3L6AA

Crystal structure of the c-terminal region of human p97
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
360
structure length
350
Chain Sequence
HHSKEELLKLTETVVTEYLNSGNANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 4 gamma 2
publication title Crystal structure of the C-terminal region of Human p97/DAP5
doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 131
structure length 350
sequence length 360
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA01
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3l6aA02
4CT4A 5ANRA 4LUNU 2IOSA 1UW4B 4B89A 4JHKA 2NSZA 1N52A 4GMJA 3L6AA 2IOLA 3EIQC 1PAQA 3RK6A 4CEMA 1UG3A 3FEYA 3JUIA 4B8CB 1H6KA 2IU1A 2KZTA 4B8AA 2VSXE 4C9BB 2HM8A 1N54A 3FEXA 1H2TC 1H2VC 3EIJA 1HU3A 2GGFA 2IONA 2FULA 4JHJA 2I2OA 2RG8A 2KZTB 3D3MA 2VSOE 1H2UA 4IULA 4CRWA 4GMLA 2ZU6B
chains in the Genus database with same CATH superfamily
4ILHB 3AG4E 3UM3A 4WWNA 5A23A 3I4GA 5T4YA 4UUCA 3Q47B 4U04A 4GB9A 3JYSA 3PREA 4RVBA 3PZ2A 3QJZA 2IOSA 1OWLA 4LERA 4EZLA 1BD8A 3MX3A 3FH8A 5AQBA 3IXEA 3RK6A 1FVFA 1QBQA 1SQMA 4N3CA 1EPUA 3PE4A 1K3ZD 2EQXA 3FUKA 3E30A 5AJLA 4E6HA 4I6JA 4AIFA 3Q7AA 3CVQA 4OAVB 3HVEB 4KXKB 3TAXA 2MOWA 4FHJA 2DZOA 4UWFA 4TXRA 2IO2C 3S7BA 4AP2A 3TG4A 3FUHA 1H6PA 2IF4A 4BETA 2MHKA 4MRUA 4GMLA 4J0UA 3ESKA 2YHEA 3UTMA 3D9LA 2XGSA 2J8SD 4Y6CA 5H7PA 2P9LG 3RJVA 3W9GA 4CDMA 3LYAA 5FZRA 4BTAA 3DSUA 1IQRA 2X6FA 4K5CA 4JXTA 4O1OA 3ZYMA 3CHSA 3PVLA 4A63B 4AY5A 1BPOA 2CFZA 5BPPA 4TV3A 4BT9A 3ULQA 3O4ZA 3RU0A 1FCHA 3DEPA 4D10C 1TN7A 3D9NA 1SVXA 2UWJG 2P9IG 4UWGA 2EIME 1S63A 2FF4A 3I5PA 1ELWA 5AQ7A 5AARA 2J9QA 2KATA 5KJKA 1EYHA 1ZU2A 3EU9A 4U8VD 3AS4A 2WXGA 4M7CA 3SZ7A 5DIZA 4CZ2D 2MYOA 5KJLA 4H7YA 3D9PA 5KJNA 2KCKA 3CIAA 5B1BE 4I17A 5EKQD 5EX0A 3FTVA 4GTMA 3NZUA 2LAHA 2CHXA 2AJAA 2R02A 2NXPA 2XGMA 1E7UA 2VGXA 3ABLE 4GTOA 4HB5A 2ZGGA 2IJGX 2AWIA 4AM9A 4I2WA 2CHZA 3DRAA 3C5RA 3TWUA 4J6IA 3JCKC 3ABME 4KMOA 4XIFA 2AXZA 3KSLA 3R9AB 3T5XA 4BWRA 2ETAA 1X5BA 4J8EA 5BNWA 3ESLA 1PAQA 4U95D 4XZ4A 1TN6A 3VTYA 3D9OA 3ABKE 1XNFA 1U3DA 3ASDA 4APOA 1HE8A 3TWXA 2P58C 1JWGA 2KBXA 2YHCA 2BEDA 4GYWA 5ANRA 4GYYA 2HR2A 3DXMG 3MEKA 4GZ3A 4DI3A 3FWVA 3EJNA 3ML9A 4L7TA 1DCQA 4WNFA 3Q73A 4ABNA 4BERA 5AN8A 2A5EA 5ENOD 4KZ0A 3V79K 1WM5A 3NF1A 1HZ4A 1LD8A 2BF0X 4XI0A 4C9BB 4TRQA 1NI1A 4C48B 3O48A 3QWPA 1TEZA 4K03A 3QWVA 3LY7A 3EUVA 5BV0A 4U0UA 5LP0A 3AG3E 4GMJA 1H6OA 5BXOA 2GW1A 2JABA 1EDUA 3AG1E 1YYHA 3CR3A 4NACA 3AU5A 3CVWA 3G2UA 3RRNB 1ELKA 3PZ4A 3UT8A 4A3TA 3B7BA 4IRUA 2WXJA 2XPIA 3HXFA 1WY6A 3ZGQA 3U66A 3AG2E 4FU3A 2V8SE 4PH4B 4CT0A 4FJYA 4PS8A 1DVPA 2P9UG 4HI8A 4CDRA 5JHAA 1OWMA 1OCCE 1OWOA 2EIJE 3CK7A 3B7RL 1SA4A 4ANWA 4TUUA 3RO3A 2BUGA 4N5CA 5AQ9A 3HXDA 3ZIMA 3B95A 2WVIA 2H6HA 5CRUA 4HLLA 3CEQA 1NA0A 2UY1A 3JUEA 3SD5A 5ENPD 4U0SA 2CHWA 4CT4A 3TGOA 3FTZA 1TNUA 2XS1A 5LFAA 2DYSE 4BY6A 5HRYA 3V31A 4B8CB 4Q96A 4CGVA 4CGWA 3GYZA 3QARA 3APFA 4DJAA 4ATGA 2C0MA 4X8QA 5D0QD 3NOCD 1QZ2A 1WG0A 3FTSA 5A6CA 1JUQA 5FWQA 4AV7A 3V2XA 1MX4A 4I9EA 4GA2A 2RFMA 1FT1A 2KZTB 2BTDA 1B89A 4XX5A 2IEJA 2DZNA 1YA0A 3IBEA 3CSTA 4ME2A 3TWSA 4FC8A 2JEKA 5ENRD 1N52A 4YNDA 2GRMA 2DVWA 5BW8C 2J4DA 2WPVA 4G1TA 3ZRHA 3ASFA 2WXOA 5FQ4A 4ANXA 4YDEA 4LUNU 3QK0A 2OV8A 2XEHA 1IKND 4U7EB 2GRRB 5CRVA 3ASHA 4Q94A 4FJZA 4GTTA 4I9CA 4G23A 3UMVA 2L0IA 2PL2A 3U9WA 1IXVA 4F53A 5JJTA 1QNFA 4HLEA 4GMRA 2ONDA 1EF1C 5FINA 3Q75A 1N4SA 4C0MA 2DIWA 2XRYA 5FQ7A 4L9PA 2J09A 4UQYA 1SZAA 4RQIA 3PZ3A 2KM4A 4ATZD 3QAQA 2WQ7A 2E0IA 2OCCE 4J8DA 4UWLA 4AY6A 2WXMA 4HVBA 2P9KG 5BUZA 4F1SA 1H2TC 3DPDA 3ZU7B 3Q15A 4HXIA 3B13A 2Q7FA 3EDTB 4J8FA 2QY7A 4K5AB 5G04J 2ETCA 4R7LA 3TXMA 4GPMA 1N95A 1WDYA 4N5QA 3FUDA 2LUHA 3T9KA 2DWZA 1JCRA 3CVLA 2L0TB 2VSOE 3PZ1A 3L22A 4JEUA 5FQ8A 2R59A 4A55A 1N0RA 3MV2B 4A1SA 3L13A 3IEGA 1O1TA 2LXLA 3E37A 5JMND 3FH5A 2Y1LE 2EINE 3QC1A 1OWPA 3CVYA 1UJJA 1P5QA 3G2WA 4HI9A 4N3AA 2WQ6A 3BU8A 3HXCA 3OAWA 3EIQC 4JW1A 5B3SE 2H6FA 1FVHA 2QYUA 1N9AA 1E8WA 3ONKA 4JA9A 1BU9A 1TNBA 4MBGA 3ENEA 2WXKA 5ANLA 2ZGDA 4O60A 1NZNA 1JCSA 3J5QB 4BX8A 4BSXA 2VTBB 2WXHA 3QB2A 1N54A 1PY1A 3HVEA 4U07A 3CSFA 1KZOA 4G26A 3TWRA 3TXNA 2XS8A 4DX5D 4F1PA 5EN5D 1N0QA 3JQ0A 2X6JA 3D9KA 4RG6A 1OCZE 3FHEA 4XKCA 4B8AA 1XGWA 3CK9A 5T8IA 3S7JA 3R7RA 3L54A 3RKVA 3CHQA 4DX7D 2J4BA 1ELRA 4F3VA 2OOEA 2I1KA 1O1SA 3AU4A 4I6EA 3UXGA 2CG3A 4V3IA 3ONLA 2A5UA 2RD0A 2NC9A 3FUIA 3VLDA 3E32A 3JUIA 3FFLA 4HNAD 3EHMA 2IU1A 1NFIE 2DBAA 4U0ZA 5HI7A 4I6GA 4K5BA 4DUIA 3K9IA 2ZU6B 3FUJA 3G2VA 4KVMA 1IHGA 3T8MA 2JLBA 3E4BA 3FEYA 1Y6IA 4WNGA 4DPRA 4YVQC 2XPZA 4KVOA 3SHFA 3UPVA 3FUEA 1RZ4A 4G2VA 1TR4A 4N2SA 3T5VA 4ACLA 1OUVA 1LD7A 5FJYA 2WMNA 4UWKA 2C0LA 2H6IA 2AW6A 3ISMC 3Q4AB 3W9FA 2MRIA 4BT8A 4BTBA 4GTPA 3FU5A 3LJ3A 4PS3A 1E8YA 3NZSA 1Q2ZA 3ZYLA 4UWHA 1ZB1A 3ZEFA 2VYIA 3FEXA 1U3CA 3B7UX 1D8DA 3UM2A 4J8SA 4L1BA 3G2SA 1YCSB 4E85A 3HRAA 3SBSA 1G3NB 3ASGA 4KT6B 1JCQA 1HU3A 4WUYA 5KWDA 4GZDA 5M72A 1H0AA 4XE0A 2FO1E 4HOSA 2NSZA 4LRZA 3PS6A 2P9PG 2XPYA 4YVOA 3ZYQA 4F7AA 3BG1B 5J90A 2BKKB 1NA3A 3MJWA 3GZ1A 5ENNA 5LOZA 3FUNA 4GU5A 2WM9A 4U63A 5G05J 3C3RA 4O6FA 2XQ0A 3SGHA 5CMWA 1FT2A 1HXIA 2AXUA 2VJ8A 3FU0A 1MYOA 3NOGD 3VLFA 5G2NA 1H2VC 1GW6A 1ZBPA 3SI5A 2OEWA 2IFUA 5T3RA 4QFVA 3DSSA 3R7QA 1MZCA 3MKQB 2P9NG 3ZXPA 4ACKA 1HG2A 4ILIA 4KYOB 4EBAA 1IYGA 4FADA 3V30A 4JVSA 5JA4D 1BI7B 4HFGA 5CEAA 2ZIRA 2YINA 1YMPA 3VLEA 5KNGA 4NRHB 2Y4TA 3PNTB 3AJIA 3L17A 4KZCA 1W3BA 3ZW3A 2WXFA 1L5JA 3S7DA 3SQVA 4I1MA 3UT7A 3MZLB 4PUCA 4DX2A 3ZHEA 3CGHA 2RKKA 1UN9A 2Y4UA 2OVBA 3Q9NC 3DBSA 3E34A 2I6HA 2KCLA 3URZA 4A1GA 2IO3C 5D0OD 4IN3B 3HIZA 3MCXA 1E90A 4HRMB 4WWOA 1OXJA 2XZTG 3FU6A 3UKRG 4LNBA 2VSNA 4GTSA 4FLHA 2WB2A 4TUMA 5G05C 5AIJA 5EYPF 4I1AA 5B1AE 5ENQD 1TNZA 3Q5MA 4EQFA 1DNPA 3SF4A 2F0YA 3UM0A 1UG3A 3D9JA 3DXKG 3PUKA 3WG7E 2NYJA 5CMYA 2KZTA 3NQPA 4WWPA 2HM8A 1HS6A 1Z6TA 3UQ3A 1TNYA 1UOHA 3UUXA 2V4HC 4BSZB 2AVPA 3L08A 2KCVA 3GZSA 3Q49B 3RO2A 3E33A 2F37A 4B93B 3B7SA 1SA5A 2XEEA 2B6CA 3LJNA 3ML8A 2DCPA 4J8YA 4H7XA 2VSXE 4WNDA 2AXVA 4G8KA 3ASNE 4UI9J 5KBAA 4GZ5A 4MS6A 3PZDA 4N39A 2X6KA 3PRZA 1BLXB 2OVFA 4B94A 3RRUA 2V5QC 2HE0A 3LEWA 1OCRE 4N2QA 3FP3A 3KD7A 3PDNA 2Y0BG 1DC2A 3L82A 5ARFA 3UIPC 3FDHA 4HOUA 1Z3YA 5BV1A 2EIKE 2GRPB 2F8YA 3TWWA 5BXUA 5FQ6A 3SFXA 3L6AA 3ZUVB 1E8XA 2KC7A 1VDYA 3F6QA 3B7TA 3FUMA 4BEPA 1TN8A 4Q69A 3CKCA 5E75A 3RAUA 4EHMA 4W9RA 4I43A 4EZKA 5FT9A 2VGYA 3LY9A 1UW4B 5EIBE 5J08A 5EIDA 3NAWA 2VGEA 3IKOB 2B0OE 3AS8A 4DX1A 2WXQA 4MKTA 2L6BA 4JHRA 4AEZC 5ENSD 3SBTB 1KLXA 4Z68A 5CHEE 2FBNA 4G8LA 2FO7A 3LCAA 2GRLA 4UI9C 1UJKA 3CVVA 5G55A 3ZFWA 2XENA 4FA6A 4M3OA 3BG0B 5FTPA 3P1UA 5C2YA 1E7VA 4F6RD 1V54E 3ZXSA 2I9CA 4G25A 4AOFA 4OVUA 1LF8A 3APDA 3DEOA 5JHBA 3FULA 2VTBA 4PS7A 4GYOA 4DI4A 4FLBA 5DBKA 4XKBA 1S70B 4WAFA 3I4RB 2ZXWE 3U64A 2F8XK 3RRMB 2GROB 4TXPA 5D66A 4JZYA 3DSTA 2YNQA 3CQCB 4JL0A 5G04C 3GZ2A 3KS2A 2Y3AA 4N3BA 1O5MA 1H6KA 5CBNA 4PDXA 3ZYKA 1OT8A 3EIJA 4KBQA 1K8KG 4CYMD 3U3WA 2X3MA 4YDOA 2BKGA 4GTVA 1N94A 3SY2A 3CLJA 2ZISA 4BX9A 2HYZA 2FI7A 5EDSA 1TYQG 3OXFA 3LS8A 2GGFA 4APFA 1KZPA 4CRWA 4EZJA 2QC9A 5CBOA 3BUAA 2H6GA 4ANUA 3QOUA 4HRLA 2P2CP 2R05A 3AAAC 1S64A 1E96B 1K1BA 3JQ1A 4HOQA 3PEUB 2I1JA 4I1OB 4RSYA 4J7WA 3D9IA 2X6HA 2J49A 3BEEA 4B89A 4JHKA 4RLYA 3T8KA 2IY0C 3DPYA 4XI9A 4JC8A 1N4RA 2OEVA 2LNIA 3DWLG 1H19A 2RFAA 2WXIA 4GAAA 2EILE 3WXXA 1PC2A 3DSVA 1D9SA 2HO1A 2QFCA 5EYLA 3C72A 4GCOA 2XCCA 2LXMA 1V55E 2V4LA 3KEAA 1TNOA 3TJPA 1K1AA 3X2QE 5CCMA 4URKA 2P9SG 1INZA 4DK5A 3OTNA 4NQ0A 4HRNA 3LVQE 4Y6WA 1HO8A 4HORA 3UM1A 3CKBA 2IQCA 5FZSA 3UKUG 2E2EA 2GRQB 1DCEA 3GW4A 4QQIA 4OYSA 1HH8A 4U8YD 4C0EA 4LCTA 3RSEG 3BQOA 4DLQA 2VGXB 3UINC 4UQXA 3MV3B 1AP7A 4FP7A 4I2ZA 4DX6D 3R9MA 3IHVA 2LAIA 5AENA 4B0ZA 2PM7A 1KT0A 5D2MC 3HG0D 4JHJA 2RG8A 4LNGA 2KXPC 3AS5A 1HX8A 2XGOA 1A5EA 2C2LA 5KNHD 2YQ8A 5AJDA 2WXPA 2ETBA 4OAUC 3IV0A 5AAOA 2PZIA 3FUFA 4FULA 3S7FA 1JPLA 4YDYA 2PM6A 3Q7FA 5JJ6A 2CG2A 2M63A 3MKQA 4ZFHA 3JXIA 3APCA 3Q79A 3CVUA 3FTWA 4IULA 2LSUA 4L2LA 4AXHA 5AQAA 1X81A 3HXEA 2J07A 4G24A 3HHMA 3MYVA 4LNUD 4HBDA 1BI8B 4DLOA 2LO6A 3CVPA 3UT4A 2V0PA 3CV0A 5IY5E 3J5PA 1HG5A 1HFAA 2GRNB 4GZCA 2DYRE 3CK8A 4L2YA 1E8ZA 5EX3A 3QNKA 4RG9A 1OCOE 2L9BA 5A7DB 4JPSA 1FPPA 3L9TA 3LY8A 3LKUA 3FY4A 3C3OA 2WMOA 4ANVA 3OXGA 5CCLA 3HYMB 3UIOC 3SFZA 3NBNB 5AYWD 1MX6A 4ILGA 4EPZA 4EBAG 1KT1A 3OXLA 2XHEA 5CECB 4GCNA 5EILA 3TWQA 1WAO1 5LCWJ 1QQEA 3PE3A 2WXRA 3S2AA 3KEZA 3D9MA 1NL4A 2QZAA 2IOLA 4JA7A 4CDNA 3TWVA 3ZHEB 1MHQA 1IQUA 3D9HA 3EHNA 3QDNA 3EHQA 2R5SA 3MKRA 3CQGB 1LTXA 5BT1A 3EU5A 3PNLB 4BESA 2I2OA 5E76A 3FTUA 3NB2A 1AWCB 2PQRA 2Y69E 4GA0A 2UY1B 3ULYA 2PQNA 3P2BA 5ITZF 1UN8A 2WXLA 3DSXA 1MQSA 3JXJA 5JJ7A 3MA5A 3SO8A 3N71A 3ZPJA 3FU3A 5FZQA 3TL5A 3C3QA 5CEDB 3CVXA 2XEVA 1IHBA 1SW6A 4GZ6A 3ASOE 3DSWA 2X38A 3Q78A 4HQDA 3QKYA 4P29A 2XZDG 1MJ0A 1TJCA 4ZHBA 3HDXA 1QYMA 3ZN3A 3V2OA 3LPZA 4GTQA 2J08A 4O1PA 5CERB 3KSQA 3MGBA 2IONA 3CVNA 3LXUX 3PEVB 4UQZA 3D3MA 4IYPA 5LCWC 3LDZA 4U96D 3CHOA 4GA1A 3UI2A 3SNXA 4HOTA 1N4PA 3ZNGA 4K0RA 3ZVVA 2V5FA 4JD2G 4L23A 4EECA 3UX4A 4UI9K 4CCAA 3FTYA 4FHKA 1H2UA 2FEZA 4LG6A 5ARGA 4LEUA 4WNEA 5KJMA 2PNNA 2R03A 4U8HA 4AVXA 2L6JA 1S0PA 2CFUA 4XEIG 1TJFA 2A4ZA 3I3NA 1Z3XA 4YDWA 3Q9UC 5KCMA 4LSZE 2LSVA 3PUJA 2ILRA 1Z5SC 4JB8P 3SFYA 3VTXA 3CHPA 1U2VG 4BFRA 2VQ2A 5LX8A 5HQ8A 2QYJA 2VSYA 4OVVA 3KAEA 5C1DA 1O1RA 3CHRA 1RW2A 3LVRE 2R2LA 4MLPA 4GTRA 3ULEG 3C98A 3TG5A 4A3VA 2X6IA 1MX2A 4HS2A 1OY3D 1OWNA 4GPKA 3FH7A 1N4QA 2XRZA 4AJWA 1KPSB 1HF8A 2WXNA 3QWWA 4NURA 3IHYA 3EHRA 5ENTD 4NIKA 4JEHA 2XCBA 1D8EA 3L16A 3G2TA 3PH0C 3RIBA 2WQHA 1JWFA 3ZKJA 1N11A 3FTXA 5HS0A 1A17A 3U4TA 4G11A 4CEMA 1NP7A 3CHMA 1Y8MA 3HXBA 4TXQA 2FULA 2R17C 5FIOA 1SZ9A 3TWTA 5HKPA 4DRXE
chains in the Genus database with same CATH topology
4ILHB 4LUNU 4NRHB 3WXXA 1PC2A 2HO1A 2QFCA 4GCOA 2XCCA 2Y4TA 3QK0A 3PNTB 4WWNA 2OV8A 5A23A 3I4GA 3L17A 5T4YA 4KZCA 1W3BA 2V4LA 3ZW3A 3Q47B 3ASHA 4Q94A 4FJZA 4U04A 2WXFA 4GB9A 4I9CA 1L5JA 4G23A 3S7DA 3TJPA 5CCMA 4URKA 3UMVA 3JYSA 4I1MA 1INZA 2L0IA 2PL2A 3U9WA 3UT7A 5JJTA 4F53A 4DK5A 1QNFA 3OTNA 4NQ0A 4HLEA 3PREA 2ONDA 3MZLB 4PUCA 4RVBA 1EF1C 3QJZA 2IOSA 1OWLA 3LVQE 4LERA 4Y6WA 4C0MA 2DIWA 1HO8A 3ZHEA 3CGHA 4HORA 4EZLA 2XRYA 3MX3A 1UN9A 3CKBA 2IQCA 3FH8A 5FQ7A 5FZSA 3RK6A 2J09A 2E2EA 4UQYA 1FVFA 1SZAA 2Y4UA 1SQMA 3GW4A 4N3CA 4OYSA 1HH8A 4C0EA 2OVBA 3DBSA 4LCTA 1EPUA 2I6HA 3PE4A 2KCLA 2EQXA 3URZA 2KM4A 4A1GA 3FUKA 4DLQA 5D0OD 4IN3B 5AJLA 2VGXB 3HIZA 3MCXA 4E6HA 1E90A 3QAQA 4UQXA 4I6JA 2WQ7A 2E0IA 4AIFA 4J8DA 3MV3B 4WWOA 4UWLA 4FP7A 4I2ZA 3CVQA 3CVWA 4AY6A 3FU6A 3HVEB 4KXKB 3TAXA 2MOWA 2WXMA 3IHVA 4FHJA 4UWFA 2LAIA 2VSNA 4HVBA 5AENA 4B0ZA 4FLHA 2PM7A 5BUZA 2WB2A 4F1SA 3S7BA 4AP2A 1KT0A 3TG4A 5G05C 1H2TC 5AIJA 3DPDA 3FUHA 3Q15A 4HXIA 4JHJA 2RG8A 4I1AA 2IF4A 2Q7FA 2MHKA 3AS5A 1HX8A 3B13A 2XGOA 3EDTB 2QY7A 2C2LA 4GMLA 2YQ8A 4J8FA 4J0UA 3Q5MA 4EQFA 3ESKA 5G04J 1DNPA 5AJDA 3SF4A 2YHEA 2WXPA 3D9LA 4R7LA 3IV0A 3TXMA 2PZIA 3FUFA 2XGSA 4FULA 3S7FA 1UG3A 3D9JA 1JPLA 3PUKA 3FUDA 2PM6A 5JJ6A 4Y6CA 5CMYA 2KZTA 2CG2A 3NQPA 2M63A 4WWPA 3MKQA 3RJVA 2HM8A 4CDMA 3LYAA 5FZRA 4BTAA 3APCA 3CVUA 1IQRA 2X6FA 3FTWA 4JXTA 3CVLA 2L0TB 2VSOE 1HS6A 4IULA 1Z6TA 3UQ3A 3ZYMA 2LSUA 4L2LA 3L22A 4AXHA 3CHSA 4JEUA 3PVLA 5FQ8A 2R59A 3UUXA 2J07A 4G24A 4A55A 4AY5A 3MV2B 1BPOA 2CFZA 3HHMA 3MYVA 4A1SA 5BPPA 4TV3A 3L13A 4BT9A 3IEGA 2AVPA 3ULQA 3O4ZA 3L08A 4DLOA 2LO6A 3CVPA 3RU0A 2KCVA 3GZSA 3UT4A 2V0PA 3FH5A 3Q49B 3RO2A 1FCHA 3CV0A 4D10C 1HFAA 1HG5A 3QC1A 3D9NA 2UWJG 1OWPA 4GZCA 4UWGA 3I5PA 2FF4A 1ELWA 2J9QA 2KATA 3CVYA 1UJJA 1P5QA 3G2WA 5KJKA 3CK8A 4L2YA 1EYHA 3B7SA 1E8ZA 1ZU2A 4N3AA 5EX3A 3QNKA 2WQ6A 3AS4A 4RG9A 3ML8A 3OAWA 3EIQC 2L9BA 5A7DB 2WXGA 4JW1A 4JPSA 2DCPA 5DIZA 3SZ7A 2VTBB 5KJLA 4H7YA 3D9PA 4H7XA 2VSXE 1FVHA 5KJNA 3LY8A 1E8WA 3LKUA 2KCKA 4WNDA 2AXVA 3CIAA 3ONKA 4JA9A 3FY4A 4UI9J 4GZ5A 2WMOA 4ANVA 3OXGA 4MS6A 5CCLA 4I17A 3PZDA 5EKQD 4N39A 5EX0A 2X6KA 3ENEA 3PRZA 3FTVA 2OVFA 2WXKA 4B94A 5ANLA 3HYMB 3NZUA 2LAHA 3RRUA 3SFZA 2CHXA 4ILGA 5AYWD 4EPZA 3LEWA 1NZNA 4N2QA 4EBAG 2NXPA 1KT1A 2XGMA 3FP3A 1E7UA 3OXLA 2VGXA 2XHEA 3KD7A 2IJGX 2AWIA 4GCNA 4AM9A 3PDNA 4I2WA 4BX8A 4BSXA 1WAO1 2WXHA 1QQEA 2CHZA 3PE3A 1N54A 3QB2A 5ARFA 5LCWJ 2WXRA 4J6IA 3FDHA 3JCKC 1PY1A 1Z3YA 4HOUA 4KMOA 4XIFA 3S2AA 5BV1A 2AXZA 3HVEA 4U07A 3CSFA 3R9AB 3KEZA 4G26A 3T5XA 3TXNA 4BWRA 3D9MA 1X5BA 5FQ6A 4J8EA 5BNWA 3ESLA 3L6AA 2IOLA 4JA7A 4CDNA 1PAQA 3ZHEB 1MHQA 4XZ4A 3JQ0A 2X6JA 1IQUA 3D9KA 4RG6A 3VTYA 3D9OA 3FHEA 3EHNA 3QDNA 4XKCA 2R5SA 3MKRA 1E8XA 3CQGB 4B8AA 1XGWA 1XNFA 3CK9A 5T8IA 3S7JA 1U3DA 3ASDA 3PNLB 4APOA 3R7RA 5BT1A 1HE8A 2KC7A 2I2OA 1VDYA 5E76A 3L54A 3FTUA 2P58C 3RKVA 3CHQA 2PQRA 2J4BA 1ELRA 1JWGA 2OOEA 4F3VA 2YHCA 4GYWA 2I1KA 5ANRA 4GYYA 3B7TA 3AU4A 3FUMA 2HR2A 4I6EA 4GA0A 2CG3A 4V3IA 3ONLA 2UY1B 2A5UA 2RD0A 4Q69A 3CKCA 2NC9A 3MEKA 2PQNA 3FUIA 3P2BA 4GZ3A 5E75A 4DI3A 3VLDA 1UN8A 3FWVA 2WXLA 3EJNA 3ML9A 1MQSA 3JUIA 3FFLA 5JJ7A 3EHMA 4L7TA 2IU1A 3MA5A 4WNFA 3N71A 4W9RA 2DBAA 4I43A 4U0ZA 4EZKA 3ZPJA 5FT9A 3FU3A 5FZQA 5HI7A 4I6GA 3K9IA 3TL5A 2ZU6B 2VGYA 3LY9A 4ABNA 3FUJA 3CVXA 2XEVA 3G2VA 1UW4B 5J08A 4KVMA 1IHGA 3T8MA 2JLBA 4KZ0A 4GZ6A 3E4BA 3IKOB 1WM5A 3NF1A 1HZ4A 3FEYA 3AS8A 1Y6IA 2BF0X 2X38A 4WNGA 4XI0A 4DPRA 2WXQA 4C9BB 4YVQC 2XPZA 4KVOA 3SHFA 3QKYA 4TRQA 3FUEA 4MKTA 3UPVA 4P29A 4G2VA 4JHRA 4AEZC 3SBTB 1KLXA 4N2SA 5CHEE 3O48A 3T5VA 2FBNA 4ACLA 1OUVA 3QWPA 1TEZA 2FO7A 3LCAA 3QWVA 1TJCA 4K03A 3HDXA 2GRLA 3LY7A 5FJYA 4UI9C 2WMNA 1UJKA 5BV0A 4U0UA 5LP0A 4UWKA 3CVVA 4GMJA 5G55A 3ZFWA 2C0LA 3ZN3A 4FA6A 2GW1A 4M3OA 2AW6A 1EDUA 3BG0B 3Q4AB 3LPZA 2J08A 3CR3A 5FTPA 4NACA 3P1UA 5C2YA 2MRIA 4BT8A 1E7VA 3AU5A 3MGBA 2IONA 3CVNA 3G2UA 1ELKA 3LXUX 3PEVB 3RRNB 3UT8A 4A3TA 4UQZA 3D3MA 4BTBA 4IRUA 2I9CA 4G25A 3ZXSA 4AOFA 4IYPA 4OVUA 1LF8A 3APDA 5LCWC 3LDZA 2WXJA 2XPIA 3CHOA 3FU5A 4GA1A 5JHBA 3LJ3A 3SNXA 4PS3A 1E8YA 1WY6A 3FULA 3ZGQA 3U66A 4HOTA 3NZSA 2VTBA 4FU3A 4K0RA 4PS7A 2V8SE 3ZVVA 2V5FA 4PH4B 3ZYLA 4CT0A 4FJYA 4PS8A 4UWHA 4L23A 4GYOA 3ZEFA 4EECA 3UX4A 4UI9K 4DI4A 1DVPA 4FLBA 2VYIA 3FEXA 3FTYA 5DBKA 1U3CA 4XKBA 4CCAA 3B7UX 4FHKA 1H2UA 4CDRA 4J8SA 5JHAA 2FEZA 1OWMA 4WAFA 3I4RB 5ARGA 3U64A 4L1BA 1OWOA 3G2SA 4LEUA 4WNEA 3RRMB 3CK7A 4E85A 5KJMA 3B7RL 4JZYA 4ANWA 4TUUA 3RO3A 3SBSA 2BUGA 4N5CA 3ASGA 2YNQA 4U8HA 3CQCB 4JL0A 4KT6B 5G04C 4AVXA 3GZ2A 2L6JA 3KS2A 2Y3AA 4N3BA 1S0PA 1H6KA 3ZIMA 4PDXA 3ZYKA 2CFUA 2WVIA 1TJFA 2A4ZA 3I3NA 1Z3XA 3EIJA 1HU3A 3CEQA 1NA0A 4KBQA 5KCMA 4WUYA 2LSVA 2UY1A 3PUJA 3SD5A 4U0SA 2CHWA 4CT4A 3U3WA 3TGOA 2ILRA 2X3MA 3FTZA 4GZDA 5M72A 1H0AA 4XE0A 4HOSA 2NSZA 4LRZA 3PS6A 5LFAA 2XPYA 4BY6A 4YVOA 3ZYQA 4F7AA 3VTXA 3CHPA 3BG1B 3CLJA 5J90A 4BFRA 2VQ2A 4BX9A 4B8CB 5LX8A 2HYZA 4Q96A 1NA3A 5HQ8A 3MJWA 2FI7A 2VSYA 5EDSA 3OXFA 4CGVA 3LS8A 4OVVA 3KAEA 3GZ1A 5ENNA 5C1DA 2GGFA 3CHRA 5LOZA 4CGWA 3FUNA 3GYZA 3QARA 4APFA 3LVRE 3APFA 4CRWA 4MLPA 4GU5A 4DJAA 3C98A 3TG5A 4EZJA 4A3VA 2X6IA 4ATGA 2C0MA 5D0QD 2WM9A 4U63A 1QZ2A 3FTSA 5A6CA 4ANUA 4HS2A 1OWNA 4GPKA 3FH7A 5G05J 2XRZA 1JUQA 4AJWA 3QOUA 5FWQA 4O6FA 2XQ0A 3SGHA 5CMWA 1HF8A 2WXNA 3QWWA 4AV7A 1HXIA 4NURA 2AXUA 4MRUA 2VJ8A 3FU0A 4I9EA 3IHYA 3VLFA 4GA2A 4JEHA 1H2VC 5G2NA 1GW6A 1ZBPA 3SI5A 2XCBA 1E96B 2IFUA 2KZTB 2BTDA 3JQ1A 4QFVA 1B89A 5T3RA 3PEUB 4HOQA 2I1JA 3MKQB 4I1OB 4XX5A 3R7QA 1YA0A 3IBEA 3L16A 4RSYA 3G2TA 4ACKA 3D9IA 3PH0C 1HG2A 3RIBA 3CSTA 2WQHA 1JWFA 2J49A 2X6HA 3BEEA 4JHKA 4ME2A 4B89A 4ILIA 3FTXA 4FC8A 2JEKA 4XI9A 1N52A 1A17A 3U4TA 4G11A 4JC8A 4CEMA 4KYOB 4EBAA 4YNDA 2GRMA 5BW8C 1IYGA 1NP7A 4FADA 3CHMA 2J4DA 4JVSA 2LNIA 2WPVA 4G1TA 1Y8MA 4HFGA 3ZRHA 3ASFA 1H19A 2WXOA 2FULA 2R17C 2YINA 1SZ9A 5FQ4A 2WXIA 3VLEA 4GAAA 4ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CT4 A;  5ANR A;  4LUN U;  2IOS A;  1UW4 B;  4B89 A;  4JHK A;  2NSZ A;  1N52 A;  4GMJ A;  3L6A A;  2IOL A;  3EIQ C;  1PAQ A;  3RK6 A;  4CEM A;  1UG3 A;  3FEY A;  3JUI A;  4B8C B;  1H6K A;  2IU1 A;  2KZT A;  4B8A A;  2VSX E;  4C9B B;  2HM8 A;  1N54 A;  3FEX A;  1H2T C;  1H2V C;  3EIJ A;  1HU3 A;  2GGF A;  2ION A;  2FUL A;  4JHJ A;  2I2O A;  2RG8 A;  2KZT B;  3D3M A;  2VSO E;  1H2U A;  4IUL A;  4CRW A;  4GML A;  2ZU6 B; 
#chains in the Genus database with same CATH topology
 4ILH B;  3AG4 E;  3UM3 A;  4WWN A;  5A23 A;  3I4G A;  5T4Y A;  4UUC A;  3Q47 B;  4U04 A;  4GB9 A;  3JYS A;  3PRE A;  4RVB A;  3PZ2 A;  3QJZ A;  2IOS A;  1OWL A;  4LER A;  4EZL A;  1BD8 A;  3MX3 A;  3FH8 A;  5AQB A;  3IXE A;  3RK6 A;  1FVF A;  1QBQ A;  1SQM A;  4N3C A;  1EPU A;  3PE4 A;  1K3Z D;  2EQX A;  3FUK A;  3E30 A;  5AJL A;  4E6H A;  4I6J A;  4AIF A;  3Q7A A;  3CVQ A;  4OAV B;  3HVE B;  4KXK B;  3TAX A;  2MOW A;  4FHJ A;  2DZO A;  4UWF A;  4TXR A;  2IO2 C;  3S7B A;  4AP2 A;  3TG4 A;  3FUH A;  1H6P A;  2IF4 A;  4BET A;  2MHK A;  4MRU A;  4GML A;  4J0U A;  3ESK A;  2YHE A;  3UTM A;  3D9L A;  2XGS A;  2J8S D;  4Y6C A;  5H7P A;  2P9L G;  3RJV A;  3W9G A;  4CDM A;  3LYA A;  5FZR A;  4BTA A;  3DSU A;  1IQR A;  2X6F A;  4K5C A;  4JXT A;  4O1O A;  3ZYM A;  3CHS A;  3PVL A;  4A63 B;  4AY5 A;  1BPO A;  2CFZ A;  5BPP A;  4TV3 A;  4BT9 A;  3ULQ A;  3O4Z A;  3RU0 A;  1FCH A;  3DEP A;  4D10 C;  1TN7 A;  3D9N A;  1SVX A;  2UWJ G;  2P9I G;  4UWG A;  2EIM E;  1S63 A;  2FF4 A;  3I5P A;  1ELW A;  5AQ7 A;  5AAR A;  2J9Q A;  2KAT A;  5KJK A;  1EYH A;  1ZU2 A;  3EU9 A;  4U8V D;  3AS4 A;  2WXG A;  4M7C A;  3SZ7 A;  5DIZ A;  4CZ2 D;  2MYO A;  5KJL A;  4H7Y A;  3D9P A;  5KJN A;  2KCK A;  3CIA A;  5B1B E;  4I17 A;  5EKQ D;  5EX0 A;  3FTV A;  4GTM A;  3NZU A;  2LAH A;  2CHX A;  2AJA A;  2R02 A;  2NXP A;  2XGM A;  1E7U A;  2VGX A;  3ABL E;  4GTO A;  4HB5 A;  2ZGG A;  2IJG X;  2AWI A;  4AM9 A;  4I2W A;  2CHZ A;  3DRA A;  3C5R A;  3TWU A;  4J6I A;  3JCK C;  3ABM E;  4KMO A;  4XIF A;  2AXZ A;  3KSL A;  3R9A B;  3T5X A;  4BWR A;  2ETA A;  1X5B A;  4J8E A;  5BNW A;  3ESL A;  1PAQ A;  4U95 D;  4XZ4 A;  1TN6 A;  3VTY A;  3D9O A;  3ABK E;  1XNF A;  1U3D A;  3ASD A;  4APO A;  1HE8 A;  3TWX A;  2P58 C;  1JWG A;  2KBX A;  2YHC A;  2BED A;  4GYW A;  5ANR A;  4GYY A;  2HR2 A;  3DXM G;  3MEK A;  4GZ3 A;  4DI3 A;  3FWV A;  3EJN A;  3ML9 A;  4L7T A;  1DCQ A;  4WNF A;  3Q73 A;  4ABN A;  4BER A;  5AN8 A;  2A5E A;  5ENO D;  4KZ0 A;  3V79 K;  1WM5 A;  3NF1 A;  1HZ4 A;  1LD8 A;  2BF0 X;  4XI0 A;  4C9B B;  4TRQ A;  1NI1 A;  4C48 B;  3O48 A;  3QWP A;  1TEZ A;  4K03 A;  3QWV A;  3LY7 A;  3EUV A;  5BV0 A;  4U0U A;  5LP0 A;  3AG3 E;  4GMJ A;  1H6O A;  5BXO A;  2GW1 A;  2JAB A;  1EDU A;  3AG1 E;  1YYH A;  3CR3 A;  4NAC A;  3AU5 A;  3CVW A;  3G2U A;  3RRN B;  1ELK A;  3PZ4 A;  3UT8 A;  4A3T A;  3B7B A;  4IRU A;  2WXJ A;  2XPI A;  3HXF A;  1WY6 A;  3ZGQ A;  3U66 A;  3AG2 E;  4FU3 A;  2V8S E;  4PH4 B;  4CT0 A;  4FJY A;  4PS8 A;  1DVP A;  2P9U G;  4HI8 A;  4CDR A;  5JHA A;  1OWM A;  1OCC E;  1OWO A;  2EIJ E;  3CK7 A;  3B7R L;  1SA4 A;  4ANW A;  4TUU A;  3RO3 A;  2BUG A;  4N5C A;  5AQ9 A;  3HXD A;  3ZIM A;  3B95 A;  2WVI A;  2H6H A;  5CRU A;  4HLL A;  3CEQ A;  1NA0 A;  2UY1 A;  3JUE A;  3SD5 A;  5ENP D;  4U0S A;  2CHW A;  4CT4 A;  3TGO A;  3FTZ A;  1TNU A;  2XS1 A;  5LFA A;  2DYS E;  4BY6 A;  5HRY A;  3V31 A;  4B8C B;  4Q96 A;  4CGV A;  4CGW A;  3GYZ A;  3QAR A;  3APF A;  4DJA A;  4ATG A;  2C0M A;  4X8Q A;  5D0Q D;  3NOC D;  1QZ2 A;  1WG0 A;  3FTS A;  5A6C A;  1JUQ A;  5FWQ A;  4AV7 A;  3V2X A;  1MX4 A;  4I9E A;  4GA2 A;  2RFM A;  1FT1 A;  2KZT B;  2BTD A;  1B89 A;  4XX5 A;  2IEJ A;  2DZN A;  1YA0 A;  3IBE A;  3CST A;  4ME2 A;  3TWS A;  4FC8 A;  2JEK A;  5ENR D;  1N52 A;  4YND A;  2GRM A;  2DVW A;  5BW8 C;  2J4D A;  2WPV A;  4G1T A;  3ZRH A;  3ASF A;  2WXO A;  5FQ4 A;  4ANX A;  4YDE A;  4LUN U;  3QK0 A;  2OV8 A;  2XEH A;  1IKN D;  4U7E B;  2GRR B;  5CRV A;  3ASH A;  4Q94 A;  4FJZ A;  4GTT A;  4I9C A;  4G23 A;  3UMV A;  2L0I A;  2PL2 A;  3U9W A;  1IXV A;  4F53 A;  5JJT A;  1QNF A;  4HLE A;  4GMR A;  2OND A;  1EF1 C;  5FIN A;  3Q75 A;  1N4S A;  4C0M A;  2DIW A;  2XRY A;  5FQ7 A;  4L9P A;  2J09 A;  4UQY A;  1SZA A;  4RQI A;  3PZ3 A;  2KM4 A;  4ATZ D;  3QAQ A;  2WQ7 A;  2E0I A;  2OCC E;  4J8D A;  4UWL A;  4AY6 A;  2WXM A;  4HVB A;  2P9K G;  5BUZ A;  4F1S A;  1H2T C;  3DPD A;  3ZU7 B;  3Q15 A;  4HXI A;  3B13 A;  2Q7F A;  3EDT B;  4J8F A;  2QY7 A;  4K5A B;  5G04 J;  2ETC A;  4R7L A;  3TXM A;  4GPM A;  1N95 A;  1WDY A;  4N5Q A;  3FUD A;  2LUH A;  3T9K A;  2DWZ A;  1JCR A;  3CVL A;  2L0T B;  2VSO E;  3PZ1 A;  3L22 A;  4JEU A;  5FQ8 A;  2R59 A;  4A55 A;  1N0R A;  3MV2 B;  4A1S A;  3L13 A;  3IEG A;  1O1T A;  2LXL A;  3E37 A;  5JMN D;  3FH5 A;  2Y1L E;  2EIN E;  3QC1 A;  1OWP A;  3CVY A;  1UJJ A;  1P5Q A;  3G2W A;  4HI9 A;  4N3A A;  2WQ6 A;  3BU8 A;  3HXC A;  3OAW A;  3EIQ C;  4JW1 A;  5B3S E;  2H6F A;  1FVH A;  2QYU A;  1N9A A;  1E8W A;  3ONK A;  4JA9 A;  1BU9 A;  1TNB A;  4MBG A;  3ENE A;  2WXK A;  5ANL A;  2ZGD A;  4O60 A;  1NZN A;  1JCS A;  3J5Q B;  4BX8 A;  4BSX A;  2VTB B;  2WXH A;  3QB2 A;  1N54 A;  1PY1 A;  3HVE A;  4U07 A;  3CSF A;  1KZO A;  4G26 A;  3TWR A;  3TXN A;  2XS8 A;  4DX5 D;  4F1P A;  5EN5 D;  1N0Q A;  3JQ0 A;  2X6J A;  3D9K A;  4RG6 A;  1OCZ E;  3FHE A;  4XKC A;  4B8A A;  1XGW A;  3CK9 A;  5T8I A;  3S7J A;  3R7R A;  3L54 A;  3RKV A;  3CHQ A;  4DX7 D;  2J4B A;  1ELR A;  4F3V A;  2OOE A;  2I1K A;  1O1S A;  3AU4 A;  4I6E A;  3UXG A;  2CG3 A;  4V3I A;  3ONL A;  2A5U A;  2RD0 A;  2NC9 A;  3FUI A;  3VLD A;  3E32 A;  3JUI A;  3FFL A;  4HNA D;  3EHM A;  2IU1 A;  1NFI E;  2DBA A;  4U0Z A;  5HI7 A;  4I6G A;  4K5B A;  4DUI A;  3K9I A;  2ZU6 B;  3FUJ A;  3G2V A;  4KVM A;  1IHG A;  3T8M A;  2JLB A;  3E4B A;  3FEY A;  1Y6I A;  4WNG A;  4DPR A;  4YVQ C;  2XPZ A;  4KVO A;  3SHF A;  3UPV A;  3FUE A;  1RZ4 A;  4G2V A;  1TR4 A;  4N2S A;  3T5V A;  4ACL A;  1OUV A;  1LD7 A;  5FJY A;  2WMN A;  4UWK A;  2C0L A;  2H6I A;  2AW6 A;  3ISM C;  3Q4A B;  3W9F A;  2MRI A;  4BT8 A;  4BTB A;  4GTP A;  3FU5 A;  3LJ3 A;  4PS3 A;  1E8Y A;  3NZS A;  1Q2Z A;  3ZYL A;  4UWH A;  1ZB1 A;  3ZEF A;  2VYI A;  3FEX A;  1U3C A;  3B7U X;  1D8D A;  3UM2 A;  4J8S A;  4L1B A;  3G2S A;  1YCS B;  4E85 A;  3HRA A;  3SBS A;  1G3N B;  3ASG A;  4KT6 B;  1JCQ A;  1HU3 A;  4WUY A;  5KWD A;  4GZD A;  5M72 A;  1H0A A;  4XE0 A;  2FO1 E;  4HOS A;  2NSZ A;  4LRZ A;  3PS6 A;  2P9P G;  2XPY A;  4YVO A;  3ZYQ A;  4F7A A;  3BG1 B;  5J90 A;  2BKK B;  1NA3 A;  3MJW A;  3GZ1 A;  5ENN A;  5LOZ A;  3FUN A;  4GU5 A;  2WM9 A;  4U63 A;  5G05 J;  3C3R A;  4O6F A;  2XQ0 A;  3SGH A;  5CMW A;  1FT2 A;  1HXI A;  2AXU A;  2VJ8 A;  3FU0 A;  1MYO A;  3NOG D;  3VLF A;  5G2N A;  1H2V C;  1GW6 A;  1ZBP A;  3SI5 A;  2OEW A;  2IFU A;  5T3R A;  4QFV A;  3DSS A;  3R7Q A;  1MZC A;  3MKQ B;  2P9N G;  3ZXP A;  4ACK A;  1HG2 A;  4ILI A;  4KYO B;  4EBA A;  1IYG A;  4FAD A;  3V30 A;  4JVS A;  5JA4 D;  1BI7 B;  4HFG A;  5CEA A;  2ZIR A;  2YIN A;  1YMP A;  3VLE A;  5KNG A;  4NRH B;  2Y4T A;  3PNT B;  3AJI A;  3L17 A;  4KZC A;  1W3B A;  3ZW3 A;  2WXF A;  1L5J A;  3S7D A;  3SQV A;  4I1M A;  3UT7 A;  3MZL B;  4PUC A;  4DX2 A;  3ZHE A;  3CGH A;  2RKK A;  1UN9 A;  2Y4U A;  2OVB A;  3Q9N C;  3DBS A;  3E34 A;  2I6H A;  2KCL A;  3URZ A;  4A1G A;  2IO3 C;  5D0O D;  4IN3 B;  3HIZ A;  3MCX A;  1E90 A;  4HRM B;  4WWO A;  1OXJ A;  2XZT G;  3FU6 A;  3UKR G;  4LNB A;  2VSN A;  4GTS A;  4FLH A;  2WB2 A;  4TUM A;  5G05 C;  5AIJ A;  5EYP F;  4I1A A;  5B1A E;  5ENQ D;  1TNZ A;  3Q5M A;  4EQF A;  1DNP A;  3SF4 A;  2F0Y A;  3UM0 A;  1UG3 A;  3D9J A;  3DXK G;  3PUK A;  3WG7 E;  2NYJ A;  5CMY A;  2KZT A;  3NQP A;  4WWP A;  2HM8 A;  1HS6 A;  1Z6T A;  3UQ3 A;  1TNY A;  1UOH A;  3UUX A;  2V4H C;  4BSZ B;  2AVP A;  3L08 A;  2KCV A;  3GZS A;  3Q49 B;  3RO2 A;  3E33 A;  2F37 A;  4B93 B;  3B7S A;  1SA5 A;  2XEE A;  2B6C A;  3LJN A;  3ML8 A;  2DCP A;  4J8Y A;  4H7X A;  2VSX E;  4WND A;  2AXV A;  4G8K A;  3ASN E;  4UI9 J;  5KBA A;  4GZ5 A;  4MS6 A;  3PZD A;  4N39 A;  2X6K A;  3PRZ A;  1BLX B;  2OVF A;  4B94 A;  3RRU A;  2V5Q C;  2HE0 A;  3LEW A;  1OCR E;  4N2Q A;  3FP3 A;  3KD7 A;  3PDN A;  2Y0B G;  1DC2 A;  3L82 A;  5ARF A;  3UIP C;  3FDH A;  4HOU A;  1Z3Y A;  5BV1 A;  2EIK E;  2GRP B;  2F8Y A;  3TWW A;  5BXU A;  5FQ6 A;  3SFX A;  3L6A A;  3ZUV B;  1E8X A;  2KC7 A;  1VDY A;  3F6Q A;  3B7T A;  3FUM A;  4BEP A;  1TN8 A;  4Q69 A;  3CKC A;  5E75 A;  3RAU A;  4EHM A;  4W9R A;  4I43 A;  4EZK A;  5FT9 A;  2VGY A;  3LY9 A;  1UW4 B;  5EIB E;  5J08 A;  5EID A;  3NAW A;  2VGE A;  3IKO B;  2B0O E;  3AS8 A;  4DX1 A;  2WXQ A;  4MKT A;  2L6B A;  4JHR A;  4AEZ C;  5ENS D;  3SBT B;  1KLX A;  4Z68 A;  5CHE E;  2FBN A;  4G8L A;  2FO7 A;  3LCA A;  2GRL A;  4UI9 C;  1UJK A;  3CVV A;  5G55 A;  3ZFW A;  2XEN A;  4FA6 A;  4M3O A;  3BG0 B;  5FTP A;  3P1U A;  5C2Y A;  1E7V A;  4F6R D;  1V54 E;  3ZXS A;  2I9C A;  4G25 A;  4AOF A;  4OVU A;  1LF8 A;  3APD A;  3DEO A;  5JHB A;  3FUL A;  2VTB A;  4PS7 A;  4GYO A;  4DI4 A;  4FLB A;  5DBK A;  4XKB A;  1S70 B;  4WAF A;  3I4R B;  2ZXW E;  3U64 A;  2F8X K;  3RRM B;  2GRO B;  4TXP A;  5D66 A;  4JZY A;  3DST A;  2YNQ A;  3CQC B;  4JL0 A;  5G04 C;  3GZ2 A;  3KS2 A;  2Y3A A;  4N3B A;  1O5M A;  1H6K A;  5CBN A;  4PDX A;  3ZYK A;  1OT8 A;  3EIJ A;  4KBQ A;  1K8K G;  4CYM D;  3U3W A;  2X3M A;  4YDO A;  2BKG A;  4GTV A;  1N94 A;  3SY2 A;  3CLJ A;  2ZIS A;  4BX9 A;  2HYZ A;  2FI7 A;  5EDS A;  1TYQ G;  3OXF A;  3LS8 A;  2GGF A;  4APF A;  1KZP A;  4CRW A;  4EZJ A;  2QC9 A;  5CBO A;  3BUA A;  2H6G A;  4ANU A;  3QOU A;  4HRL A;  2P2C P;  2R05 A;  3AAA C;  1S64 A;  1E96 B;  1K1B A;  3JQ1 A;  4HOQ A;  3PEU B;  2I1J A;  4I1O B;  4RSY A;  4J7W A;  3D9I A;  2X6H A;  2J49 A;  3BEE A;  4B89 A;  4JHK A;  4RLY A;  3T8K A;  2IY0 C;  3DPY A;  4XI9 A;  4JC8 A;  1N4R A;  2OEV A;  2LNI A;  3DWL G;  1H19 A;  2RFA A;  2WXI A;  4GAA A;  2EIL E;  3WXX A;  1PC2 A;  3DSV A;  1D9S A;  2HO1 A;  2QFC A;  5EYL A;  3C72 A;  4GCO A;  2XCC A;  2LXM A;  1V55 E;  2V4L A;  3KEA A;  1TNO A;  3TJP A;  1K1A A;  3X2Q E;  5CCM A;  4URK A;  2P9S G;  1INZ A;  4DK5 A;  3OTN A;  4NQ0 A;  4HRN A;  3LVQ E;  4Y6W A;  1HO8 A;  4HOR A;  3UM1 A;  3CKB A;  2IQC A;  5FZS A;  3UKU G;  2E2E A;  2GRQ B;  1DCE A;  3GW4 A;  4QQI A;  4OYS A;  1HH8 A;  4U8Y D;  4C0E A;  4LCT A;  3RSE G;  3BQO A;  4DLQ A;  2VGX B;  3UIN C;  4UQX A;  3MV3 B;  1AP7 A;  4FP7 A;  4I2Z A;  4DX6 D;  3R9M A;  3IHV A;  2LAI A;  5AEN A;  4B0Z A;  2PM7 A;  1KT0 A;  5D2M C;  3HG0 D;  4JHJ A;  2RG8 A;  4LNG A;  2KXP C;  3AS5 A;  1HX8 A;  2XGO A;  1A5E A;  2C2L A;  5KNH D;  2YQ8 A;  5AJD A;  2WXP A;  2ETB A;  4OAU C;  3IV0 A;  5AAO A;  2PZI A;  3FUF A;  4FUL A;  3S7F A;  1JPL A;  4YDY A;  2PM6 A;  3Q7F A;  5JJ6 A;  2CG2 A;  2M63 A;  3MKQ A;  4ZFH A;  3JXI A;  3APC A;  3Q79 A;  3CVU A;  3FTW A;  4IUL A;  2LSU A;  4L2L A;  4AXH A;  5AQA A;  1X81 A;  3HXE A;  2J07 A;  4G24 A;  3HHM A;  3MYV A;  4LNU D;  4HBD A;  1BI8 B;  4DLO A;  2LO6 A;  3CVP A;  3UT4 A;  2V0P A;  3CV0 A;  5IY5 E;  3J5P A;  1HG5 A;  1HFA A;  2GRN B;  4GZC A;  2DYR E;  3CK8 A;  4L2Y A;  1E8Z A;  5EX3 A;  3QNK A;  4RG9 A;  1OCO E;  2L9B A;  5A7D B;  4JPS A;  1FPP A;  3L9T A;  3LY8 A;  3LKU A;  3FY4 A;  3C3O A;  2WMO A;  4ANV A;  3OXG A;  5CCL A;  3HYM B;  3UIO C;  3SFZ A;  3NBN B;  5AYW D;  1MX6 A;  4ILG A;  4EPZ A;  4EBA G;  1KT1 A;  3OXL A;  2XHE A;  5CEC B;  4GCN A;  5EIL A;  3TWQ A;  1WAO 1;  5LCW J;  1QQE A;  3PE3 A;  2WXR A;  3S2A A;  3KEZ A;  3D9M A;  1NL4 A;  2QZA A;  2IOL A;  4JA7 A;  4CDN A;  3TWV A;  3ZHE B;  1MHQ A;  1IQU A;  3D9H A;  3EHN A;  3QDN A;  3EHQ A;  2R5S A;  3MKR A;  3CQG B;  1LTX A;  5BT1 A;  3EU5 A;  3PNL B;  4BES A;  2I2O A;  5E76 A;  3FTU A;  3NB2 A;  1AWC B;  2PQR A;  2Y69 E;  4GA0 A;  2UY1 B;  3ULY A;  2PQN A;  3P2B A;  5ITZ F;  1UN8 A;  2WXL A;  3DSX A;  1MQS A;  3JXJ A;  5JJ7 A;  3MA5 A;  3SO8 A;  3N71 A;  3ZPJ A;  3FU3 A;  5FZQ A;  3TL5 A;  3C3Q A;  5CED B;  3CVX A;  2XEV A;  1IHB A;  1SW6 A;  4GZ6 A;  3ASO E;  3DSW A;  2X38 A;  3Q78 A;  4HQD A;  3QKY A;  4P29 A;  2XZD G;  1MJ0 A;  1TJC A;  4ZHB A;  3HDX A;  1QYM A;  3ZN3 A;  3V2O A;  3LPZ A;  4GTQ A;  2J08 A;  4O1P A;  5CER B;  3KSQ A;  3MGB A;  2ION A;  3CVN A;  3LXU X;  3PEV B;  4UQZ A;  3D3M A;  4IYP A;  5LCW C;  3LDZ A;  4U96 D;  3CHO A;  4GA1 A;  3UI2 A;  3SNX A;  4HOT A;  1N4P A;  3ZNG A;  4K0R A;  3ZVV A;  2V5F A;  4JD2 G;  4L23 A;  4EEC A;  3UX4 A;  4UI9 K;  4CCA A;  3FTY A;  4FHK A;  1H2U A;  2FEZ A;  4LG6 A;  5ARG A;  4LEU A;  4WNE A;  5KJM A;  2PNN A;  2R03 A;  4U8H A;  4AVX A;  2L6J A;  1S0P A;  2CFU A;  4XEI G;  1TJF A;  2A4Z A;  3I3N A;  1Z3X A;  4YDW A;  3Q9U C;  5KCM A;  4LSZ E;  2LSV A;  3PUJ A;  2ILR A;  1Z5S C;  4JB8 P;  3SFY A;  3VTX A;  3CHP A;  1U2V G;  4BFR A;  2VQ2 A;  5LX8 A;  5HQ8 A;  2QYJ A;  2VSY A;  4OVV A;  3KAE A;  5C1D A;  1O1R A;  3CHR A;  1RW2 A;  3LVR E;  2R2L A;  4MLP A;  4GTR A;  3ULE G;  3C98 A;  3TG5 A;  4A3V A;  2X6I A;  1MX2 A;  4HS2 A;  1OY3 D;  1OWN A;  4GPK A;  3FH7 A;  1N4Q A;  2XRZ A;  4AJW A;  1KPS B;  1HF8 A;  2WXN A;  3QWW A;  4NUR A;  3IHY A;  3EHR A;  5ENT D;  4NIK A;  4JEH A;  2XCB A;  1D8E A;  3L16 A;  3G2T A;  3PH0 C;  3RIB A;  2WQH A;  1JWF A;  3ZKJ A;  1N11 A;  3FTX A;  5HS0 A;  1A17 A;  3U4T A;  4G11 A;  4CEM A;  1NP7 A;  3CHM A;  1Y8M A;  3HXB A;  4TXQ A;  2FUL A;  2R17 C;  5FIO A;  1SZ9 A;  3TWT A;  5HKP A;  4DRX E; 
#chains in the Genus database with same CATH homology
 4ILH B;  4LUN U;  4NRH B;  3WXX A;  1PC2 A;  2HO1 A;  2QFC A;  4GCO A;  2XCC A;  2Y4T A;  3QK0 A;  3PNT B;  4WWN A;  2OV8 A;  5A23 A;  3I4G A;  3L17 A;  5T4Y A;  4KZC A;  1W3B A;  2V4L A;  3ZW3 A;  3Q47 B;  3ASH A;  4Q94 A;  4FJZ A;  4U04 A;  2WXF A;  4GB9 A;  4I9C A;  1L5J A;  4G23 A;  3S7D A;  3TJP A;  5CCM A;  4URK A;  3UMV A;  3JYS A;  4I1M A;  1INZ A;  2L0I A;  2PL2 A;  3U9W A;  3UT7 A;  5JJT A;  4F53 A;  4DK5 A;  1QNF A;  3OTN A;  4NQ0 A;  4HLE A;  3PRE A;  2OND A;  3MZL B;  4PUC A;  4RVB A;  1EF1 C;  3QJZ A;  2IOS A;  1OWL A;  3LVQ E;  4LER A;  4Y6W A;  4C0M A;  2DIW A;  1HO8 A;  3ZHE A;  3CGH A;  4HOR A;  4EZL A;  2XRY A;  3MX3 A;  1UN9 A;  3CKB A;  2IQC A;  3FH8 A;  5FQ7 A;  5FZS A;  3RK6 A;  2J09 A;  2E2E A;  4UQY A;  1FVF A;  1SZA A;  2Y4U A;  1SQM A;  3GW4 A;  4N3C A;  4OYS A;  1HH8 A;  4C0E A;  2OVB A;  3DBS A;  4LCT A;  1EPU A;  2I6H A;  3PE4 A;  2KCL A;  2EQX A;  3URZ A;  2KM4 A;  4A1G A;  3FUK A;  4DLQ A;  5D0O D;  4IN3 B;  5AJL A;  2VGX B;  3HIZ A;  3MCX A;  4E6H A;  1E90 A;  3QAQ A;  4UQX A;  4I6J A;  2WQ7 A;  2E0I A;  4AIF A;  4J8D A;  3MV3 B;  4WWO A;  4UWL A;  4FP7 A;  4I2Z A;  3CVQ A;  3CVW A;  4AY6 A;  3FU6 A;  3HVE B;  4KXK B;  3TAX A;  2MOW A;  2WXM A;  3IHV A;  4FHJ A;  4UWF A;  2LAI A;  2VSN A;  4HVB A;  5AEN A;  4B0Z A;  4FLH A;  2PM7 A;  5BUZ A;  2WB2 A;  4F1S A;  3S7B A;  4AP2 A;  1KT0 A;  3TG4 A;  5G05 C;  1H2T C;  5AIJ A;  3DPD A;  3FUH A;  3Q15 A;  4HXI A;  4JHJ A;  2RG8 A;  4I1A A;  2IF4 A;  2Q7F A;  2MHK A;  3AS5 A;  1HX8 A;  3B13 A;  2XGO A;  3EDT B;  2QY7 A;  2C2L A;  4GML A;  2YQ8 A;  4J8F A;  4J0U A;  3Q5M A;  4EQF A;  3ESK A;  5G04 J;  1DNP A;  5AJD A;  3SF4 A;  2YHE A;  2WXP A;  3D9L A;  4R7L A;  3IV0 A;  3TXM A;  2PZI A;  3FUF A;  2XGS A;  4FUL A;  3S7F A;  1UG3 A;  3D9J A;  1JPL A;  3PUK A;  3FUD A;  2PM6 A;  5JJ6 A;  4Y6C A;  5CMY A;  2KZT A;  2CG2 A;  3NQP A;  2M63 A;  4WWP A;  3MKQ A;  3RJV A;  2HM8 A;  4CDM A;  3LYA A;  5FZR A;  4BTA A;  3APC A;  3CVU A;  1IQR A;  2X6F A;  3FTW A;  4JXT A;  3CVL A;  2L0T B;  2VSO E;  1HS6 A;  4IUL A;  1Z6T A;  3UQ3 A;  3ZYM A;  2LSU A;  4L2L A;  3L22 A;  4AXH A;  3CHS A;  4JEU A;  3PVL A;  5FQ8 A;  2R59 A;  3UUX A;  2J07 A;  4G24 A;  4A55 A;  4AY5 A;  3MV2 B;  1BPO A;  2CFZ A;  3HHM A;  3MYV A;  4A1S A;  5BPP A;  4TV3 A;  3L13 A;  4BT9 A;  3IEG A;  2AVP A;  3ULQ A;  3O4Z A;  3L08 A;  4DLO A;  2LO6 A;  3CVP A;  3RU0 A;  2KCV A;  3GZS A;  3UT4 A;  2V0P A;  3FH5 A;  3Q49 B;  3RO2 A;  1FCH A;  3CV0 A;  4D10 C;  1HFA A;  1HG5 A;  3QC1 A;  3D9N A;  2UWJ G;  1OWP A;  4GZC A;  4UWG A;  3I5P A;  2FF4 A;  1ELW A;  2J9Q A;  2KAT A;  3CVY A;  1UJJ A;  1P5Q A;  3G2W A;  5KJK A;  3CK8 A;  4L2Y A;  1EYH A;  3B7S A;  1E8Z A;  1ZU2 A;  4N3A A;  5EX3 A;  3QNK A;  2WQ6 A;  3AS4 A;  4RG9 A;  3ML8 A;  3OAW A;  3EIQ C;  2L9B A;  5A7D B;  2WXG A;  4JW1 A;  4JPS A;  2DCP A;  5DIZ A;  3SZ7 A;  2VTB B;  5KJL A;  4H7Y A;  3D9P A;  4H7X A;  2VSX E;  1FVH A;  5KJN A;  3LY8 A;  1E8W A;  3LKU A;  2KCK A;  4WND A;  2AXV A;  3CIA A;  3ONK A;  4JA9 A;  3FY4 A;  4UI9 J;  4GZ5 A;  2WMO A;  4ANV A;  3OXG A;  4MS6 A;  5CCL A;  4I17 A;  3PZD A;  5EKQ D;  4N39 A;  5EX0 A;  2X6K A;  3ENE A;  3PRZ A;  3FTV A;  2OVF A;  2WXK A;  4B94 A;  5ANL A;  3HYM B;  3NZU A;  2LAH A;  3RRU A;  3SFZ A;  2CHX A;  4ILG A;  5AYW D;  4EPZ A;  3LEW A;  1NZN A;  4N2Q A;  4EBA G;  2NXP A;  1KT1 A;  2XGM A;  3FP3 A;  1E7U A;  3OXL A;  2VGX A;  2XHE A;  3KD7 A;  2IJG X;  2AWI A;  4GCN A;  4AM9 A;  3PDN A;  4I2W A;  4BX8 A;  4BSX A;  1WAO 1;  2WXH A;  1QQE A;  2CHZ A;  3PE3 A;  1N54 A;  3QB2 A;  5ARF A;  5LCW J;  2WXR A;  4J6I A;  3FDH A;  3JCK C;  1PY1 A;  1Z3Y A;  4HOU A;  4KMO A;  4XIF A;  3S2A A;  5BV1 A;  2AXZ A;  3HVE A;  4U07 A;  3CSF A;  3R9A B;  3KEZ A;  4G26 A;  3T5X A;  3TXN A;  4BWR A;  3D9M A;  1X5B A;  5FQ6 A;  4J8E A;  5BNW A;  3ESL A;  3L6A A;  2IOL A;  4JA7 A;  4CDN A;  1PAQ A;  3ZHE B;  1MHQ A;  4XZ4 A;  3JQ0 A;  2X6J A;  1IQU A;  3D9K A;  4RG6 A;  3VTY A;  3D9O A;  3FHE A;  3EHN A;  3QDN A;  4XKC A;  2R5S A;  3MKR A;  1E8X A;  3CQG B;  4B8A A;  1XGW A;  1XNF A;  3CK9 A;  5T8I A;  3S7J A;  1U3D A;  3ASD A;  3PNL B;  4APO A;  3R7R A;  5BT1 A;  1HE8 A;  2KC7 A;  2I2O A;  1VDY A;  5E76 A;  3L54 A;  3FTU A;  2P58 C;  3RKV A;  3CHQ A;  2PQR A;  2J4B A;  1ELR A;  1JWG A;  2OOE A;  4F3V A;  2YHC A;  4GYW A;  2I1K A;  5ANR A;  4GYY A;  3B7T A;  3AU4 A;  3FUM A;  2HR2 A;  4I6E A;  4GA0 A;  2CG3 A;  4V3I A;  3ONL A;  2UY1 B;  2A5U A;  2RD0 A;  4Q69 A;  3CKC A;  2NC9 A;  3MEK A;  2PQN A;  3FUI A;  3P2B A;  4GZ3 A;  5E75 A;  4DI3 A;  3VLD A;  1UN8 A;  3FWV A;  2WXL A;  3EJN A;  3ML9 A;  1MQS A;  3JUI A;  3FFL A;  5JJ7 A;  3EHM A;  4L7T A;  2IU1 A;  3MA5 A;  4WNF A;  3N71 A;  4W9R A;  2DBA A;  4I43 A;  4U0Z A;  4EZK A;  3ZPJ A;  5FT9 A;  3FU3 A;  5FZQ A;  5HI7 A;  4I6G A;  3K9I A;  3TL5 A;  2ZU6 B;  2VGY A;  3LY9 A;  4ABN A;  3FUJ A;  3CVX A;  2XEV A;  3G2V A;  1UW4 B;  5J08 A;  4KVM A;  1IHG A;  3T8M A;  2JLB A;  4KZ0 A;  4GZ6 A;  3E4B A;  3IKO B;  1WM5 A;  3NF1 A;  1HZ4 A;  3FEY A;  3AS8 A;  1Y6I A;  2BF0 X;  2X38 A;  4WNG A;  4XI0 A;  4DPR A;  2WXQ A;  4C9B B;  4YVQ C;  2XPZ A;  4KVO A;  3SHF A;  3QKY A;  4TRQ A;  3FUE A;  4MKT A;  3UPV A;  4P29 A;  4G2V A;  4JHR A;  4AEZ C;  3SBT B;  1KLX A;  4N2S A;  5CHE E;  3O48 A;  3T5V A;  2FBN A;  4ACL A;  1OUV A;  3QWP A;  1TEZ A;  2FO7 A;  3LCA A;  3QWV A;  1TJC A;  4K03 A;  3HDX A;  2GRL A;  3LY7 A;  5FJY A;  4UI9 C;  2WMN A;  1UJK A;  5BV0 A;  4U0U A;  5LP0 A;  4UWK A;  3CVV A;  4GMJ A;  5G55 A;  3ZFW A;  2C0L A;  3ZN3 A;  4FA6 A;  2GW1 A;  4M3O A;  2AW6 A;  1EDU A;  3BG0 B;  3Q4A B;  3LPZ A;  2J08 A;  3CR3 A;  5FTP A;  4NAC A;  3P1U A;  5C2Y A;  2MRI A;  4BT8 A;  1E7V A;  3AU5 A;  3MGB A;  2ION A;  3CVN A;  3G2U A;  1ELK A;  3LXU X;  3PEV B;  3RRN B;  3UT8 A;  4A3T A;  4UQZ A;  3D3M A;  4BTB A;  4IRU A;  2I9C A;  4G25 A;  3ZXS A;  4AOF A;  4IYP A;  4OVU A;  1LF8 A;  3APD A;  5LCW C;  3LDZ A;  2WXJ A;  2XPI A;  3CHO A;  3FU5 A;  4GA1 A;  5JHB A;  3LJ3 A;  3SNX A;  4PS3 A;  1E8Y A;  1WY6 A;  3FUL A;  3ZGQ A;  3U66 A;  4HOT A;  3NZS A;  2VTB A;  4FU3 A;  4K0R A;  4PS7 A;  2V8S E;  3ZVV A;  2V5F A;  4PH4 B;  3ZYL A;  4CT0 A;  4FJY A;  4PS8 A;  4UWH A;  4L23 A;  4GYO A;  3ZEF A;  4EEC A;  3UX4 A;  4UI9 K;  4DI4 A;  1DVP A;  4FLB A;  2VYI A;  3FEX A;  3FTY A;  5DBK A;  1U3C A;  4XKB A;  4CCA A;  3B7U X;  4FHK A;  1H2U A;  4CDR A;  4J8S A;  5JHA A;  2FEZ A;  1OWM A;  4WAF A;  3I4R B;  5ARG A;  3U64 A;  4L1B A;  1OWO A;  3G2S A;  4LEU A;  4WNE A;  3RRM B;  3CK7 A;  4E85 A;  5KJM A;  3B7R L;  4JZY A;  4ANW A;  4TUU A;  3RO3 A;  3SBS A;  2BUG A;  4N5C A;  3ASG A;  2YNQ A;  4U8H A;  3CQC B;  4JL0 A;  4KT6 B;  5G04 C;  4AVX A;  3GZ2 A;  2L6J A;  3KS2 A;  2Y3A A;  4N3B A;  1S0P A;  1H6K A;  3ZIM A;  4PDX A;  3ZYK A;  2CFU A;  2WVI A;  1TJF A;  2A4Z A;  3I3N A;  1Z3X A;  3EIJ A;  1HU3 A;  3CEQ A;  1NA0 A;  4KBQ A;  5KCM A;  4WUY A;  2LSV A;  2UY1 A;  3PUJ A;  3SD5 A;  4U0S A;  2CHW A;  4CT4 A;  3U3W A;  3TGO A;  2ILR A;  2X3M A;  3FTZ A;  4GZD A;  5M72 A;  1H0A A;  4XE0 A;  4HOS A;  2NSZ A;  4LRZ A;  3PS6 A;  5LFA A;  2XPY A;  4BY6 A;  4YVO A;  3ZYQ A;  4F7A A;  3VTX A;  3CHP A;  3BG1 B;  3CLJ A;  5J90 A;  4BFR A;  2VQ2 A;  4BX9 A;  4B8C B;  5LX8 A;  2HYZ A;  4Q96 A;  1NA3 A;  5HQ8 A;  3MJW A;  2FI7 A;  2VSY A;  5EDS A;  3OXF A;  4CGV A;  3LS8 A;  4OVV A;  3KAE A;  3GZ1 A;  5ENN A;  5C1D A;  2GGF A;  3CHR A;  5LOZ A;  4CGW A;  3FUN A;  3GYZ A;  3QAR A;  4APF A;  3LVR E;  3APF A;  4CRW A;  4MLP A;  4GU5 A;  4DJA A;  3C98 A;  3TG5 A;  4EZJ A;  4A3V A;  2X6I A;  4ATG A;  2C0M A;  5D0Q D;  2WM9 A;  4U63 A;  1QZ2 A;  3FTS A;  5A6C A;  4ANU A;  4HS2 A;  1OWN A;  4GPK A;  3FH7 A;  5G05 J;  2XRZ A;  1JUQ A;  4AJW A;  3QOU A;  5FWQ A;  4O6F A;  2XQ0 A;  3SGH A;  5CMW A;  1HF8 A;  2WXN A;  3QWW A;  4AV7 A;  1HXI A;  4NUR A;  2AXU A;  4MRU A;  2VJ8 A;  3FU0 A;  4I9E A;  3IHY A;  3VLF A;  4GA2 A;  4JEH A;  1H2V C;  5G2N A;  1GW6 A;  1ZBP A;  3SI5 A;  2XCB A;  1E96 B;  2IFU A;  2KZT B;  2BTD A;  3JQ1 A;  4QFV A;  1B89 A;  5T3R A;  3PEU B;  4HOQ A;  2I1J A;  3MKQ B;  4I1O B;  4XX5 A;  3R7Q A;  1YA0 A;  3IBE A;  3L16 A;  4RSY A;  3G2T A;  4ACK A;  3D9I A;  3PH0 C;  1HG2 A;  3RIB A;  3CST A;  2WQH A;  1JWF A;  2J49 A;  2X6H A;  3BEE A;  4JHK A;  4ME2 A;  4B89 A;  4ILI A;  3FTX A;  4FC8 A;  2JEK A;  4XI9 A;  1N52 A;  1A17 A;  3U4T A;  4G11 A;  4JC8 A;  4CEM A;  4KYO B;  4EBA A;  4YND A;  2GRM A;  5BW8 C;  1IYG A;  1NP7 A;  4FAD A;  3CHM A;  2J4D A;  4JVS A;  2LNI A;  2WPV A;  4G1T A;  1Y8M A;  4HFG A;  3ZRH A;  3ASF A;  1H19 A;  2WXO A;  2FUL A;  2R17 C;  2YIN A;  1SZ9 A;  5FQ4 A;  2WXI A;  3VLE A;  4GAA A;  4ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...