3L6NA

Crystal structure of metallo-beta-lactamase ind-7
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
218
Chain Sequence
QVKDFVIEPPIKNNLHIYKTFGVFGGKEYSANSMYLVTKKGVVLFDVPWEKVQYQSLMDTIKKRHNLPVVAVFATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSNSATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords metallo-beta-lactamase
publication title Structure of metallo-beta-lactamase IND-7 from a Chryseobacterium indologenes clinical isolate at 1.65-A resolution
pubmed doi rcsb
source organism Chryseobacterium indologenes
molecule tags Hydrolase
total genus 67
structure length 218
sequence length 218
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3l6nA00
4FR7A 1KO3A 5FQCA 1ZTCA 4YSLA 1YCGA 2QEDA 3SW3A 4TZFA 4Z60A 5EVBA 2QDTA 4UWRB 4B87A 5EV8A 3RPCA 5LCFA 4U4LA 1L9YA 4NQ5A 4FEKA 5EHTA 5EVKA 4AX0B 1SMLA 3T3OA 2BFZA 3SBLA 4ZEJA 4V0HA 1VGNA 4Z6XA 2DOOA 3RKKA 4Z67A 2YNTB 2BTNA 5AXOA 2P4ZA 2M5DA 2Q0JA 2WYMA 1YCHA 2GKLA 4TYFA 2AIOA 2OHHA 1E5DA 2WYLA 4YSBA 4KEQA 2UYXA 3X2ZA 3ZQ4A 4CHLA 4P62A 4PVOA 4C1HA 3QH8A 5EH9A 2WYMC 2BG8B 4RL2A 5A0TA 4WD6A 3R2UA 1KR3A 3IELA 3X30A 4EYFA 5ACTA 1DXKA 3I13A 4JO0A 2BR6A 4ZNBA 3MD7A 5K4NA 1BVTA 2XF4A 2YNVB 2ZZIA 3JXPA 1X8HA 3H3EA 3X2XA 5ACXA 4UA4A 5FQBA 1HLKA 4F6ZA 2FU8A 5AYAA 4EFZA 5A5ZA 3IDZA 4TYTA 2BFKA 3KNRA 3TP9A 4TZBA 3AF6A 3T3NA 3I0VA 4ZO3A 1A7TA 5AHRA 1BC2A 4D1WA 4RBSA 2YNWA 2YZ3A 4RAMA 2OHIA 5KIKA 4D1UA 5AHOA 2H6AA 3Q6VA 1VMEA 2GFKA 3I14A 1BMCA 3RKJA 2NZFA 4GYQA 2NYPA 2OHJA 3G1PA 2I7TA 3DHBA 3SFPA 5EW0A 1WRAA 5HIPA 2VW8A 1KO2A 4UWSB 5LS3A 3T9MA 3DHCA 3ZWFA 5ACQA 2XR1A 2AZ4A 4J5FA 2P18A 1MQOA 2Y8AA 2ZO4A 1JT1A 4EY2A 5A87A 2NZEA 3ESHA 5EV6A 2GFJA 2QINA 2A7MA 2E7YA 4XUKA 5B1UA 5EVDA 5FQAA 1X8GA 3ZR9A 2FHXA 4RL0A 2BG2A 4EYBA 5AEBA 4EYLA 1QH3A 2Q42A 3IEKA 2BG7A 3X2YA 5LE1A 2BMIA 2NXAA 2I7XA 4LE6A 1P9EA 5DPXA 2M5CA 2Q0IA 4RM5A 3I11A 2WHGA 4KEPA 4YSKA 1WUOA 3S0ZA 5HIOA 3FAIA 2P1EA 3BV6A 4DILA 4RAWA 4BP0A 4AWZA 2Y8BA 1DD6A 5ACUA 2R2DA 5HISA 5LM6A 3VPEA 2GCUA 2ZWRA 4C1GA 4DIKA 2HB9A 3IEMA 3IE2A 4UBQA 4O98A 1WW1A 2ZNBA 4AD9A 4XWTA 3IOFA 2FK6A 3SD9A 5LCHA 5LSCA 2Y87A 4HKYA 1ZNBA 2GMNA 3IE1A 5K4KA 4XWWA 4D1VA 1YCFA 5LCAA 4HL2A 3AF5A 2DKFA 1QH5A 2QJSA 5B15A 4BZ3A 1Y44A 4J5HA 1XTOA 5LLDA 5IQKA 4NQ2A 4FSBA 1DDKA 1XM8A 2YNTA 1A8TA 3DH8A 5KILA 4ZO2A 3ADRA 3I15A 3SPUA 5ACRA 3DHAA 5ACWA 4HL1A 5HH5A 3BC2A 5HH4A 5ACSA 4GCWA 1K07A 3PG4A 4NQ6A 2BG8A 3BK1A 3AJ3A 2YNUA 2BFZB 2QDSA 4Z7RA 5HIQA 4H0DA 5AXRA 5K4MA 5ACVA 4NQ4A 4AWYB 3A4YA 3LVZA 4TZ9A 2YNVA 4UAMA 4C1CA 1JJEA 5ACPA 2FHXB 1JJTA 4UWOB 4C1EA 4GYUA 2BGAA 4Z5YA 2YCBA 3KNSA 4C1FA 4EXYA 4C09A 4Z5ZA 3VQZA 2BC2A 4EXSA 2CBNA 2WRSA 2P97A 2BIBA 5HH6A 3KL7A 4PVTA 5K0WA 3FCZA 3IOGA 1X8IA 2FU9A 3PY5A 2BFLA 4C1DA 4F6HA 3PY6A 2Q9UA 2FM6A 4TZEA 1ZKPA 2I7VA 4D02A 4D1TA 3P2UA 1M2XA 2BG6A 2FU6A 5LMCA 1WUPA 2FU7A 3L6NA 5EWAA 5B3RA 4UWPB 3IE0A 3F9OA 3BK2A 4AX1B 3ZNBA 3WXCA 3SRXA 1VJNA 5A0VA
chains in the Genus database with same CATH superfamily
4FR7A 1KO3A 5FQCA 1ZTCA 4YSLA 1YCGA 2QEDA 3SW3A 4TZFA 4Z60A 5EVBA 2QDTA 4UWRB 4B87A 5EV8A 3RPCA 2YHEA 5LCFA 4U4LA 1L9YA 4NQ5A 4FEKA 5AIJA 5EHTA 5EVKA 4AX0B 1SMLA 3T3OA 2BFZA 3SBLA 4ZEJA 4V0HA 1VGNA 4Z6XA 2DOOA 3RKKA 4Z67A 2YNTB 2BTNA 5AXOA 2P4ZA 2M5DA 2Q0JA 2WYMA 1YCHA 2GKLA 4TYFA 2AIOA 2OHHA 1E5DA 2WYLA 4YSBA 4KEQA 2UYXA 2CG2A 3X2ZA 3ZQ4A 4CHLA 4P62A 4PVOA 4C1HA 3QH8A 5EH9A 2WYMC 2BG8B 4RL2A 5A0TA 4WD6A 3R2UA 1KR3A 3IELA 3X30A 4EYFA 5ACTA 1DXKA 3I13A 4JO0A 2BR6A 4ZNBA 3MD7A 5K4NA 1BVTA 2XF4A 2YNVB 2ZZIA 3JXPA 1X8HA 3H3EA 3X2XA 4AXHA 5ACXA 4UA4A 5FQBA 1HLKA 4F6ZA 2FU8A 5AYAA 4EFZA 5A5ZA 3IDZA 4TYTA 2BFKA 3KNRA 3TP9A 4TZBA 3AF6A 3T3NA 3I0VA 4ZO3A 1A7TA 5AHRA 1BC2A 4D1WA 4RBSA 2YNWA 2YZ3A 4RAMA 4PDXA 2OHIA 5KIKA 4D1UA 5AHOA 2H6AA 3Q6VA 1VMEA 2GFKA 3I14A 1BMCA 3RKJA 2NZFA 4GYQA 2NYPA 2OHJA 3G1PA 2I7TA 3DHBA 3SFPA 5EW0A 1WRAA 5HIPA 2VW8A 5A23A 1KO2A 4UWSB 5LS3A 3T9MA 3DHCA 3ZWFA 5ACQA 2XR1A 2AZ4A 4J5FA 2P18A 1MQOA 2Y8AA 2ZO4A 1JT1A 4EY2A 5A87A 2NZEA 3ESHA 5EV6A 2GFJA 2QINA 2A7MA 2E7YA 4XUKA 5B1UA 5EVDA 5FQAA 1X8GA 3ZR9A 2FHXA 4RL0A 2BG2A 4EYBA 5AEBA 4EYLA 4AV7A 1QH3A 2Q42A 3IEKA 2BG7A 3X2YA 5LE1A 2BMIA 2NXAA 2I7XA 4LE6A 1P9EA 5DPXA 2M5CA 2Q0IA 4RM5A 3I11A 2WHGA 4KEPA 4YSKA 1WUOA 3S0ZA 5HIOA 3FAIA 2P1EA 3BV6A 4DILA 4RAWA 4BP0A 4AWZA 2Y8BA 1DD6A 5ACUA 2R2DA 5HISA 5LM6A 3VPEA 2GCUA 2ZWRA 4C1GA 4DIKA 2HB9A 3IEMA 3IE2A 4UBQA 4O98A 1WW1A 2ZNBA 4AD9A 4XWTA 3IOFA 2FK6A 3SD9A 5LCHA 5LSCA 2Y87A 4HKYA 1ZNBA 2GMNA 3IE1A 5K4KA 4XWWA 4D1VA 1YCFA 5LCAA 4HL2A 3AF5A 2DKFA 1QH5A 2QJSA 5B15A 4BZ3A 1Y44A 4J5HA 1XTOA 5LLDA 5IQKA 4NQ2A 4FSBA 1DDKA 1XM8A 2CG3A 2YNTA 1A8TA 3DH8A 5KILA 4ZO2A 3ADRA 3I15A 3SPUA 5ACRA 3DHAA 5ACWA 4HL1A 5HH5A 3BC2A 5HH4A 5ACSA 4GCWA 2CFUA 1K07A 3PG4A 4NQ6A 2BG8A 3BK1A 3AJ3A 2YNUA 2BFZB 2QDSA 4Z7RA 5HIQA 4H0DA 5AXRA 5K4MA 5ACVA 4NQ4A 4AWYB 3A4YA 3LVZA 4TZ9A 2YNVA 4UAMA 4C1CA 1JJEA 5ACPA 2FHXB 1JJTA 4UWOB 4C1EA 4GYUA 2BGAA 4Z5YA 2YCBA 3KNSA 4C1FA 4EXYA 4C09A 4Z5ZA 3VQZA 2BC2A 4EXSA 2CBNA 2WRSA 2P97A 2BIBA 5HH6A 3KL7A 4PVTA 5K0WA 3FCZA 3IOGA 1X8IA 2FU9A 3PY5A 2BFLA 4C1DA 4F6HA 3PY6A 2Q9UA 2FM6A 4TZEA 1ZKPA 5AJLA 2I7VA 4D02A 4D1TA 3P2UA 1M2XA 2BG6A 2FU6A 5LMCA 4NURA 1WUPA 2FU7A 3L6NA 5EWAA 5B3RA 4UWPB 3IE0A 3F9OA 3BK2A 4AX1B 3ZNBA 3WXCA 3SRXA 1VJNA 5A0VA 2CFZA
chains in the Genus database with same CATH topology
4FR7A 1KO3A 5FQCA 1ZTCA 4YSLA 1YCGA 2QEDA 3SW3A 4TZFA 4Z60A 5EVBA 2QDTA 4UWRB 4B87A 5EV8A 3RPCA 5LCFA 4U4LA 1L9YA 4NQ5A 4FEKA 5EHTA 5EVKA 4AX0B 1SMLA 3T3OA 2BFZA 3SBLA 4ZEJA 4V0HA 1VGNA 4Z6XA 2DOOA 3RKKA 4Z67A 2YNTB 2BTNA 5AXOA 2P4ZA 2M5DA 2Q0JA 2WYMA 1YCHA 2GKLA 4TYFA 2AIOA 2OHHA 1E5DA 2WYLA 4YSBA 4KEQA 2UYXA 3X2ZA 3ZQ4A 4CHLA 4P62A 4PVOA 4C1HA 3QH8A 5EH9A 2WYMC 2BG8B 4RL2A 5A0TA 4WD6A 3R2UA 1KR3A 3IELA 3X30A 4EYFA 5ACTA 1DXKA 3I13A 4JO0A 2BR6A 4ZNBA 3MD7A 5K4NA 1BVTA 2XF4A 2YNVB 2ZZIA 3JXPA 1X8HA 3H3EA 3X2XA 5ACXA 4UA4A 5FQBA 1HLKA 4F6ZA 2FU8A 5AYAA 4EFZA 5A5ZA 3IDZA 4TYTA 2BFKA 3KNRA 3TP9A 4TZBA 3AF6A 3T3NA 3I0VA 4ZO3A 1A7TA 5AHRA 1BC2A 4D1WA 4RBSA 2YNWA 2YZ3A 4RAMA 2OHIA 5KIKA 4D1UA 5AHOA 2H6AA 3Q6VA 1VMEA 2GFKA 3I14A 1BMCA 3RKJA 2NZFA 4GYQA 2NYPA 2OHJA 3G1PA 2I7TA 3DHBA 3SFPA 5EW0A 1WRAA 5HIPA 2VW8A 1KO2A 4UWSB 5LS3A 3T9MA 3DHCA 3ZWFA 5ACQA 2XR1A 2AZ4A 4J5FA 2P18A 1MQOA 2Y8AA 2ZO4A 1JT1A 4EY2A 5A87A 2NZEA 3ESHA 5EV6A 2GFJA 2QINA 2A7MA 2E7YA 4XUKA 5B1UA 5EVDA 5FQAA 1X8GA 3ZR9A 2FHXA 4RL0A 2BG2A 4EYBA 5AEBA 4EYLA 1QH3A 2Q42A 3IEKA 2BG7A 3X2YA 5LE1A 2BMIA 2NXAA 2I7XA 4LE6A 1P9EA 5DPXA 2M5CA 2Q0IA 4RM5A 3I11A 2WHGA 4KEPA 4YSKA 1WUOA 3S0ZA 5HIOA 3FAIA 2P1EA 3BV6A 4DILA 4RAWA 4BP0A 4AWZA 2Y8BA 1DD6A 5ACUA 2R2DA 5HISA 5LM6A 3VPEA 2GCUA 2ZWRA 4C1GA 4DIKA 2HB9A 3IEMA 3IE2A 4UBQA 4O98A 1WW1A 2ZNBA 4AD9A 4XWTA 3IOFA 2FK6A 3SD9A 5LCHA 5LSCA 2Y87A 4HKYA 1ZNBA 2GMNA 3IE1A 5K4KA 4XWWA 4D1VA 1YCFA 5LCAA 4HL2A 3AF5A 2DKFA 1QH5A 2QJSA 5B15A 4BZ3A 1Y44A 4J5HA 1XTOA 5LLDA 5IQKA 4NQ2A 4FSBA 1DDKA 1XM8A 2YNTA 1A8TA 3DH8A 5KILA 4ZO2A 3ADRA 3I15A 3SPUA 5ACRA 3DHAA 5ACWA 4HL1A 5HH5A 3BC2A 5HH4A 5ACSA 4GCWA 1K07A 3PG4A 4NQ6A 2BG8A 3BK1A 3AJ3A 2YNUA 2BFZB 2QDSA 4Z7RA 5HIQA 4H0DA 5AXRA 5K4MA 5ACVA 4NQ4A 4AWYB 3A4YA 3LVZA 4TZ9A 2YNVA 4UAMA 4C1CA 1JJEA 5ACPA 2FHXB 1JJTA 4UWOB 4C1EA 4GYUA 2BGAA 4Z5YA 2YCBA 3KNSA 4C1FA 4EXYA 4C09A 4Z5ZA 3VQZA 2BC2A 4EXSA 2CBNA 2WRSA 2P97A 2BIBA 5HH6A 3KL7A 4PVTA 5K0WA 3FCZA 3IOGA 1X8IA 2FU9A 3PY5A 2BFLA 4C1DA 4F6HA 3PY6A 2Q9UA 2FM6A 4TZEA 1ZKPA 2I7VA 4D02A 4D1TA 3P2UA 1M2XA 2BG6A 2FU6A 5LMCA 1WUPA 2FU7A 3L6NA 5EWAA 5B3RA 4UWPB 3IE0A 3F9OA 3BK2A 4AX1B 3ZNBA 3WXCA 3SRXA 1VJNA 5A0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FR7 A;  1KO3 A;  5FQC A;  1ZTC A;  4YSL A;  1YCG A;  2QED A;  3SW3 A;  4TZF A;  4Z60 A;  5EVB A;  2QDT A;  4UWR B;  4B87 A;  5EV8 A;  3RPC A;  5LCF A;  4U4L A;  1L9Y A;  4NQ5 A;  4FEK A;  5EHT A;  5EVK A;  4AX0 B;  1SML A;  3T3O A;  2BFZ A;  3SBL A;  4ZEJ A;  4V0H A;  1VGN A;  4Z6X A;  2DOO A;  3RKK A;  4Z67 A;  2YNT B;  2BTN A;  5AXO A;  2P4Z A;  2M5D A;  2Q0J A;  2WYM A;  1YCH A;  2GKL A;  4TYF A;  2AIO A;  2OHH A;  1E5D A;  2WYL A;  4YSB A;  4KEQ A;  2UYX A;  3X2Z A;  3ZQ4 A;  4CHL A;  4P62 A;  4PVO A;  4C1H A;  3QH8 A;  5EH9 A;  2WYM C;  2BG8 B;  4RL2 A;  5A0T A;  4WD6 A;  3R2U A;  1KR3 A;  3IEL A;  3X30 A;  4EYF A;  5ACT A;  1DXK A;  3I13 A;  4JO0 A;  2BR6 A;  4ZNB A;  3MD7 A;  5K4N A;  1BVT A;  2XF4 A;  2YNV B;  2ZZI A;  3JXP A;  1X8H A;  3H3E A;  3X2X A;  5ACX A;  4UA4 A;  5FQB A;  1HLK A;  4F6Z A;  2FU8 A;  5AYA A;  4EFZ A;  5A5Z A;  3IDZ A;  4TYT A;  2BFK A;  3KNR A;  3TP9 A;  4TZB A;  3AF6 A;  3T3N A;  3I0V A;  4ZO3 A;  1A7T A;  5AHR A;  1BC2 A;  4D1W A;  4RBS A;  2YNW A;  2YZ3 A;  4RAM A;  2OHI A;  5KIK A;  4D1U A;  5AHO A;  2H6A A;  3Q6V A;  1VME A;  2GFK A;  3I14 A;  1BMC A;  3RKJ A;  2NZF A;  4GYQ A;  2NYP A;  2OHJ A;  3G1P A;  2I7T A;  3DHB A;  3SFP A;  5EW0 A;  1WRA A;  5HIP A;  2VW8 A;  1KO2 A;  4UWS B;  5LS3 A;  3T9M A;  3DHC A;  3ZWF A;  5ACQ A;  2XR1 A;  2AZ4 A;  4J5F A;  2P18 A;  1MQO A;  2Y8A A;  2ZO4 A;  1JT1 A;  4EY2 A;  5A87 A;  2NZE A;  3ESH A;  5EV6 A;  2GFJ A;  2QIN A;  2A7M A;  2E7Y A;  4XUK A;  5B1U A;  5EVD A;  5FQA A;  1X8G A;  3ZR9 A;  2FHX A;  4RL0 A;  2BG2 A;  4EYB A;  5AEB A;  4EYL A;  1QH3 A;  2Q42 A;  3IEK A;  2BG7 A;  3X2Y A;  5LE1 A;  2BMI A;  2NXA A;  2I7X A;  4LE6 A;  1P9E A;  5DPX A;  2M5C A;  2Q0I A;  4RM5 A;  3I11 A;  2WHG A;  4KEP A;  4YSK A;  1WUO A;  3S0Z A;  5HIO A;  3FAI A;  2P1E A;  3BV6 A;  4DIL A;  4RAW A;  4BP0 A;  4AWZ A;  2Y8B A;  1DD6 A;  5ACU A;  2R2D A;  5HIS A;  5LM6 A;  3VPE A;  2GCU A;  2ZWR A;  4C1G A;  4DIK A;  2HB9 A;  3IEM A;  3IE2 A;  4UBQ A;  4O98 A;  1WW1 A;  2ZNB A;  4AD9 A;  4XWT A;  3IOF A;  2FK6 A;  3SD9 A;  5LCH A;  5LSC A;  2Y87 A;  4HKY A;  1ZNB A;  2GMN A;  3IE1 A;  5K4K A;  4XWW A;  4D1V A;  1YCF A;  5LCA A;  4HL2 A;  3AF5 A;  2DKF A;  1QH5 A;  2QJS A;  5B15 A;  4BZ3 A;  1Y44 A;  4J5H A;  1XTO A;  5LLD A;  5IQK A;  4NQ2 A;  4FSB A;  1DDK A;  1XM8 A;  2YNT A;  1A8T A;  3DH8 A;  5KIL A;  4ZO2 A;  3ADR A;  3I15 A;  3SPU A;  5ACR A;  3DHA A;  5ACW A;  4HL1 A;  5HH5 A;  3BC2 A;  5HH4 A;  5ACS A;  4GCW A;  1K07 A;  3PG4 A;  4NQ6 A;  2BG8 A;  3BK1 A;  3AJ3 A;  2YNU A;  2BFZ B;  2QDS A;  4Z7R A;  5HIQ A;  4H0D A;  5AXR A;  5K4M A;  5ACV A;  4NQ4 A;  4AWY B;  3A4Y A;  3LVZ A;  4TZ9 A;  2YNV A;  4UAM A;  4C1C A;  1JJE A;  5ACP A;  2FHX B;  1JJT A;  4UWO B;  4C1E A;  4GYU A;  2BGA A;  4Z5Y A;  2YCB A;  3KNS A;  4C1F A;  4EXY A;  4C09 A;  4Z5Z A;  3VQZ A;  2BC2 A;  4EXS A;  2CBN A;  2WRS A;  2P97 A;  2BIB A;  5HH6 A;  3KL7 A;  4PVT A;  5K0W A;  3FCZ A;  3IOG A;  1X8I A;  2FU9 A;  3PY5 A;  2BFL A;  4C1D A;  4F6H A;  3PY6 A;  2Q9U A;  2FM6 A;  4TZE A;  1ZKP A;  2I7V A;  4D02 A;  4D1T A;  3P2U A;  1M2X A;  2BG6 A;  2FU6 A;  5LMC A;  1WUP A;  2FU7 A;  3L6N A;  5EWA A;  5B3R A;  4UWP B;  3IE0 A;  3F9O A;  3BK2 A;  4AX1 B;  3ZNB A;  3WXC A;  3SRX A;  1VJN A;  5A0V A; 
#chains in the Genus database with same CATH topology
 4FR7 A;  1KO3 A;  5FQC A;  1ZTC A;  4YSL A;  1YCG A;  2QED A;  3SW3 A;  4TZF A;  4Z60 A;  5EVB A;  2QDT A;  4UWR B;  4B87 A;  5EV8 A;  3RPC A;  2YHE A;  5LCF A;  4U4L A;  1L9Y A;  4NQ5 A;  4FEK A;  5AIJ A;  5EHT A;  5EVK A;  4AX0 B;  1SML A;  3T3O A;  2BFZ A;  3SBL A;  4ZEJ A;  4V0H A;  1VGN A;  4Z6X A;  2DOO A;  3RKK A;  4Z67 A;  2YNT B;  2BTN A;  5AXO A;  2P4Z A;  2M5D A;  2Q0J A;  2WYM A;  1YCH A;  2GKL A;  4TYF A;  2AIO A;  2OHH A;  1E5D A;  2WYL A;  4YSB A;  4KEQ A;  2UYX A;  2CG2 A;  3X2Z A;  3ZQ4 A;  4CHL A;  4P62 A;  4PVO A;  4C1H A;  3QH8 A;  5EH9 A;  2WYM C;  2BG8 B;  4RL2 A;  5A0T A;  4WD6 A;  3R2U A;  1KR3 A;  3IEL A;  3X30 A;  4EYF A;  5ACT A;  1DXK A;  3I13 A;  4JO0 A;  2BR6 A;  4ZNB A;  3MD7 A;  5K4N A;  1BVT A;  2XF4 A;  2YNV B;  2ZZI A;  3JXP A;  1X8H A;  3H3E A;  3X2X A;  4AXH A;  5ACX A;  4UA4 A;  5FQB A;  1HLK A;  4F6Z A;  2FU8 A;  5AYA A;  4EFZ A;  5A5Z A;  3IDZ A;  4TYT A;  2BFK A;  3KNR A;  3TP9 A;  4TZB A;  3AF6 A;  3T3N A;  3I0V A;  4ZO3 A;  1A7T A;  5AHR A;  1BC2 A;  4D1W A;  4RBS A;  2YNW A;  2YZ3 A;  4RAM A;  4PDX A;  2OHI A;  5KIK A;  4D1U A;  5AHO A;  2H6A A;  3Q6V A;  1VME A;  2GFK A;  3I14 A;  1BMC A;  3RKJ A;  2NZF A;  4GYQ A;  2NYP A;  2OHJ A;  3G1P A;  2I7T A;  3DHB A;  3SFP A;  5EW0 A;  1WRA A;  5HIP A;  2VW8 A;  5A23 A;  1KO2 A;  4UWS B;  5LS3 A;  3T9M A;  3DHC A;  3ZWF A;  5ACQ A;  2XR1 A;  2AZ4 A;  4J5F A;  2P18 A;  1MQO A;  2Y8A A;  2ZO4 A;  1JT1 A;  4EY2 A;  5A87 A;  2NZE A;  3ESH A;  5EV6 A;  2GFJ A;  2QIN A;  2A7M A;  2E7Y A;  4XUK A;  5B1U A;  5EVD A;  5FQA A;  1X8G A;  3ZR9 A;  2FHX A;  4RL0 A;  2BG2 A;  4EYB A;  5AEB A;  4EYL A;  4AV7 A;  1QH3 A;  2Q42 A;  3IEK A;  2BG7 A;  3X2Y A;  5LE1 A;  2BMI A;  2NXA A;  2I7X A;  4LE6 A;  1P9E A;  5DPX A;  2M5C A;  2Q0I A;  4RM5 A;  3I11 A;  2WHG A;  4KEP A;  4YSK A;  1WUO A;  3S0Z A;  5HIO A;  3FAI A;  2P1E A;  3BV6 A;  4DIL A;  4RAW A;  4BP0 A;  4AWZ A;  2Y8B A;  1DD6 A;  5ACU A;  2R2D A;  5HIS A;  5LM6 A;  3VPE A;  2GCU A;  2ZWR A;  4C1G A;  4DIK A;  2HB9 A;  3IEM A;  3IE2 A;  4UBQ A;  4O98 A;  1WW1 A;  2ZNB A;  4AD9 A;  4XWT A;  3IOF A;  2FK6 A;  3SD9 A;  5LCH A;  5LSC A;  2Y87 A;  4HKY A;  1ZNB A;  2GMN A;  3IE1 A;  5K4K A;  4XWW A;  4D1V A;  1YCF A;  5LCA A;  4HL2 A;  3AF5 A;  2DKF A;  1QH5 A;  2QJS A;  5B15 A;  4BZ3 A;  1Y44 A;  4J5H A;  1XTO A;  5LLD A;  5IQK A;  4NQ2 A;  4FSB A;  1DDK A;  1XM8 A;  2CG3 A;  2YNT A;  1A8T A;  3DH8 A;  5KIL A;  4ZO2 A;  3ADR A;  3I15 A;  3SPU A;  5ACR A;  3DHA A;  5ACW A;  4HL1 A;  5HH5 A;  3BC2 A;  5HH4 A;  5ACS A;  4GCW A;  2CFU A;  1K07 A;  3PG4 A;  4NQ6 A;  2BG8 A;  3BK1 A;  3AJ3 A;  2YNU A;  2BFZ B;  2QDS A;  4Z7R A;  5HIQ A;  4H0D A;  5AXR A;  5K4M A;  5ACV A;  4NQ4 A;  4AWY B;  3A4Y A;  3LVZ A;  4TZ9 A;  2YNV A;  4UAM A;  4C1C A;  1JJE A;  5ACP A;  2FHX B;  1JJT A;  4UWO B;  4C1E A;  4GYU A;  2BGA A;  4Z5Y A;  2YCB A;  3KNS A;  4C1F A;  4EXY A;  4C09 A;  4Z5Z A;  3VQZ A;  2BC2 A;  4EXS A;  2CBN A;  2WRS A;  2P97 A;  2BIB A;  5HH6 A;  3KL7 A;  4PVT A;  5K0W A;  3FCZ A;  3IOG A;  1X8I A;  2FU9 A;  3PY5 A;  2BFL A;  4C1D A;  4F6H A;  3PY6 A;  2Q9U A;  2FM6 A;  4TZE A;  1ZKP A;  5AJL A;  2I7V A;  4D02 A;  4D1T A;  3P2U A;  1M2X A;  2BG6 A;  2FU6 A;  5LMC A;  4NUR A;  1WUP A;  2FU7 A;  3L6N A;  5EWA A;  5B3R A;  4UWP B;  3IE0 A;  3F9O A;  3BK2 A;  4AX1 B;  3ZNB A;  3WXC A;  3SRX A;  1VJN A;  5A0V A;  2CFZ A; 
#chains in the Genus database with same CATH homology
 4FR7 A;  1KO3 A;  5FQC A;  1ZTC A;  4YSL A;  1YCG A;  2QED A;  3SW3 A;  4TZF A;  4Z60 A;  5EVB A;  2QDT A;  4UWR B;  4B87 A;  5EV8 A;  3RPC A;  5LCF A;  4U4L A;  1L9Y A;  4NQ5 A;  4FEK A;  5EHT A;  5EVK A;  4AX0 B;  1SML A;  3T3O A;  2BFZ A;  3SBL A;  4ZEJ A;  4V0H A;  1VGN A;  4Z6X A;  2DOO A;  3RKK A;  4Z67 A;  2YNT B;  2BTN A;  5AXO A;  2P4Z A;  2M5D A;  2Q0J A;  2WYM A;  1YCH A;  2GKL A;  4TYF A;  2AIO A;  2OHH A;  1E5D A;  2WYL A;  4YSB A;  4KEQ A;  2UYX A;  3X2Z A;  3ZQ4 A;  4CHL A;  4P62 A;  4PVO A;  4C1H A;  3QH8 A;  5EH9 A;  2WYM C;  2BG8 B;  4RL2 A;  5A0T A;  4WD6 A;  3R2U A;  1KR3 A;  3IEL A;  3X30 A;  4EYF A;  5ACT A;  1DXK A;  3I13 A;  4JO0 A;  2BR6 A;  4ZNB A;  3MD7 A;  5K4N A;  1BVT A;  2XF4 A;  2YNV B;  2ZZI A;  3JXP A;  1X8H A;  3H3E A;  3X2X A;  5ACX A;  4UA4 A;  5FQB A;  1HLK A;  4F6Z A;  2FU8 A;  5AYA A;  4EFZ A;  5A5Z A;  3IDZ A;  4TYT A;  2BFK A;  3KNR A;  3TP9 A;  4TZB A;  3AF6 A;  3T3N A;  3I0V A;  4ZO3 A;  1A7T A;  5AHR A;  1BC2 A;  4D1W A;  4RBS A;  2YNW A;  2YZ3 A;  4RAM A;  2OHI A;  5KIK A;  4D1U A;  5AHO A;  2H6A A;  3Q6V A;  1VME A;  2GFK A;  3I14 A;  1BMC A;  3RKJ A;  2NZF A;  4GYQ A;  2NYP A;  2OHJ A;  3G1P A;  2I7T A;  3DHB A;  3SFP A;  5EW0 A;  1WRA A;  5HIP A;  2VW8 A;  1KO2 A;  4UWS B;  5LS3 A;  3T9M A;  3DHC A;  3ZWF A;  5ACQ A;  2XR1 A;  2AZ4 A;  4J5F A;  2P18 A;  1MQO A;  2Y8A A;  2ZO4 A;  1JT1 A;  4EY2 A;  5A87 A;  2NZE A;  3ESH A;  5EV6 A;  2GFJ A;  2QIN A;  2A7M A;  2E7Y A;  4XUK A;  5B1U A;  5EVD A;  5FQA A;  1X8G A;  3ZR9 A;  2FHX A;  4RL0 A;  2BG2 A;  4EYB A;  5AEB A;  4EYL A;  1QH3 A;  2Q42 A;  3IEK A;  2BG7 A;  3X2Y A;  5LE1 A;  2BMI A;  2NXA A;  2I7X A;  4LE6 A;  1P9E A;  5DPX A;  2M5C A;  2Q0I A;  4RM5 A;  3I11 A;  2WHG A;  4KEP A;  4YSK A;  1WUO A;  3S0Z A;  5HIO A;  3FAI A;  2P1E A;  3BV6 A;  4DIL A;  4RAW A;  4BP0 A;  4AWZ A;  2Y8B A;  1DD6 A;  5ACU A;  2R2D A;  5HIS A;  5LM6 A;  3VPE A;  2GCU A;  2ZWR A;  4C1G A;  4DIK A;  2HB9 A;  3IEM A;  3IE2 A;  4UBQ A;  4O98 A;  1WW1 A;  2ZNB A;  4AD9 A;  4XWT A;  3IOF A;  2FK6 A;  3SD9 A;  5LCH A;  5LSC A;  2Y87 A;  4HKY A;  1ZNB A;  2GMN A;  3IE1 A;  5K4K A;  4XWW A;  4D1V A;  1YCF A;  5LCA A;  4HL2 A;  3AF5 A;  2DKF A;  1QH5 A;  2QJS A;  5B15 A;  4BZ3 A;  1Y44 A;  4J5H A;  1XTO A;  5LLD A;  5IQK A;  4NQ2 A;  4FSB A;  1DDK A;  1XM8 A;  2YNT A;  1A8T A;  3DH8 A;  5KIL A;  4ZO2 A;  3ADR A;  3I15 A;  3SPU A;  5ACR A;  3DHA A;  5ACW A;  4HL1 A;  5HH5 A;  3BC2 A;  5HH4 A;  5ACS A;  4GCW A;  1K07 A;  3PG4 A;  4NQ6 A;  2BG8 A;  3BK1 A;  3AJ3 A;  2YNU A;  2BFZ B;  2QDS A;  4Z7R A;  5HIQ A;  4H0D A;  5AXR A;  5K4M A;  5ACV A;  4NQ4 A;  4AWY B;  3A4Y A;  3LVZ A;  4TZ9 A;  2YNV A;  4UAM A;  4C1C A;  1JJE A;  5ACP A;  2FHX B;  1JJT A;  4UWO B;  4C1E A;  4GYU A;  2BGA A;  4Z5Y A;  2YCB A;  3KNS A;  4C1F A;  4EXY A;  4C09 A;  4Z5Z A;  3VQZ A;  2BC2 A;  4EXS A;  2CBN A;  2WRS A;  2P97 A;  2BIB A;  5HH6 A;  3KL7 A;  4PVT A;  5K0W A;  3FCZ A;  3IOG A;  1X8I A;  2FU9 A;  3PY5 A;  2BFL A;  4C1D A;  4F6H A;  3PY6 A;  2Q9U A;  2FM6 A;  4TZE A;  1ZKP A;  2I7V A;  4D02 A;  4D1T A;  3P2U A;  1M2X A;  2BG6 A;  2FU6 A;  5LMC A;  1WUP A;  2FU7 A;  3L6N A;  5EWA A;  5B3R A;  4UWP B;  3IE0 A;  3F9O A;  3BK2 A;  4AX1 B;  3ZNB A;  3WXC A;  3SRX A;  1VJN A;  5A0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...