  3ZHE B;  4A55 A;  5J08 A;  3HDX A;  4GCO A;  3CSF A;  1DNP A;  1HG5 A;  4RVB A;  3UT4 A;  3SF4 A;  4O6F A;  5AJD A;  4A1G A;  3CK7 A;  2JEK A;  3RRU A;  5EKQ D;  3B7R L;  2X6H A;  3FUE A;  4GA0 A;  4OYS A;  2J49 A;  5FZQ A;  4B94 A;  1E96 B;  3PRZ A;  1XGW A;  5DBK A;  4ANX A;  3I3N A;  4CCA A;  4N2S A;  1E90 A;  2VSN A;  3KAE A;  1GW6 A;  4AOF A;  2XEV A;  5A23 A;  1SZA A;  1E8Z A;  4NRH B;  2KCK A;  3CEQ A;  3MGB A;  2X6J A;  4WUY A;  4JEH A;  3IV0 A;  4UI9 J;  4L2L A;  5FWQ A;  3R9A B;  4NQ0 A;  4C0M A;  3KS2 A;  4I17 A;  4UQY A;  4G24 A;  3UPV A;  1HF8 A;  4N2Q A;  5KJN A;  3FTZ A;  4HFG A;  4XZ4 A;  4FAD A;  4AIF A;  3QDN A;  4KZC A;  1EYH A;  3AS8 A;  2PM7 A;  3JCK C;  3TXM A;  3LKU A;  3UT7 A;  4URK A;  3QNK A;  5BUZ A;  3DPD A;  1OWL A;  1PC2 A;  1TJC A;  1HE8 A;  3Q5M A;  3CHO A;  3VLD A;  3ZW3 A;  1UJJ A;  2RG8 A;  4IYP A;  4FHK A;  2C2L A;  2MOW A;  4N39 A;  5G05 J;  2PM6 A;  5LOZ A;  1UG3 A;  2IOL A;  3CK9 A;  3CKC A;  5ENN A;  5JHA A;  4APF A;  3CVL A;  3B7U X;  3FTY A;  4H7Y A;  3WXX A;  3AS5 A;  4B8C B;  2QFC A;  2X3M A;  2E2E A;  4I43 A;  2J08 A;  1E8W A;  3RRN B;  3G2V A;  3BG0 B;  4BTA A;  4J6I A;  5KJK A;  5KJM A;  3AS4 A;  4ANV A;  3TXN A;  4DK5 A;  1H19 A;  4FLH A;  1ELK A;  2FI7 A;  2BF0 X;  3UQ3 A;  3IEG A;  3FY4 A;  5CMW A;  2XHE A;  4G25 A;  4W9R A;  4J8F A;  1VDY A;  3ESL A;  4I2Z A;  4FUL A;  2J4D A;  1IQR A;  1ZBP A;  4WWN A;  3CHQ A;  5FQ6 A;  3RO3 A;  4NUR A;  4HOT A;  3SD5 A;  2CG3 A;  4UQX A;  4E85 A;  4JC8 A;  5M72 A;  1NA3 A;  5BNW A;  1E7U A;  3O48 A;  3CK8 A;  2XGS A;  4N3C A;  2WQH A;  3FDH A;  3O4Z A;  4TV3 A;  4F53 A;  2LAI A;  2VSX E;  5D0O D;  3L13 A;  1INZ A;  4I6J A;  1H2T C;  2WPV A;  2X6I A;  3FWV A;  3URZ A;  3T8M A;  2LSV A;  4BT8 A;  3G2W A;  3TJP A;  4EBA G;  2DBA A;  1Z6T A;  2CHZ A;  3EIJ A;  4EZJ A;  3U4T A;  4G2V A;  2OND A;  3LJ3 A;  3QWW A;  2UY1 A;  4PH4 B;  3S7F A;  4J8D A;  2JLB A;  3HHM A;  3FEX A;  5G04 J;  3GZS A;  3U9W A;  4WWO A;  2OVF A;  3Q15 A;  1E7V A;  4G11 A;  3QJZ A;  1N52 A;  4G26 A;  4FP7 A;  3ZYL A;  2FEZ A;  2YIN A;  4KT6 B;  4Q96 A;  4R7L A;  3RJV A;  4F7A A;  3OXF A;  5EX0 A;  3UUX A;  2PQR A;  3ZPJ A;  2J07 A;  4GMJ A;  3CVY A;  4HS2 A;  4I2W A;  4EQF A;  4UWG A;  5DIZ A;  2OV8 A;  2I1K A;  3VTY A;  3FTV A;  2J09 A;  2KC7 A;  3CLJ A;  4JL0 A;  3CV0 A;  4LUN U;  5KCM A;  4LEU A;  3CHS A;  3FTX A;  4GZ5 A;  3L08 A;  5AIJ A;  3G2U A;  4N3B A;  1EPU A;  1Y6I A;  1Z3X A;  4C9B B;  4Y6C A;  4KBQ A;  3LEW A;  1BPO A;  1UN9 A;  3SZ7 A;  2WXI A;  4U04 A;  1S0P A;  3ENE A;  3S7D A;  4ATG A;  4HOS A;  3QOU A;  1HO8 A;  2VSO E;  3U66 A;  4WWP A;  1MQS A;  3ESK A;  3HVE B;  4I1M A;  3LY9 A;  3HIZ A;  4GYW A;  4CGV A;  1JPL A;  5ARG A;  2WB2 A;  2DIW A;  2L6J A;  4MKT A;  2CG2 A;  4IRU A;  1JUQ A;  1H0A A;  1XNF A;  2MHK A;  3CHM A;  1HG2 A;  4PS7 A;  5CCM A;  2WXQ A;  2KZT A;  3PUK A;  4UI9 C;  4DLQ A;  4K03 A;  1FVF A;  2XPI A;  2MRI A;  3MYV A;  3SGH A;  5BV1 A;  3ASH A;  5LP0 A;  3VTX A;  5C1D A;  2HO1 A;  3CIA A;  3MJW A;  4QFV A;  3CVU A;  2L0T B;  5JJ6 A;  5EX3 A;  3L54 A;  4FJZ A;  2V5F A;  4KVM A;  4JHJ A;  4XKC A;  1H2U A;  3OAW A;  4CDR A;  1IHG A;  2J4B A;  2WXK A;  2XCC A;  2YNQ A;  4JXT A;  4WNE A;  4KMO A;  3UT8 A;  4I6E A;  2M63 A;  3B7S A;  4RSY A;  3ZFW A;  3TGO A;  5G05 C;  4N3A A;  3FH5 A;  2WQ6 A;  4L1B A;  3JYS A;  5LFA A;  3ONK A;  5CMY A;  4HLE A;  3QK0 A;  3FUK A;  3LDZ A;  1MHQ A;  2KZT B;  1UJK A;  2XGM A;  3L16 A;  4YND A;  2KCV A;  4WNG A;  1DVP A;  1HZ4 A;  2VSY A;  3U3W A;  3S7B A;  1NZN A;  3KD7 A;  2YHC A;  4BX9 A;  2DCP A;  3FUN A;  4PDX A;  1OWP A;  3SBS A;  3FUL A;  1YA0 A;  3SBT B;  3KEZ A;  3LVQ E;  2C0L A;  4XI0 A;  5FJY A;  4PUC A;  3L22 A;  5CHE E;  4CDM A;  3CVV A;  3IKO B;  3SI5 A;  4ACL A;  3CVW A;  4GAA A;  2LO6 A;  4J8E A;  3IHV A;  1QQE A;  4UWK A;  1W3B A;  4J8S A;  4APO A;  3APC A;  3LY7 A;  2J9Q A;  3APD A;  2VGX A;  4GA1 A;  4LCT A;  1HX8 A;  2YQ8 A;  4MLP A;  4ACK A;  5T3R A;  4ANU A;  4TRQ A;  2WXN A;  2AWI A;  3K9I A;  3ZYK A;  2CFZ A;  3EIQ C;  1UW4 B;  3PE3 A;  3ZYM A;  5ANL A;  4F1S A;  3QB2 A;  3PS6 A;  2FBN A;  2WXO A;  3APF A;  3D3M A;  3FUI A;  3FUM A;  4UWF A;  4B8A A;  4U63 A;  4EEC A;  3ZXS A;  4DI3 A;  4EPZ A;  3AU4 A;  1OWN A;  4JHK A;  4GB9 A;  2CHX A;  4JEU A;  3ASG A;  3LVR E;  2IU1 A;  2PZI A;  2GGF A;  3PE4 A;  2AW6 A;  3P1U A;  3FU0 A;  3FUJ A;  4L23 A;  4AP2 A;  4G23 A;  3FFL A;  1HS6 A;  2XRY A;  1PY1 A;  4GZC A;  2WM9 A;  4J0U A;  3ML9 A;  2AVP A;  4CT4 A;  4A1S A;  4PS8 A;  1ELR A;  4AJW A;  3T5X A;  2WXJ A;  2VGX B;  2CHW A;  3CKB A;  4GA2 A;  3NZU A;  3MKQ A;  4AVX A;  4AY6 A;  5T4Y A;  4JZY A;  3TG5 A;  4B89 A;  1OUV A;  3JQ0 A;  2IQC A;  4KZ0 A;  3CQC B;  4YVO A;  4JA9 A;  3SHF A;  1QNF A;  2PL2 A;  5BPP A;  1A17 A;  3FTS A;  4F3V A;  2XQ0 A;  1B89 A;  4JHR A;  2QY7 A;  3CVN A;  5HI7 A;  3UX4 A;  2CFU A;  2KCL A;  3ASF A;  5LCW C;  4XKB A;  3OTN A;  3PVL A;  1IYG A;  2XPY A;  3ZEF A;  4V3I A;  2Y4U A;  3FUH A;  3OXG A;  3QAR A;  4FJY A;  4U8H A;  2WXF A;  2A5U A;  2AXU A;  4XI9 A;  5E76 A;  3QWV A;  3CQG B;  4AEZ C;  2A4Z A;  2EQX A;  4EZK A;  3CVX A;  3Q4A B;  4GZ3 A;  2R59 A;  4IN3 B;  4HVB A;  4HOR A;  3D9I A;  2KAT A;  3B7T A;  4HXI A;  2KM4 A;  2LNI A;  3Q47 B;  4ILI A;  4U0U A;  2LAH A;  2VQ2 A;  4CRW A;  1WY6 A;  3N71 A;  4NAC A;  4BTB A;  1EDU A;  2AXV A;  1N54 A;  4U0S A;  4ILH B;  4A3V A;  3CR3 A;  3I5P A;  1H2V C;  3NQP A;  3TL5 A;  3LCA A;  4TUU A;  3JUI A;  3QKY A;  4FA6 A;  2OOE A;  4BY6 A;  4XE0 A;  4RG6 A;  4FLB A;  4I1A A;  3ZVV A;  3B13 A;  1U3D A;  3PEV B;  4GYY A;  3PEU B;  4XX5 A;  2NSZ A;  4EZL A;  3LPZ A;  3T5V A;  4RG9 A;  2WQ7 A;  3FTU A;  1HXI A;  2V4L A;  4B0Z A;  4GZD A;  1IQU A;  4PS3 A;  4YVQ C;  1NA0 A;  4Q69 A;  4KYO B;  2Q7F A;  4OVU A;  3GYZ A;  3EHN A;  2VGY A;  3HYM B;  1UN8 A;  4ILG A;  3FTW A;  4KVO A;  5BT1 A;  3S7J A;  4KXK B;  5FT9 A;  3L6A A;  3FEY A;  3FH8 A;  4GZ6 A;  4G1T A;  4DI4 A;  2IFU A;  3G2S A;  3QC1 A;  3ONL A;  5E75 A;  3FHE A;  3FP3 A;  4AY5 A;  1L5J A;  1E8Y A;  1LF8 A;  1EF1 C;  4AM9 A;  3P2B A;  3IHY A;  3IBE A;  5C2Y A;  3D9O A;  3GW4 A;  5BV0 A;  1SQM A;  3CVQ A;  2NC9 A;  3R7Q A;  3TG4 A;  2IOS A;  4E6H A;  4HOU A;  3SFZ A;  3FU6 A;  3ZIM A;  2WVI A;  2PQN A;  3DBS A;  4UWH A;  5LX8 A;  4D10 C;  1X5B A;  4FU3 A;  5G55 A;  2V8S E;  2XGO A;  4Q94 A;  2AXZ A;  4GPK A;  3GZ1 A;  2HM8 A;  4BT9 A;  4LER A;  1JWG A;  2E0I A;  3MCX A;  3PRE A;  1FCH A;  4L7T A;  3I4R B;  1KT1 A;  4CDN A;  4FHJ A;  4AXH A;  2WMN A;  5JJT A;  3EDT B;  1OWM A;  1KLX A;  3CHR A;  3FH7 A;  3TAX A;  1Y8M A;  1FVH A;  5FTP A;  2XPZ A;  4CEM A;  2FF4 A;  2WMO A;  4XIF A;  1E8X A;  2L9B A;  3ML8 A;  2HR2 A;  4I1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...