3L6AA

Crystal structure of the c-terminal region of human p97
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
360
structure length
350
Chain Sequence
HHSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the C-terminal region of Human p97/DAP5
doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 4 gamma 2
total genus 131
structure length 350
sequence length 360
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA01
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA02
4CT4A 2I2OA 1H6KA 2RG8A 1HU3A 2IOSA 3D3MA 2GGFA 4JHJA 2IONA 4C9BB 2KZTA 2VSXE 4CEMA 1H2TC 1N52A 3FEXA 4JHKA 3EIQC 2VSOE 3JUIA 1H2UA 4B89A 1PAQA 3L6AA 4GMLA 2IU1A 4IULA 1N54A 2FULA 4B8CB 1H2VC 4GMJA 4B8AA 2KZTB 1UW4B 4CRWA 2HM8A 1UG3A 3FEYA 2NSZA 3RK6A 5ANRA 2ZU6B 4LUNU 2IOLA 3EIJA
chains in the Genus database with same CATH superfamily
4Y6WA 5EYPF 4UWHA 4KXKB 2B6CA 2VTBA 3CHPA 4KVOA 2R5SA 2OVFA 3ASDA 2ZGGA 4A63B 4N3BA 3PZ1A 3UIPC 2P9UG 3CQCB 3RSEG 4LNBA 4UQXA 5AQBA 5EIDA 5FIOA 2DIWA 3SF4A 5CECB 3MV2B 3AG3E 4ZHBA 4K5CA 4FC8A 4W9RA 5ARGA 2XEVA 4ACKA 4GU5A 3ONLA 3JUIA 2WXOA 3ASHA 3S7BA 3QWVA 1FT2A 3UKRG 2CHZA 2J9QA 4YNDA 4BTBA 2QY7A 1XNFA 4FULA 4WNDA 3TWXA 4F1SA 4JHJA 4U07A 2P9SG 3CK9A 2A5UA 3FTZA 3B7RL 2XQ0A 4DRXE 1IQUA 4TRQA 4G25A 1YCSB 3CEQA 3SBTB 2GRQB 1KT0A 3LVRE 4I1OB 1N0RA 4GYYA 3FFLA 3ZFWA 4DI3A 1ZU2A 5A6CA 3ESLA 2WB2A 3DSTA 3AU4A 2GW1A 4GZCA 2WXPA 3FEYA 3LS8A 4GZ6A 1FVFA 2XZTG 2XPIA 2WQHA 4GA2A 2VSXE 4I1AA 1OWLA 2IY0C 4JEHA 2FI7A 4GTOA 3L22A 4A1GA 3RIBA 5AIJA 4AJWA 1XGWA 3SO8A 2WXNA 2FF4A 3K9IA 2F37A 1E7VA 4AY5A 5ENTD 5EX0A 3DSSA 2BKGA 4AVXA 4ANVA 2XPZA 2WXLA 3CK7A 4ILHB 5DBKA 3TAXA 5G55A 1KLXA 1NZNA 2PM7A 2XEEA 1QYMA 4HOSA 2V5FA 3B13A 3MEKA 5FINA 3FU3A 2AW6A 1TYQG 4GCOA 3DSUA 1OCCE 4GTMA 1SA4A 4BY6A 4YVQC 1O1RA 4J8YA 1A5EA 1MX2A 3PDNA 2MOWA 3ASOE 4HB5A 4F53A 3ZHEB 1Q2ZA 2XCCA 5M72A 4BFRA 1JUQA 2JLBA 1N52A 4URKA 2WXKA 2P9KG 3PEVB 3KS2A 4N3CA 3ZYMA 2BTDA 1TJCA 2WXHA 3IXEA 4KZCA 2Y4UA 5E75A 1ZB1A 3DXKG 4J8EA 2PQRA 3C5RA 3UXGA 2WXGA 2DZNA 1N95A 1A17A 4BETA 5HRYA 3QJZA 3E37A 2M63A 3V2XA 4HORA 3PNTB 3PUKA 2ETAA 5CBNA 4JA7A 4U63A 1E7UA 3Q9NC 4Q69A 1N4SA 3CVNA 1HG2A 1V55E 1QBQA 2Y3AA 2AWIA 2IO2C 4TUMA 3U3WA 3E30A 3P2BA 5FJYA 1O1TA 3URZA 4XZ4A 2WQ7A 5AQ7A 5HKPA 4FHJA 4IYPA 5FT9A 2A4ZA 3FWVA 1SZ9A 1KZOA 3SFZA 1HS6A 4LSZE 5D2MC 5ENNA 1TR4A 3AG4E 1NA0A 3HXCA 4ILIA 3CK8A 1H6KA 3CVWA 1OWNA 4C9BB 5CEDB 4KZ0A 2XGOA 1DC2A 4JD2G 4RG9A 5FZSA 5AENA 4RSYA 2IQCA 3Q5MA 4UWFA 1HFAA 3ZYKA 3MCXA 4U04A 3L82A 3ZPJA 4BESA 3CHOA 1O1SA 3D9KA 5EX3A 2LSUA 3WXXA 4G2VA 4DX6D 4BT9A 3UKUG 2XPYA 4AV7A 3ZIMA 4F7AA 2CG2A 3MJWA 5JJTA 1FCHA 4OYSA 1NA3A 5CMYA 4A3TA 4BSZB 4WNGA 1MX4A 2C0LA 1JWFA 2ETCA 3Q9UC 4A1SA 4GTQA 1PY1A 3R9AB 3CR3A 3EJNA 2BUGA 4XEIG 4M3OA 5CRVA 4F6RD 2CFZA 5DIZA 5AJLA 5FQ7A 3L54A 2NC9A 1N0QA 2BKKB 3HXDA 2VGEA 2NYJA 1YA0A 3Q7AA 1QNFA 3GW4A 4LCTA 3QWWA 4AY6A 1Z3YA 3CKCA 1MYOA 4O1OA 2IJGX 3ZUVB 5KJLA 4J7WA 5JJ7A 4Z68A 3QC1A 2LUHA 5FTPA 2WVIA 1MQSA 4GTPA 4HOTA 3PUJA 3SI5A 1PAQA 2KCKA 4I9CA 4KVMA 1S64A 1E8XA 3AAAC 4BEPA 5LP0A 3DPDA 2NSZA 3UTMA 3FUJA 4LUNU 2VSNA 3PZ3A 3HG0D 3SHFA 2GROB 3ZNGA 3PE4A 1E8YA 2R03A 3CHQA 2IO3C 3O4ZA 5KJNA 1MX6A 5H7PA 4K03A 3WG7E 3W9FA 4L7TA 3KSQA 4QQIA 2VGXA 4PS7A 4EBAG 2IFUA 3AS5A 3G2TA 3SFYA 3ML8A 2H6GA 3HIZA 4MBGA 2IU1A 2WXMA 5KJKA 3IBEA 3RAUA 2YHEA 4N5CA 2RKKA 4GB9A 3DSWA 4JPSA 2LXMA 5BPPA 1HXIA 4ANUA 2V5QC 5ENQD 3UT8A 3Q15A 2Y1LE 5ENOD 3FUHA 3TGOA 4I2ZA 2VYIA 2WMNA 4C0EA 1KT1A 2WMOA 3MKQB 1U3CA 3EHQA 3CIAA 3EHNA 4B0ZA 5G04J 1RZ4A 4A3VA 1E90A 1SW6A 3LDZA 3FUMA 1S0PA 5CEAA 4CDMA 3GYZA 3S2AA 1JCSA 3DPYA 3Q47B 3UI2A 2XGSA 1JCRA 1UJKA 4XKCA 2CG3A 1D9SA 3D9MA 1N54A 4E6HA 1H0AA 4BSXA 3APDA 3SZ7A 4DLOA 3FUDA 2OCCE 3FTUA 1IHBA 1NP7A 1HX8A 3DSVA 3FTXA 3PNLB 3I4RB 1HG5A 3RRNB 3IV0A 4TUUA 4CDRA 4I43A 2E2EA 3LPZA 2F8XK 3NZSA 3I5PA 4YDEA 5FWQA 3ZVVA 2KATA 3ASGA 5BUZA 2EINE 1OCOE 1D8EA 3UX4A 3IHVA 1FVHA 3OXLA 3F6QA 4KMOA 1IXVA 3HYMB 3PRZA 5EN5D 2KCLA 1K1AA 1E96B 4JL0A 5KNGA 4V3IA 4B93B 5HS0A 2LSVA 2J8SD 4L2YA 3RO2A 2X6KA 2DYRE 4APOA 4K5BA 2PNNA 3EHRA 2P9IG 4CEMA 3OXFA 2MRIA 3W9GA 5JA4D 1OXJA 3B7SA 1JCQA 5KCMA 3UINC 5D66A 3SFXA 2C2LA 4WWOA 2I2OA 3P1UA 3B95A 2EILE 2OEVA 2ZGDA 2FEZA 3S7DA 5G2NA 3CLJA 3LCAA 3RRUA 4GTSA 2MHKA 4K0RA 2PM6A 2H6HA 4U95D 3J5PA 3ASNE 2EIJE 4J0UA 2IOLA 3APCA 1OCRE 4WUYA 3B7BA 1KZPA 1TNUA 4IRUA 1EF1C 4FJZA 3T5VA 4FADA 1Y6IA 2XENA 2AXZA 3FUFA 3TWTA 3ISMC 2KC7A 2ETBA 3LVQE 4XX5A 4FLBA 1ZBPA 5JMND 3KEZA 5EYLA 3I4GA 3Q78A 2J09A 5AQ9A 3KAEA 3FTYA 4B89A 3QB2A 4HQDA 3EU5A 1NL4A 4B8AA 2VGXB 3AS4A 2YINA 3OXGA 4YVOA 3E32A 4ILGA 4HLLA 4MLPA 4EPZA 3DEPA 1TN8A 3D9HA 4J8FA 3CHSA 5T4YA 2XCBA 3C72A 2VSOE 3TWRA 1WAO1 2GRMA 4JEUA 3TWWA 4EZKA 3CVVA 5ANLA 2KM4A 1NFIE 1HH8A 5C1DA 4TXQA 2RD0A 4GTVA 2IONA 2HE0A 4NQ0A 2R02A 4GMRA 1OT8A 3EIQC 2XHEA 5FQ8A 3ULYA 2ONDA 4ZFHA 2WXIA 3ZXPA 3TG5A 2H6IA 4I9EA 2VQ2A 2ZU6B 4EQFA 3BEEA 1ELRA 3CHMA 1HU3A 5LX8A 1BI8B 2L6JA 4EZLA 1LTXA 1Z5SC 5ENPD 4YDWA 3UIOC 3T5XA 2I1KA 3QWPA 4CRWA 2Y69E 3CSTA 2IOSA 5LCWJ 3JXJA 3G2SA 4F1PA 3BG0B 1H2UA 3NQPA 3U4TA 3KD7A 3SBSA 2XRYA 3QOUA 3UM0A 3CVUA 5BV0A 4U8VD 3E33A 3PH0C 5JJ6A 3MKRA 2FO1E 4OVVA 4L1BA 4GZ3A 3S7JA 4OVUA 3ULEG 3DXMG 4BX9A 4JW1A 3FTVA 4CGWA 3C3RA 3D3MA 4ME2A 3ZYLA 3HVEB 1EYHA 3FEXA 3E34A 2FBNA 1P5QA 1UJJA 1SZAA 4GCNA 4HRLA 1QQEA 5KBAA 3PZ2A 4H7XA 2OEWA 3LEWA 4RVBA 4MS6A 2GGFA 4BTAA 3VLFA 3JQ1A 3TJPA 3LJNA 4DX5D 5CRUA 3DSXA 4HOUA 4PH4B 4GA0A 1K3ZD 3OAWA 2WXJA 4B8CB 3FU5A 2UY1A 4U0SA 2DVWA 3JUEA 4Q96A 4MRUA 3D9LA 4PS8A 4AOFA 5KNHD 2JEKA 3MV3B 4XE0A 1MZCA 1ELKA 2VTBB 1VDYA 1DCEA 3NOCD 3X2QE 3LY7A 3JCKC 4TXRA 3RK6A 4DJAA 2JABA 4G26A 5ANRA 4H7YA 5ENSD 4BT8A 4A55A 1IQRA 5BXOA 2X6HA 4ATZD 4X8QA 4FP7A 2XZDG 4XI9A 4G23A 3JQ0A 1V54E 4I17A 5LCWC 2BEDA 4R7LA 4DK5A 4I6JA 2FO7A 5CCMA 4JHKA 1OCZE 2V4LA 1IYGA 2GRLA 3O48A 2LAIA 3R9MA 2CHXA 3FU0A 4I1MA 2R17C 2EIME 5FQ4A 4HI9A 4CCAA 3G2VA 4I6GA 5HQ8A 1BI7B 3FH8A 3TXNA 2EQXA 3SD5A 5T3RA 3HXBA 3PREA 3E4BA 2I9CA 5G05C 3D9IA 2XEHA 1X5BA 4JZYA 2RG8A 4HRNA 3DRAA 4ACLA 3FH5A 4JB8P 3S7FA 3TWSA 1SVXA 3Q7FA 2L0TB 1SQMA 5EDSA 2FULA 5J08A 2WPVA 1EPUA 3CVXA 5D0OD 4UI9K 3LY9A 2ZXWE 3LXUX 2GRRB 4TXPA 3V79K 1K1BA 4P29A 3TWQA 5BV1A 3IHYA 4HI8A 3QDNA 4U8YD 2NXPA 1FT1A 3Q79A 2DYSE 2F8YA 4N3AA 1O5MA 3AJIA 3CKBA 4EECA 2A5EA 3BG1B 3CVPA 5AJDA 3ZGQA 1N4PA 3HHMA 3IKOB 4O6FA 4GPKA 3ULQA 2CFUA 2R59A 2X6IA 3Q4AB 3SNXA 2I6HA 3C3OA 2J07A 3FUKA 1YMPA 3QNKA 3G2WA 2WM9A 4UQZA 3TWVA 2GRNB 2X6JA 4U7EB 3T8MA 3FUNA 4GMLA 4UWLA 5CHEE 2ILRA 1D8DA 4I2WA 3I3NA 3MGBA 1TNOA 3QAQA 2ZISA 4WAFA 2CHWA 3ABLE 2V8SE 2DCPA 2HO1A 4XIFA 2P2CP 4NIKA 4QFVA 5JHAA 2MYOA 4N5QA 4AP2A 3L17A 5BW8C 1TJFA 1U3DA 3GZ1A 1U2VG 2OOEA 4HS2A 1N4QA 3U64A 2AJAA 4UI9J 1DVPA 3TG4A 4FHKA 2IF4A 3Q49B 3VTYA 4GPMA 2XRZA 4DLQA 3CV0A 5ITZF 4HLEA 3APFA 3ZU7B 2PZIA 1WDYA 3HVEA 5KJMA 5IY5E 1UOHA 4HNAD 4MKTA 2P9PG 4K5AB 4ABNA 4G11A 4WWNA 1BD8A 2YNQA 3T8KA 1Z3XA 1TN6A 1KPSB 4JXTA 3ZRHA 2AXVA 3UM1A 3J5QB 1DNPA 2KZTB 1BLXB 3LYAA 3ZKJA 1TNBA 2L0IA 3G2UA 4JHRA 3CVLA 2VSYA 2LNIA 2UY1B 3CQGB 4WNEA 1W3BA 3AS8A 3CGHA 1H19A 3HDXA 2Y0BG 2L9BA 4XKBA 1PC2A 3MX3A 4O60A 3JYSA 5AYWD 5JHBA 3NF1A 2IEJA 3KSLA 2KCVA 4PDXA 3UM3A 5G04C 4U8HA 1IHGA 3ABME 4DUIA 3SGHA 2WXQA 3D9JA 5BNWA 3ESKA 3PVLA 4I6EA 3CVQA 4GYOA 4G24A 2V4HC 1GW6A 1HO8A 4DX1A 4RG6A 2KXPC 4ATGA 2E0IA 4B94A 3DBSA 3NZUA 3ZW3A 4CGVA 4KYOB 3KEAA 1S70B 4N2SA 3DWLG 4UI9C 4RLYA 3UQ3A 1S63A 3SY2A 4YDOA 2HR2A 3FDHA 5CERB 5B1AE 3MYVA 1Y8MA 4FA6A 2C0MA 4FLHA 1AP7A 1UG3A 4XI0A 3RO3A 1YYHA 2HYZA 4CT4A 3L13A 1OWOA 1HE8A 5A7DB 5J90A 2QYUA 4N2QA 4IN3B 1TNZA 3MKQA 1Z6TA 3RJVA 1HF8A 2LO6A 1LD7A 4ANWA 3OTNA 5BT1A 3ZHEA 4APFA 2RFAA 2R2LA 4LNGA 3TWUA 3V2OA 3JXIA 4HXIA 2BF0X 3L08A 2VGYA 1QZ2A 3ZEFA 3V31A 5CCLA 3HXEA 5EIBE 5LFAA 3ZXSA 2VJ8A 2WXFA 4FU3A 3LKUA 2P58C 1EDUA 3AU5A 3PS6A 3GZSA 4DI4A 4UWKA 3TL5A 3U66A 5EILA 1E8WA 4YDYA 1SA5A 3HXFA 3BQOA 4ANXA 3D9OA 2J49A 4OAUC 4NRHB 4GA1A 3BU8A 5AAOA 3PZDA 2R05A 3BUAA 4HOQA 3UPVA 4HFGA 5B3SE 1H2VC 2WXRA 4HBDA 4HRMB 1E8ZA 3AG1E 4RQIA 3C98A 1DCQA 2LAHA 3UT4A 4GYWA 2X3MA 4J8SA 1BU9A 2ZIRA 1B89A 5B1BE 2LXLA 4KBQA 4U0UA 4KT6B 3UUXA 1LF8A 5E76A 5FQ6A 4LRZA 4LEUA 1H2TC 3U9WA 1WG0A 3PEUB 3FY4A 4CT0A 4O1PA 3C3QA 5LOZA 3ASFA 5ARFA 2AXUA 1H6OA 4PS3A 2QZAA 3CHRA 3FTWA 2PQNA 4CDNA 3QKYA 2J4DA 2X6FA 2HM8A 2QYJA 4LG6A 2EIKE 2QC9A 5T8IA 3NBNB 3FUIA 3EHMA 2XS8A 3R7QA 3EU9A 4FJYA 2KZTA 4F3VA 2OVBA 1N4RA 4E85A 3UT7A 1G3NB 5BXUA 1JPLA 3ABKE 4JC8A 4L2LA 1ELWA 1OY3D 1UN8A 2OV8A 5EKQD 4BX8A 1INZA 1N94A 4BWRA 3CVYA 4DX7D 1WY6A 4N39A 1L5JA 5KWDA 5D0QD 2L6BA 1IKND 1N9AA 5ENRD 3PZ4A 4C48B 2DZOA 2J4BA 3ZN3A 1JWGA 3RU0A 3MA5A 3GZ2A 4HVBA 3V30A 2DBAA 5A23A 5CBOA 4CYMD 3QARA 3L16A 1RW2A 4BERA 4J8DA 1MHQA 2GRPB 2YHCA 4G8KA 4UQYA 4G8LA 3L6AA 4GAAA 2I1JA 3ONKA 1OWPA 1TEZA 3NAWA 3PE3A 4JA9A 3LJ3A 1LD8A 4AEZC 3EUVA 2UWJG 3FH7A 1AWCB 4NURA 5HI7A 5AARA 4LERA 1OUVA 4EBAA 4IULA 3TXMA 4AIFA 5AQAA 2J08A 4GZ5A 1UW4B 3B7TA 2Q7FA 2H6FA 4AXHA 4Q94A 2X38A 3FTSA 2QFCA 3D9PA 4GTTA 2DWZA 1K8KG 3B7UX 4L23A 3FHEA 1WM5A 4D10C 4U96D 4Y6CA 4C0MA 4LNUD 3AG2E 2XGMA 4PUCA 2B0OE 2F0YA 4OAVB 3MZLB 3EIJA 2P9NG 3FULA 4AM9A 2P9LG 3VTXA 2RFMA 4WNFA 3SQVA 1MJ0A 4G1TA 3ML9A 4J6IA 4EZJA 4CZ2D 3QK0A 2YQ8A 4U0ZA 3UMVA 2Y4TA 1HZ4A 2V0PA 3D9NA 3VLDA 3FUEA 4JVSA 1FPPA 1X81A 3T9KA 5CMWA 2PL2A 4EHMA 3DEOA 4GMJA 2AVPA 4DX2A 4WWPA 3VLEA 2XS1A 2KBXA 3EDTB 3RKVA 3FP3A 1OWMA 4NACA 4GZDA 5FZRA 1NI1A 4UWGA 5AN8A 3FU6A 3RRMB 3ENEA 3Q75A 1H6PA 3UM2A 4TV3A 3R7RA 5C2YA 3N71A 3HRAA 3CSFA 1TN7A 4UUCA 3ZYQA 1UN9A 3NB2A 1TNYA 4L9PA 2WQ6A 1N11A 1BPOA 4DPRA 4GTRA 3L9TA 3LY8A 3Q73A 5FZQA 5G05J 4M7CA 3NOGD 3IEGA
chains in the Genus database with same CATH topology
4CT4A 4MS6A 3L13A 1OWOA 4Y6WA 3SHFA 4UWHA 2GGFA 1HE8A 5A7DB 4KXKB 3PE4A 5J90A 1E8YA 3CHQA 2VTBA 4N2QA 4BTAA 3O4ZA 3CHPA 4KVOA 4IN3B 3JQ1A 3TJPA 2R5SA 3VLFA 5KJNA 2OVFA 3MKQA 3ASDA 1Z6TA 4K03A 4HOUA 3RJVA 4N3BA 4PH4B 4GA0A 4L7TA 1HF8A 2LO6A 3OAWA 2WXJA 4B8CB 3CQCB 3FU5A 2UY1A 4ANWA 4UQXA 2VGXA 2DIWA 3OTNA 5BT1A 3ZHEA 4PS7A 4APFA 3SF4A 4EBAG 4U0SA 3MV2B 2IFUA 3AS5A 3G2TA 4FC8A 4HXIA 4Q96A 4W9RA 5ARGA 2XEVA 4MRUA 3ML8A 3D9LA 4PS8A 2BF0X 3L08A 4ACKA 4AOFA 2VGYA 4GU5A 2JEKA 3ONLA 3MV3B 1QZ2A 2WXOA 3JUIA 4XE0A 3HIZA 3ZEFA 3ASHA 1ELKA 2IU1A 2VTBB 3S7BA 1VDYA 2WXMA 3LY7A 3QWVA 5KJKA 5CCLA 3IBEA 2CHZA 3JCKC 2YHEA 2J9QA 4N5CA 4YNDA 4BTBA 4GB9A 5LFAA 3ZXSA 3RK6A 2VJ8A 2WXFA 4DJAA 4G26A 4JPSA 5ANRA 4FU3A 4H7YA 2QY7A 5BPPA 1XNFA 1HXIA 4FULA 4ANUA 4WNDA 3LKUA 3UT8A 4JHJA 3Q15A 4BT8A 4F1SA 4A55A 4U07A 3FUHA 2P58C 1IQRA 3TGOA 1EDUA 3AU5A 4I2ZA 3PS6A 2X6HA 3CK9A 2VYIA 2WMNA 2A5UA 3GZSA 4C0EA 4DI4A 1KT1A 4UWKA 3FTZA 2WMOA 3B7RL 2XQ0A 4FP7A 3TL5A 3MKQB 4XI9A 1U3CA 1IQUA 4TRQA 3U66A 4G25A 3CEQA 3SBTB 1KT0A 1E8WA 3CIAA 4G23A 3EHNA 3JQ0A 4B0ZA 4I17A 4ANXA 5G04J 5LCWC 3LVRE 1E90A 4A3VA 4I1OB 3D9OA 2J49A 3LDZA 3FUMA 4R7LA 4NRHB 1S0PA 4GA1A 4CDMA 4DK5A 3GYZA 4GYYA 4I6JA 3S2AA 2FO7A 3FFLA 3PZDA 5CCMA 3ZFWA 4JHKA 4DI3A 1ZU2A 5A6CA 3Q47B 3ESLA 2XGSA 1UJKA 4XKCA 2V4LA 2WB2A 2CG3A 1IYGA 4HOQA 3D9MA 1N54A 3UPVA 2GRLA 4HFGA 3O48A 2LAIA 4E6HA 1H0AA 2CHXA 1H2VC 4BSXA 3AU4A 3APDA 3FU0A 2GW1A 4GZCA 4I1MA 2R17C 3SZ7A 2WXRA 2WXPA 4DLOA 3FUDA 3FTUA 3FEYA 5FQ4A 3LS8A 4GZ6A 1NP7A 1E8ZA 1FVFA 4CCAA 1HX8A 3FTXA 3C98A 3PNLB 2LAHA 3I4RB 1HG5A 2XPIA 3UT4A 2WQHA 4GA2A 2VSXE 4I1AA 3IV0A 4GYWA 1OWLA 3RRNB 2X3MA 4J8SA 4TUUA 3G2VA 4JEHA 1B89A 4I6GA 2FI7A 4CDRA 5HQ8A 4I43A 3FH8A 4KBQA 2EQXA 2E2EA 3LPZA 3TXNA 4U0UA 3SD5A 3L22A 4A1GA 5T3RA 3NZSA 3PREA 4KT6B 3RIBA 3UUXA 3I5PA 1LF8A 5AIJA 3E4BA 4RVBA 2I9CA 4AJWA 1XGWA 5G05C 5FWQA 2KATA 3D9IA 3ZVVA 2WXNA 3ASGA 5E76A 1X5BA 2FF4A 5FQ6A 5BUZA 3K9IA 4LRZA 4JZYA 4LEUA 2RG8A 1E7VA 4AY5A 3UX4A 4ACLA 3FH5A 3IHVA 1H2TC 3S7FA 5EX0A 1FVHA 3OXLA 4KMOA 3U9WA 3HYMB 3PRZA 4AVXA 3PEUB 2XPZA 4ANVA 2KCLA 2WXLA 3FY4A 2L0TB 1SQMA 1E96B 3CK7A 4ILHB 4JL0A 5DBKA 4CT0A 5EDSA 2FULA 3TAXA 5J08A 5G55A 2WPVA 1KLXA 1EPUA 1NZNA 4V3IA 3CVXA 2PM7A 2LSVA 4L2YA 3RO2A 5D0OD 4UI9K 3LY9A 4HOSA 2V5FA 2X6KA 3B13A 3MEKA 3LXUX 3ASFA 5LOZA 4APOA 5ARFA 2AXUA 3FU3A 4PS3A 2AW6A 4P29A 4CEMA 4GCOA 5BV1A 3IHYA 3OXFA 3QDNA 3CHRA 2NXPA 2MRIA 3FTWA 4BY6A 4YVQC 2PQNA 4CDNA 3B7SA 4N3AA 3QKYA 2J4DA 5KCMA 3CKBA 3PDNA 2MOWA 4EECA 3CVPA 3BG1B 2X6FA 2HM8A 5AJDA 2C2LA 5T8IA 3ZGQA 4F53A 3FUIA 3ZHEB 3EHMA 3HHMA 4WWOA 2I2OA 2XCCA 3P1UA 3IKOB 3R7QA 4O6FA 4GPKA 3ULQA 5M72A 4BFRA 1JUQA 2CFUA 2JLBA 2KZTA 4FJYA 2R59A 2OVBA 4F3VA 1N52A 4E85A 2X6IA 3Q4AB 2FEZA 4URKA 3UT7A 1JPLA 3S7DA 2WXKA 5G2NA 4JC8A 4L2LA 3CLJA 3LCAA 3SNXA 1ELWA 2I6HA 3RRUA 1UN8A 2OV8A 3PEVB 5EKQD 4BX8A 1INZA 3KS2A 4N3CA 2J07A 2MHKA 2PM6A 4K0RA 3ZYMA 2BTDA 4BWRA 1TJCA 3CVYA 2WXHA 4KZCA 3FUKA 2Y4UA 4J0UA 5E75A 3APCA 2IOLA 1WY6A 4N39A 4WUYA 1L5JA 4IRUA 3QNKA 3G2WA 4J8EA 2WM9A 1EF1C 5D0QD 4UQZA 4FJZA 2PQRA 3T5VA 4FADA 2X6JA 2WXGA 1Y6IA 2AXZA 3FUFA 3T8MA 3FUNA 2J4BA 2KC7A 4GMLA 3ZN3A 4UWLA 5CHEE 2ILRA 1A17A 1JWGA 3RU0A 3QJZA 3LVQE 4XX5A 3MA5A 4FLBA 3GZ2A 4HVBA 1ZBPA 2DBAA 2M63A 4I2WA 5A23A 3I3NA 3MGBA 4HORA 3KEZA 3QAQA 3QARA 3L16A 3I4GA 3PNTB 3PUKA 4WAFA 2CHWA 4J8DA 4JA7A 4U63A 2V8SE 2J09A 2DCPA 2HO1A 4XIFA 1E7UA 1MHQA 3KAEA 5JHAA 4QFVA 4Q69A 2YHCA 4AP2A 3CVNA 4UQYA 3FTYA 4B89A 3L6AA 3QB2A 1HG2A 3L17A 5BW8C 4GAAA 1TJFA 1U3DA 2I1JA 3GZ1A 3ONKA 2OOEA 1OWPA 2Y3AA 4HS2A 1TEZA 4B8AA 2AWIA 2VGXB 3AS4A 2YINA 3OXGA 4YVOA 3PE3A 3U3WA 3U64A 4UI9J 4ILGA 1DVPA 3P2BA 4MLPA 4JA9A 5FJYA 3LJ3A 4FHKA 2IF4A 3TG4A 4EPZA 4AEZC 3Q49B 3VTYA 3URZA 2UWJG 3FH7A 4XZ4A 2WQ7A 2XRZA 4NURA 4FHJA 4IYPA 4J8FA 3CV0A 5FT9A 5HI7A 4DLQA 3CHSA 4LERA 5T4YA 2XCBA 2VSOE 4HLEA 1OUVA 3APFA 2A4ZA 3FWVA 1WAO1 2GRMA 2PZIA 4EBAA 1SZ9A 4IULA 3SFZA 3TXMA 4AIFA 4JEUA 1HS6A 3HVEA 2J08A 5ENNA 4GZ5A 5KJMA 1UW4B 3B7TA 2Q7FA 1NA0A 4EZKA 3CVVA 4ILIA 5ANLA 2KM4A 4AXHA 4Q94A 1HH8A 5C1DA 3CK8A 2X38A 3FTSA 1H6KA 2QFCA 3D9PA 4MKTA 2RD0A 3CVWA 2IONA 1OWNA 4C9BB 4ABNA 4KZ0A 4G11A 4NQ0A 2XGOA 4WWNA 3EIQC 3B7UX 2XHEA 2YNQA 5FQ8A 4L23A 3FHEA 1WM5A 1Z3XA 4D10C 4Y6CA 4C0MA 4JXTA 2ONDA 3ZRHA 2AXVA 2WXIA 4RG9A 3TG5A 5FZSA 5AENA 1DNPA 4I9EA 2KZTB 3LYAA 2IQCA 4RSYA 3Q5MA 4UWFA 2XGMA 1HFAA 2L0IA 4PUCA 3MCXA 2VQ2A 3ZYKA 3G2UA 3MZLB 4JHRA 2ZU6B 3CVLA 2VSYA 4EQFA 4U04A 3EIJA 3ZPJA 3BEEA 1ELRA 3CHMA 1HU3A 5LX8A 3FULA 2LNIA 2L6JA 2UY1B 3CHOA 4AM9A 3CQGB 4WNEA 3VTXA 3D9KA 1W3BA 4EZLA 3AS8A 4WNFA 5EX3A 2LSUA 3CGHA 3WXXA 1H19A 4G2VA 3T5XA 3HDXA 2I1KA 2L9BA 3QWPA 4XKBA 4BT9A 4G1TA 2XPYA 1PC2A 3ML9A 3MX3A 3JYSA 4AV7A 5AYWD 4J6IA 4CRWA 3ZIMA 4F7AA 4EZJA 5JHBA 2CG2A 3MJWA 2YQ8A 3QK0A 5JJTA 3NF1A 4U0ZA 1FCHA 2KCVA 4PDXA 3UMVA 4OYSA 3CSTA 2IOSA 5G04C 5LCWJ 1NA3A 2Y4TA 1HZ4A 5CMYA 4U8HA 1IHGA 3G2SA 2V0PA 4A3TA 3D9NA 4WNGA 3VLDA 3FUEA 4JVSA 2C0LA 3SGHA 3BG0B 2WXQA 1JWFA 4A1SA 1H2UA 3D9JA 5BNWA 1PY1A 3R9AB 3NQPA 3CR3A 3ESKA 5CMWA 3EJNA 2PL2A 3PVLA 3U4TA 2BUGA 4I6EA 4M3OA 3KD7A 3CVQA 4GMJA 4GYOA 3SBSA 2AVPA 4G24A 2XRYA 3QOUA 4WWPA 3VLEA 1GW6A 1HO8A 2CFZA 5DIZA 3CVUA 5BV0A 5AJLA 5FQ7A 4RG6A 3L54A 2NC9A 4ATGA 2E0IA 3PH0C 4B94A 3EDTB 5JJ6A 3RKVA 3MKRA 3FP3A 4LUNU 3DBSA 3NZUA 3ZW3A 4CGVA 1OWMA 4NACA 4GZDA 4OVVA 4KYOB 5FZRA 4L1BA 4UWGA 3FU6A 4GZ3A 1YA0A 3S7JA 4N2SA 4UI9C 3RRMB 3ENEA 1QNFA 3GW4A 3UQ3A 4OVUA 4LCTA 3QWWA 4AY6A 1Z3YA 3CKCA 4JW1A 3FTVA 4TV3A 4BX9A 4CGWA 3D3MA 4ME2A 5C2YA 3R7RA 2IJGX 3N71A 2HR2A 3ZYLA 3FDHA 5JJ7A 5KJLA 3HVEB 1EYHA 3QC1A 3MYVA 5FTPA 3FEXA 2WVIA 1Y8MA 1MQSA 3CSFA 2FBNA 3ZYQA 1P5QA 4HOTA 3PUJA 1UN9A 4FA6A 3SI5A 1PAQA 2KCKA 1UJJA 1SZAA 2C0MA 2WQ6A 4GCNA 1BPOA 4FLHA 4I9CA 4KVMA 4DPRA 1QQEA 1E8XA 3LY8A 5LP0A 4H7XA 3DPDA 1UG3A 4XI0A 5FZQA 3RO3A 2NSZA 2HYZA 5G05J 3LEWA 3FUJA 2VSNA 3IEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CT4 A;  2I2O A;  1H6K A;  2RG8 A;  1HU3 A;  2IOS A;  3D3M A;  2GGF A;  4JHJ A;  2ION A;  4C9B B;  2KZT A;  2VSX E;  4CEM A;  1H2T C;  1N52 A;  3FEX A;  4JHK A;  3EIQ C;  2VSO E;  3JUI A;  1H2U A;  4B89 A;  1PAQ A;  3L6A A;  4GML A;  2IU1 A;  4IUL A;  1N54 A;  2FUL A;  4B8C B;  1H2V C;  4GMJ A;  4B8A A;  2KZT B;  1UW4 B;  4CRW A;  2HM8 A;  1UG3 A;  3FEY A;  2NSZ A;  3RK6 A;  5ANR A;  2ZU6 B;  4LUN U;  2IOL A;  3EIJ A; 
#chains in the Genus database with same CATH topology
 4Y6W A;  5EYP F;  4UWH A;  4KXK B;  2B6C A;  2VTB A;  3CHP A;  4KVO A;  2R5S A;  2OVF A;  3ASD A;  2ZGG A;  4A63 B;  4N3B A;  3PZ1 A;  3UIP C;  2P9U G;  3CQC B;  3RSE G;  4LNB A;  4UQX A;  5AQB A;  5EID A;  5FIO A;  2DIW A;  3SF4 A;  5CEC B;  3MV2 B;  3AG3 E;  4ZHB A;  4K5C A;  4FC8 A;  4W9R A;  5ARG A;  2XEV A;  4ACK A;  4GU5 A;  3ONL A;  3JUI A;  2WXO A;  3ASH A;  3S7B A;  3QWV A;  1FT2 A;  3UKR G;  2CHZ A;  2J9Q A;  4YND A;  4BTB A;  2QY7 A;  1XNF A;  4FUL A;  4WND A;  3TWX A;  4F1S A;  4JHJ A;  4U07 A;  2P9S G;  3CK9 A;  2A5U A;  3FTZ A;  3B7R L;  2XQ0 A;  4DRX E;  1IQU A;  4TRQ A;  4G25 A;  1YCS B;  3CEQ A;  3SBT B;  2GRQ B;  1KT0 A;  3LVR E;  4I1O B;  1N0R A;  4GYY A;  3FFL A;  3ZFW A;  4DI3 A;  1ZU2 A;  5A6C A;  3ESL A;  2WB2 A;  3DST A;  3AU4 A;  2GW1 A;  4GZC A;  2WXP A;  3FEY A;  3LS8 A;  4GZ6 A;  1FVF A;  2XZT G;  2XPI A;  2WQH A;  4GA2 A;  2VSX E;  4I1A A;  1OWL A;  2IY0 C;  4JEH A;  2FI7 A;  4GTO A;  3L22 A;  4A1G A;  3RIB A;  5AIJ A;  4AJW A;  1XGW A;  3SO8 A;  2WXN A;  2FF4 A;  3K9I A;  2F37 A;  1E7V A;  4AY5 A;  5ENT D;  5EX0 A;  3DSS A;  2BKG A;  4AVX A;  4ANV A;  2XPZ A;  2WXL A;  3CK7 A;  4ILH B;  5DBK A;  3TAX A;  5G55 A;  1KLX A;  1NZN A;  2PM7 A;  2XEE A;  1QYM A;  4HOS A;  2V5F A;  3B13 A;  3MEK A;  5FIN A;  3FU3 A;  2AW6 A;  1TYQ G;  4GCO A;  3DSU A;  1OCC E;  4GTM A;  1SA4 A;  4BY6 A;  4YVQ C;  1O1R A;  4J8Y A;  1A5E A;  1MX2 A;  3PDN A;  2MOW A;  3ASO E;  4HB5 A;  4F53 A;  3ZHE B;  1Q2Z A;  2XCC A;  5M72 A;  4BFR A;  1JUQ A;  2JLB A;  1N52 A;  4URK A;  2WXK A;  2P9K G;  3PEV B;  3KS2 A;  4N3C A;  3ZYM A;  2BTD A;  1TJC A;  2WXH A;  3IXE A;  4KZC A;  2Y4U A;  5E75 A;  1ZB1 A;  3DXK G;  4J8E A;  2PQR A;  3C5R A;  3UXG A;  2WXG A;  2DZN A;  1N95 A;  1A17 A;  4BET A;  5HRY A;  3QJZ A;  3E37 A;  2M63 A;  3V2X A;  4HOR A;  3PNT B;  3PUK A;  2ETA A;  5CBN A;  4JA7 A;  4U63 A;  1E7U A;  3Q9N C;  4Q69 A;  1N4S A;  3CVN A;  1HG2 A;  1V55 E;  1QBQ A;  2Y3A A;  2AWI A;  2IO2 C;  4TUM A;  3U3W A;  3E30 A;  3P2B A;  5FJY A;  1O1T A;  3URZ A;  4XZ4 A;  2WQ7 A;  5AQ7 A;  5HKP A;  4FHJ A;  4IYP A;  5FT9 A;  2A4Z A;  3FWV A;  1SZ9 A;  1KZO A;  3SFZ A;  1HS6 A;  4LSZ E;  5D2M C;  5ENN A;  1TR4 A;  3AG4 E;  1NA0 A;  3HXC A;  4ILI A;  3CK8 A;  1H6K A;  3CVW A;  1OWN A;  4C9B B;  5CED B;  4KZ0 A;  2XGO A;  1DC2 A;  4JD2 G;  4RG9 A;  5FZS A;  5AEN A;  4RSY A;  2IQC A;  3Q5M A;  4UWF A;  1HFA A;  3ZYK A;  3MCX A;  4U04 A;  3L82 A;  3ZPJ A;  4BES A;  3CHO A;  1O1S A;  3D9K A;  5EX3 A;  2LSU A;  3WXX A;  4G2V A;  4DX6 D;  4BT9 A;  3UKU G;  2XPY A;  4AV7 A;  3ZIM A;  4F7A A;  2CG2 A;  3MJW A;  5JJT A;  1FCH A;  4OYS A;  1NA3 A;  5CMY A;  4A3T A;  4BSZ B;  4WNG A;  1MX4 A;  2C0L A;  1JWF A;  2ETC A;  3Q9U C;  4A1S A;  4GTQ A;  1PY1 A;  3R9A B;  3CR3 A;  3EJN A;  2BUG A;  4XEI G;  4M3O A;  5CRV A;  4F6R D;  2CFZ A;  5DIZ A;  5AJL A;  5FQ7 A;  3L54 A;  2NC9 A;  1N0Q A;  2BKK B;  3HXD A;  2VGE A;  2NYJ A;  1YA0 A;  3Q7A A;  1QNF A;  3GW4 A;  4LCT A;  3QWW A;  4AY6 A;  1Z3Y A;  3CKC A;  1MYO A;  4O1O A;  2IJG X;  3ZUV B;  5KJL A;  4J7W A;  5JJ7 A;  4Z68 A;  3QC1 A;  2LUH A;  5FTP A;  2WVI A;  1MQS A;  4GTP A;  4HOT A;  3PUJ A;  3SI5 A;  1PAQ A;  2KCK A;  4I9C A;  4KVM A;  1S64 A;  1E8X A;  3AAA C;  4BEP A;  5LP0 A;  3DPD A;  2NSZ A;  3UTM A;  3FUJ A;  4LUN U;  2VSN A;  3PZ3 A;  3HG0 D;  3SHF A;  2GRO B;  3ZNG A;  3PE4 A;  1E8Y A;  2R03 A;  3CHQ A;  2IO3 C;  3O4Z A;  5KJN A;  1MX6 A;  5H7P A;  4K03 A;  3WG7 E;  3W9F A;  4L7T A;  3KSQ A;  4QQI A;  2VGX A;  4PS7 A;  4EBA G;  2IFU A;  3AS5 A;  3G2T A;  3SFY A;  3ML8 A;  2H6G A;  3HIZ A;  4MBG A;  2IU1 A;  2WXM A;  5KJK A;  3IBE A;  3RAU A;  2YHE A;  4N5C A;  2RKK A;  4GB9 A;  3DSW A;  4JPS A;  2LXM A;  5BPP A;  1HXI A;  4ANU A;  2V5Q C;  5ENQ D;  3UT8 A;  3Q15 A;  2Y1L E;  5ENO D;  3FUH A;  3TGO A;  4I2Z A;  2VYI A;  2WMN A;  4C0E A;  1KT1 A;  2WMO A;  3MKQ B;  1U3C A;  3EHQ A;  3CIA A;  3EHN A;  4B0Z A;  5G04 J;  1RZ4 A;  4A3V A;  1E90 A;  1SW6 A;  3LDZ A;  3FUM A;  1S0P A;  5CEA A;  4CDM A;  3GYZ A;  3S2A A;  1JCS A;  3DPY A;  3Q47 B;  3UI2 A;  2XGS A;  1JCR A;  1UJK A;  4XKC A;  2CG3 A;  1D9S A;  3D9M A;  1N54 A;  4E6H A;  1H0A A;  4BSX A;  3APD A;  3SZ7 A;  4DLO A;  3FUD A;  2OCC E;  3FTU A;  1IHB A;  1NP7 A;  1HX8 A;  3DSV A;  3FTX A;  3PNL B;  3I4R B;  1HG5 A;  3RRN B;  3IV0 A;  4TUU A;  4CDR A;  4I43 A;  2E2E A;  3LPZ A;  2F8X K;  3NZS A;  3I5P A;  4YDE A;  5FWQ A;  3ZVV A;  2KAT A;  3ASG A;  5BUZ A;  2EIN E;  1OCO E;  1D8E A;  3UX4 A;  3IHV A;  1FVH A;  3OXL A;  3F6Q A;  4KMO A;  1IXV A;  3HYM B;  3PRZ A;  5EN5 D;  2KCL A;  1K1A A;  1E96 B;  4JL0 A;  5KNG A;  4V3I A;  4B93 B;  5HS0 A;  2LSV A;  2J8S D;  4L2Y A;  3RO2 A;  2X6K A;  2DYR E;  4APO A;  4K5B A;  2PNN A;  3EHR A;  2P9I G;  4CEM A;  3OXF A;  2MRI A;  3W9G A;  5JA4 D;  1OXJ A;  3B7S A;  1JCQ A;  5KCM A;  3UIN C;  5D66 A;  3SFX A;  2C2L A;  4WWO A;  2I2O A;  3P1U A;  3B95 A;  2EIL E;  2OEV A;  2ZGD A;  2FEZ A;  3S7D A;  5G2N A;  3CLJ A;  3LCA A;  3RRU A;  4GTS A;  2MHK A;  4K0R A;  2PM6 A;  2H6H A;  4U95 D;  3J5P A;  3ASN E;  2EIJ E;  4J0U A;  2IOL A;  3APC A;  1OCR E;  4WUY A;  3B7B A;  1KZP A;  1TNU A;  4IRU A;  1EF1 C;  4FJZ A;  3T5V A;  4FAD A;  1Y6I A;  2XEN A;  2AXZ A;  3FUF A;  3TWT A;  3ISM C;  2KC7 A;  2ETB A;  3LVQ E;  4XX5 A;  4FLB A;  1ZBP A;  5JMN D;  3KEZ A;  5EYL A;  3I4G A;  3Q78 A;  2J09 A;  5AQ9 A;  3KAE A;  3FTY A;  4B89 A;  3QB2 A;  4HQD A;  3EU5 A;  1NL4 A;  4B8A A;  2VGX B;  3AS4 A;  2YIN A;  3OXG A;  4YVO A;  3E32 A;  4ILG A;  4HLL A;  4MLP A;  4EPZ A;  3DEP A;  1TN8 A;  3D9H A;  4J8F A;  3CHS A;  5T4Y A;  2XCB A;  3C72 A;  2VSO E;  3TWR A;  1WAO 1;  2GRM A;  4JEU A;  3TWW A;  4EZK A;  3CVV A;  5ANL A;  2KM4 A;  1NFI E;  1HH8 A;  5C1D A;  4TXQ A;  2RD0 A;  4GTV A;  2ION A;  2HE0 A;  4NQ0 A;  2R02 A;  4GMR A;  1OT8 A;  3EIQ C;  2XHE A;  5FQ8 A;  3ULY A;  2OND A;  4ZFH A;  2WXI A;  3ZXP A;  3TG5 A;  2H6I A;  4I9E A;  2VQ2 A;  2ZU6 B;  4EQF A;  3BEE A;  1ELR A;  3CHM A;  1HU3 A;  5LX8 A;  1BI8 B;  2L6J A;  4EZL A;  1LTX A;  1Z5S C;  5ENP D;  4YDW A;  3UIO C;  3T5X A;  2I1K A;  3QWP A;  4CRW A;  2Y69 E;  3CST A;  2IOS A;  5LCW J;  3JXJ A;  3G2S A;  4F1P A;  3BG0 B;  1H2U A;  3NQP A;  3U4T A;  3KD7 A;  3SBS A;  2XRY A;  3QOU A;  3UM0 A;  3CVU A;  5BV0 A;  4U8V D;  3E33 A;  3PH0 C;  5JJ6 A;  3MKR A;  2FO1 E;  4OVV A;  4L1B A;  4GZ3 A;  3S7J A;  4OVU A;  3ULE G;  3DXM G;  4BX9 A;  4JW1 A;  3FTV A;  4CGW A;  3C3R A;  3D3M A;  4ME2 A;  3ZYL A;  3HVE B;  1EYH A;  3FEX A;  3E34 A;  2FBN A;  1P5Q A;  1UJJ A;  1SZA A;  4GCN A;  4HRL A;  1QQE A;  5KBA A;  3PZ2 A;  4H7X A;  2OEW A;  3LEW A;  4RVB A;  4MS6 A;  2GGF A;  4BTA A;  3VLF A;  3JQ1 A;  3TJP A;  3LJN A;  4DX5 D;  5CRU A;  3DSX A;  4HOU A;  4PH4 B;  4GA0 A;  1K3Z D;  3OAW A;  2WXJ A;  4B8C B;  3FU5 A;  2UY1 A;  4U0S A;  2DVW A;  3JUE A;  4Q96 A;  4MRU A;  3D9L A;  4PS8 A;  4AOF A;  5KNH D;  2JEK A;  3MV3 B;  4XE0 A;  1MZC A;  1ELK A;  2VTB B;  1VDY A;  1DCE A;  3NOC D;  3X2Q E;  3LY7 A;  3JCK C;  4TXR A;  3RK6 A;  4DJA A;  2JAB A;  4G26 A;  5ANR A;  4H7Y A;  5ENS D;  4BT8 A;  4A55 A;  1IQR A;  5BXO A;  2X6H A;  4ATZ D;  4X8Q A;  4FP7 A;  2XZD G;  4XI9 A;  4G23 A;  3JQ0 A;  1V54 E;  4I17 A;  5LCW C;  2BED A;  4R7L A;  4DK5 A;  4I6J A;  2FO7 A;  5CCM A;  4JHK A;  1OCZ E;  2V4L A;  1IYG A;  2GRL A;  3O48 A;  2LAI A;  3R9M A;  2CHX A;  3FU0 A;  4I1M A;  2R17 C;  2EIM E;  5FQ4 A;  4HI9 A;  4CCA A;  3G2V A;  4I6G A;  5HQ8 A;  1BI7 B;  3FH8 A;  3TXN A;  2EQX A;  3SD5 A;  5T3R A;  3HXB A;  3PRE A;  3E4B A;  2I9C A;  5G05 C;  3D9I A;  2XEH A;  1X5B A;  4JZY A;  2RG8 A;  4HRN A;  3DRA A;  4ACL A;  3FH5 A;  4JB8 P;  3S7F A;  3TWS A;  1SVX A;  3Q7F A;  2L0T B;  1SQM A;  5EDS A;  2FUL A;  5J08 A;  2WPV A;  1EPU A;  3CVX A;  5D0O D;  4UI9 K;  3LY9 A;  2ZXW E;  3LXU X;  2GRR B;  4TXP A;  3V79 K;  1K1B A;  4P29 A;  3TWQ A;  5BV1 A;  3IHY A;  4HI8 A;  3QDN A;  4U8Y D;  2NXP A;  1FT1 A;  3Q79 A;  2DYS E;  2F8Y A;  4N3A A;  1O5M A;  3AJI A;  3CKB A;  4EEC A;  2A5E A;  3BG1 B;  3CVP A;  5AJD A;  3ZGQ A;  1N4P A;  3HHM A;  3IKO B;  4O6F A;  4GPK A;  3ULQ A;  2CFU A;  2R59 A;  2X6I A;  3Q4A B;  3SNX A;  2I6H A;  3C3O A;  2J07 A;  3FUK A;  1YMP A;  3QNK A;  3G2W A;  2WM9 A;  4UQZ A;  3TWV A;  2GRN B;  2X6J A;  4U7E B;  3T8M A;  3FUN A;  4GML A;  4UWL A;  5CHE E;  2ILR A;  1D8D A;  4I2W A;  3I3N A;  3MGB A;  1TNO A;  3QAQ A;  2ZIS A;  4WAF A;  2CHW A;  3ABL E;  2V8S E;  2DCP A;  2HO1 A;  4XIF A;  2P2C P;  4NIK A;  4QFV A;  5JHA A;  2MYO A;  4N5Q A;  4AP2 A;  3L17 A;  5BW8 C;  1TJF A;  1U3D A;  3GZ1 A;  1U2V G;  2OOE A;  4HS2 A;  1N4Q A;  3U64 A;  2AJA A;  4UI9 J;  1DVP A;  3TG4 A;  4FHK A;  2IF4 A;  3Q49 B;  3VTY A;  4GPM A;  2XRZ A;  4DLQ A;  3CV0 A;  5ITZ F;  4HLE A;  3APF A;  3ZU7 B;  2PZI A;  1WDY A;  3HVE A;  5KJM A;  5IY5 E;  1UOH A;  4HNA D;  4MKT A;  2P9P G;  4K5A B;  4ABN A;  4G11 A;  4WWN A;  1BD8 A;  2YNQ A;  3T8K A;  1Z3X A;  1TN6 A;  1KPS B;  4JXT A;  3ZRH A;  2AXV A;  3UM1 A;  3J5Q B;  1DNP A;  2KZT B;  1BLX B;  3LYA A;  3ZKJ A;  1TNB A;  2L0I A;  3G2U A;  4JHR A;  3CVL A;  2VSY A;  2LNI A;  2UY1 B;  3CQG B;  4WNE A;  1W3B A;  3AS8 A;  3CGH A;  1H19 A;  3HDX A;  2Y0B G;  2L9B A;  4XKB A;  1PC2 A;  3MX3 A;  4O60 A;  3JYS A;  5AYW D;  5JHB A;  3NF1 A;  2IEJ A;  3KSL A;  2KCV A;  4PDX A;  3UM3 A;  5G04 C;  4U8H A;  1IHG A;  3ABM E;  4DUI A;  3SGH A;  2WXQ A;  3D9J A;  5BNW A;  3ESK A;  3PVL A;  4I6E A;  3CVQ A;  4GYO A;  4G24 A;  2V4H C;  1GW6 A;  1HO8 A;  4DX1 A;  4RG6 A;  2KXP C;  4ATG A;  2E0I A;  4B94 A;  3DBS A;  3NZU A;  3ZW3 A;  4CGV A;  4KYO B;  3KEA A;  1S70 B;  4N2S A;  3DWL G;  4UI9 C;  4RLY A;  3UQ3 A;  1S63 A;  3SY2 A;  4YDO A;  2HR2 A;  3FDH A;  5CER B;  5B1A E;  3MYV A;  1Y8M A;  4FA6 A;  2C0M A;  4FLH A;  1AP7 A;  1UG3 A;  4XI0 A;  3RO3 A;  1YYH A;  2HYZ A;  4CT4 A;  3L13 A;  1OWO A;  1HE8 A;  5A7D B;  5J90 A;  2QYU A;  4N2Q A;  4IN3 B;  1TNZ A;  3MKQ A;  1Z6T A;  3RJV A;  1HF8 A;  2LO6 A;  1LD7 A;  4ANW A;  3OTN A;  5BT1 A;  3ZHE A;  4APF A;  2RFA A;  2R2L A;  4LNG A;  3TWU A;  3V2O A;  3JXI A;  4HXI A;  2BF0 X;  3L08 A;  2VGY A;  1QZ2 A;  3ZEF A;  3V31 A;  5CCL A;  3HXE A;  5EIB E;  5LFA A;  3ZXS A;  2VJ8 A;  2WXF A;  4FU3 A;  3LKU A;  2P58 C;  1EDU A;  3AU5 A;  3PS6 A;  3GZS A;  4DI4 A;  4UWK A;  3TL5 A;  3U66 A;  5EIL A;  1E8W A;  4YDY A;  1SA5 A;  3HXF A;  3BQO A;  4ANX A;  3D9O A;  2J49 A;  4OAU C;  4NRH B;  4GA1 A;  3BU8 A;  5AAO A;  3PZD A;  2R05 A;  3BUA A;  4HOQ A;  3UPV A;  4HFG A;  5B3S E;  1H2V C;  2WXR A;  4HBD A;  4HRM B;  1E8Z A;  3AG1 E;  4RQI A;  3C98 A;  1DCQ A;  2LAH A;  3UT4 A;  4GYW A;  2X3M A;  4J8S A;  1BU9 A;  2ZIR A;  1B89 A;  5B1B E;  2LXL A;  4KBQ A;  4U0U A;  4KT6 B;  3UUX A;  1LF8 A;  5E76 A;  5FQ6 A;  4LRZ A;  4LEU A;  1H2T C;  3U9W A;  1WG0 A;  3PEU B;  3FY4 A;  4CT0 A;  4O1P A;  3C3Q A;  5LOZ A;  3ASF A;  5ARF A;  2AXU A;  1H6O A;  4PS3 A;  2QZA A;  3CHR A;  3FTW A;  2PQN A;  4CDN A;  3QKY A;  2J4D A;  2X6F A;  2HM8 A;  2QYJ A;  4LG6 A;  2EIK E;  2QC9 A;  5T8I A;  3NBN B;  3FUI A;  3EHM A;  2XS8 A;  3R7Q A;  3EU9 A;  4FJY A;  2KZT A;  4F3V A;  2OVB A;  1N4R A;  4E85 A;  3UT7 A;  1G3N B;  5BXU A;  1JPL A;  3ABK E;  4JC8 A;  4L2L A;  1ELW A;  1OY3 D;  1UN8 A;  2OV8 A;  5EKQ D;  4BX8 A;  1INZ A;  1N94 A;  4BWR A;  3CVY A;  4DX7 D;  1WY6 A;  4N39 A;  1L5J A;  5KWD A;  5D0Q D;  2L6B A;  1IKN D;  1N9A A;  5ENR D;  3PZ4 A;  4C48 B;  2DZO A;  2J4B A;  3ZN3 A;  1JWG A;  3RU0 A;  3MA5 A;  3GZ2 A;  4HVB A;  3V30 A;  2DBA A;  5A23 A;  5CBO A;  4CYM D;  3QAR A;  3L16 A;  1RW2 A;  4BER A;  4J8D A;  1MHQ A;  2GRP B;  2YHC A;  4G8K A;  4UQY A;  4G8L A;  3L6A A;  4GAA A;  2I1J A;  3ONK A;  1OWP A;  1TEZ A;  3NAW A;  3PE3 A;  4JA9 A;  3LJ3 A;  1LD8 A;  4AEZ C;  3EUV A;  2UWJ G;  3FH7 A;  1AWC B;  4NUR A;  5HI7 A;  5AAR A;  4LER A;  1OUV A;  4EBA A;  4IUL A;  3TXM A;  4AIF A;  5AQA A;  2J08 A;  4GZ5 A;  1UW4 B;  3B7T A;  2Q7F A;  2H6F A;  4AXH A;  4Q94 A;  2X38 A;  3FTS A;  2QFC A;  3D9P A;  4GTT A;  2DWZ A;  1K8K G;  3B7U X;  4L23 A;  3FHE A;  1WM5 A;  4D10 C;  4U96 D;  4Y6C A;  4C0M A;  4LNU D;  3AG2 E;  2XGM A;  4PUC A;  2B0O E;  2F0Y A;  4OAV B;  3MZL B;  3EIJ A;  2P9N G;  3FUL A;  4AM9 A;  2P9L G;  3VTX A;  2RFM A;  4WNF A;  3SQV A;  1MJ0 A;  4G1T A;  3ML9 A;  4J6I A;  4EZJ A;  4CZ2 D;  3QK0 A;  2YQ8 A;  4U0Z A;  3UMV A;  2Y4T A;  1HZ4 A;  2V0P A;  3D9N A;  3VLD A;  3FUE A;  4JVS A;  1FPP A;  1X81 A;  3T9K A;  5CMW A;  2PL2 A;  4EHM A;  3DEO A;  4GMJ A;  2AVP A;  4DX2 A;  4WWP A;  3VLE A;  2XS1 A;  2KBX A;  3EDT B;  3RKV A;  3FP3 A;  1OWM A;  4NAC A;  4GZD A;  5FZR A;  1NI1 A;  4UWG A;  5AN8 A;  3FU6 A;  3RRM B;  3ENE A;  3Q75 A;  1H6P A;  3UM2 A;  4TV3 A;  3R7R A;  5C2Y A;  3N71 A;  3HRA A;  3CSF A;  1TN7 A;  4UUC A;  3ZYQ A;  1UN9 A;  3NB2 A;  1TNY A;  4L9P A;  2WQ6 A;  1N11 A;  1BPO A;  4DPR A;  4GTR A;  3L9T A;  3LY8 A;  3Q73 A;  5FZQ A;  5G05 J;  4M7C A;  3NOG D;  3IEG A; 
#chains in the Genus database with same CATH homology
 4CT4 A;  4MS6 A;  3L13 A;  1OWO A;  4Y6W A;  3SHF A;  4UWH A;  2GGF A;  1HE8 A;  5A7D B;  4KXK B;  3PE4 A;  5J90 A;  1E8Y A;  3CHQ A;  2VTB A;  4N2Q A;  4BTA A;  3O4Z A;  3CHP A;  4KVO A;  4IN3 B;  3JQ1 A;  3TJP A;  2R5S A;  3VLF A;  5KJN A;  2OVF A;  3MKQ A;  3ASD A;  1Z6T A;  4K03 A;  4HOU A;  3RJV A;  4N3B A;  4PH4 B;  4GA0 A;  4L7T A;  1HF8 A;  2LO6 A;  3OAW A;  2WXJ A;  4B8C B;  3CQC B;  3FU5 A;  2UY1 A;  4ANW A;  4UQX A;  2VGX A;  2DIW A;  3OTN A;  5BT1 A;  3ZHE A;  4PS7 A;  4APF A;  3SF4 A;  4EBA G;  4U0S A;  3MV2 B;  2IFU A;  3AS5 A;  3G2T A;  4FC8 A;  4HXI A;  4Q96 A;  4W9R A;  5ARG A;  2XEV A;  4MRU A;  3ML8 A;  3D9L A;  4PS8 A;  2BF0 X;  3L08 A;  4ACK A;  4AOF A;  2VGY A;  4GU5 A;  2JEK A;  3ONL A;  3MV3 B;  1QZ2 A;  2WXO A;  3JUI A;  4XE0 A;  3HIZ A;  3ZEF A;  3ASH A;  1ELK A;  2IU1 A;  2VTB B;  3S7B A;  1VDY A;  2WXM A;  3LY7 A;  3QWV A;  5KJK A;  5CCL A;  3IBE A;  2CHZ A;  3JCK C;  2YHE A;  2J9Q A;  4N5C A;  4YND A;  4BTB A;  4GB9 A;  5LFA A;  3ZXS A;  3RK6 A;  2VJ8 A;  2WXF A;  4DJA A;  4G26 A;  4JPS A;  5ANR A;  4FU3 A;  4H7Y A;  2QY7 A;  5BPP A;  1XNF A;  1HXI A;  4FUL A;  4ANU A;  4WND A;  3LKU A;  3UT8 A;  4JHJ A;  3Q15 A;  4BT8 A;  4F1S A;  4A55 A;  4U07 A;  3FUH A;  2P58 C;  1IQR A;  3TGO A;  1EDU A;  3AU5 A;  4I2Z A;  3PS6 A;  2X6H A;  3CK9 A;  2VYI A;  2WMN A;  2A5U A;  3GZS A;  4C0E A;  4DI4 A;  1KT1 A;  4UWK A;  3FTZ A;  2WMO A;  3B7R L;  2XQ0 A;  4FP7 A;  3TL5 A;  3MKQ B;  4XI9 A;  1U3C A;  1IQU A;  4TRQ A;  3U66 A;  4G25 A;  3CEQ A;  3SBT B;  1KT0 A;  1E8W A;  3CIA A;  4G23 A;  3EHN A;  3JQ0 A;  4B0Z A;  4I17 A;  4ANX A;  5G04 J;  5LCW C;  3LVR E;  1E90 A;  4A3V A;  4I1O B;  3D9O A;  2J49 A;  3LDZ A;  3FUM A;  4R7L A;  4NRH B;  1S0P A;  4GA1 A;  4CDM A;  4DK5 A;  3GYZ A;  4GYY A;  4I6J A;  3S2A A;  2FO7 A;  3FFL A;  3PZD A;  5CCM A;  3ZFW A;  4JHK A;  4DI3 A;  1ZU2 A;  5A6C A;  3Q47 B;  3ESL A;  2XGS A;  1UJK A;  4XKC A;  2V4L A;  2WB2 A;  2CG3 A;  1IYG A;  4HOQ A;  3D9M A;  1N54 A;  3UPV A;  2GRL A;  4HFG A;  3O48 A;  2LAI A;  4E6H A;  1H0A A;  2CHX A;  1H2V C;  4BSX A;  3AU4 A;  3APD A;  3FU0 A;  2GW1 A;  4GZC A;  4I1M A;  2R17 C;  3SZ7 A;  2WXR A;  2WXP A;  4DLO A;  3FUD A;  3FTU A;  3FEY A;  5FQ4 A;  3LS8 A;  4GZ6 A;  1NP7 A;  1E8Z A;  1FVF A;  4CCA A;  1HX8 A;  3FTX A;  3C98 A;  3PNL B;  2LAH A;  3I4R B;  1HG5 A;  2XPI A;  3UT4 A;  2WQH A;  4GA2 A;  2VSX E;  4I1A A;  3IV0 A;  4GYW A;  1OWL A;  3RRN B;  2X3M A;  4J8S A;  4TUU A;  3G2V A;  4JEH A;  1B89 A;  4I6G A;  2FI7 A;  4CDR A;  5HQ8 A;  4I43 A;  3FH8 A;  4KBQ A;  2EQX A;  2E2E A;  3LPZ A;  3TXN A;  4U0U A;  3SD5 A;  3L22 A;  4A1G A;  5T3R A;  3NZS A;  3PRE A;  4KT6 B;  3RIB A;  3UUX A;  3I5P A;  1LF8 A;  5AIJ A;  3E4B A;  4RVB A;  2I9C A;  4AJW A;  1XGW A;  5G05 C;  5FWQ A;  2KAT A;  3D9I A;  3ZVV A;  2WXN A;  3ASG A;  5E76 A;  1X5B A;  2FF4 A;  5FQ6 A;  5BUZ A;  3K9I A;  4LRZ A;  4JZY A;  4LEU A;  2RG8 A;  1E7V A;  4AY5 A;  3UX4 A;  4ACL A;  3FH5 A;  3IHV A;  1H2T C;  3S7F A;  5EX0 A;  1FVH A;  3OXL A;  4KMO A;  3U9W A;  3HYM B;  3PRZ A;  4AVX A;  3PEU B;  2XPZ A;  4ANV A;  2KCL A;  2WXL A;  3FY4 A;  2L0T B;  1SQM A;  1E96 B;  3CK7 A;  4ILH B;  4JL0 A;  5DBK A;  4CT0 A;  5EDS A;  2FUL A;  3TAX A;  5J08 A;  5G55 A;  2WPV A;  1KLX A;  1EPU A;  1NZN A;  4V3I A;  3CVX A;  2PM7 A;  2LSV A;  4L2Y A;  3RO2 A;  5D0O D;  4UI9 K;  3LY9 A;  4HOS A;  2V5F A;  2X6K A;  3B13 A;  3MEK A;  3LXU X;  3ASF A;  5LOZ A;  4APO A;  5ARF A;  2AXU A;  3FU3 A;  4PS3 A;  2AW6 A;  4P29 A;  4CEM A;  4GCO A;  5BV1 A;  3IHY A;  3OXF A;  3QDN A;  3CHR A;  2NXP A;  2MRI A;  3FTW A;  4BY6 A;  4YVQ C;  2PQN A;  4CDN A;  3B7S A;  4N3A A;  3QKY A;  2J4D A;  5KCM A;  3CKB A;  3PDN A;  2MOW A;  4EEC A;  3CVP A;  3BG1 B;  2X6F A;  2HM8 A;  5AJD A;  2C2L A;  5T8I A;  3ZGQ A;  4F53 A;  3FUI A;  3ZHE B;  3EHM A;  3HHM A;  4WWO A;  2I2O A;  2XCC A;  3P1U A;  3IKO B;  3R7Q A;  4O6F A;  4GPK A;  3ULQ A;  5M72 A;  4BFR A;  1JUQ A;  2CFU A;  2JLB A;  2KZT A;  4FJY A;  2R59 A;  2OVB A;  4F3V A;  1N52 A;  4E85 A;  2X6I A;  3Q4A B;  2FEZ A;  4URK A;  3UT7 A;  1JPL A;  3S7D A;  2WXK A;  5G2N A;  4JC8 A;  4L2L A;  3CLJ A;  3LCA A;  3SNX A;  1ELW A;  2I6H A;  3RRU A;  1UN8 A;  2OV8 A;  3PEV B;  5EKQ D;  4BX8 A;  1INZ A;  3KS2 A;  4N3C A;  2J07 A;  2MHK A;  2PM6 A;  4K0R A;  3ZYM A;  2BTD A;  4BWR A;  1TJC A;  3CVY A;  2WXH A;  4KZC A;  3FUK A;  2Y4U A;  4J0U A;  5E75 A;  3APC A;  2IOL A;  1WY6 A;  4N39 A;  4WUY A;  1L5J A;  4IRU A;  3QNK A;  3G2W A;  4J8E A;  2WM9 A;  1EF1 C;  5D0Q D;  4UQZ A;  4FJZ A;  2PQR A;  3T5V A;  4FAD A;  2X6J A;  2WXG A;  1Y6I A;  2AXZ A;  3FUF A;  3T8M A;  3FUN A;  2J4B A;  2KC7 A;  4GML A;  3ZN3 A;  4UWL A;  5CHE E;  2ILR A;  1A17 A;  1JWG A;  3RU0 A;  3QJZ A;  3LVQ E;  4XX5 A;  3MA5 A;  4FLB A;  3GZ2 A;  4HVB A;  1ZBP A;  2DBA A;  2M63 A;  4I2W A;  5A23 A;  3I3N A;  3MGB A;  4HOR A;  3KEZ A;  3QAQ A;  3QAR A;  3L16 A;  3I4G A;  3PNT B;  3PUK A;  4WAF A;  2CHW A;  4J8D A;  4JA7 A;  4U63 A;  2V8S E;  2J09 A;  2DCP A;  2HO1 A;  4XIF A;  1E7U A;  1MHQ A;  3KAE A;  5JHA A;  4QFV A;  4Q69 A;  2YHC A;  4AP2 A;  3CVN A;  4UQY A;  3FTY A;  4B89 A;  3L6A A;  3QB2 A;  1HG2 A;  3L17 A;  5BW8 C;  4GAA A;  1TJF A;  1U3D A;  2I1J A;  3GZ1 A;  3ONK A;  2OOE A;  1OWP A;  2Y3A A;  4HS2 A;  1TEZ A;  4B8A A;  2AWI A;  2VGX B;  3AS4 A;  2YIN A;  3OXG A;  4YVO A;  3PE3 A;  3U3W A;  3U64 A;  4UI9 J;  4ILG A;  1DVP A;  3P2B A;  4MLP A;  4JA9 A;  5FJY A;  3LJ3 A;  4FHK A;  2IF4 A;  3TG4 A;  4EPZ A;  4AEZ C;  3Q49 B;  3VTY A;  3URZ A;  2UWJ G;  3FH7 A;  4XZ4 A;  2WQ7 A;  2XRZ A;  4NUR A;  4FHJ A;  4IYP A;  4J8F A;  3CV0 A;  5FT9 A;  5HI7 A;  4DLQ A;  3CHS A;  4LER A;  5T4Y A;  2XCB A;  2VSO E;  4HLE A;  1OUV A;  3APF A;  2A4Z A;  3FWV A;  1WAO 1;  2GRM A;  2PZI A;  4EBA A;  1SZ9 A;  4IUL A;  3SFZ A;  3TXM A;  4AIF A;  4JEU A;  1HS6 A;  3HVE A;  2J08 A;  5ENN A;  4GZ5 A;  5KJM A;  1UW4 B;  3B7T A;  2Q7F A;  1NA0 A;  4EZK A;  3CVV A;  4ILI A;  5ANL A;  2KM4 A;  4AXH A;  4Q94 A;  1HH8 A;  5C1D A;  3CK8 A;  2X38 A;  3FTS A;  1H6K A;  2QFC A;  3D9P A;  4MKT A;  2RD0 A;  3CVW A;  2ION A;  1OWN A;  4C9B B;  4ABN A;  4KZ0 A;  4G11 A;  4NQ0 A;  2XGO A;  4WWN A;  3EIQ C;  3B7U X;  2XHE A;  2YNQ A;  5FQ8 A;  4L23 A;  3FHE A;  1WM5 A;  1Z3X A;  4D10 C;  4Y6C A;  4C0M A;  4JXT A;  2OND A;  3ZRH A;  2AXV A;  2WXI A;  4RG9 A;  3TG5 A;  5FZS A;  5AEN A;  1DNP A;  4I9E A;  2KZT B;  3LYA A;  2IQC A;  4RSY A;  3Q5M A;  4UWF A;  2XGM A;  1HFA A;  2L0I A;  4PUC A;  3MCX A;  2VQ2 A;  3ZYK A;  3G2U A;  3MZL B;  4JHR A;  2ZU6 B;  3CVL A;  2VSY A;  4EQF A;  4U04 A;  3EIJ A;  3ZPJ A;  3BEE A;  1ELR A;  3CHM A;  1HU3 A;  5LX8 A;  3FUL A;  2LNI A;  2L6J A;  2UY1 B;  3CHO A;  4AM9 A;  3CQG B;  4WNE A;  3VTX A;  3D9K A;  1W3B A;  4EZL A;  3AS8 A;  4WNF A;  5EX3 A;  2LSU A;  3CGH A;  3WXX A;  1H19 A;  4G2V A;  3T5X A;  3HDX A;  2I1K A;  2L9B A;  3QWP A;  4XKB A;  4BT9 A;  4G1T A;  2XPY A;  1PC2 A;  3ML9 A;  3MX3 A;  3JYS A;  4AV7 A;  5AYW D;  4J6I A;  4CRW A;  3ZIM A;  4F7A A;  4EZJ A;  5JHB A;  2CG2 A;  3MJW A;  2YQ8 A;  3QK0 A;  5JJT A;  3NF1 A;  4U0Z A;  1FCH A;  2KCV A;  4PDX A;  3UMV A;  4OYS A;  3CST A;  2IOS A;  5G04 C;  5LCW J;  1NA3 A;  2Y4T A;  1HZ4 A;  5CMY A;  4U8H A;  1IHG A;  3G2S A;  2V0P A;  4A3T A;  3D9N A;  4WNG A;  3VLD A;  3FUE A;  4JVS A;  2C0L A;  3SGH A;  3BG0 B;  2WXQ A;  1JWF A;  4A1S A;  1H2U A;  3D9J A;  5BNW A;  1PY1 A;  3R9A B;  3NQP A;  3CR3 A;  3ESK A;  5CMW A;  3EJN A;  2PL2 A;  3PVL A;  3U4T A;  2BUG A;  4I6E A;  4M3O A;  3KD7 A;  3CVQ A;  4GMJ A;  4GYO A;  3SBS A;  2AVP A;  4G24 A;  2XRY A;  3QOU A;  4WWP A;  3VLE A;  1GW6 A;  1HO8 A;  2CFZ A;  5DIZ A;  3CVU A;  5BV0 A;  5AJL A;  5FQ7 A;  4RG6 A;  3L54 A;  2NC9 A;  4ATG A;  2E0I A;  3PH0 C;  4B94 A;  3EDT B;  5JJ6 A;  3RKV A;  3MKR A;  3FP3 A;  4LUN U;  3DBS A;  3NZU A;  3ZW3 A;  4CGV A;  1OWM A;  4NAC A;  4GZD A;  4OVV A;  4KYO B;  5FZR A;  4L1B A;  4UWG A;  3FU6 A;  4GZ3 A;  1YA0 A;  3S7J A;  4N2S A;  4UI9 C;  3RRM B;  3ENE A;  1QNF A;  3GW4 A;  3UQ3 A;  4OVU A;  4LCT A;  3QWW A;  4AY6 A;  1Z3Y A;  3CKC A;  4JW1 A;  3FTV A;  4TV3 A;  4BX9 A;  4CGW A;  3D3M A;  4ME2 A;  5C2Y A;  3R7R A;  2IJG X;  3N71 A;  2HR2 A;  3ZYL A;  3FDH A;  5JJ7 A;  5KJL A;  3HVE B;  1EYH A;  3QC1 A;  3MYV A;  5FTP A;  3FEX A;  2WVI A;  1Y8M A;  1MQS A;  3CSF A;  2FBN A;  3ZYQ A;  1P5Q A;  4HOT A;  3PUJ A;  1UN9 A;  4FA6 A;  3SI5 A;  1PAQ A;  2KCK A;  1UJJ A;  1SZA A;  2C0M A;  2WQ6 A;  4GCN A;  1BPO A;  4FLH A;  4I9C A;  4KVM A;  4DPR A;  1QQE A;  1E8X A;  3LY8 A;  5LP0 A;  4H7X A;  3DPD A;  1UG3 A;  4XI0 A;  5FZQ A;  3RO3 A;  2NSZ A;  2HYZ A;  5G05 J;  3LEW A;  3FUJ A;  2VSN A;  3IEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...