3L6AA

Crystal structure of the c-terminal region of human p97
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
360
structure length
350
Chain Sequence
b'HHSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 4 gamma 2
publication title Crystal structure of the C-terminal region of Human p97/DAP5
doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 131
structure length 350
sequence length 360
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA01
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA02
2IOSA 4C9BB 4CRWA 3RK6A 4JHKA 2I2OA 1H2UA 2VSXE 2IU1A 1N54A 2ZU6B 4JHJA 3EIQC 4B8CB 2KZTB 2VSOE 4B8AA 3L6AA 3JUIA 2GGFA 2IONA 1H2TC 1HU3A 4CT4A 5ANRA 4B89A 3EIJA 1UW4B 3D3MA 2FULA 3FEYA 2IOLA 4CEMA 1UG3A 3FEXA 4GMJA 2RG8A 1H6KA 2KZTA 4LUNU 1H2VC 1PAQA 1N52A 4GMLA 2HM8A 4IULA 2NSZA
chains in the Genus database with same CATH superfamily
4GA2A 5BXOA 1KLXA 1ELRA 5AIJA 3MCXA 5EX0A 3LXUX 3PE3A 3JUEA 3B7TA 1EYHA 3IV0A 2J8SD 4J7WA 4UWGA 5BNWA 4AV7A 3U64A 1NA3A 4Q94A 2I2OA 2KCLA 4GA0A 2XS1A 3FTSA 3EHNA 3SNXA 5H7PA 2DBAA 4AIFA 2P58C 3CK9A 5AQ7A 3EDTB 1IHBA 4DX6D 4GB9A 1HZ4A 2IEJA 4W9RA 3ESLA 2GRMA 5M72A 4CT0A 2AW6A 4J6IA 4JHRA 2QC9A 2GGFA 2DYSE 4G2VA 2HE0A 4WWPA 4PS3A 5T3RA 5ANRA 1Y6IA 4QQIA 5BT1A 5EX3A 2R05A 1EDUA 3Q15A 5ENOD 3Q4AB 3ZPJA 3MEKA 3CSTA 1D9SA 3LKUA 3ZUVB 3C3OA 4JL0A 5A7DB 2QZAA 5E75A 2ZISA 3FTYA 2F8YA 4KBQA 5JJ7A 3DPDA 3NAWA 3SD5A 1E90A 5D66A 4MKTA 2OVFA 3DRAA 4EBAA 4BWRA 2XPZA 4HORA 5CBNA 5EIDA 4ZFHA 2LUHA 4N2QA 2IJGX 4AOFA 1TNYA 1HH8A 4UI9C 5FQ7A 3UUXA 3FWVA 4PS7A 3JUIA 2FBNA 4F6RD 2DWZA 4EBAG 1O5MA 3CKCA 1TNOA 3RIBA 4UQXA 1FVFA 4JD2G 3AS8A 1FPPA 2VSOE 4WUYA 3CVXA 1AP7A 3HXEA 3ZHEA 3QAQA 5KJNA 2P9IG 2YQ8A 4HNAD 4BTAA 2Y0BG 3BQOA 1K1AA 3FH5A 3S7DA 1HF8A 2KATA 3CK7A 4YVOA 3PZ4A 2PQNA 3UQ3A 5AQ9A 3C3RA 5ENSD 2XEEA 3V30A 1OCZE 2P9UG 2IF4A 1HFAA 4CGVA 4BETA 2Q7FA 3Q47B 5J90A 3D9JA 2LNIA 4NACA 1N9AA 4B8AA 3LPZA 3ZYKA 2PM6A 4J0UA 2GRPB 2QYUA 3WG7E 5KWDA 4G1TA 4UWKA 5B3SE 2CHWA 1FCHA 3G2WA 3FUHA 3CVWA 5G2NA 3D9NA 3F6QA 2WXIA 4AVXA 5LCWC 2OCCE 2ZXWE 2J09A 2WXPA 3VLDA 1D8EA 3PEVB 3SFZA 4F53A 1U3DA 3EIJA 4CDRA 4G25A 3PZ3A 2WQ6A 1UG3A 4P29A 1Z5SC 3E30A 3BEEA 4UUCA 4JA9A 1HX8A 4TV3A 2VYIA 3MKQB 3FY4A 5CMYA 2H6GA 5ENPD 2X6HA 4U0UA 3EU9A 4ABNA 4UQYA 3P2BA 4PUCA 2EIME 2RFMA 2FULA 4TRQA 4GTTA 5A23A 3SGHA 1LD7A 3ZNGA 1NZNA 4V3IA 2VGXA 1UJJA 4K0RA 5LX8A 2DCPA 2AXUA 4HRNA 4I6GA 2WM9A 3MJWA 2DYRE 4ATGA 1MHQA 4AY5A 3IKOB 2LXMA 1TNZA 2IQCA 3Q5MA 3AS5A 1N0RA 4ANWA 3MYVA 3IHYA 5EKQD 1S70B 1WAO1 3B7SA 3FHEA 1JCQA 3MA5A 4LUNU 4L7TA 2V0PA 3NQPA 1E8XA 2NSZA 3B7UX 2WQ7A 3UT7A 4GZ5A 1TEZA 4GPKA 3ZFWA 1N54A 3PNTB 4GYOA 2VGEA 4XKCA 4K5CA 5CCMA 2XCBA 2R5SA 1MX2A 4G8LA 5AYWD 2C2LA 1JCSA 3FUMA 3T5XA 3UM3A 5KJKA 3PNLB 5FQ4A 3RK6A 2ILRA 4DI3A 1BU9A 2UY1A 4B8CB 4R7LA 5CMWA 2IO3C 3QOUA 3PH0C 2XHEA 5B1AE 4HOSA 4JXTA 3UIPC 3IEGA 4G24A 2XS8A 5CBOA 3UT4A 1S64A 2WMNA 3NZUA 2CHXA 5ITZF 3DXMG 4XIFA 4EZKA 3PS6A 3DEPA 2WXMA 1S63A 4Z68A 4U96D 2WPVA 4XI0A 4U8VD 3FTZA 4CRWA 5G05J 5EIBE 1YYHA 3HVEA 2YHCA 3ZN3A 4YNDA 1Z3YA 4XKBA 2C0MA 2RD0A 1RZ4A 4E85A 3Q78A 2IOLA 4WNFA 1OT8A 3CQCB 3QWWA 3RKVA 4I6EA 4YDWA 1HXIA 3AG2E 4DX2A 4ANUA 3APFA 3AS4A 5FZSA 4KVOA 3CIAA 4FJYA 4G11A 4TXQA 2MOWA 4A3TA 2XPYA 4XI9A 1ZU2A 4GZ3A 1E7UA 2WXNA 1GW6A 4A55A 3U9WA 2M63A 2ZU6B 1K1BA 3BG1B 3FU5A 2XGOA 4UI9K 3HHMA 3FEYA 1IQUA 3S2AA 1PC2A 2LXLA 3PREA 3VTYA 3SHFA 3ZGQA 3RJVA 1H0AA 1TNBA 4BESA 2X6FA 2R02A 1DCQA 3KSQA 3AU4A 4BERA 3FEXA 4JB8P 2B6CA 3CHRA 2X3MA 3KEZA 5D0QD 1RW2A 4BFRA 3FU0A 3URZA 3DWLG 3C3QA 3Q75A 2E0IA 2Y3AA 2OEWA 3DSSA 4RQIA 1O1RA 4ANVA 1BI8B 3NZSA 5LFAA 3L13A 3G2UA 4BY6A 4A1GA 5BW8C 3TJPA 2I1KA 3X2QE 1OUVA 4RG9A 1QBQA 2QYJA 1QZ2A 3LVRE 3ULYA 3Q7AA 5FT9A 3G2TA 4FA6A 1BD8A 1VDYA 3ASNE 1UJKA 5CRVA 1V55E 4MS6A 4YDYA 4BT8A 4APOA 3L22A 4DX5D 1B89A 4OVUA 2JABA 4I2WA 4JEUA 2RG8A 4QFVA 3ONLA 5KBAA 3RRNB 3FH7A 1OWNA 2VQ2A 3FUJA 1HG5A 4WAFA 1KT0A 4ILIA 3Q79A 5JJ6A 3E32A 5FZQA 2CFZA 1N0QA 2PZIA 3FUFA 2J49A 5AJDA 4DI4A 4KXKB 3SFXA 4BEPA 3BG0B 2PQRA 4J8DA 4FHKA 3UTMA 1XNFA 4LNUD 4BX9A 4ME2A 1UOHA 4EHMA 3APDA 4I9EA 4EZLA 4GZCA 4E6HA 4N3CA 4H7XA 5T4YA 5AN8A 5JHBA 3NOGD 3O48A 3CHMA 4H7YA 4JW1A 2WB2A 2ETBA 3MGBA 2V5QC 3DSXA 2RKKA 4XEIG 4APFA 5HRYA 2CFUA 4BSZB 1N4QA 3CHSA 4DPRA 4PH4B 1KPSB 1DNPA 2H6FA 3DSUA 1LTXA 3I5PA 5ARGA 2P9PG 5FTPA 5KNGA 2EIKE 1O1TA 2J08A 5D2MC 1TJFA 3FTUA 3ZEFA 2BTDA 4Y6WA 3T8MA 3UM0A 1OWPA 2GROB 3CVYA 3HXFA 2UWJG 4Q96A 3AG3E 4GAAA 1N11A 3HXCA 4ATZD 4HRMB 2GW1A 3ZYLA 3AG4E 3GZ2A 2VTBB 1E8YA 2X6KA 4BTBA 2X38A 4U0ZA 3PE4A 2XQ0A 3D9MA 4L23A 3EHMA 3PUKA 1HE8A 5G04J 4EZJA 4HOQA 2BEDA 5HI7A 5IY5E 1HO8A 2CG3A 1MX4A 2P9SG 1NP7A 4TXPA 5ENTD 2ETCA 1H2VC 1IKND 4C0EA 2NYJA 3CVNA 2PL2A 3TAXA 2VGYA 3LDZA 1A5EA 2L6BA 4HQDA 1HU3A 1U3CA 1OY3D 2XGMA 3AG1E 1NI1A 1SQMA 3KS2A 3T9KA 3ABLE 1UW4B 3I4GA 2Y69E 3FTWA 3D9IA 2ETAA 3CVLA 2L0TB 3D9PA 3ASOE 5T8IA 4UWLA 4N3BA 3ASFA 1K8KG 3UXGA 4JHJA 3GW4A 4WNEA 2R2LA 2I9CA 4JPSA 4KVMA 3CLJA 3JYSA 1Y8MA 4HLEA 1TJCA 2BUGA 3ML8A 2J9QA 2BF0X 2V5FA 4I6JA 3ASHA 4OAVB 1K3ZD 4XX5A 3WXXA 2X6IA 1DVPA 3TXNA 5AENA 4EQFA 3ABME 1OCCE 3AAAC 3L9TA 3EUVA 2CHZA 3MV2B 3TWQA 4AEZC 1XGWA 3G2SA 2BKGA 3QC1A 4DX7D 4DJAA 3ZVVA 2FEZA 4N2SA 1TN6A 3T8KA 4CZ2D 4YDEA 3D3MA 4JZYA 4U0SA 4GMLA 2L6JA 3TWTA 1KT1A 3L08A 1TN7A 4IN3B 4JHKA 2XRYA 3QK0A 4LNBA 3JQ0A 3PUJA 4FLHA 2QY7A 3ABKE 1OWLA 2FI7A 3D9HA 2WXOA 1BLXB 2XEHA 1YCSB 1E96B 1BPOA 3CK8A 4MLPA 4A1SA 2A4ZA 4LNGA 5B1BE 4ILGA 4AJWA 3QB2A 2E2EA 1IXVA 4UI9J 3BUAA 3HYMB 1JPLA 3ISMC 4I1MA 4WWNA 3MKRA 4JEHA 3JCKC 1WY6A 5EILA 4GZ6A 4I1AA 2DVWA 2IFUA 5BV1A 3TWWA 3CHOA 3UKUG 4ANXA 1QNFA 4LERA 2XEVA 3ZIMA 3PZ2A 2XRZA 3V79K 2WXQA 4N5QA 5AQBA 3TG4A 3TWVA 3FDHA 3CEQA 1WDYA 3L17A 1DCEA 3S7JA 3TL5A 3PZ1A 3V31A 3VLFA 1E8ZA 1LD8A 1L5JA 1TYQG 3LY8A 4HI9A 1MJ0A 1TN8A 2MHKA 2HM8A 4EPZA 1EPUA 4J8EA 2LAHA 3SY2A 2DZNA 2B0OE 3TWUA 2PM7A 3TWXA 2J4BA 3LJ3A 1FT2A 3D9KA 3DSWA 4ILHB 4GZDA 2BKKB 3FU6A 2KCVA 2QFCA 3PZDA 2GRNB 5HKPA 3L54A 3D9LA 3CSFA 2NC9A 4HVBA 4HI8A 3P1UA 1YMPA 3O4ZA 3DSTA 3E37A 3B13A 4U95D 5EYPF 5LCWJ 3RO2A 1MYOA 3DPYA 4MRUA 2R59A 2WXRA 2HO1A 3S7FA 4OAUC 4C48B 3HXBA 2EQXA 3ZYMA 2AXVA 3LS8A 3ZHEB 5DBKA 3E4BA 3TWRA 2WXKA 3U3WA 4N39A 2IONA 1ZB1A 2AWIA 5FQ6A 3EHRA 3ASDA 1KZOA 5AQAA 4GTRA 2WXGA 1N4RA 5CECB 3UX4A 3GYZA 3MX3A 3E33A 4K5AB 4TXRA 4FLBA 5D0OD 2WXLA 3FU3A 3HG0D 4O1PA 4CT4A 4PS8A 3R9MA 2PNNA 5C1DA 3BU8A 2F8XK 1SA5A 3KEAA 4WWOA 1S0PA 4A63B 2L0IA 2KZTA 3LY7A 2J07A 3EU5A 5JA4D 2WXJA 4GTSA 1MZCA 5FJYA 4NRHB 4HOUA 5CEAA 5CRUA 5HS0A 4AY6A 4J8SA 4I2ZA 3UM1A 3KSLA 5EN5D 5C2YA 3FUEA 4RG6A 1FVHA 4NURA 4X8QA 1WG0A 3MKQA 1H6KA 3L16A 4ACLA 3SI5A 2ONDA 3Q9NC 3QDNA 3ZYQA 5JJTA 1P5QA 1QYMA 3ULQA 1ELWA 1JUQA 2Y4TA 2AXZA 3EJNA 4FP7A 4CYMD 3FUIA 4O1OA 4CGWA 2L9BA 3NB2A 2X6JA 4DUIA 1KZPA 2XPIA 2LAIA 4UQZA 4DRXE 3LEWA 4G23A 3ASGA 3OXLA 3Q73A 5BUZA 3W9FA 2VGXB 4WNGA 3QJZA 4I43A 3ONKA 3SQVA 3KD7A 3FUNA 3UT8A 5FIOA 5LP0A 2OOEA 1N95A 3T5VA 2KBXA 3Q7FA 4HRLA 5FZRA 4CDMA 3SBSA 3PDNA 3I4RB 2V4HC 4F3VA 1FT1A 1IHGA 3FUKA 1TR4A 4GTOA 5EYLA 3FTXA 3DSVA 4XE0A 2HR2A 4HOTA 1H6PA 1O1SA 5KNHD 2IU1A 3SFYA 4RSYA 4I9CA 2P9KG 5ARFA 3NBNB 4AM9A 1WM5A 3RSEG 3JXIA 2WVIA 3MV3B 3LY9A 3APCA 2UY1B 4HFGA 4MBGA 2R17C 3FH8A 3CQGB 2ZIRA 3B95A 3SF4A 1SA4A 2VSYA 4U8YD 5LOZA 4U07A 5ANLA 1EF1C 3IXEA 3Q9UC 5J08A 3CHPA 3TWSA 4BX8A 4CCAA 2WXHA 2YINA 1JWFA 3KAEA 4GTMA 4DLOA 3ZKJA 3CKBA 4URKA 1N4PA 1PY1A 3IBEA 1Z3XA 4HS2A 2IO2C 2VJ8A 1G3NB 4G26A 3QWVA 5FQ8A 5G55A 4ACKA 5CERB 4DLQA 3QKYA 4U04A 2XCCA 4DX1A 4AP2A 3HVEB 4KYOB 4FC8A 4A3VA 1SZ9A 1TNUA 3SZ7A 3ML9A 3VTXA 2WQHA 3D9OA 3S7BA 3K9IA 3V2OA 2EIJE 3LJNA 4FADA 3R7RA 3RO3A 2FO7A 2DZOA 3HXDA 2LSVA 3J5QB 4RVBA 1JWGA 3GZ1A 4U7EB 4J8YA 2KC7A 5FWQA 3FUDA 1NL4A 2JLBA 3E34A 1H2TC 1W3BA 3DXKG 4JVSA 5JHAA 3UI2A 2H6HA 5AARA 5AJLA 3FP3A 1LF8A 3UM2A 3GZSA 3PVLA 4L2YA 5G05C 2V4LA 3CHQA 5CEDB 1NA0A 1SVXA 4L9PA 2AJAA 3ULEG 4LSZE 3CR3A 3SO8A 4BT9A 3QARA 4DK5A 4GYWA 3ZRHA 3UINC 2IY0C 5KJLA 2Y4UA 1SW6A 4UWFA 4GA1A 3LCAA 4N5CA 3L82A 5EDSA 4Q69A 4YVQC 1H6OA 4FU3A 5AAOA 2KZTB 3L6AA 3ENEA 2GRRB 4B89A 3UKRG 5FINA 4GPMA 1HG2A 4IULA 1YA0A 1Q2ZA 4C9BB 2MRIA 3Q49B 4KT6B 2JEKA 1X5BA 4O6FA 2FF4A 3C5RA 5JMND 3HRAA 5CHEE 4F7AA 4HB5A 1INZA 1N4SA 4GU5A 4WNDA 2VSNA 4ZHBA 3SBTB 3OXFA 2YNQA 3LYAA 2IOSA 1QQEA 4I1OB 4Y6CA 4IYPA 3R9AB 3R7QA 1A17A 2A5UA 5KJMA 2I1JA 2WMOA 2J4DA 1N52A 1HS6A 4M3OA 3IHVA 4BSXA 4FULA 1H19A 2NXPA 2XZTG 4OVVA 4IRUA 4JC8A 4LEUA 1N94A 3B7RL 1Z6TA 2R03A 4N3AA 4HLLA 3I3NA 3JXJA 3AJIA 3U66A 1E8WA 3FFLA 4LG6A 2F37A 1UN9A 3CVPA 1IYGA 4L2LA 2WXFA 1OWOA 2P2CP 4LCTA 2KCKA 5BXUA 4XZ4A 4C0MA 3RRUA 3NF1A 5ENNA 4KZ0A 4KZCA 3V2XA 4CEMA 1UN8A 4K5BA 2XENA 3MZLB 4L1BA 3RRMB 3W9GA 3JQ1A 2EINE 4F1PA 3CVUA 2FO1E 3DEOA 3AU5A 4GMJA 1OXJA 2GRQB 4OYSA 1SZAA 3J5PA 3G2VA 5ENQD 4LRZA 1H2UA 1V54E 2YHEA 3UPVA 1NFIE 3QNKA 2LSUA 3VLEA 1BI7B 3PRZA 1OCRE 2A5EA 4YDOA 2LO6A 4B93B 4AXHA 3C72A 5ENRD 4HBDA 3TG5A 1PAQA 2VTBA 2P9NG 2OEVA 4U8HA 1AWCB 1D8DA 4FHJA 1IQRA 2VSXE 2GRLA 4GTVA 3OAWA 4EECA 3RU0A 2HYZA 4GTQA 4F1SA 1U2VG 1X81A 3NOCD 5E76A 3HDXA 2KM4A 3ZXPA 3TXMA 4B94A 4I17A 2XGSA 3DBSA 1ZBPA 3ZW3A 4O60A 2Y1LE 3TGOA 2KXPC 2C0LA 4GMRA 5DIZA 4UWHA 3EHQA 4JA7A 4J8FA 3OXGA 4M7CA 5HQ8A 4KMOA 3UMVA 5A6CA 3HIZA 3RAUA 3ZXSA 4U63A 3N71A 4B0ZA 3CVQA 2AVPA 2DIWA 1JCRA 1OWMA 3PEUB 4GCOA 2CG2A 3CV0A 2V8SE 1E7VA 4GYYA 3UIOC 5BPPA 3LVQE 2XZDG 2EILE 4K03A 2ZGDA 2ZGGA 3EIQC 3QWPA 4RLYA 4GCNA 3U4TA 3ZU7B 4GTPA 3CGHA 1MX6A 4HXIA 2H6IA 3C98A 1MQSA 2OVBA 3CVVA 4CDNA 4FJZA 3ESKA 3FTVA 5KCMA 4NIKA 4PDXA 4NQ0A 5BV0A 4D10C 2I6HA 2OV8A 3B7BA 4TUMA 5G04C 1DC2A 2F0YA 3FULA 3OTNA 4G8KA 1ELKA 2MYOA 2P9LG 5CCLA 1OCOE 2RFAA 4TUUA
chains in the Genus database with same CATH topology
4DLOA 4GA2A 3CKBA 3FTZA 4CRWA 4URKA 5G05J 1PY1A 3IBEA 1KLXA 1Z3XA 4HS2A 1ELRA 3HVEA 5AIJA 3MCXA 2YHCA 3ZN3A 4YNDA 2VJ8A 4G26A 5EX0A 3QWVA 5FQ8A 5G55A 1Z3YA 3LXUX 3PE3A 4XKBA 4ACKA 2C0MA 2RD0A 4DLQA 3QKYA 3B7TA 1EYHA 4E85A 3D3MA 3IV0A 4JZYA 4U04A 2IOLA 2XCCA 4WNFA 3CQCB 3QWWA 4U0SA 3RKVA 4I6EA 4AP2A 3HVEB 4KYOB 4UWGA 4FC8A 4GMLA 4A3VA 5BNWA 2L6JA 1SZ9A 1HXIA 1KT1A 3L08A 3ML9A 3SZ7A 3VTXA 4AV7A 4IN3B 3U64A 4ANUA 3APFA 1NA3A 4JHKA 2I2OA 3AS4A 4Q94A 2XRYA 3QK0A 2WQHA 2KCLA 5FZSA 4KVOA 3D9OA 3S7BA 3CIAA 4FJYA 3K9IA 3JQ0A 3PUJA 4FLHA 4GA0A 4G11A 2QY7A 3FTSA 1OWLA 2FI7A 2WXOA 4FADA 2MOWA 3EHNA 3R7RA 4A3TA 3CVVA 2XPYA 3SNXA 2DBAA 4XI9A 3RO3A 1ZU2A 4GZ3A 4AIFA 2FO7A 2P58C 1E96B 1E7UA 3CK9A 1BPOA 3CK8A 4MLPA 3EDTB 2LSVA 4A1SA 4RVBA 1JWGA 1HZ4A 2WXNA 2A4ZA 3GZ1A 1GW6A 4GB9A 4W9RA 4A55A 3ESLA 4ILGA 2KC7A 4AJWA 3QB2A 2GRMA 5M72A 3U9WA 5FWQA 4CT0A 2E2EA 2M63A 2AW6A 2ZU6B 4J6IA 3FUDA 4JHRA 3BG1B 4UI9J 3FU5A 2GGFA 2JLBA 2XGOA 4G2VA 1H2TC 3HYMB 1W3BA 4UI9K 4WWPA 1JPLA 4I1MA 4JVSA 4PS3A 5ANRA 4WWNA 1Y6IA 3HHMA 5T3RA 5EX3A 5BT1A 5JHAA 3MKRA 1EDUA 3Q15A 4JEHA 3FEYA 3JCKC 5AJLA 1WY6A 3FP3A 1LF8A 3Q4AB 4GZ6A 4I1AA 1IQUA 3S2AA 3ZPJA 1PC2A 3GZSA 3MEKA 3PVLA 3PREA 4L2YA 3VTYA 2IFUA 5G05C 3CSTA 3SHFA 3LKUA 3ZGQA 2V4LA 5BV1A 3RJVA 3CHQA 1NA0A 4JL0A 1H0AA 5A7DB 3CHOA 4ANXA 1QNFA 4LERA 3CR3A 4BT9A 4DK5A 3QARA 4GYWA 5E75A 3ZRHA 2XEVA 3ZIMA 3FTYA 5KJLA 2X6FA 2Y4UA 2XRZA 4KBQA 4UWFA 4GA1A 2WXQA 3AU4A 3LCAA 5JJ7A 4N5CA 3FEXA 3DPDA 3TG4A 5EDSA 3FDHA 4YVQC 4Q69A 3CHRA 2X3MA 4FU3A 3KEZA 5D0QD 3CEQA 3SD5A 4BFRA 1E90A 3L17A 3FU0A 3URZA 3S7JA 4MKTA 2KZTB 3TL5A 2E0IA 2Y3AA 2OVFA 3L6AA 3VLFA 1E8ZA 3ENEA 4B89A 1L5JA 4ANVA 3LY8A 4EBAA 4BWRA 2XPZA 4HORA 3NZSA 5LFAA 3L13A 4N2QA 3G2UA 2IJGX 2MHKA 2HM8A 4BY6A 1HG2A 4IULA 1YA0A 4AOFA 1HH8A 1EPUA 4EPZA 4A1GA 4C9BB 2MRIA 3Q49B 4KT6B 2I1KA 4J8EA 5BW8C 3TJPA 2JEKA 2LAHA 1OUVA 4RG9A 4UI9C 5FQ7A 3UUXA 1X5BA 3FWVA 4O6FA 2FF4A 4PS7A 3JUIA 2FBNA 5CHEE 4F7AA 1INZA 4EBAG 1QZ2A 4GU5A 3CKCA 4WNDA 2PM7A 3LVRE 2J4BA 2VSNA 3LJ3A 3RIBA 3SBTB 5FT9A 3D9KA 3G2TA 4ILHB 4UQXA 4GZDA 3FU6A 2KCVA 2QFCA 3OXFA 3PZDA 1FVFA 3L54A 2YNQA 3LYAA 3D9LA 3CSFA 2IOSA 2NC9A 4FA6A 4HVBA 1QQEA 1VDYA 3AS8A 3P1UA 4I1OB 3O4ZA 4Y6CA 4IYPA 1UJKA 2VSOE 3R9AB 4WUYA 3R7QA 3B13A 1A17A 2A5UA 4MS6A 5LCWJ 3RO2A 3CVXA 4BT8A 3ZHEA 4MRUA 2R59A 3QAQA 4APOA 2WXRA 5KJNA 3L22A 2HO1A 3S7FA 1B89A 2YQ8A 4OVUA 4I2WA 5KJMA 2I1JA 4JEUA 4BTAA 2RG8A 2WMOA 2J4DA 2EQXA 1N52A 4QFVA 3ONLA 3ZYMA 1HS6A 2AXVA 3FH5A 3RRNB 3LS8A 3ZHEB 4M3OA 3IHVA 5DBKA 4BSXA 3FH7A 1OWNA 1HF8A 3S7DA 2KATA 2VQ2A 3E4BA 3FUJA 4FULA 1H19A 1HG5A 2NXPA 1KT0A 3CK7A 4IRUA 2WXKA 4OVVA 4WAFA 4ILIA 4YVOA 2PQNA 4JC8A 4LEUA 3UQ3A 3U3WA 5JJ6A 3B7RL 1Z6TA 5FZQA 2CFZA 4N39A 4N3AA 2IONA 2PZIA 3FUFA 3I3NA 2AWIA 5FQ6A 3ASDA 2J49A 3U66A 1E8WA 5AJDA 4DI4A 3FFLA 2IF4A 1HFAA 4KXKB 2WXGA 1UN9A 3BG0B 3CVPA 1IYGA 2PQRA 4CGVA 2Q7FA 3Q47B 4J8DA 4FHKA 3UX4A 3GYZA 3MX3A 1XNFA 3D9JA 4L2LA 5J90A 2LNIA 2WXFA 4NACA 4BX9A 1OWOA 4LCTA 4ME2A 2KCKA 4FLBA 5D0OD 3APDA 2WXLA 3FU3A 4I9EA 4EZLA 4B8AA 3LPZA 3ZYKA 4GZCA 4XZ4A 2PM6A 4CT4A 4E6HA 4J0UA 4PS8A 4N3CA 4C0MA 4H7XA 3RRUA 5T4YA 5C1DA 5JHBA 3NF1A 5ENNA 3O48A 4KZ0A 4KZCA 4WWOA 1S0PA 4G1TA 4CEMA 4UWKA 2L0IA 2CHWA 1FCHA 1UN8A 2J07A 2KZTA 3G2WA 3FUHA 3LY7A 3CVWA 3CHMA 4H7YA 5G2NA 4JW1A 2WB2A 3D9NA 2WXJA 5FJYA 3MZLB 4L1BA 2WXIA 3RRMB 3MGBA 4NRHB 4HOUA 4AVXA 3JQ1A 4APFA 4AY6A 5LCWC 4J8SA 4I2ZA 2CFUA 2J09A 2WXPA 5C2YA 3VLDA 3FUEA 3PEVB 4RG6A 3CVUA 3SFZA 4F53A 1FVHA 1U3DA 4NURA 3CHSA 3AU5A 3EIJA 4CDRA 4DPRA 4G25A 2WQ6A 3MKQA 1UG3A 4GMJA 4PH4B 1H6KA 1DNPA 3L16A 4P29A 4OYSA 1SZAA 4ACLA 3G2VA 3SI5A 2ONDA 3BEEA 3QDNA 4LRZA 4JA9A 3ZYQA 1HX8A 4TV3A 1H2UA 2VYIA 2YHEA 3MKQB 3FY4A 5CMYA 3UPVA 2X6HA 3I5PA 5ARGA 5JJTA 1P5QA 4U0UA 4ABNA 3ULQA 4UQYA 5FTPA 3P2BA 1ELWA 2J08A 3QNKA 1JUQA 1TJFA 2LSUA 3FTUA 4PUCA 3VLEA 2Y4TA 2FULA 3ZEFA 3PRZA 4TRQA 2AXZA 2LO6A 2BTDA 3EJNA 3TG5A 4AXHA 5A23A 4Y6WA 3T8MA 4FP7A 1OWPA 1PAQA 2VTBA 3CVYA 2UWJG 3FUIA 3SGHA 4Q96A 4U8HA 4CGWA 1NZNA 2L9BA 4GAAA 4FHJA 1IQRA 2VSXE 2GRLA 4V3IA 2X6JA 2GW1A 3ZYLA 3OAWA 2VGXA 4EECA 1UJJA 3GZ2A 3RU0A 2XPIA 2VTBB 2HYZA 4K0RA 2LAIA 5LX8A 4UQZA 4F1SA 3LEWA 2DCPA 2AXUA 1E8YA 3ASGA 4G23A 3OXLA 5E76A 3HDXA 2KM4A 2X6KA 4BTBA 5BUZA 2X38A 4I6GA 2WM9A 4U0ZA 3MJWA 3PE4A 2VGXB 2XQ0A 4WNGA 3QJZA 4ATGA 3D9MA 1MHQA 3TXMA 4AY5A 4I43A 3IKOB 4B94A 4I17A 4L23A 2XGSA 3DBSA 3EHMA 3PUKA 3ONKA 1HE8A 1ZBPA 2IQCA 3Q5MA 3ZW3A 3AS5A 4ANWA 3KD7A 5G04J 4HOQA 4EZJA 3MYVA 3TGOA 3IHYA 2C0LA 5HI7A 5EKQD 3FUNA 1HO8A 1WAO1 3UT8A 5LP0A 5DIZA 2CG3A 2OOEA 3T5VA 3B7SA 3FHEA 3MA5A 1NP7A 4UWHA 4JA7A 4LUNU 4L7TA 1H2VC 4J8FA 2V0PA 3NQPA 3OXGA 5FZRA 1E8XA 2NSZA 4C0EA 4CDMA 3CVNA 5HQ8A 2PL2A 3B7UX 4KMOA 3TAXA 2WQ7A 3UMVA 4GZ5A 3UT7A 5A6CA 3SBSA 3HIZA 3ZXSA 2VGYA 3PDNA 4U63A 3N71A 4B0ZA 3LDZA 1TEZA 4GPKA 3I4RB 3ZFWA 1N54A 3PNTB 4F3VA 3CVQA 2AVPA 2DIWA 4GYOA 1IHGA 3FUKA 1OWMA 1HU3A 1U3CA 2XGMA 3PEUB 4XKCA 5CCMA 1SQMA 2XCBA 2R5SA 3KS2A 4GCOA 3FTXA 2CG2A 3CV0A 1UW4B 4XE0A 3I4GA 3FTWA 2HR2A 5AYWD 3D9IA 2C2LA 2V8SE 3CVLA 1E7VA 2L0TB 4GYYA 3FUMA 3T5XA 3D9PA 5KJKA 3PNLB 5T8IA 4UWLA 5BPPA 4HOTA 5FQ4A 3RK6A 2ILRA 4N3BA 3ASFA 3LVQE 4DI3A 2IU1A 4I9CA 2UY1A 4RSYA 4K03A 4JHJA 3EIQC 4B8CB 5ARFA 3GW4A 3QWPA 4GCNA 4R7LA 4WNEA 3U4TA 5CMWA 4AM9A 3CGHA 1WM5A 2WVIA 3MV3B 4HXIA 3QOUA 2I9CA 3PH0C 4JPSA 4KVMA 3C98A 3LY9A 2XHEA 3CLJA 1MQSA 1Y8MA 2OVBA 3JYSA 4CDNA 4FJZA 4HLEA 3APCA 3ESKA 2UY1B 3FTVA 1TJCA 2BUGA 3ML8A 4HFGA 4PDXA 5KCMA 4NQ0A 2J9QA 5BV0A 4HOSA 4JXTA 2BF0X 2R17C 2V5FA 4D10C 2I6HA 3ASHA 3FH8A 4I6JA 3CQGB 4XX5A 2OV8A 3WXXA 2X6IA 1DVPA 5G04C 3IEGA 3SF4A 3TXNA 2VSYA 4G24A 5AENA 5LOZA 4EQFA 4U07A 3UT4A 2WMNA 3FULA 1EF1C 2CHXA 3NZUA 3OTNA 1ELKA 5ANLA 5J08A 3CHPA 4XIFA 4BX8A 4CCAA 2CHZA 4EZKA 3MV2B 3PS6A 5CCLA 2WXHA 4AEZC 1XGWA 3G2SA 2WXMA 2YINA 1JWFA 3QC1A 2WPVA 4DJAA 4XI0A 4TUUA 3KAEA 3ZVVA 2FEZA 4N2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOS A;  4C9B B;  4CRW A;  3RK6 A;  4JHK A;  2I2O A;  1H2U A;  2VSX E;  2IU1 A;  1N54 A;  2ZU6 B;  4JHJ A;  3EIQ C;  4B8C B;  2KZT B;  2VSO E;  4B8A A;  3L6A A;  3JUI A;  2GGF A;  2ION A;  1H2T C;  1HU3 A;  4CT4 A;  5ANR A;  4B89 A;  3EIJ A;  1UW4 B;  3D3M A;  2FUL A;  3FEY A;  2IOL A;  4CEM A;  1UG3 A;  3FEX A;  4GMJ A;  2RG8 A;  1H6K A;  2KZT A;  4LUN U;  1H2V C;  1PAQ A;  1N52 A;  4GML A;  2HM8 A;  4IUL A;  2NSZ A; 
#chains in the Genus database with same CATH topology
 4GA2 A;  5BXO A;  1KLX A;  1ELR A;  5AIJ A;  3MCX A;  5EX0 A;  3LXU X;  3PE3 A;  3JUE A;  3B7T A;  1EYH A;  3IV0 A;  2J8S D;  4J7W A;  4UWG A;  5BNW A;  4AV7 A;  3U64 A;  1NA3 A;  4Q94 A;  2I2O A;  2KCL A;  4GA0 A;  2XS1 A;  3FTS A;  3EHN A;  3SNX A;  5H7P A;  2DBA A;  4AIF A;  2P58 C;  3CK9 A;  5AQ7 A;  3EDT B;  1IHB A;  4DX6 D;  4GB9 A;  1HZ4 A;  2IEJ A;  4W9R A;  3ESL A;  2GRM A;  5M72 A;  4CT0 A;  2AW6 A;  4J6I A;  4JHR A;  2QC9 A;  2GGF A;  2DYS E;  4G2V A;  2HE0 A;  4WWP A;  4PS3 A;  5T3R A;  5ANR A;  1Y6I A;  4QQI A;  5BT1 A;  5EX3 A;  2R05 A;  1EDU A;  3Q15 A;  5ENO D;  3Q4A B;  3ZPJ A;  3MEK A;  3CST A;  1D9S A;  3LKU A;  3ZUV B;  3C3O A;  4JL0 A;  5A7D B;  2QZA A;  5E75 A;  2ZIS A;  3FTY A;  2F8Y A;  4KBQ A;  5JJ7 A;  3DPD A;  3NAW A;  3SD5 A;  1E90 A;  5D66 A;  4MKT A;  2OVF A;  3DRA A;  4EBA A;  4BWR A;  2XPZ A;  4HOR A;  5CBN A;  5EID A;  4ZFH A;  2LUH A;  4N2Q A;  2IJG X;  4AOF A;  1TNY A;  1HH8 A;  4UI9 C;  5FQ7 A;  3UUX A;  3FWV A;  4PS7 A;  3JUI A;  2FBN A;  4F6R D;  2DWZ A;  4EBA G;  1O5M A;  3CKC A;  1TNO A;  3RIB A;  4UQX A;  1FVF A;  4JD2 G;  3AS8 A;  1FPP A;  2VSO E;  4WUY A;  3CVX A;  1AP7 A;  3HXE A;  3ZHE A;  3QAQ A;  5KJN A;  2P9I G;  2YQ8 A;  4HNA D;  4BTA A;  2Y0B G;  3BQO A;  1K1A A;  3FH5 A;  3S7D A;  1HF8 A;  2KAT A;  3CK7 A;  4YVO A;  3PZ4 A;  2PQN A;  3UQ3 A;  5AQ9 A;  3C3R A;  5ENS D;  2XEE A;  3V30 A;  1OCZ E;  2P9U G;  2IF4 A;  1HFA A;  4CGV A;  4BET A;  2Q7F A;  3Q47 B;  5J90 A;  3D9J A;  2LNI A;  4NAC A;  1N9A A;  4B8A A;  3LPZ A;  3ZYK A;  2PM6 A;  4J0U A;  2GRP B;  2QYU A;  3WG7 E;  5KWD A;  4G1T A;  4UWK A;  5B3S E;  2CHW A;  1FCH A;  3G2W A;  3FUH A;  3CVW A;  5G2N A;  3D9N A;  3F6Q A;  2WXI A;  4AVX A;  5LCW C;  2OCC E;  2ZXW E;  2J09 A;  2WXP A;  3VLD A;  1D8E A;  3PEV B;  3SFZ A;  4F53 A;  1U3D A;  3EIJ A;  4CDR A;  4G25 A;  3PZ3 A;  2WQ6 A;  1UG3 A;  4P29 A;  1Z5S C;  3E30 A;  3BEE A;  4UUC A;  4JA9 A;  1HX8 A;  4TV3 A;  2VYI A;  3MKQ B;  3FY4 A;  5CMY A;  2H6G A;  5ENP D;  2X6H A;  4U0U A;  3EU9 A;  4ABN A;  4UQY A;  3P2B A;  4PUC A;  2EIM E;  2RFM A;  2FUL A;  4TRQ A;  4GTT A;  5A23 A;  3SGH A;  1LD7 A;  3ZNG A;  1NZN A;  4V3I A;  2VGX A;  1UJJ A;  4K0R A;  5LX8 A;  2DCP A;  2AXU A;  4HRN A;  4I6G A;  2WM9 A;  3MJW A;  2DYR E;  4ATG A;  1MHQ A;  4AY5 A;  3IKO B;  2LXM A;  1TNZ A;  2IQC A;  3Q5M A;  3AS5 A;  1N0R A;  4ANW A;  3MYV A;  3IHY A;  5EKQ D;  1S70 B;  1WAO 1;  3B7S A;  3FHE A;  1JCQ A;  3MA5 A;  4LUN U;  4L7T A;  2V0P A;  3NQP A;  1E8X A;  2NSZ A;  3B7U X;  2WQ7 A;  3UT7 A;  4GZ5 A;  1TEZ A;  4GPK A;  3ZFW A;  1N54 A;  3PNT B;  4GYO A;  2VGE A;  4XKC A;  4K5C A;  5CCM A;  2XCB A;  2R5S A;  1MX2 A;  4G8L A;  5AYW D;  2C2L A;  1JCS A;  3FUM A;  3T5X A;  3UM3 A;  5KJK A;  3PNL B;  5FQ4 A;  3RK6 A;  2ILR A;  4DI3 A;  1BU9 A;  2UY1 A;  4B8C B;  4R7L A;  5CMW A;  2IO3 C;  3QOU A;  3PH0 C;  2XHE A;  5B1A E;  4HOS A;  4JXT A;  3UIP C;  3IEG A;  4G24 A;  2XS8 A;  5CBO A;  3UT4 A;  1S64 A;  2WMN A;  3NZU A;  2CHX A;  5ITZ F;  3DXM G;  4XIF A;  4EZK A;  3PS6 A;  3DEP A;  2WXM A;  1S63 A;  4Z68 A;  4U96 D;  2WPV A;  4XI0 A;  4U8V D;  3FTZ A;  4CRW A;  5G05 J;  5EIB E;  1YYH A;  3HVE A;  2YHC A;  3ZN3 A;  4YND A;  1Z3Y A;  4XKB A;  2C0M A;  2RD0 A;  1RZ4 A;  4E85 A;  3Q78 A;  2IOL A;  4WNF A;  1OT8 A;  3CQC B;  3QWW A;  3RKV A;  4I6E A;  4YDW A;  1HXI A;  3AG2 E;  4DX2 A;  4ANU A;  3APF A;  3AS4 A;  5FZS A;  4KVO A;  3CIA A;  4FJY A;  4G11 A;  4TXQ A;  2MOW A;  4A3T A;  2XPY A;  4XI9 A;  1ZU2 A;  4GZ3 A;  1E7U A;  2WXN A;  1GW6 A;  4A55 A;  3U9W A;  2M63 A;  2ZU6 B;  1K1B A;  3BG1 B;  3FU5 A;  2XGO A;  4UI9 K;  3HHM A;  3FEY A;  1IQU A;  3S2A A;  1PC2 A;  2LXL A;  3PRE A;  3VTY A;  3SHF A;  3ZGQ A;  3RJV A;  1H0A A;  1TNB A;  4BES A;  2X6F A;  2R02 A;  1DCQ A;  3KSQ A;  3AU4 A;  4BER A;  3FEX A;  4JB8 P;  2B6C A;  3CHR A;  2X3M A;  3KEZ A;  5D0Q D;  1RW2 A;  4BFR A;  3FU0 A;  3URZ A;  3DWL G;  3C3Q A;  3Q75 A;  2E0I A;  2Y3A A;  2OEW A;  3DSS A;  4RQI A;  1O1R A;  4ANV A;  1BI8 B;  3NZS A;  5LFA A;  3L13 A;  3G2U A;  4BY6 A;  4A1G A;  5BW8 C;  3TJP A;  2I1K A;  3X2Q E;  1OUV A;  4RG9 A;  1QBQ A;  2QYJ A;  1QZ2 A;  3LVR E;  3ULY A;  3Q7A A;  5FT9 A;  3G2T A;  4FA6 A;  1BD8 A;  1VDY A;  3ASN E;  1UJK A;  5CRV A;  1V55 E;  4MS6 A;  4YDY A;  4BT8 A;  4APO A;  3L22 A;  4DX5 D;  1B89 A;  4OVU A;  2JAB A;  4I2W A;  4JEU A;  2RG8 A;  4QFV A;  3ONL A;  5KBA A;  3RRN B;  3FH7 A;  1OWN A;  2VQ2 A;  3FUJ A;  1HG5 A;  4WAF A;  1KT0 A;  4ILI A;  3Q79 A;  5JJ6 A;  3E32 A;  5FZQ A;  2CFZ A;  1N0Q A;  2PZI A;  3FUF A;  2J49 A;  5AJD A;  4DI4 A;  4KXK B;  3SFX A;  4BEP A;  3BG0 B;  2PQR A;  4J8D A;  4FHK A;  3UTM A;  1XNF A;  4LNU D;  4BX9 A;  4ME2 A;  1UOH A;  4EHM A;  3APD A;  4I9E A;  4EZL A;  4GZC A;  4E6H A;  4N3C A;  4H7X A;  5T4Y A;  5AN8 A;  5JHB A;  3NOG D;  3O48 A;  3CHM A;  4H7Y A;  4JW1 A;  2WB2 A;  2ETB A;  3MGB A;  2V5Q C;  3DSX A;  2RKK A;  4XEI G;  4APF A;  5HRY A;  2CFU A;  4BSZ B;  1N4Q A;  3CHS A;  4DPR A;  4PH4 B;  1KPS B;  1DNP A;  2H6F A;  3DSU A;  1LTX A;  3I5P A;  5ARG A;  2P9P G;  5FTP A;  5KNG A;  2EIK E;  1O1T A;  2J08 A;  5D2M C;  1TJF A;  3FTU A;  3ZEF A;  2BTD A;  4Y6W A;  3T8M A;  3UM0 A;  1OWP A;  2GRO B;  3CVY A;  3HXF A;  2UWJ G;  4Q96 A;  3AG3 E;  4GAA A;  1N11 A;  3HXC A;  4ATZ D;  4HRM B;  2GW1 A;  3ZYL A;  3AG4 E;  3GZ2 A;  2VTB B;  1E8Y A;  2X6K A;  4BTB A;  2X38 A;  4U0Z A;  3PE4 A;  2XQ0 A;  3D9M A;  4L23 A;  3EHM A;  3PUK A;  1HE8 A;  5G04 J;  4EZJ A;  4HOQ A;  2BED A;  5HI7 A;  5IY5 E;  1HO8 A;  2CG3 A;  1MX4 A;  2P9S G;  1NP7 A;  4TXP A;  5ENT D;  2ETC A;  1H2V C;  1IKN D;  4C0E A;  2NYJ A;  3CVN A;  2PL2 A;  3TAX A;  2VGY A;  3LDZ A;  1A5E A;  2L6B A;  4HQD A;  1HU3 A;  1U3C A;  1OY3 D;  2XGM A;  3AG1 E;  1NI1 A;  1SQM A;  3KS2 A;  3T9K A;  3ABL E;  1UW4 B;  3I4G A;  2Y69 E;  3FTW A;  3D9I A;  2ETA A;  3CVL A;  2L0T B;  3D9P A;  3ASO E;  5T8I A;  4UWL A;  4N3B A;  3ASF A;  1K8K G;  3UXG A;  4JHJ A;  3GW4 A;  4WNE A;  2R2L A;  2I9C A;  4JPS A;  4KVM A;  3CLJ A;  3JYS A;  1Y8M A;  4HLE A;  1TJC A;  2BUG A;  3ML8 A;  2J9Q A;  2BF0 X;  2V5F A;  4I6J A;  3ASH A;  4OAV B;  1K3Z D;  4XX5 A;  3WXX A;  2X6I A;  1DVP A;  3TXN A;  5AEN A;  4EQF A;  3ABM E;  1OCC E;  3AAA C;  3L9T A;  3EUV A;  2CHZ A;  3MV2 B;  3TWQ A;  4AEZ C;  1XGW A;  3G2S A;  2BKG A;  3QC1 A;  4DX7 D;  4DJA A;  3ZVV A;  2FEZ A;  4N2S A;  1TN6 A;  3T8K A;  4CZ2 D;  4YDE A;  3D3M A;  4JZY A;  4U0S A;  4GML A;  2L6J A;  3TWT A;  1KT1 A;  3L08 A;  1TN7 A;  4IN3 B;  4JHK A;  2XRY A;  3QK0 A;  4LNB A;  3JQ0 A;  3PUJ A;  4FLH A;  2QY7 A;  3ABK E;  1OWL A;  2FI7 A;  3D9H A;  2WXO A;  1BLX B;  2XEH A;  1YCS B;  1E96 B;  1BPO A;  3CK8 A;  4MLP A;  4A1S A;  2A4Z A;  4LNG A;  5B1B E;  4ILG A;  4AJW A;  3QB2 A;  2E2E A;  1IXV A;  4UI9 J;  3BUA A;  3HYM B;  1JPL A;  3ISM C;  4I1M A;  4WWN A;  3MKR A;  4JEH A;  3JCK C;  1WY6 A;  5EIL A;  4GZ6 A;  4I1A A;  2DVW A;  2IFU A;  5BV1 A;  3TWW A;  3CHO A;  3UKU G;  4ANX A;  1QNF A;  4LER A;  2XEV A;  3ZIM A;  3PZ2 A;  2XRZ A;  3V79 K;  2WXQ A;  4N5Q A;  5AQB A;  3TG4 A;  3TWV A;  3FDH A;  3CEQ A;  1WDY A;  3L17 A;  1DCE A;  3S7J A;  3TL5 A;  3PZ1 A;  3V31 A;  3VLF A;  1E8Z A;  1LD8 A;  1L5J A;  1TYQ G;  3LY8 A;  4HI9 A;  1MJ0 A;  1TN8 A;  2MHK A;  2HM8 A;  4EPZ A;  1EPU A;  4J8E A;  2LAH A;  3SY2 A;  2DZN A;  2B0O E;  3TWU A;  2PM7 A;  3TWX A;  2J4B A;  3LJ3 A;  1FT2 A;  3D9K A;  3DSW A;  4ILH B;  4GZD A;  2BKK B;  3FU6 A;  2KCV A;  2QFC A;  3PZD A;  2GRN B;  5HKP A;  3L54 A;  3D9L A;  3CSF A;  2NC9 A;  4HVB A;  4HI8 A;  3P1U A;  1YMP A;  3O4Z A;  3DST A;  3E37 A;  3B13 A;  4U95 D;  5EYP F;  5LCW J;  3RO2 A;  1MYO A;  3DPY A;  4MRU A;  2R59 A;  2WXR A;  2HO1 A;  3S7F A;  4OAU C;  4C48 B;  3HXB A;  2EQX A;  3ZYM A;  2AXV A;  3LS8 A;  3ZHE B;  5DBK A;  3E4B A;  3TWR A;  2WXK A;  3U3W A;  4N39 A;  2ION A;  1ZB1 A;  2AWI A;  5FQ6 A;  3EHR A;  3ASD A;  1KZO A;  5AQA A;  4GTR A;  2WXG A;  1N4R A;  5CEC B;  3UX4 A;  3GYZ A;  3MX3 A;  3E33 A;  4K5A B;  4TXR A;  4FLB A;  5D0O D;  2WXL A;  3FU3 A;  3HG0 D;  4O1P A;  4CT4 A;  4PS8 A;  3R9M A;  2PNN A;  5C1D A;  3BU8 A;  2F8X K;  1SA5 A;  3KEA A;  4WWO A;  1S0P A;  4A63 B;  2L0I A;  2KZT A;  3LY7 A;  2J07 A;  3EU5 A;  5JA4 D;  2WXJ A;  4GTS A;  1MZC A;  5FJY A;  4NRH B;  4HOU A;  5CEA A;  5CRU A;  5HS0 A;  4AY6 A;  4J8S A;  4I2Z A;  3UM1 A;  3KSL A;  5EN5 D;  5C2Y A;  3FUE A;  4RG6 A;  1FVH A;  4NUR A;  4X8Q A;  1WG0 A;  3MKQ A;  1H6K A;  3L16 A;  4ACL A;  3SI5 A;  2OND A;  3Q9N C;  3QDN A;  3ZYQ A;  5JJT A;  1P5Q A;  1QYM A;  3ULQ A;  1ELW A;  1JUQ A;  2Y4T A;  2AXZ A;  3EJN A;  4FP7 A;  4CYM D;  3FUI A;  4O1O A;  4CGW A;  2L9B A;  3NB2 A;  2X6J A;  4DUI A;  1KZP A;  2XPI A;  2LAI A;  4UQZ A;  4DRX E;  3LEW A;  4G23 A;  3ASG A;  3OXL A;  3Q73 A;  5BUZ A;  3W9F A;  2VGX B;  4WNG A;  3QJZ A;  4I43 A;  3ONK A;  3SQV A;  3KD7 A;  3FUN A;  3UT8 A;  5FIO A;  5LP0 A;  2OOE A;  1N95 A;  3T5V A;  2KBX A;  3Q7F A;  4HRL A;  5FZR A;  4CDM A;  3SBS A;  3PDN A;  3I4R B;  2V4H C;  4F3V A;  1FT1 A;  1IHG A;  3FUK A;  1TR4 A;  4GTO A;  5EYL A;  3FTX A;  3DSV A;  4XE0 A;  2HR2 A;  4HOT A;  1H6P A;  1O1S A;  5KNH D;  2IU1 A;  3SFY A;  4RSY A;  4I9C A;  2P9K G;  5ARF A;  3NBN B;  4AM9 A;  1WM5 A;  3RSE G;  3JXI A;  2WVI A;  3MV3 B;  3LY9 A;  3APC A;  2UY1 B;  4HFG A;  4MBG A;  2R17 C;  3FH8 A;  3CQG B;  2ZIR A;  3B95 A;  3SF4 A;  1SA4 A;  2VSY A;  4U8Y D;  5LOZ A;  4U07 A;  5ANL A;  1EF1 C;  3IXE A;  3Q9U C;  5J08 A;  3CHP A;  3TWS A;  4BX8 A;  4CCA A;  2WXH A;  2YIN A;  1JWF A;  3KAE A;  4GTM A;  4DLO A;  3ZKJ A;  3CKB A;  4URK A;  1N4P A;  1PY1 A;  3IBE A;  1Z3X A;  4HS2 A;  2IO2 C;  2VJ8 A;  1G3N B;  4G26 A;  3QWV A;  5FQ8 A;  5G55 A;  4ACK A;  5CER B;  4DLQ A;  3QKY A;  4U04 A;  2XCC A;  4DX1 A;  4AP2 A;  3HVE B;  4KYO B;  4FC8 A;  4A3V A;  1SZ9 A;  1TNU A;  3SZ7 A;  3ML9 A;  3VTX A;  2WQH A;  3D9O A;  3S7B A;  3K9I A;  3V2O A;  2EIJ E;  3LJN A;  4FAD A;  3R7R A;  3RO3 A;  2FO7 A;  2DZO A;  3HXD A;  2LSV A;  3J5Q B;  4RVB A;  1JWG A;  3GZ1 A;  4U7E B;  4J8Y A;  2KC7 A;  5FWQ A;  3FUD A;  1NL4 A;  2JLB A;  3E34 A;  1H2T C;  1W3B A;  3DXK G;  4JVS A;  5JHA A;  3UI2 A;  2H6H A;  5AAR A;  5AJL A;  3FP3 A;  1LF8 A;  3UM2 A;  3GZS A;  3PVL A;  4L2Y A;  5G05 C;  2V4L A;  3CHQ A;  5CED B;  1NA0 A;  1SVX A;  4L9P A;  2AJA A;  3ULE G;  4LSZ E;  3CR3 A;  3SO8 A;  4BT9 A;  3QAR A;  4DK5 A;  4GYW A;  3ZRH A;  3UIN C;  2IY0 C;  5KJL A;  2Y4U A;  1SW6 A;  4UWF A;  4GA1 A;  3LCA A;  4N5C A;  3L82 A;  5EDS A;  4Q69 A;  4YVQ C;  1H6O A;  4FU3 A;  5AAO A;  2KZT B;  3L6A A;  3ENE A;  2GRR B;  4B89 A;  3UKR G;  5FIN A;  4GPM A;  1HG2 A;  4IUL A;  1YA0 A;  1Q2Z A;  4C9B B;  2MRI A;  3Q49 B;  4KT6 B;  2JEK A;  1X5B A;  4O6F A;  2FF4 A;  3C5R A;  5JMN D;  3HRA A;  5CHE E;  4F7A A;  4HB5 A;  1INZ A;  1N4S A;  4GU5 A;  4WND A;  2VSN A;  4ZHB A;  3SBT B;  3OXF A;  2YNQ A;  3LYA A;  2IOS A;  1QQE A;  4I1O B;  4Y6C A;  4IYP A;  3R9A B;  3R7Q A;  1A17 A;  2A5U A;  5KJM A;  2I1J A;  2WMO A;  2J4D A;  1N52 A;  1HS6 A;  4M3O A;  3IHV A;  4BSX A;  4FUL A;  1H19 A;  2NXP A;  2XZT G;  4OVV A;  4IRU A;  4JC8 A;  4LEU A;  1N94 A;  3B7R L;  1Z6T A;  2R03 A;  4N3A A;  4HLL A;  3I3N A;  3JXJ A;  3AJI A;  3U66 A;  1E8W A;  3FFL A;  4LG6 A;  2F37 A;  1UN9 A;  3CVP A;  1IYG A;  4L2L A;  2WXF A;  1OWO A;  2P2C P;  4LCT A;  2KCK A;  5BXU A;  4XZ4 A;  4C0M A;  3RRU A;  3NF1 A;  5ENN A;  4KZ0 A;  4KZC A;  3V2X A;  4CEM A;  1UN8 A;  4K5B A;  2XEN A;  3MZL B;  4L1B A;  3RRM B;  3W9G A;  3JQ1 A;  2EIN E;  4F1P A;  3CVU A;  2FO1 E;  3DEO A;  3AU5 A;  4GMJ A;  1OXJ A;  2GRQ B;  4OYS A;  1SZA A;  3J5P A;  3G2V A;  5ENQ D;  4LRZ A;  1H2U A;  1V54 E;  2YHE A;  3UPV A;  1NFI E;  3QNK A;  2LSU A;  3VLE A;  1BI7 B;  3PRZ A;  1OCR E;  2A5E A;  4YDO A;  2LO6 A;  4B93 B;  4AXH A;  3C72 A;  5ENR D;  4HBD A;  3TG5 A;  1PAQ A;  2VTB A;  2P9N G;  2OEV A;  4U8H A;  1AWC B;  1D8D A;  4FHJ A;  1IQR A;  2VSX E;  2GRL A;  4GTV A;  3OAW A;  4EEC A;  3RU0 A;  2HYZ A;  4GTQ A;  4F1S A;  1U2V G;  1X81 A;  3NOC D;  5E76 A;  3HDX A;  2KM4 A;  3ZXP A;  3TXM A;  4B94 A;  4I17 A;  2XGS A;  3DBS A;  1ZBP A;  3ZW3 A;  4O60 A;  2Y1L E;  3TGO A;  2KXP C;  2C0L A;  4GMR A;  5DIZ A;  4UWH A;  3EHQ A;  4JA7 A;  4J8F A;  3OXG A;  4M7C A;  5HQ8 A;  4KMO A;  3UMV A;  5A6C A;  3HIZ A;  3RAU A;  3ZXS A;  4U63 A;  3N71 A;  4B0Z A;  3CVQ A;  2AVP A;  2DIW A;  1JCR A;  1OWM A;  3PEU B;  4GCO A;  2CG2 A;  3CV0 A;  2V8S E;  1E7V A;  4GYY A;  3UIO C;  5BPP A;  3LVQ E;  2XZD G;  2EIL E;  4K03 A;  2ZGD A;  2ZGG A;  3EIQ C;  3QWP A;  4RLY A;  4GCN A;  3U4T A;  3ZU7 B;  4GTP A;  3CGH A;  1MX6 A;  4HXI A;  2H6I A;  3C98 A;  1MQS A;  2OVB A;  3CVV A;  4CDN A;  4FJZ A;  3ESK A;  3FTV A;  5KCM A;  4NIK A;  4PDX A;  4NQ0 A;  5BV0 A;  4D10 C;  2I6H A;  2OV8 A;  3B7B A;  4TUM A;  5G04 C;  1DC2 A;  2F0Y A;  3FUL A;  3OTN A;  4G8K A;  1ELK A;  2MYO A;  2P9L G;  5CCL A;  1OCO E;  2RFA A;  4TUU A; 
#chains in the Genus database with same CATH homology
 4DLO A;  4GA2 A;  3CKB A;  3FTZ A;  4CRW A;  4URK A;  5G05 J;  1PY1 A;  3IBE A;  1KLX A;  1Z3X A;  4HS2 A;  1ELR A;  3HVE A;  5AIJ A;  3MCX A;  2YHC A;  3ZN3 A;  4YND A;  2VJ8 A;  4G26 A;  5EX0 A;  3QWV A;  5FQ8 A;  5G55 A;  1Z3Y A;  3LXU X;  3PE3 A;  4XKB A;  4ACK A;  2C0M A;  2RD0 A;  4DLQ A;  3QKY A;  3B7T A;  1EYH A;  4E85 A;  3D3M A;  3IV0 A;  4JZY A;  4U04 A;  2IOL A;  2XCC A;  4WNF A;  3CQC B;  3QWW A;  4U0S A;  3RKV A;  4I6E A;  4AP2 A;  3HVE B;  4KYO B;  4UWG A;  4FC8 A;  4GML A;  4A3V A;  5BNW A;  2L6J A;  1SZ9 A;  1HXI A;  1KT1 A;  3L08 A;  3ML9 A;  3SZ7 A;  3VTX A;  4AV7 A;  4IN3 B;  3U64 A;  4ANU A;  3APF A;  1NA3 A;  4JHK A;  2I2O A;  3AS4 A;  4Q94 A;  2XRY A;  3QK0 A;  2WQH A;  2KCL A;  5FZS A;  4KVO A;  3D9O A;  3S7B A;  3CIA A;  4FJY A;  3K9I A;  3JQ0 A;  3PUJ A;  4FLH A;  4GA0 A;  4G11 A;  2QY7 A;  3FTS A;  1OWL A;  2FI7 A;  2WXO A;  4FAD A;  2MOW A;  3EHN A;  3R7R A;  4A3T A;  3CVV A;  2XPY A;  3SNX A;  2DBA A;  4XI9 A;  3RO3 A;  1ZU2 A;  4GZ3 A;  4AIF A;  2FO7 A;  2P58 C;  1E96 B;  1E7U A;  3CK9 A;  1BPO A;  3CK8 A;  4MLP A;  3EDT B;  2LSV A;  4A1S A;  4RVB A;  1JWG A;  1HZ4 A;  2WXN A;  2A4Z A;  3GZ1 A;  1GW6 A;  4GB9 A;  4W9R A;  4A55 A;  3ESL A;  4ILG A;  2KC7 A;  4AJW A;  3QB2 A;  2GRM A;  5M72 A;  3U9W A;  5FWQ A;  4CT0 A;  2E2E A;  2M63 A;  2AW6 A;  2ZU6 B;  4J6I A;  3FUD A;  4JHR A;  3BG1 B;  4UI9 J;  3FU5 A;  2GGF A;  2JLB A;  2XGO A;  4G2V A;  1H2T C;  3HYM B;  1W3B A;  4UI9 K;  4WWP A;  1JPL A;  4I1M A;  4JVS A;  4PS3 A;  5ANR A;  4WWN A;  1Y6I A;  3HHM A;  5T3R A;  5EX3 A;  5BT1 A;  5JHA A;  3MKR A;  1EDU A;  3Q15 A;  4JEH A;  3FEY A;  3JCK C;  5AJL A;  1WY6 A;  3FP3 A;  1LF8 A;  3Q4A B;  4GZ6 A;  4I1A A;  1IQU A;  3S2A A;  3ZPJ A;  1PC2 A;  3GZS A;  3MEK A;  3PVL A;  3PRE A;  4L2Y A;  3VTY A;  2IFU A;  5G05 C;  3CST A;  3SHF A;  3LKU A;  3ZGQ A;  2V4L A;  5BV1 A;  3RJV A;  3CHQ A;  1NA0 A;  4JL0 A;  1H0A A;  5A7D B;  3CHO A;  4ANX A;  1QNF A;  4LER A;  3CR3 A;  4BT9 A;  4DK5 A;  3QAR A;  4GYW A;  5E75 A;  3ZRH A;  2XEV A;  3ZIM A;  3FTY A;  5KJL A;  2X6F A;  2Y4U A;  2XRZ A;  4KBQ A;  4UWF A;  4GA1 A;  2WXQ A;  3AU4 A;  3LCA A;  5JJ7 A;  4N5C A;  3FEX A;  3DPD A;  3TG4 A;  5EDS A;  3FDH A;  4YVQ C;  4Q69 A;  3CHR A;  2X3M A;  4FU3 A;  3KEZ A;  5D0Q D;  3CEQ A;  3SD5 A;  4BFR A;  1E90 A;  3L17 A;  3FU0 A;  3URZ A;  3S7J A;  4MKT A;  2KZT B;  3TL5 A;  2E0I A;  2Y3A A;  2OVF A;  3L6A A;  3VLF A;  1E8Z A;  3ENE A;  4B89 A;  1L5J A;  4ANV A;  3LY8 A;  4EBA A;  4BWR A;  2XPZ A;  4HOR A;  3NZS A;  5LFA A;  3L13 A;  4N2Q A;  3G2U A;  2IJG X;  2MHK A;  2HM8 A;  4BY6 A;  1HG2 A;  4IUL A;  1YA0 A;  4AOF A;  1HH8 A;  1EPU A;  4EPZ A;  4A1G A;  4C9B B;  2MRI A;  3Q49 B;  4KT6 B;  2I1K A;  4J8E A;  5BW8 C;  3TJP A;  2JEK A;  2LAH A;  1OUV A;  4RG9 A;  4UI9 C;  5FQ7 A;  3UUX A;  1X5B A;  3FWV A;  4O6F A;  2FF4 A;  4PS7 A;  3JUI A;  2FBN A;  5CHE E;  4F7A A;  1INZ A;  4EBA G;  1QZ2 A;  4GU5 A;  3CKC A;  4WND A;  2PM7 A;  3LVR E;  2J4B A;  2VSN A;  3LJ3 A;  3RIB A;  3SBT B;  5FT9 A;  3D9K A;  3G2T A;  4ILH B;  4UQX A;  4GZD A;  3FU6 A;  2KCV A;  2QFC A;  3OXF A;  3PZD A;  1FVF A;  3L54 A;  2YNQ A;  3LYA A;  3D9L A;  3CSF A;  2IOS A;  2NC9 A;  4FA6 A;  4HVB A;  1QQE A;  1VDY A;  3AS8 A;  3P1U A;  4I1O B;  3O4Z A;  4Y6C A;  4IYP A;  1UJK A;  2VSO E;  3R9A B;  4WUY A;  3R7Q A;  3B13 A;  1A17 A;  2A5U A;  4MS6 A;  5LCW J;  3RO2 A;  3CVX A;  4BT8 A;  3ZHE A;  4MRU A;  2R59 A;  3QAQ A;  4APO A;  2WXR A;  5KJN A;  3L22 A;  2HO1 A;  3S7F A;  1B89 A;  2YQ8 A;  4OVU A;  4I2W A;  5KJM A;  2I1J A;  4JEU A;  4BTA A;  2RG8 A;  2WMO A;  2J4D A;  2EQX A;  1N52 A;  4QFV A;  3ONL A;  3ZYM A;  1HS6 A;  2AXV A;  3FH5 A;  3RRN B;  3LS8 A;  3ZHE B;  4M3O A;  3IHV A;  5DBK A;  4BSX A;  3FH7 A;  1OWN A;  1HF8 A;  3S7D A;  2KAT A;  2VQ2 A;  3E4B A;  3FUJ A;  4FUL A;  1H19 A;  1HG5 A;  2NXP A;  1KT0 A;  3CK7 A;  4IRU A;  2WXK A;  4OVV A;  4WAF A;  4ILI A;  4YVO A;  2PQN A;  4JC8 A;  4LEU A;  3UQ3 A;  3U3W A;  5JJ6 A;  3B7R L;  1Z6T A;  5FZQ A;  2CFZ A;  4N39 A;  4N3A A;  2ION A;  2PZI A;  3FUF A;  3I3N A;  2AWI A;  5FQ6 A;  3ASD A;  2J49 A;  3U66 A;  1E8W A;  5AJD A;  4DI4 A;  3FFL A;  2IF4 A;  1HFA A;  4KXK B;  2WXG A;  1UN9 A;  3BG0 B;  3CVP A;  1IYG A;  2PQR A;  4CGV A;  2Q7F A;  3Q47 B;  4J8D A;  4FHK A;  3UX4 A;  3GYZ A;  3MX3 A;  1XNF A;  3D9J A;  4L2L A;  5J90 A;  2LNI A;  2WXF A;  4NAC A;  4BX9 A;  1OWO A;  4LCT A;  4ME2 A;  2KCK A;  4FLB A;  5D0O D;  3APD A;  2WXL A;  3FU3 A;  4I9E A;  4EZL A;  4B8A A;  3LPZ A;  3ZYK A;  4GZC A;  4XZ4 A;  2PM6 A;  4CT4 A;  4E6H A;  4J0U A;  4PS8 A;  4N3C A;  4C0M A;  4H7X A;  3RRU A;  5T4Y A;  5C1D A;  5JHB A;  3NF1 A;  5ENN A;  3O48 A;  4KZ0 A;  4KZC A;  4WWO A;  1S0P A;  4G1T A;  4CEM A;  4UWK A;  2L0I A;  2CHW A;  1FCH A;  1UN8 A;  2J07 A;  2KZT A;  3G2W A;  3FUH A;  3LY7 A;  3CVW A;  3CHM A;  4H7Y A;  5G2N A;  4JW1 A;  2WB2 A;  3D9N A;  2WXJ A;  5FJY A;  3MZL B;  4L1B A;  2WXI A;  3RRM B;  3MGB A;  4NRH B;  4HOU A;  4AVX A;  3JQ1 A;  4APF A;  4AY6 A;  5LCW C;  4J8S A;  4I2Z A;  2CFU A;  2J09 A;  2WXP A;  5C2Y A;  3VLD A;  3FUE A;  3PEV B;  4RG6 A;  3CVU A;  3SFZ A;  4F53 A;  1FVH A;  1U3D A;  4NUR A;  3CHS A;  3AU5 A;  3EIJ A;  4CDR A;  4DPR A;  4G25 A;  2WQ6 A;  3MKQ A;  1UG3 A;  4GMJ A;  4PH4 B;  1H6K A;  1DNP A;  3L16 A;  4P29 A;  4OYS A;  1SZA A;  4ACL A;  3G2V A;  3SI5 A;  2OND A;  3BEE A;  3QDN A;  4LRZ A;  4JA9 A;  3ZYQ A;  1HX8 A;  4TV3 A;  1H2U A;  2VYI A;  2YHE A;  3MKQ B;  3FY4 A;  5CMY A;  3UPV A;  2X6H A;  3I5P A;  5ARG A;  5JJT A;  1P5Q A;  4U0U A;  4ABN A;  3ULQ A;  4UQY A;  5FTP A;  3P2B A;  1ELW A;  2J08 A;  3QNK A;  1JUQ A;  1TJF A;  2LSU A;  3FTU A;  4PUC A;  3VLE A;  2Y4T A;  2FUL A;  3ZEF A;  3PRZ A;  4TRQ A;  2AXZ A;  2LO6 A;  2BTD A;  3EJN A;  3TG5 A;  4AXH A;  5A23 A;  4Y6W A;  3T8M A;  4FP7 A;  1OWP A;  1PAQ A;  2VTB A;  3CVY A;  2UWJ G;  3FUI A;  3SGH A;  4Q96 A;  4U8H A;  4CGW A;  1NZN A;  2L9B A;  4GAA A;  4FHJ A;  1IQR A;  2VSX E;  2GRL A;  4V3I A;  2X6J A;  2GW1 A;  3ZYL A;  3OAW A;  2VGX A;  4EEC A;  1UJJ A;  3GZ2 A;  3RU0 A;  2XPI A;  2VTB B;  2HYZ A;  4K0R A;  2LAI A;  5LX8 A;  4UQZ A;  4F1S A;  3LEW A;  2DCP A;  2AXU A;  1E8Y A;  3ASG A;  4G23 A;  3OXL A;  5E76 A;  3HDX A;  2KM4 A;  2X6K A;  4BTB A;  5BUZ A;  2X38 A;  4I6G A;  2WM9 A;  4U0Z A;  3MJW A;  3PE4 A;  2VGX B;  2XQ0 A;  4WNG A;  3QJZ A;  4ATG A;  3D9M A;  1MHQ A;  3TXM A;  4AY5 A;  4I43 A;  3IKO B;  4B94 A;  4I17 A;  4L23 A;  2XGS A;  3DBS A;  3EHM A;  3PUK A;  3ONK A;  1HE8 A;  1ZBP A;  2IQC A;  3Q5M A;  3ZW3 A;  3AS5 A;  4ANW A;  3KD7 A;  5G04 J;  4HOQ A;  4EZJ A;  3MYV A;  3TGO A;  3IHY A;  2C0L A;  5HI7 A;  5EKQ D;  3FUN A;  1HO8 A;  1WAO 1;  3UT8 A;  5LP0 A;  5DIZ A;  2CG3 A;  2OOE A;  3T5V A;  3B7S A;  3FHE A;  3MA5 A;  1NP7 A;  4UWH A;  4JA7 A;  4LUN U;  4L7T A;  1H2V C;  4J8F A;  2V0P A;  3NQP A;  3OXG A;  5FZR A;  1E8X A;  2NSZ A;  4C0E A;  4CDM A;  3CVN A;  5HQ8 A;  2PL2 A;  3B7U X;  4KMO A;  3TAX A;  2WQ7 A;  3UMV A;  4GZ5 A;  3UT7 A;  5A6C A;  3SBS A;  3HIZ A;  3ZXS A;  2VGY A;  3PDN A;  4U63 A;  3N71 A;  4B0Z A;  3LDZ A;  1TEZ A;  4GPK A;  3I4R B;  3ZFW A;  1N54 A;  3PNT B;  4F3V A;  3CVQ A;  2AVP A;  2DIW A;  4GYO A;  1IHG A;  3FUK A;  1OWM A;  1HU3 A;  1U3C A;  2XGM A;  3PEU B;  4XKC A;  5CCM A;  1SQM A;  2XCB A;  2R5S A;  3KS2 A;  4GCO A;  3FTX A;  2CG2 A;  3CV0 A;  1UW4 B;  4XE0 A;  3I4G A;  3FTW A;  2HR2 A;  5AYW D;  3D9I A;  2C2L A;  2V8S E;  3CVL A;  1E7V A;  2L0T B;  4GYY A;  3FUM A;  3T5X A;  3D9P A;  5KJK A;  3PNL B;  5T8I A;  4UWL A;  5BPP A;  4HOT A;  5FQ4 A;  3RK6 A;  2ILR A;  4N3B A;  3ASF A;  3LVQ E;  4DI3 A;  2IU1 A;  4I9C A;  2UY1 A;  4RSY A;  4K03 A;  4JHJ A;  3EIQ C;  4B8C B;  5ARF A;  3GW4 A;  3QWP A;  4GCN A;  4R7L A;  4WNE A;  3U4T A;  5CMW A;  4AM9 A;  3CGH A;  1WM5 A;  2WVI A;  3MV3 B;  4HXI A;  3QOU A;  2I9C A;  3PH0 C;  4JPS A;  4KVM A;  3C98 A;  3LY9 A;  2XHE A;  3CLJ A;  1MQS A;  1Y8M A;  2OVB A;  3JYS A;  4CDN A;  4FJZ A;  4HLE A;  3APC A;  3ESK A;  2UY1 B;  3FTV A;  1TJC A;  2BUG A;  3ML8 A;  4HFG A;  4PDX A;  5KCM A;  4NQ0 A;  2J9Q A;  5BV0 A;  4HOS A;  4JXT A;  2BF0 X;  2R17 C;  2V5F A;  4D10 C;  2I6H A;  3ASH A;  3FH8 A;  4I6J A;  3CQG B;  4XX5 A;  2OV8 A;  3WXX A;  2X6I A;  1DVP A;  5G04 C;  3IEG A;  3SF4 A;  3TXN A;  2VSY A;  4G24 A;  5AEN A;  5LOZ A;  4EQF A;  4U07 A;  3UT4 A;  2WMN A;  3FUL A;  1EF1 C;  2CHX A;  3NZU A;  3OTN A;  1ELK A;  5ANL A;  5J08 A;  3CHP A;  4XIF A;  4BX8 A;  4CCA A;  2CHZ A;  4EZK A;  3MV2 B;  3PS6 A;  5CCL A;  2WXH A;  4AEZ C;  1XGW A;  3G2S A;  2WXM A;  2YIN A;  1JWF A;  3QC1 A;  2WPV A;  4DJA A;  4XI0 A;  4TUU A;  3KAE A;  3ZVV A;  2FEZ A;  4N2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...