3L6PA

Crystal structure of dengue virus 1 ns2b/ns3 protease
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
221
structure length
196
Chain Sequence
HMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTGEVGAIALDFKPGTSGSPIVNREGKIVGLYGNGVVTYVSAIAQAKASQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family.
pubmed doi rcsb
source organism Dengue virus type 1 (strain singapore/s275/1990)
molecule tags Viral protein,hydrolase
molecule keywords fusion protein of nonstructural protein 2B and nonstructural
total genus 29
structure length 196
sequence length 221
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2009-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l6pA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3l6pA01
2SNVA 1TBZH 2VINA 2P95A 2ZC9H 1QL7A 1ELGA 1OXGA 2FI3E 1SGQE 5DK1A 1O2GH 2Y5FA 1H9HE 2Y5HA 3A8AA 3SJ8A 4WY3A 3SNEA 3UTUH 1EJAA 1KXAA 1NU7B 2ZG0H 1MD8A 2LPRA 3T62A 1KIGH 2C3SA 1P9SA 3RMNH 4HTCH 3QTVH 4FU8A 2WV5A 1DT2A 1WOFA 3U98H 1K1NA 4AB9A 1KDQB 2WINI 3PMJA 2A5KA 5I46H 1V2QT 4ZKNU 3FZDA 1OS8A 1AFQC 1EB1H 2Z9LA 4YLQH 5A8YA 1JXPA 1O5DH 2QYIA 2WPMS 2LNCA 1PQ7A 1W13U 4JZFH 2Y6TA 2R2MB 1KXEA 1O2SA 2BY7X 4RKJB 3ZZAA 3S9AA 1P57B 3CS7A 1S84A 3ZZ7A 1IHSH 1P02A 2XWBI 4K1SA 2ZCHP 1OKXA 1EZUC 5H4IB 5C1XA 1O2ZA 1T4UH 3NK8A 1RTLA 4D7FA 3HGPA 1SGDE 1V2ST 1HBTH 1EZSC 2Y80A 1BTHH 3EDXB 1GI4A 1V2WT 3CS0A 4MNWA 2QY0B 1BTUA 2NWNA 1T8OA 3RXGA 1H9IE 3Q77A 1QL9A 1HIAA 1K1OA 1ELVA 3MMGA 3HK6B 1UVOA 4B1TA 2XYAA 1HJAB 3GYLB 3V12A 4AB8A 1BMNH 2SGFE 3UR6A 1MKXK 1O5BB 4CRCA 3SGAE 1OX1A 4Q80A 1V2NT 2R0KA 2G8TA 3U1JB 2Y7XA 2ZFRH 4MVNA 2P3UB 1J8AA 1PYTD 1B7XB 5I25A 2BY9X 5EW2H 1XUFA 5BRRE 2ZQ1A 1QHRB 4U30A 1G2LA 1D3QB 4ZH8A 2TIOA 3E8LA 1AFQB 2BDYA 1Y3YA 3DFLA 4HZHA 1Z6JH 1QRWA 5TJXA 1TNGA 1SGRE 2BZAA 1A1RA 2BQWB 5HXFA 3MH5A 4B2CA 3KL6A 4INLA 2H2ZA 5DP4A 1BDAA 2G5VA 3E16B 3KQEA 3OX7U 3P6ZB 3PM3A 3OU0A 3TGIE 1FZZA 2ODPA 3EA9A 4CH2B 4XBCA 3A8CA 6ESTA 1O3GA 3OSYA 7KMEH 2ZDVH 1YC0A 2OK5A 1YLCA 2BLWA 4CRAA 3ZVBA 3A86A 5C1UA 3A81A 3N7OA 1QGFA 1IQFA 2CV3A 3DFJA 4ABEA 1W7GH 3ATLA 2FODA 2G00A 1A7SA 2Q6FA 1ZJDA 1Y3VA 7LPRA 2VIDA 2FI5E 3SI3H 4K8YA 1BRAA 2H5DA 2ZU4A 4GHTA 4CHAC 5FX5A 1FY5A 2TRMA 3LGTA 1TNKA 3T5FH 2BY6X 1THSH 3E91A 1UVSH 3LT3A 4JYVH 1F7ZA 3LH1A 4A6LA 5ABWA 3W94A 1BA8B 2KAIB 2W3KA 4OS5A 1AB9B 2CHAC 2TGDA 3MO3A 2IJOB 4NIWA 1O3IA 1O39A 3WY8A 1WU1A 1GMCG 2OTVA 1O36A 2C90B 3O8BA 1LO6A 2BLQA 1V2VT 5E0HA 1PFXC 2VU8E 4WMDA 2DE8A 3TH2H 5T3HA 4TPYA 3RXIA 2H1UA 1O2HA 3ENSB 2GV6A 5JYIA 2ZDKA 3SU0A 3PTBA 1UK4A 1C5QA 2GVFA 4Y7BA 4CH8B 2RDLA 3BTHE 4SGBE 2GCTC 1O5GH 1GBLA 3LGWA 4Y10E 2QF3A 1SI5H 2C8XB 2UUJB 3SGBE 3UNRA 3Q00A 2WPLS 2PWXA 1C2DA 4UDWH 1THPB 4D9QA 4NG9H 4Y8YA 1DANH 1UTPA 3BF6H 1AO5A 1O3PB 4GHQA 1ID5H 1C1SA 3RMOH 2A5IA 1UMAH 1OWEA 1Z8RA 1W7XH 5DP9A 1VR1H 3RXHA 3E90B 1A5GH 1ETRH 2O8MA 4B6FA 6CHAC 4CRBA 3BEFB 5FAHA 3T26A 1QB9A 1OOKB 4NIVA 1EKBB 1AZ8A 2OC0A 1TPPA 3GY8A 3URCA 2XTTB 1MQ5A 3O8DA 2FIRH 2ZDAH 4U32A 3SJOA 4WWYA 3GCHC 1C5SA 3A83A 5DKMA 2NU0E 3O8RA 1WQSA 2I6SA 4DVAU 2PTNA 1NRQH 3PV5A 2CXVA 1KLTA 2HNTC 3I78A 1S5SA 3U8TH 2VIVA 1LKAA 3SHCH 2ZA5A 6CHAB 4X0WU 1O2PA 4Y11E 4H6SB 1GI9B 1A0HB 1BMMH 1SFIA 2J38A 5E2OA 3T28A 3E1XB 1VITG 1P12E 4Y6DA 3SORA 1EASA 1GBIA 3O8CA 2CJIA 3GICB 1FUJA 1ZMLA 2VVVA 3LGYA 1F0RA 1MAXA 2ZU5A 3ESTA 4ABGA 3SNAA 2ZCKP 1SSXA 1TLDA 1W10U 5C3NA 3BN9A 2PFEA 1TA6A 1SR5C 1HAVA 1WXRA 3MU5A 4WXIA 1O3NA 1BTYA 2H6MA 4MPUA 1DX5M 3S69A 2DE9A 4FUGA 5GPIB 5A2MH 3ATWA 3KF2A 1YPGH 1C9TA 1H1BA 1AB9C 1JRSA 2TGTA 1TX6A 1E35B 4X1PU 5JBAS 1OYQA 1GVZA 1AQ7A 2JETB 1SGCA 1NTPA 1HLTH 3H09A 4O97A 1XMNB 3VXFH 1Q31A 4X2YA 1KYNA 4KGAA 1YCPK 4TPIZ 4IS5A 2AERH 5FX6A 2XRCA 5B6OA 1MKWK 3BTME 1F5KU 3ZVCA 3M61U 4X1SU 1EZXC 1EPTA 1C5LH 1RTKA 4LZ1H 1DPOA 2ZU1A 4HI3A 3K6YA 1UTQA 3A8BA 5HM9A 3QGJA 1TMUH 4X8TH 3S9CA 1HAVB 5EODA 2OP9A 3PO1B 1J16A 4BNRA 2DUCA 4JZDH 4YT6H 4E7RG 1F0TA 1NRPH 5EOKA 3MNXA 1GHAG 1VITF 2V0BA 2AMQA 2PSXA 1SC8U 1IQMA 3BTDE 1SQAA 4IC5A 1YPKH 1S0RA 2ZU2A 1O2VA 2JETC 3TK9A 3RXCA 2ZKSA 1SGEE 1AI8H 4FUJA 1CE5A 2BB4A 2J34A 1Y5UT 3GY6A 4WJG2 3NWUA 1C5MD 2GTBA 5L6NH 3LC5A 4DCDA 3MFJA 4I32A 5FXLA 2WYGA 4NA7A 1SLWB 2ASUB 3K65B 1UTOA 1P2IA 5EXLA 2VH0A 1S0QA 3SJ9A 2P94A 5LPRA 4I8LA 1G3BA 3RXDA 4X1RU 3MH4A 2VJ1A 5AFZH 1PPFE 2TGAA 3I29A 4ASHA 2ZU3A 1QTFA 5T6FA 3HK3B 4XFQA 2QXIA 4ZKSU 4BAHB 3SO3A 1HAXB 1OYTH 1S82A 3A87A 3ZZ9A 2PLXA 2ZHWH 4A5TS 1HJAC 3OY6U 5G4BA 4BANB 2GT7A 4X8SH 1BMAA 3LONA 1IQGA 3F9EA 4NFFA 2AFQB 3BTTE 4AGKA 1L0ZA 3TITA 4BTUB 2HPPH 1BZXE 1AHTH 1DUAA 4NSVA 1D4PB 2A31A 1VJ9U 3VFEA 4ABIA 1A0LA 1NESE 4X8VH 3DA9B 2HALA 3MH6A 1EAXA 3T29A 3DT0H 1KXFA 1VGCB 1PJPA 1C1TA 1YF4A 1DSTA 1Y8TA 4A92A 1ZPBA 3SU1A 1XXDA 1QJ1B 2Y82A 3EAJA 3S9BA 3TLOA 1EP6A 1AN1E 1DDJA 2I6QA 1CT4E 4AG1A 1GL0E 3ATMA 2UWLA 1O2RA 3GCOA 2OD3B 4H6TA 1QJ7B 3RP2A 1UHBB 4AFZA 1IOEA 1OWIA 3UWJH 1K28D 2RCEA 3ZYDA 1ORFA 1KTSB 1HCGA 4I8KA 7GCHF 1A46H 3RXUA 2GKVE 1Q2WA 1EAWA 2UUYA 1C1RA 1O5CB 1XVMA 4JCNA 1O3OA 3M3SA 2AIPA 3UOPA 1NO9H 3ZVFA 1E38B 1MBQA 1N8OC 2FZZA 2G5NA 3AAUA 1FPCH 2GZ7A 3V7TA 2KAIA 3E0NB 1NM6A 2ZP0H 2P3FH 1QA7A 3MU1A 4K69A 4YOIA 2OINA 3UY9A 1W3CA 1O5FH 4CRDA 1UTKA 1HUTH 4DURA 2SGDE 3VB5A 4YESB 8KME2 1T4VH 2UWPA 3SV9A 5J4SA 3RXPA 4D8NA 1IQJA 3BSQA 4GCHG 3A80A 4IMZA 1P2NA 1FV9A 3A7XA 1K9OE 5TCAA 1EJNA 1MKXH 4UFEH 1GG6C 1GBBA 2Z9JA 1HAGE 1K21H 1SGFG 4JYTA 1SG8B 1BTPA 1V2MT 2SFAA 3OTJE 1GBJA 1BRUP 1C2EA 3MI4A 1CHGA 2EA3A 1C5YB 1FMGA 1K2I1 3M3VA 1BT7A 2BD9A 3Q3YA 5DPAA 5E2PA 3K9XB 1FONA 1KLJH 1B0EA 1FY1A 4Y0ZE 3ELAH 2GZ9A 1P06A 3STIA 1VCWA 1O3KA 3FFGA 3RC6A 1FIZA 3RC4A 1TABE 1NFWA 1ZTJA 1L1NA 1P3CA 1DXPA 4KELA 4Y76A 3RXOA 4YOGA 1BRCE 3SUFA 1V2KT 4CR5A 2WZQA 1IQEA 3ZZ5A 1MU6B 2NU3E 1NN6A 1NFXA 1Z7KA 2J4IA 2GCTB 3SZNA 1N6XA 3L33A 4ZXXH 3KHVA 3PROA 4A1VA 3SNCA 2OBQA 1G32B 1TRMA 3PLPA 1F0UA 1YCPM 2BOKA 2O8WA 1LVYA 3TH3H 2ALVA 1TQ7B 2GCHG 1FLEE 3UQOA 1WCZA 3M36A 1ESTA 2A45B 1ACBE 2CF8H 1EJMA 1LCYA 1TYNA 3TH4H 4YTAA 1BTXA 2TBSA 3GCNA 3ZZBA 2AYWA 4O3UA 1E34B 1O0DH 3B23B 2XCNA 4BAOB 3RMMH 2ZNKH 8ESTE 1IQNA 2HPQH 1TAWA 2A0QB 1C5TA 1SGYE 1ESAA 1H9LB 1C5VA 4DJZB 1VCPA 2ZGHA 2OC8A 2XC5A 1HXEH 1Z1IA 3LPRA 1C1QA 2Z3EA 2AMDA 2ZECA 4IW4E 2PKAB 2O9QA 2BVRH 1P01A 2FWWA 3C27B 3PTNA 5C5NA 5PTPA 3PO1C 4ZHAA 3BG4C 4RSPA 3VGCB 4NA8A 1GBMA 3SBKA 1Z71A 3UWIA 1P2MA 2ZHDA 3GCTF 3STJA 3TVJB 5GWZA 5E0JA 3ATIA 1EQ9A 1IQIA 1SBWA 1GDNA 1FN8A 1BHXB 4UEHH 1MBMA 3KQBA 4CR9A 1HDTH 4ZUHA 6GCHF 1EPTB 1ANDA 1HJ9A 1UK3A 1MCVA 1O3DA 2Z6BD 2FPZA 1BB0B 2G52A 3R0FA 3UPEA 5ESTE 3RXTA 1INCA 2NU4E 3U69H 1NRRH 3M5OA 4WMFA 5FBEA 4FUEA 1O2JA 4OS7A 1RD3B 2VWMA 1IQLA 3TJOA 1CA0B 1TPAE 3BEUA 4MLFB 4B6EA 1V2PT 4OS4A 1HIAB 2BDHA 5EQRA 1T8MA 1HGTH 2FEQH 2RG3A 2A1DB 1BJVA 1P2OA 2BD2A 2TGPZ 5FPTA 2BDBA 4NFEA 1JIMA 2ZDLA 2ALPA 2ZGXH 5CMXH 2H9EH 3MU4A 2GDEH 4GAWA 1L4DA 3RU4D 6LPRA 1LHCH 1V2UT 3QN7A 1RFNA 1DXWA 1LDTT 2WUCA 1SGNE 1XKAC 4I8JA 2SGAA 1L2EA 1LQEA 2V35A 1TGSZ 3MO9A 3RU4E 2FP7B 4DGJA 2RA3A 1ZR0A 1UTJA 2A2XH 2OBOA 1K1JA 4MPVA 1Y5BT 3LOXA 4BTIB 1GL1A 1C4Y2 1EATA 1ZJKA 2ZFQH 1CGIE 1LHFH 2FOAA 1HNEE 4BAQB 1A3BH 2HNTE 1EUFA 1K1MA 3UUZA 3SU5A 3M35A 3F9FA 2XBVA 1GI3A 3BTFE 2HWLB 1GMDF 3PWBA 2VB0A 3QWCH 3RDZA 4MNVA 1ZSLA 2FI4E 3ZVGA 1ZRBA 3TIUA 1GDUA 5B6LA 4B2AA 3BTGE 4RKOB 1O33A 1TE0A 5A8XA 1QRXA 3URDA 4ABFA 2UUKB 1J14A 1A4WH 5FCKA 3NKKA 1GHZA 1TBQH 1YPMH 1GCDA 5GDSH 4M9FA 1MCTA 3EYDA 4E06H 1GMCF 1MUEB 4CBNA 1TPOA 1WUNH 2J95A 4LZ4B 1TX7A 2A4RA 2YNBA 4A1XA 3M5LA 1O2IA 3QZQA 2R0LA 1GI1A 2VNTA 2AGGX 2UUFB 1FAKH 2Z9KA 1P2JA 2ZFSA 3SUGA 4INKA 2BM2A 4X2WA 3MYWA 1C5PA 5ETXA 7GCHG 5TCCA 3HKIB 3LGUA 3M5MA 4Q2KA 3MH7A 2FDAA 5DG6A 5FHTA 2AGIX 4WH8A 1ELCA 1OPHB 1IQKA 2J2UA 1QY6A 4I8HA 2BMGB 1C2MA 3L3TA 1XUKA 1GBTA 4ZXYH 2CMYA 1QB1A 3ITIA 3RU4T 1F0SA 3NZIA 4AFQA 1AUTC 2Z3CA 1UVUH 3F68H 2F9NA 1W14U 1UHBA 3RXLA 1EOJA 2A5AA 3LU9B 1SQOA 5LPEA 3SV2H 1O3LA 1PPEE 1UVPA 2BX3A 3GY3A 4X6NA 4WXVA 4GLYA 4E05H 1P2KA 2ZHEH 3TNTA 3D65E 1K1IA 5E0GA 1DWBH 3A7ZA 2BDIA 2XC0A 4CRGA 2FM2A 2XBWA 4UFDH 1O2UA 5GNDA 4DIIH 3F6UH 4A7IB 2B5TB 4UD9H 2W3IA 2P8OC 4IN2A 1DY8A 1ETSH 1MAYA 1VGCC 2ZTZA 4I8GA 4GUXA 4OGYA 3GDUA 4I33A 1E37B 2ANWA 4AFUA 4D76A 1ZRKA 3PV2A 4XBDA 2XWAA 2BZ6H 3HPTB 4I31A 5DP5A 5HGGA 3ZZDA 1QR3E 4AZ2B 4KP0A 4YM9A 1O2WA 4NGAH 4BAKB 1GJDB 2A4OA 1O3AA 1YLDA 2BXTH 2FO9A 3EA7A 3W95A 3SU2A 4ZMAH 2EI6A 1LPKB 1NFUA 1MU8B 2D2DA 1IAUA 2QXHA 3CP7A 2XCFA 3RXBA 1O3BA 3GISB 1VITH 1GI6A 3HGNA 5DP8A 2EI7A 8GCHF 2QA9E 1O2KA 1XXFA 1GMHG 1TMTH 2CN0H 2OQUA 1NRSH 2P59A 2FYQA 3D49H 3S7KB 4XBBA 1D3PB 3U1IB 2VIWA 3L6PA 3G01A 1GCTB 1DICA 4B75A 1IHTH 1PYTC 4SGAE 2FLRH 2J92A 2BD7A 2V3HH 4DW2U 4YO9A 4YZUA 4ZKRU 1EPTC 1OWKA 1W0YH 2B7DH 1O2YA 5LH8A 2GDDA 4Y71A 1OP0A 2FX6A 2VWOA 1A5HA 1C5WB 2H9HA 2BVSH 1K22H 5EPYA 1Z8IB 3D23A 3C1KA 2PKSB 4K8BA 1O30A 3GYMA 4PROA 2ZPQA 2ZO3H 5IYTA 3OYPA 1O2OA 1OP2A 4FU9A 1TFXA 2A32A 4ISIH 2PKAA 3DHKH 3A88A 5EXNA 3BTEE 2AEIH 1TOMH 1ELFA 3A85A 3BG8A 1L4ZA 1KXBA 4FUBA 4BAMB 1QNJA 1C2GA 4M7GA 2HOBA 1GHBG 1HRTH 2GZ8A 4O03A 3GDSA 1ZOMA 3FANA 1J9CH 2JH6D 1PPCE 4X2XA 4X1NU 3SGQE 1E0FD 3ZVDA 3UREA 4FVBA 1ANEA 3BIUH 2OQ5A 2UWOA 1ELAA 1GGDC 4FUCA 1AVXA 2FYRA 1SL3A 4YLUA 5L30H 3QLPH 1TGBA 4XSKU 1PPGE 2Y7ZA 3SW2B 1GBDA 1C1WH 2IPHA 1V2TT 4X6OA 3FVFB 3CENA 1BQYA 3TGJE 2G55A 5L2YH 5HMAA 3EGKH 3V3MA 3KEEA 2ZZUH 1UVTH 9LPRA 5HYOA 2RA0A 1QBNA 1SOTA 2OC7A 2ANMH 1L1GA 1LPGB 3MTYA 1O34A 1WSSH 1HJ8A 4FUDA 1GMHF 3HKJB 5DO4H 4B76A 1D3TB 2BD3A 2F9PA 3Q76A 1C5UA 2ZTXA 2ZFPH 3UNQA 1NRNH 4DOQA 3IG6B 3SNBA 1HAPH 3MNSA 5EXMA 4VGCB 1O2MA 3GDVA 1FN6A 1TRNA 2SGPE 1OWHA 1GI8B 1NS3A 1J15A 3S7HB 3NPSA 3A8DA 1F92A 4TYDA 5C2ZA 1P9UA 1C5ZB 1ZLRA 3MNBA 3NXPA 2C4FH 4UONA 1THRH 2ZHQH 3SU6A 5LPFA 2SGQE 2TPIZ 4IC6A 1Z1JA 1HFDA 2BY8X 2GD4B 4HFPB 1O3JA 2ESTE 1W12U 1QQUA 2F9BH 5AHGH 3M7UA 2BQ7B 1BBRK 3BV9B 3RXRA 2W7UA 1W0ZU 1OWDA 1CO7E 1SLXB 5HM2A 3M7TA 2PGQB 4NA9H 4BXWA 2ZGBH 1SLVB 1ZYOA 2R3YA 4NZLA 4JMYA 1GJ8B 1JMOH 1ESBA 1G37A 2V3OH 3PLKA 2B9LA 1HB0B 2HLCA 3BTKE 5CHAC 4R8TB 3TGKE 1ZTLA 1HXFH 1TPSA 2XW9A 3A7YA 3SOSA 2O8LA 2VGCC 1MQ6A 2PUXB 3QTOH 3PMHB 3E6PH 4FUIA 4HGCA 5K7RA 1GHYH 1TQ0B 3ZV8A 2Y5GA 5AVDA 3BIVH 2JKHA 3MU0A 5GIBA 2GX4A 3UOUA 4FUFA 1V3XA 3T27A 1GHWH 5GCHG 3V0XA 1GHXH 1H8DH 1GJBB 2D1JA 3LKWA 3RXEA 2BD5A 2A7HA 4NZQA 3SJKA 1GPZA 3T2NA 1TGCA 1FY4A 1T31A 2EEKA 1LHEH 4AG2A 4ZAEA 1FY8E 1G30B 2IN2A 1BBRH 1D6WA 1WTHD 1VZQH 1EP5A 3LGVA 2XC4A 2VIOA 1N8OB 2FX4A 1K1LA 4XOJA 2VVCA 3A7WA 1WYKA 1ZZZA 2VGCB 5C20A 1P0SH 1GJ9B 1QQ4A 1V6DA 4WH6A 1JWTA 4AYVB 1EB2A 2BX4A 4Y79A 1TALA 4ISOA 1TNJA 2W7SA 4WF8A 3B8JA 1BRBE 1O35A 4Y0YE 4IGDA 5IDKA 2F9VA 2PW8H 3KCGH 4Z6AH 2ZFFH 1O32A 1G36A 3LH3A 4LXBH 2VBCA 2BHGA 5EQQA 2WV4A 1O3EA 4E7NA 2QV1A 3P8OA 2A2QH 1BJUA 4D7GA 1P03A 3KGPA 3VPKA 1TGTA 2YOLA 1LQDB 1UO6A 5A0CA 2BXUH 1EAIA 2XXLA 3HATH 5K0HA 4AGJA 1F5RA 3LDXH 1CT0E 1NU9A 3RM2H 2FOFA 3PMAB 2F9UA 1CBWB 3FAOA 3BG4B 1Q3XA 1G3CA 5EU8A 3JZ1B 1EX3A 2Z9GA 1LPZB 1SGIB 1NROH 1OP8A 3FP6E 3LIWA 2QCYA 4INHA 4DIHH 5GCHF 1Y5AT 1F2SE 3RXVA 1O5EH 1BOQA 1X7AC 1ELEE 1YCPH 1WTGH 2GMTC 1DSUA 1JRTA 1FQ3A 1LVOA 1UTNA 5JBBS 1HV7A 2B8OH 1AVWA 4R0IA 1C2HA 3AVZA 5JB9S 1WAYB 3MU8A 2IJD1 4NWLA 1ABIH 4FUHA 2GP9B 1WBGB 4H42U 1XUIA 1C5XB 1JBUH 1AGJA 1AFEH 1C1MA 1LKBA 1GBFA 2CGAA 1QJ6B 1C1UH 1C5NH 2J9NA 2ZTYA 5A0BA 5F8XA 1F5LA 2GMTB 1YPHE 1TNHA 1DVAH 1GGDB 1V2RT 1DWEH 1HPGA 3MNCA 1AWFH 1O37A 1C2FA 2ZPRA 4ZKOU 1EOLA 1T8NA 2PR3A 3PWCA 4CHAB 1GI7B 1MMJN 1P10A 1RGQA 5GXPA 2SGEE 1ZPZA 3R3GB 3AW0A 6GCHG 2BQ6B 3I77A 4AYYB 2GGVB 2FTLE 2H9TH 4AORA 3VEQB 2Z9IA 4O9VA 1CBWC 2QXJA 1C2IA 1FXYA 1JOUB 5C1YA 2V6NA 4DT7B 3A7TA 2OCVB 1ANCA 2ZGJA 3FP7E 4WVPE 2Q6GA 1T8LA 5L2ZH 3M3TA 3RMLH 4K1EA 1ARCA 3K2UA 1TNIA 3U8OH 4ABHA 5LGOA 3AAVA 4MNYA 3DUXH 2O8UA 2R2WU 1SGPE 4MG3A 5A8ZA 3LJJA 1TMBH 2XBYA 2BOHB 1CGJE 1FY3A 1QL8A 5EW1H 3FZZA 1KLIH 1TONA 5T1VA 1RIWC 2ZFTA 1N1LA 3UQVA 4X6PA 2IOTA 5FBIA 1D9IA 4OS1A 1VCQA 3SJIA 1QRZA 3SV7A 1C9PA 3RXQA 1PPZA 1KXCA 5EG4A 1RIWB 3ZZ6A 1O3HA 1MD7A 1O3MA 1O5AB 1ZHRA 2THFB 3PLBA 2D26C 3VB6A 1FJSA 1DE7H 5T6DA 1MTVA 1QURH 4K3JA 1D3DB 1D6RA 1ZMJA 3PYHA 1BITA 4F4OC 2R3UA 1C1OA 1SHHB 3E3TA 3ATKA 3SV8A 1YM0A 1LTOA 1E36B 4THNH 2FOEA 2AH4X 3ZZ8A 1Y3XA 2F9OA 4JZEH 4XDEA 4J1YA 1P2QA 4NCYA 1DLEA 3JZ2B 1Y59T 2CF9H 3SQHE 1RS0A 1LHDH 2QAAA 3AW1A 1L1JA 1SLUB 1AIXH 1QB6A 3F9HA 4MQAA 4X6MA 2STBE 4UFFH 1EAUA 2PUQH 1GBEA 4NWKA 4DG4A 1U6QA 3OTPA 3UFAA 3TK6A 2ANYA 1GDQA 2G4TA 3GOVB 3TNSA 3RUOA 2O8TA 2QGRA 2OUAA 1BBRE 3SUDA 1KTTB 5CE1A 1CHOF 1C2JA 1UCYE 2ODQA 4K1TA 1K1PA 1A2CH 2C93B 1HAYB 2A4QA 1J17T 4CREA 1ELTA 1AY6H 3SU3A 3UR9A 3QZRA 2FOCA 4IN1A 4KTSA 2F4LA 1MKWH 1P11E 4MNXA 5AFYH 5J4QA 1S6HA 1GG6B 1GJ6A 3AASA 1P09A 4ESTE 1UJ1A 2G4UA 2VIQA 1FDPA 1GCTC 1AUJA 3RLYH 1CA8B 1AZZA 2QIQA 3ZZ3A 1G3EA 4I7YH 3SI4H 2WUBA 2OXSA 1ABJH 1FNIA 2FOHA 4Z0KA 2BVXH 1P8VC 4WMEA 1QA0A 2HNTF 5JBCS 2PGBB 1Z6EA 1W8BH 1YPEH 4AOQA 1O3FA 1DUEA 1UTMA 4FXGH 1GI5A 3EQ0H 4TWWA 2WYJA 3RXAA 2ZIQH 1XUHA 2OC1A 4OM9A 4B73A 1SGFA 3E0PB 1TGNA 1GJ5H 2CHAB 1MZDA 2GCHF 2QF0A 1KY9A 4YOJA 4JYUH 3U9AH 3ZZ4A 3QX5H 5DJ7A 1ETTH 2W5EA 5JB8S 4MPXA 1HAZB 1DITH 1B0FA 3PV4A 4TY6A 2FTMA 4TWYA 4TY7A 5F8ZA 1ZHPA 1QBOA 1SGTA 1TNLA 3SHAH 2PHBA 3GCHB 1DS2E 3SNDA 1UTLM 2H5CA 3B9FH 1AMHA 2ILNA 2R9PA 1GHBF 2W26A 4MTBA 1GBKA 3F1SB 2FXRA 8LPRA 2ODYB 2ZCLP 5F03A 1SQTA 3FP8E 1RTFB 2ZWLH 3RXKA 1FI8A 1ZPCA 4H4FA 4BOHA 4ISHH 9ESTA 4X2VA 1UK2A 4OS6A 2WPJS 2C8YB 1YPHC 2ULLA 1C1PA 1G3DA 4F49A 3M7QA 1BHXF 1FPHH 1YPLH 1MZAA 3PMBB 3P92A 5JPMH 2ZDMA 1IQHA 3Q3XA 1MTSA 1LMWB 3GY7A 2BYAX 4K2YA 3NCLA 1GJ4H 2VVUA 2WHXA 1SB1H 4D9RA 4RN6A 3IITA 3KQCA 4B74A 3D62A 1QBVH 1CGHA 1NZQH 1AE8H 3NUMA 2F3CE 3GY5A 1A61H 1LHGH 2P3TB 1AU8A 1N6YA 1YPJH 2PSYA 1NY22 5DP6A 4BTTB 1TA2A 1ANBA 1ELBA 2ZF0H 2WV9A 2ANKH 2Z94A 4ZHLU 3KN2A 1C1NA 2AGEX 3A7VA 4FVDA 4RI0A 3EA8A 1TBRH 1CT2E 2GV7A 2ZGCA 4UE7H 1O38A 1XVOA 2AS9A 2GT8A 2PV9B 1ZGIA 1GJ7B 1OSSA 1T7CA 2Q6DA 1BMLA 2C8ZB 3EE0B 1A3EH 3QUMP 2AMPA 4KTCA 3P17H 4GCHF 1ZHMA 2BDAA 1YGCH 3ZVEA 1XUJA 5F8TA 2QN5T 3M37A 2HGTH 5JDUB 1V2OT 3SU4A 2EC9H 3VB4A 1C5RA 1O2LA 1A0JA 1CA0C 1DM4B 5FPYA 2BD8A 4ABDA 4OGXA 3K6ZA 3P8NA 1SFQB 1ZMNA 2BY5X 4Q7XA 3VB7A 1HAOH 4B2BA 1BCUH 2FMJA 1S6FA 2BDGA 2ZQ2A 3MOCA 3VXEH 3RC5A 1V2JT 3SYJA 3DD2H 3RXMA 4DY7B 2FOMB 1TRYA 1P3EA 1CQQA 4LK4A 4VGCC 3ZV9A 1W2KH 1HAHH 4K60A 1LVMA 1PPHE 2BTCE 3SQEE 4JZIA 5C67A 3LGIA 3AK5A 1QIXB 1GI2A 1O3CA 3P95A 1C2KA 3SV6A 1AWHB 1H8IH 5GJ4B 1BTZA 3RLWH 1ZGVA 2P93A 2VIPA 1V2LT 1ELDE 1QCPA 5AF9H 1RRKA 1KDQA 3VGCC 1A5IA 1LVBA 2FLBH 2FOBA 2P16A 2QC2A 3KQDA 4JK5A 5F6MA 2PKSC 3SZEA 1ARBA 2ZEBA 2P8OB 5DP7A 1NC6A 4J2YB 4NIYA 1GHAF 1GHVH 2J94A 2NU1E 4QT8C 1AD8H 4NIXA 1O31A 1SMFE 2NU2E 1DLKB 5FPSA 3SUEA 4IBLH 1O2XA 1C1VH 2HRVA 4KKDA 4ABBA 1XKBC 1XX9A 4K5ZA 1GWAA 5SGAE 4ABJA 1BTWA 1FIWA 5EQSA 1ZSKA 2FOGA 1PQ5A 1YBWA 4GVUA 4ZROA 3KIDU 3TJNA 2Z7FE 1KXDA 4B71A 1OWJA 1GI0A 3GCTG 5FCRA 2VH6A 1QFKH 1PQAA 1RXPA 3QGNB 2F91A 1SHYA 1KSNA 3BTWE 1CU1A 2OLGA 2QXGA 4X8UH 1DWCH 1G2MA 4YT7H 1O2TA 1S83A 2ZI2H 3RXJA 3P8GA 2EI8A 3H5CB 4KTUA 1BIOA 2JH0D 2XBXA 3TU7H 1SVPA 1O2NA 2K1QA 1AVGH 3QDZB 1C4U2 1MH0A 4X1QU 1YKTA 2ZPSA 1NFYA 1SPJA 2Y81A 1PQ8A 5A09A 4CRFA 1WQVH 7ESTE 1UCYK 1EXFA 3M5NA 1S81A 4Q7ZA 5CHAB 3IWMA 2A7JA 2STAE 4ISNA 1HYLA 2XNIA 2ZHFH 1AE5A 2G81E 3TJUA 1DOJA 5A0AE 1ZTKA 3PB1E 1JIRA 4NSYA 5EPNA 4U01A 3ODDA 1T32A 1YYY1 1H4WA 4U2WA 3MO6A 1C4V2 4IMQA 5EGMA 1Z8JB 2F83A 3SN8A 3ZVAA 4LOYH 4UFGH 3A84A 5BPEA 4GSOA 3UIRA 1GVKB 3T25A 3GY4A 3S0NA 1GBHA 4GPGA 1BUIA 1P05A 4XE4A 2PTCE 1B5GH 4ZHMU 3A89A 2FS9A 3GY2A 2Q1JA 4AN7A 4Y8XA 1EZQA 4AX9H 2VWNA 4MPWA 3U8RH 4BXSA 3H7OA 4JK6A 1GBCA 1MTNC 2A7CA 1C5OH 2BD4A 2AIQA 4OS2A 1FAXA 1UCYH 1MTUA 2ZDNA 3H7TA 2BLVA 4MDSA 1WV7H 5DP3A 3ZZCA 1TIOA 8GCHG 2WPIS 1ZSJA 3LC3A 1CSOE 1PPBH 2FS8A 1P04A 5T6GA 1TWXB 2HVXA 1MTWA 1AKSB 1NPMA 2YNAA 5E8EH 2B0FA 4ABAA 3P8FA 2SNWA 3MHWU 3RXSA 1NT1A 1Y3WA 1S85A 1DWDH 3Q3KA 1GVLA 3RXFA 2Z3DA 1GJAB 1M9UA 3TPIZ 1MTNB 1AKSA 3LJOA 5C5OA 3V13A 2G51A 4Q7YA 1G9IE 2BDCA 2C8WB 3BTQE 3KNXA 5DGJA 1DY9A 3ZYEA 1RJXB 4A1TA 1YP9A 2JH5D 2WPHS 1GJCB 3MWIU 5JBTA 1GBAA 3TJVA 4ISLA 1GMDG 3QK1A 3RM0H 4CBOA 1W11U 2FESH 1SOZA 1C2LA 2BLOA 1XUGA 3BEIB 4FU7A 5ESBA 2A4GA 1CVWH 1Z8GA 3QO6A 3ODFA 4Y7AA 3VB3A 3TK5A 1Y3UA 4Y8ZA 1TX8A 4O3TA 1DFPA 1VJAU 1CHOG 2VWLA 3P70B 2M5TA 1XM1A 1HAIH 2D8WA 4AFSA 3A82A 1TOCB 3OY5U 2WPKS 1TB6H 1O2QA 4JZ1A 3F9GA 3UNSA
chains in the Genus database with same CATH superfamily
2AHME 2SNVA 1TBZH 2VINA 2P95A 2ZC9H 1QL7A 1ELGA 1OXGA 2FI3E 1SGQE 5DK1A 1O2GH 2Y5FA 1H9HE 2Y5HA 3A8AA 3SJ8A 4WY3A 3SNEA 3UTUH 1EJAA 1KXAA 1NU7B 2ZG0H 1MD8A 2LPRA 3T62A 1KIGH 2C3SA 1P9SA 3RMNH 4HTCH 3QTVH 4FU8A 2WV5A 1DT2A 1WOFA 3U98H 1K1NA 4AB9A 1KDQB 3OEHD 2WINI 3PMJA 2A5KA 5I46H 1V2QT 4ZKNU 3FZDA 1OS8A 1AFQC 1EB1H 2Z9LA 4YLQH 5A8YA 1JXPA 1O5DH 2QYIA 2WPMS 2LNCA 1PQ7A 1W13U 4JZFH 2Y6TA 2R2MB 1KXEA 1O2SA 2BY7X 4RKJB 3ZZAA 3S9AA 1P57B 3CS7A 1S84A 3U28C 3ZZ7A 1IHSH 1P02A 2XWBI 4K1SA 2ZCHP 1OKXA 1EZUC 5H4IB 3FN8A 5C1XA 1O2ZA 1T4UH 3NK8A 1RTLA 4D7FA 3HGPA 1SGDE 1V2ST 1HBTH 1EZSC 2Y80A 1BTHH 3EDXB 1GI4A 1V2WT 3CS0A 4MNWA 2QY0B 1BTUA 2NWNA 1T8OA 3RXGA 1H9IE 3Q77A 1QL9A 1HIAA 1K1OA 2CK3D 1ELVA 3MMGA 3WWFA 3HK6B 1UVOA 4B1TA 2XYAA 3PRBA 1HJAB 3GYLB 3V12A 4AB8A 1BMNH 2SGFE 3UR6A 1MKXK 1O5BB 4CRCA 3SGAE 1OX1A 4Q80A 1V2NT 2R0KA 2G8TA 3U1JB 2Y7XA 2ZFRH 4MVNA 2P3UB 1J8AA 1PYTD 3WWBA 1B7XB 5I25A 2BY9X 5EW2H 1XUFA 2V7QD 5BRRE 2ZQ1A 1QHRB 4U30A 1G2LA 1D3QB 4ZH8A 2TIOA 3E8LA 1AFQB 2BDYA 1Y3YA 3DFLA 4HZHA 1Z6JH 1QRWA 5TJXA 1TNGA 1SGRE 2BZAA 1A1RA 2BQWB 5HXFA 2JJ1D 3MH5A 4B2CA 3KL6A 4INLA 2H2ZA 5DP4A 1BDAA 2G5VA 3E16B 1YLNA 3KQEA 3OX7U 3P6ZB 3OU0A 3PM3A 3TGIE 1FZZA 2ODPA 3EA9A 4CH2B 4XBCA 3A8CA 6ESTA 2KCPA 1O3GA 3OSYA 7KMEH 2ZDVH 1YC0A 2OK5A 1YLCA 2BLWA 4CRAA 3ZVBA 3A86A 5C1UA 3A81A 3N7OA 1QGFA 1IQFA 2CV3A 3DFJA 4ABEA 1W7GH 3ATLA 1NBMD 2FODA 2G00A 1A7SA 2Q6FA 1ZJDA 1Y3VA 7LPRA 2VIDA 2FI5E 3SI3H 4K8YA 1BRAA 2H5DA 2ZU4A 4GHTA 4CHAC 5FX5A 1FY5A 2TRMA 3LGTA 1TNKA 3T5FH 2BY6X 1THSH 3E91A 1UVSH 3LT3A 4P02A 4JYVH 1F7ZA 3LH1A 4A6LA 5ABWA 3W94A 1BA8B 2KAIB 2W3KA 4OS5A 1AB9B 2CHAC 2TGDA 3MO3A 2IJOB 4NIWA 2KCYA 4XRNA 1O3IA 1O39A 3WY8A 1WU1A 1GMCG 2OTVA 1O36A 2C90B 3O8BA 1LO6A 2BLQA 1V2VT 5E0HA 1PFXC 2VU8E 4WMDA 2DE8A 3TH2H 2PP6A 5T3HA 4TPYA 3RXIA 2H1UA 1O2HA 3ENSB 2GV6A 5JYIA 2ZDKA 3SU0A 3PTBA 1UK4A 1C5QA 2GVFA 4Y7BA 4CH8B 2RDLA 3BTHE 4SGBE 2GCTC 1O5GH 1GBLA 3LGWA 4Y10E 2QF3A 1SI5H 2C8XB 2UUJB 3SGBE 3UNRA 3Q00A 2WPLS 2PWXA 1C2DA 4UDWH 1THPB 4D9QA 4NG9H 4Y8YA 1DANH 1UTPA 3BF6H 1AO5A 1O3PB 4GHQA 1ID5H 1C1SA 3RMOH 2A5IA 1UMAH 1OWEA 1Z8RA 1W7XH 5DP9A 1VR1H 3RXHA 3E90B 1A5GH 1ETRH 2O8MA 4B6FA 6CHAC 4CRBA 3BEFB 5FAHA 3T26A 1QB9A 1OOKB 4NIVA 1EKBB 1AZ8A 2OC0A 1TPPA 3GY8A 3URCA 1YWUA 2XTTB 1MQ5A 3O8DA 2FIRH 2ZDAH 4U32A 3SJOA 4WWYA 3GCHC 3KYFA 1C5SA 3A83A 5DKMA 2NU0E 3O8RA 1WQSA 2I6SA 4DVAU 3ZIAD 2PTNA 1NRQH 3PV5A 2CXVA 1KLTA 2HNTC 3DSPA 3I78A 1S5SA 3U8TH 2VIVA 1LKAA 3SHCH 2ZA5A 6CHAB 4X0WU 1O2PA 4Y11E 4H6SB 1GI9B 1A0HB 1BMMH 1SFIA 2J38A 5E2OA 2GJGA 3T28A 3E1XB 1VITG 1P12E 4Y6DA 3SORA 1EASA 1GBIA 3O8CA 2CJIA 3GICB 1FUJA 1ZMLA 2VVVA 3LGYA 4FETA 3UB0A 1F0RA 1MAXA 2ZU5A 3ESTA 4ABGA 3SNAA 2ZCKP 1SSXA 1TLDA 1W10U 5C3NA 3BN9A 4HG6A 2PFEA 1TA6A 1SR5C 1HAVA 1WXRA 3MU5A 4WXIA 4F55A 1O3NA 2HLDD 1BTYA 2H6MA 4MPUA 1DX5M 2L6OA 3S69A 2DE9A 2KCAA 4FUGA 5GPIB 5A2MH 3ATWA 3KF2A 1YPGH 1C9TA 1H1BA 1AB9C 1JRSA 2TGTA 1TX6A 1E35B 4X1PU 5JBAS 1OYQA 1GVZA 1AQ7A 2JETB 1SGCA 1NTPA 1E79D 1HLTH 1VKYA 3H09A 4O97A 1XMNB 3VXFH 1Q31A 4X2YA 1KYNA 4KGAA 1YCPK 4TPIZ 3GS9A 4IS5A 2AERH 5FX6A 2XRCA 5B6OA 1MKWK 3BTME 1F5KU 3ZVCA 3M61U 4X1SU 1EZXC 1EPTA 1C5LH 1RTKA 4LZ1H 1DPOA 2ZU1A 4HI3A 3K6YA 1UTQA 3A8BA 5HM9A 3QGJA 1TMUH 4X8TH 3S9CA 1HAVB 5EODA 2OP9A 3PO1B 1J16A 4BNRA 2DUCA 4JZDH 4YT6H 4E7RG 1F0TA 1NRPH 5EOKA 3MNXA 1GHAG 1VITF 2V0BA 2AMQA 4XD7D 2PSXA 3F0PA 1SC8U 1IQMA 3BTDE 1SQAA 4IC5A 1YPKH 1S0RA 2ZU2A 1O2VA 2JETC 3TK9A 3RXCA 4TSFD 2ZKSA 1SGEE 1AI8H 4FUJA 5HIZA 1CE5A 2BB4A 2J34A 1Y5UT 2WPDD 3GY6A 4WJG2 3NWUA 5KECA 1C5MD 2GTBA 5L6NH 3N99A 3LC5A 4DCDA 3MFJA 4I32A 5FXLA 2WYGA 4NA7A 1SLWB 2ASUB 3K65B 1UTOA 1P2IA 5EXLA 2VH0A 1S0QA 1W0JD 3SJ9A 2P94A 5LPRA 4I8LA 2QE7D 1G3BA 3RXDA 4X1RU 3MH4A 2KM0A 2VJ1A 5AFZH 1PPFE 2TGAA 3I29A 4ASHA 2ZU3A 1QTFA 5T6FA 3HK3B 4XFQA 2QXIA 4ZKSU 4BAHB 3SO3A 1HAXB 1OYTH 1S82A 3A87A 3ZZ9A 2PLXA 2ZHWH 4A5TS 1HJAC 3OY6U 5G4BA 4BANB 2GT7A 4X8SH 1BMAA 3LONA 1IQGA 3F9EA 4NFFA 2AFQB 3BTTE 4AGKA 1L0ZA 3TITA 4BTUB 2HPPH 1BZXE 1AHTH 1DUAA 4NSVA 1D4PB 2A31A 1VJ9U 3VFEA 4ABIA 1A0LA 1NESE 4X8VH 3DA9B 2HALA 3MH6A 1EAXA 3T29A 3DT0H 1KXFA 1VGCB 1PJPA 1C1TA 1YF4A 2YMSC 1DSTA 1Y8TA 4A92A 1ZPBA 3SU1A 1XXDA 1QJ1B 2Y82A 3EAJA 3S9BA 3TLOA 1EP6A 1AN1E 1DDJA 2I6QA 1CT4E 4AG1A 1GL0E 3ATMA 2UWLA 1O2RA 2L74A 3GCOA 2OD3B 4H6TA 1QJ7B 3RP2A 1UHBB 4AFZA 1IOEA 1OWIA 3UWJH 1K28D 2RCEA 3ZYDA 1ORFA 1KTSB 1HCGA 4I8KA 7GCHF 1A46H 3RXUA 2GKVE 1Q2WA 1EAWA 2UUYA 3FKSD 1C1RA 5KEDA 1O5CB 1XVMA 4JCNA 1O3OA 3M3SA 2AIPA 3UOPA 1NO9H 3ZVFA 3W1EA 1E38B 1MBQA 1N8OC 2FZZA 2G5NA 3AAUA 1FPCH 2GZ7A 3V7TA 2KAIA 3E0NB 1NM6A 4YXWD 2ZP0H 2P3FH 1QA7A 3MU1A 4K69A 4YOIA 2OINA 3UY9A 1W3CA 1O5FH 4CRDA 1UTKA 1HUTH 4DURA 2SGDE 3DCLA 3VB5A 4YESB 8KME2 1T4VH 2UWPA 2IPQX 3SV9A 5J4SA 3RXPA 4D8NA 1IQJA 3BSQA 4GCHG 3A80A 4IMZA 1P2NA 2YMSD 1FV9A 3A7XA 1K9OE 5TCAA 1EJNA 1MKXH 4UFEH 1GG6C 1GBBA 2Z9JA 4ZCNA 1HAGE 1K21H 1SGFG 4JYTA 1SG8B 1BTPA 1V2MT 5C94A 2SFAA 3OTJE 1GBJA 1BRUP 1C2EA 3MI4A 1CHGA 2EA3A 2YMSB 1C5YB 1FMGA 1K2I1 3M3VA 1BT7A 2BD9A 3Q3YA 5DPAA 5E2PA 3K9XB 1FONA 1KLJH 1B0EA 1FY1A 4Y0ZE 3ELAH 2GZ9A 1P06A 3STIA 1VCWA 1O3KA 3FFGA 3RC6A 1FIZA 3RC4A 1TABE 1NFWA 5C0UA 1ZTJA 1L1NA 1P3CA 1DXPA 4KELA 2J98A 4Y76A 4YOGA 1BRCE 3RXOA 2XNDD 3SUFA 1V2KT 4CR5A 2WZQA 1IQEA 3ZZ5A 1MU6B 2NU3E 1NN6A 1NFXA 1Z7KA 2J4IA 2GCTB 3SZNA 1N6XA 3L33A 4ZXXH 3KHVA 3PROA 4A1VA 3SNCA 2OBQA 1G32B 1TRMA 3PLPA 1F0UA 1YCPM 2BOKA 2O8WA 1LVYA 3TH3H 2ALVA 1TQ7B 2GCHG 1FLEE 3UQOA 1WCZA 3M36A 1ESTA 2A45B 1ACBE 2CF8H 1EJMA 1LCYA 1TYNA 2J97A 3TH4H 4YTAA 1BTXA 2TBSA 3GCNA 3ZZBA 2AYWA 4O3UA 1E34B 1O0DH 3B23B 2XCNA 4BAOB 3RMMH 2ZNKH 8ESTE 1IQNA 2HPQH 1TAWA 2A0QB 1C5TA 1SGYE 1ESAA 1H9LB 1C5VA 4DJZB 1VCPA 2ZGHA 2OC8A 2XC5A 1HXEH 1Z1IA 3LPRA 1C1QA 2Z3EA 2AMDA 2ZECA 4IW4E 2PKAB 2O9QA 2BVRH 1P01A 2FWWA 3C27B 3PTNA 5C5NA 5PTPA 3PO1C 4ZHAA 3BG4C 4RSPA 3VGCB 4NA8A 1GBMA 3SBKA 1Z71A 3UWIA 1P2MA 3VG8A 2KR7A 2ZHDA 3GCTF 3STJA 3TVJB 5GWZA 5E0JA 3ATIA 1EQ9A 1IQIA 1SBWA 1GDNA 1FN8A 1NBME 1BHXB 4UEHH 1MBMA 3KQBA 4CR9A 1HDTH 4ZUHA 6GCHF 1EPTB 1SKYE 1ANDA 1HJ9A 1UK3A 1MCVA 1O3DA 2Z6BD 4P00A 2FPZA 3OFND 1BB0B 2G52A 3R0FA 3UPEA 5ESTE 3RXTA 1INCA 2NU4E 3U69H 1NRRH 3M5OA 3F0OA 4WMFA 5FBEA 4FUEA 1O2JA 4OS7A 1RD3B 2VWMA 1IQLA 3TJOA 1CA0B 1TPAE 3BEUA 4MLFB 4B6EA 1V2PT 4OS4A 1HIAB 2BDHA 5EQRA 1T8MA 1HGTH 2FEQH 2RG3A 2A1DB 1BJVA 1P2OA 2BD2A 2QF4A 2TGPZ 5FPTA 1E1QD 2BDBA 4NFEA 1JIMA 2ZDLA 2ALPA 2ZGXH 5CMXH 2H9EH 3MU4A 2GDEH 4GAWA 1L4DA 3RU4D 6LPRA 1LHCH 1V2UT 3QN7A 1RFNA 1DXWA 1LDTT 1SGNE 1XKAC 2WUCA 4I8JA 2SGAA 1L2EA 1LQEA 2V35A 1TGSZ 3MO9A 3RU4E 2FP7B 4DGJA 2RA3A 1ZR0A 1UTJA 2A2XH 2OBOA 1K1JA 4MPVA 1Y5BT 3LOXA 4Q63A 4BTIB 1GL1A 3N7DA 1C4Y2 1EATA 1ZJKA 2ZFQH 1CGIE 1LHFH 2FOAA 1HNEE 4BAQB 1A3BH 2HNTE 1EUFA 1K1MA 3UUZA 3SU5A 3M35A 3F9FA 2XBVA 1GI3A 5HIYA 3BTFE 2HWLB 1GMDF 3PWBA 2VB0A 3QWCH 3RDZA 4MNVA 1ZSLA 2FI4E 3ZVGA 1ZRBA 3TIUA 1GDUA 5B6LA 4B2AA 3BTGE 4RKOB 1O33A 1TE0A 5A8XA 1QRXA 3URDA 4ABFA 2UUKB 1J14A 1A4WH 5FCKA 3NKKA 1GHZA 1TBQH 1YPMH 1GCDA 4M9FA 5GDSH 1MCTA 3EYDA 4E06H 1GMCF 1MUEB 4CBNA 1TPOA 1WUNH 2J95A 4LZ4B 2JJ2D 1TX7A 2A4RA 2YNBA 4A1XA 3M5LA 1O2IA 3QZQA 2R0LA 1GI1A 2VNTA 2AGGX 2UUFB 1FAKH 2Z9KA 1P2JA 2ZFSA 3SUGA 4INKA 2BM2A 4X2WA 3MYWA 1C5PA 5ETXA 7GCHG 5TCCA 3HKIB 3LGUA 3M5MA 4Q2KA 3MH7A 3KYGA 2FDAA 5DG6A 1S6LA 5FHTA 2AGIX 4WH8A 1ELCA 1OPHB 1IQKA 2J2UA 1QY6A 4I8HA 2BMGB 1C2MA 3L3TA 1XUKA 3OAAD 1GBTA 4ZXYH 2CMYA 1QB1A 3ITIA 3RU4T 1F0SA 3NZIA 4AFQA 1AUTC 2Z3CA 1UVUH 3F68H 2F9NA 1W14U 1UHBA 3RXLA 1EOJA 4I86A 2A5AA 3LU9B 1SQOA 5LPEA 3SV2H 1O3LA 1PPEE 1UVPA 2HVYB 2BX3A 3GY3A 4X6NA 4WXVA 4GLYA 4E05H 1P2KA 2ZHEH 3TNTA 3D65E 1K1IA 5E0GA 1DWBH 3A7ZA 2BDIA 2XC0A 4CRGA 2FM2A 2XBWA 4UFDH 1O2UA 5GNDA 4DIIH 3F6UH 4A7IB 2B5TB 2KFWA 1WDIA 4UD9H 2W3IA 2P8OC 4IN2A 1DY8A 1ETSH 1MAYA 1VGCC 2ZTZA 4I8GA 4GUXA 4OGYA 3GDUA 4I33A 1E37B 2ANWA 4AFUA 4D76A 1ZRKA 3PV2A 4XBDA 2XWAA 2BZ6H 3HPTB 4I31A 5DP5A 5HGGA 3ZZDA 1QR3E 4AZ2B 4KP0A 4YM9A 1O2WA 4NGAH 4BAKB 1GJDB 2A4OA 1O3AA 1YLDA 2BXTH 2FO9A 3EA7A 3W95A 5C17A 3SU2A 4ZMAH 2EI6A 1LPKB 1NFUA 1MU8B 2D2DA 1IAUA 2QXHA 3CP7A 2XCFA 3RXBA 1O3BA 3GISB 1VITH 1GI6A 3HGNA 5DP8A 2EI7A 8GCHF 2QA9E 1O2KA 3F3BA 1XXFA 1GMHG 1TMTH 2CN0H 2OQUA 1NRSH 2P59A 2FYQA 3D49H 3S7KB 4XBBA 1D3PB 3U1IB 2VIWA 3L6PA 3G01A 1GCTB 1DICA 4B75A 1IHTH 1PYTC 4SGAE 2FLRH 2J92A 2BD7A 2V3HH 4DW2U 4YO9A 4YZUA 4ZKRU 1EPTC 1OWKA 1W0YH 2B7DH 1O2YA 5LH8A 2GDDA 4Y71A 1OP0A 2FX6A 2VWOA 1A5HA 1C5WB 2H9HA 2BVSH 1K22H 5EPYA 1Z8IB 3D23A 3C1KA 2PKSB 4K8BA 1O30A 3GYMA 4PROA 2ZPQA 2ZO3H 5IYTA 3OYPA 1O2OA 1OP2A 4FU9A 1TFXA 2A32A 4ISIH 2PKAA 3DHKH 3A88A 5EXNA 3BTEE 2AEIH 1TOMH 1ELFA 3A85A 3BG8A 1L4ZA 1KXBA 4FUBA 4BAMB 1QNJA 1C2GA 4M7GA 2HOBA 1GHBG 1HRTH 2GZ8A 4O03A 3GDSA 1ZOMA 3FANA 1J9CH 2JH6D 1PPCE 4X2XA 3OEED 4X1NU 3SGQE 1E0FD 3ZVDA 3UREA 4FVBA 1ANEA 5FL7D 3BIUH 2OQ5A 2UWOA 1ELAA 1GGDC 4FUCA 1AVXA 2FYRA 1SL3A 4RT1A 4YLUA 5L30H 3QLPH 1TGBA 4XSKU 1PPGE 2Y7ZA 3SW2B 1GBDA 1C1WH 2IPHA 1V2TT 4X6OA 3FVFB 3CENA 1BQYA 3TGJE 2G55A 5L2YH 5HMAA 3EGKH 3V3MA 3KEEA 2ZZUH 1UVTH 9LPRA 5HYOA 4AC9A 2RA0A 1QBNA 1SOTA 2OC7A 2ANMH 1L1GA 1LPGB 2RFKC 1QZ8A 3MTYA 1O34A 1WSSH 1HJ8A 4FUDA 1GMHF 3HKJB 5DO4H 4B76A 1D3TB 2BD3A 2J5UA 2F9PA 3Q76A 1C5UA 2ZTXA 2ZFPH 3UNQA 1NRNH 4DOQA 3IG6B 3SNBA 1HAPH 3MNSA 5EXMA 4VGCB 1O2MA 3GDVA 4F48B 1FN6A 1TRNA 2SGPE 1OWHA 1GI8B 1NS3A 1J15A 3S7HB 3NPSA 3A8DA 1F92A 4TYDA 5C2ZA 5CDFE 1P9UA 1C5ZB 1ZLRA 3MNBA 3NXPA 2C4FH 4UONA 1THRH 2ZHQH 3SU6A 5LPFA 2SGQE 1UW7A 2TPIZ 4IC6A 1Z1JA 2W6JD 1HFDA 2BY8X 2GD4B 4HFPB 1O3JA 2ESTE 1W12U 1QQUA 2F9BH 5AHGH 3M7UA 2BQ7B 1BBRK 3BV9B 3RXRA 2W7UA 1W0ZU 1OWDA 1CO7E 1SLXB 5HM2A 3M7TA 2PGQB 3NRLA 4NA9H 4BXWA 2ZGBH 1SLVB 1ZYOA 2R3YA 4NZLA 5DN6D 4JMYA 1GJ8B 1JMOH 1ESBA 1G37A 2V3OH 3KQ5A 3PLKA 2B9LA 1HB0B 2HLCA 3BTKE 5CHAC 3DSGA 3OE7D 2J98B 4R8TB 3TGKE 1ZTLA 1HXFH 5DSFA 1TPSA 2XW9A 3A7YA 3SOSA 2O8LA 2VGCC 1MQ6A 2PUXB 3QTOH 3PMHB 3E6PH 4FUIA 4HGCA 5K7RA 1GHYH 1TQ0B 3ZV8A 2Y5GA 5AVDA 1BMFD 4ACBA 3BIVH 2JKHA 3MU0A 5GIBA 2GX4A 3UOUA 4FUFA 1V3XA 3T27A 1GHWH 5GCHG 3V0XA 1GHXH 1H8DH 1GJBB 2D1JA 3LKWA 3RXEA 2BD5A 2A7HA 4NZQA 3SJKA 1GPZA 2WSSD 3T2NA 1TGCA 1FY4A 1T31A 2JDID 2EEKA 1LHEH 4AG2A 4ZAEA 1FY8E 1G30B 1K0HA 2IN2A 1BBRH 1D6WA 1WTHD 1VZQH 1EP5A 3LGVA 2XC4A 2VIOA 1N8OB 2K8IA 2FX4A 1K1LA 4XOJA 2VVCA 2EY4C 3A7WA 1WYKA 1ZZZA 2VGCB 5C20A 1P0SH 1GJ9B 1QQ4A 1V6DA 4WH6A 1JWTA 4AYVB 1EB2A 3FO8D 2BX4A 4Y79A 1TALA 4ISOA 1TNJA 2W7SA 4WF8A 3B8JA 1BRBE 1O35A 4Y0YE 4IGDA 5IDKA 2F9VA 2PW8H 3KCGH 4Z6AH 2ZFFH 1O32A 1G36A 3LH3A 2VBCA 4LXBH 2BHGA 5EQQA 2WV4A 1O3EA 4E7NA 1MABB 2QV1A 3P8OA 2A2QH 1BJUA 4D7GA 1P03A 3KGPA 3VPKA 1TGTA 2YOLA 1LQDB 1UO6A 5A0CA 2BXUH 1EAIA 2XXLA 3HATH 5K0HA 4AGJA 1F5RA 3LDXH 1CT0E 1NU9A 3RM2H 2FOFA 3PMAB 2F9UA 1CBWB 3FAOA 3BG4B 1Q3XA 1G3CA 5EU8A 3JZ1B 1EX3A 2Z9GA 1LPZB 1SGIB 1NROH 1OP8A 3FP6E 5IK2D 3LIWA 2QCYA 4INHA 5EJLA 4DIHH 5GCHF 1Y5AT 1F2SE 3RXVA 1O5EH 1BOQA 1X7AC 1ELEE 1YCPH 1WTGH 2GMTC 2K0QA 1DSUA 1JRTA 1FQ3A 1LVOA 1UTNA 2LP6A 5JBBS 1HV7A 2B8OH 1AVWA 4R0IA 1C2HA 3AVZA 2IJD1 1WAYB 3MU8A 5JB9S 4NWLA 1ABIH 4FUHA 2GP9B 1WBGB 4H42U 1XUIA 1C5XB 1JBUH 1AGJA 1AFEH 1C1MA 5CHBA 1LKBA 1GBFA 2CGAA 2J9NA 1C1UH 1C5NH 1QJ6B 2ZTYA 5A0BA 5F8XA 1F5LA 2GMTB 1YPHE 1TNHA 1DVAH 1GGDB 1V2RT 1DWEH 1HPGA 3MNCA 1AWFH 1O37A 1C2FA 2ZPRA 4Q4LA 4ZKOU 1EOLA 1T8NA 2PR3A 3PWCA 4CHAB 1GI7B 1MMJN 1P10A 1RGQA 5GXPA 2SGEE 1ZPZA 3R3GB 3AW0A 6GCHG 2BQ6B 3I77A 4AYYB 2GGVB 2FTLE 2H9TH 4AORA 3VEQB 2Z9IA 4O9VA 1CBWC 2QXJA 5KGOA 1C2IA 1FXYA 1JOUB 5C1YA 2V6NA 4DT7B 3A7TA 2OCVB 1FX0B 1ANCA 2ZGJA 2V3MA 3FP7E 4WVPE 2Q6GA 1T8LA 5L2ZH 3M3TA 3RMLH 4DT4A 4K1EA 1ARCA 3K2UA 1TNIA 3U8OH 4ABHA 5LGOA 3AAVA 4MNYA 3DUXH 2O8UA 2R2WU 1SGPE 4MG3A 5A8ZA 4RT0A 3LJJA 1TMBH 2XBYA 2BOHB 1CGJE 1FY3A 1QL8A 5EW1H 3FZZA 1KLIH 1TONA 5T1VA 1RIWC 2ZFTA 1N1LA 3UQVA 4X6PA 2IOTA 5FBIA 1D9IA 4OS1A 1VCQA 3SJIA 1QRZA 3SV7A 1C9PA 3RXQA 1PPZA 1KXCA 5EG4A 1RIWB 3ZZ6A 1O3HA 1MD7A 1O3MA 1O5AB 1ZHRA 2THFB 3PLBA 2D26C 3VB6A 1FJSA 1DE7H 5T6DA 1MTVA 1QURH 5F53A 4K3JA 1D3DB 1D6RA 1ZMJA 3PYHA 1BITA 4F4OC 2R3UA 1C1OA 1SHHB 3E3TA 3ATKA 3SV8A 1YM0A 1LTOA 1E36B 4THNH 5EJ1A 2FOEA 2AH4X 3ZZ8A 1Y3XA 2F9OA 4JZEH 4XDEA 2F43B 4J1YA 1P2QA 4NCYA 1DLEA 3JZ2B 1Y59T 2CF9H 3SQHE 1RS0A 1LHDH 2QAAA 3AW1A 1L1JA 1SLUB 1AIXH 1QB6A 3F9HA 4MQAA 4X6MA 2STBE 4UFFH 1EAUA 2PUQH 1GBEA 3OTPA 4NWKA 1U6QA 4DG4A 3UFAA 3TK6A 2ANYA 1GDQA 2G4TA 3GOVB 3TNSA 3RUOA 2O8TA 2QGRA 2OUAA 1BBRE 3SUDA 1KTTB 5CE1A 1CHOF 1C2JA 1UCYE 2ODQA 4K1TA 1K1PA 1A2CH 4FOUC 2C93B 1HAYB 2A4QA 1J17T 4CREA 1ELTA 1AY6H 3SU3A 3UR9A 3QZRA 2FOCA 4IN1A 4KTSA 2F4LA 2LELA 1MKWH 4ASUD 1P11E 4MNXA 5AFYH 5J4QA 1OHHD 1GG6B 1GJ6A 1S6HA 3AASA 1P09A 4ESTE 1UJ1A 2G4UA 2RDEA 2VIQA 1FDPA 1GCTC 3F2FA 1AUJA 3RLYH 1CA8B 1AZZA 2QIQA 3ZZ3A 1G3EA 4I7YH 3SI4H 2WUBA 2OXSA 1ABJH 1FNIA 2FOHA 4Z0KA 2BVXH 1P8VC 2KX4A 4WMEA 1QA0A 2HNTF 5JBCS 2PGBB 1Z6EA 1W8BH 1YPEH 4AOQA 1SQRA 1O3FA 1DUEA 1UTMA 4FXGH 1GI5A 3EQ0H 4TWWA 2WYJA 3RXAA 2ZIQH 1XUHA 2OC1A 4OM9A 4B73A 1SGFA 3E0PB 1TGNA 1GJ5H 2CHAB 1MZDA 2GCHF 1COWD 1KY9A 2JIZD 2QF0A 4YOJA 4JYUH 3U9AH 3ZZ4A 3QX5H 5DJ7A 1ETTH 2W5EA 5JB8S 4MPXA 1HAZB 1DITH 1B0FA 3PV4A 4TY6A 2FTMA 4TWYA 4TY7A 5F8ZA 1ZHPA 1QBOA 1SGTA 1TNLA 3SHAH 2PHBA 3GCHB 1DS2E 3SNDA 1UTLM 2H5CA 3B9FH 3F2HA 1AMHA 2ILNA 2R9PA 1GHBF 2W26A 4MTBA 1GBKA 3F1SB 2FXRA 8LPRA 2ODYB 2ZCLP 2W6ID 5F03A 1SQTA 3FP8E 1RTFB 2ZWLH 3RXKA 1FI8A 1H8HD 1ZPCA 4H4FA 4BOHA 4ISHH 9ESTA 4X2VA 1UK2A 4OS6A 2WPJS 2C8YB 1YPHC 2ULLA 1C1PA 1G3DA 4F49A 3M7QA 1BHXF 1FPHH 1YPLH 1MZAA 3PMBB 3P92A 5JPMH 2ZDMA 1IQHA 3Q3XA 1MTSA 1LMWB 3GY7A 2BYAX 3PRDA 4K2YA 3NCLA 1GJ4H 2VVUA 2WHXA 1SB1H 4D9RA 4RN6A 3IITA 3KQCA 4B74A 3WW7A 3D62A 1QBVH 1CGHA 1NZQH 1AE8H 3NUMA 2F3CE 3GY5A 1A61H 1LHGH 2P3TB 1AU8A 1N6YA 1YPJH 2PSYA 1NY22 5DP6A 4BTTB 1TA2A 1ANBA 1EFRD 1ELBA 2ZF0H 2WV9A 2ANKH 2Z94A 4ZHLU 3KN2A 1C1NA 2AGEX 3A7VA 4FVDA 4RI0A 3EA8A 1TBRH 1CT2E 2GV7A 2ZGCA 4UE7H 1O38A 1XVOA 2AS9A 2GT8A 2PV9B 1ZGIA 1GJ7B 1OSSA 1T7CA 2Q6DA 1BMLA 2C8ZB 3EE0B 1A3EH 3QUMP 2AMPA 4KTCA 3P17H 4GCHF 1ZHMA 2BDAA 1YGCH 3ZVEA 1XUJA 5F8TA 2QN5T 3M37A 2HGTH 3F2GA 5JDUB 1V2OT 3SU4A 2EC9H 3VB4A 1C5RA 1O2LA 1A0JA 1CA0C 1DM4B 5FPYA 2BD8A 4ABDA 4OGXA 3K6ZA 3P8NA 1SFQB 1ZMNA 2BY5X 4Q7XA 3VB7A 1HAOH 4B2BA 1BCUH 2FMJA 1S6FA 2BDGA 2ZQ2A 3MOCA 3VXEH 3RC5A 1V2JT 3SYJA 3DD2H 3RXMA 4DY7B 2FOMB 4TT3D 1TRYA 1P3EA 1CQQA 4LK4A 4VGCC 3ZV9A 1W2KH 1HAHH 4K60A 1LVMA 1PPHE 2BTCE 3SQEE 4JZIA 5C67A 3LGIA 3AK5A 1QIXB 1GI2A 1O3CA 3P95A 1C2KA 3SV6A 1AWHB 1H8IH 5GJ4B 1BTZA 3RLWH 1ZGVA 2P93A 2VIPA 1V2LT 1ELDE 1QCPA 5AF9H 1RRKA 1KDQA 3VGCC 1A5IA 1LVBA 2FLBH 2FOBA 2P16A 2QC2A 3KQDA 4JK5A 3SZEA 2PKSC 5F6MA 3DSOA 1ARBA 2ZEBA 2P8OB 5DP7A 1NC6A 4J2YB 4NIYA 1GHAF 1GHVH 2J94A 2NU1E 4QT8C 1AD8H 4NIXA 1O31A 1SMFE 2NU2E 1DLKB 5FPSA 3SUEA 4IBLH 1O2XA 1C1VH 2HRVA 4KKDA 4ABBA 1XKBC 1XX9A 4K5ZA 1GWAA 5SGAE 4ABJA 1BTWA 1FIWA 5EQSA 1ZSKA 2FOGA 1PQ5A 1YBWA 4GVUA 4ZROA 3KIDU 3TJNA 2Z7FE 1KXDA 4B71A 1OWJA 1GI0A 3GCTG 5FCRA 2VH6A 1QFKH 1PQAA 1RXPA 3QGNB 2F91A 1SHYA 1KSNA 4ACAA 3BTWE 1CU1A 2OLGA 2QXGA 4X8UH 1DWCH 1G2MA 4YT7H 1O2TA 1S83A 5EIYA 2ZI2H 3RXJA 3P8GA 2EI8A 3H5CB 4KTUA 1BIOA 2JH0D 2XBXA 3TU7H 1SVPA 1O2NA 2K1QA 1AVGH 3QDZB 1C4U2 1MH0A 4X1QU 1YKTA 2ZPSA 2XOKD 1NFYA 1SPJA 2Y81A 1PQ8A 5A09A 4CRFA 1WQVH 7ESTE 1UCYK 1EXFA 3M5NA 1S81A 4Q7ZA 5CHAB 3IWMA 2A7JA 2STAE 4ISNA 1HYLA 2XNIA 2ZHFH 1AE5A 2G81E 3TJUA 1DOJA 5A0AE 1W0KD 1ZTKA 3PB1E 1JIRA 4NSYA 3CNRA 5EPNA 4U01A 3ODDA 1T32A 1YY3A 1YYY1 1H4WA 3FOAA 4U2WA 3MO6A 1C4V2 4IMQA 5EGMA 1Z8JB 2F83A 3SN8A 3ZVAA 4LOYH 4UFGH 3A84A 5BPEA 4GSOA 3UIRA 1GVKB 3T25A 3GY4A 3S0NA 1GBHA 4GPGA 5C0TA 2EQNA 1BUIA 1P05A 1E1RD 4XE4A 2PTCE 1B5GH 4ZHMU 3A89A 2FS9A 3GY2A 2Q1JA 4AN7A 4Z1MD 2QF5A 4Y8XA 1EZQA 4AX9H 2VWNA 4MPWA 3U8RH 4BXSA 3H7OA 4JK6A 1GBCA 1MTNC 2A7CA 1C5OH 2BD4A 2AIQA 4OS2A 1FAXA 1UCYH 1MTUA 2ZDNA 3H7TA 2BLVA 4MDSA 1WV7H 5DP3A 3ZZCA 1TIOA 8GCHG 2WPIS 1ZSJA 3MQKC 3LC3A 1CSOE 1PPBH 2FS8A 1P04A 5T6GA 3EE7A 1TWXB 2HVXA 1MTWA 1AKSB 1NPMA 2M2AA 2YNAA 5E8EH 2B0FA 4ABAA 3N7EA 5EJZA 3P8FA 3UAIC 2SNWA 3MHWU 3RXSA 1NT1A 1Y3WA 1S85A 1DWDH 3Q3KA 1GVLA 3RXFA 2Z3DA 1GJAB 1M9UA 3TPIZ 1MTNB 1AKSA 1KMHB 3LJOA 5C5OA 3V13A 2G51A 4Q7YA 1G9IE 2BDCA 2C8WB 3BTQE 3KNXA 1H8ED 5DGJA 1DY9A 2KZ4A 3ZYEA 1RJXB 4A1TA 1YP9A 2JH5D 2WPHS 1GJCB 3MWIU 5JBTA 1GBAA 3TJVA 4ISLA 1GMDG 3QK1A 3RM0H 4CBOA 1W11U 2FESH 1SOZA 1C2LA 2BLOA 1XUGA 3BEIB 4FU7A 5ESBA 2A4GA 1CVWH 1Z8GA 3QO6A 3ODFA 4Y7AA 3VB3A 3TK5A 1Y3UA 4Y8ZA 1TX8A 4O3TA 1DFPA 1VJAU 2KCOA 1CHOG 2VWLA 3P70B 2M5TA 1XM1A 1HAIH 2D8WA 4AFSA 3A82A 1TOCB 3OY5U 2WPKS 1TB6H 1O2QA 4JZ1A 3F9GA 3UNSA 5HKKD
chains in the Genus database with same CATH topology
2SNVA 2AHME 1TBZH 2VINA 2P95A 2ZC9H 1QL7A 1ELGA 1OXGA 2FI3E 1SGQE 5DK1A 1O2GH 2Y5FA 1H9HE 2Y5HA 3A8AA 3SJ8A 4WY3A 3SNEA 3UTUH 1EJAA 1KXAA 1NU7B 2ZG0H 1MD8A 2LPRA 3T62A 1KIGH 2C3SA 1P9SA 3RMNH 4HTCH 3QTVH 4FU8A 2WV5A 1DT2A 1WOFA 3U98H 1K1NA 4AB9A 1KDQB 3OEHD 2WINI 3PMJA 2A5KA 5I46H 1V2QT 4ZKNU 3FZDA 1OS8A 1AFQC 1EB1H 2Z9LA 4YLQH 5A8YA 1JXPA 1O5DH 2QYIA 2WPMS 2LNCA 1PQ7A 1W13U 4JZFH 2Y6TA 2R2MB 1KXEA 1O2SA 2BY7X 4RKJB 3ZZAA 3S9AA 1P57B 3CS7A 1S84A 3ZZ7A 1IHSH 1P02A 2XWBI 4K1SA 2ZCHP 1OKXA 1EZUC 5H4IB 3FN8A 5C1XA 1O2ZA 1T4UH 3NK8A 1RTLA 4D7FA 3HGPA 1SGDE 1V2ST 1HBTH 1EZSC 2Y80A 1BTHH 3EDXB 1GI4A 1V2WT 3CS0A 4MNWA 2QY0B 1BTUA 2NWNA 1T8OA 3RXGA 1H9IE 3Q77A 1QL9A 1HIAA 1K1OA 2CK3D 1ELVA 3MMGA 3WWFA 3HK6B 1UVOA 4B1TA 2XYAA 3PRBA 1HJAB 3GYLB 3V12A 4AB8A 1BMNH 2SGFE 3UR6A 1MKXK 1O5BB 4CRCA 3SGAE 1OX1A 4Q80A 1V2NT 2R0KA 2G8TA 3U1JB 2Y7XA 2ZFRH 4MVNA 2P3UB 1J8AA 1PYTD 3WWBA 1B7XB 5I25A 2BY9X 5EW2H 1XUFA 2V7QD 5BRRE 2ZQ1A 1QHRB 4U30A 1G2LA 1D3QB 4ZH8A 2TIOA 3E8LA 1AFQB 2BDYA 1Y3YA 3DFLA 4HZHA 1Z6JH 1QRWA 5TJXA 1TNGA 1SGRE 2BZAA 1A1RA 2BQWB 5HXFA 2JJ1D 3MH5A 4B2CA 3KL6A 4INLA 2H2ZA 5DP4A 1BDAA 2G5VA 3E16B 3KQEA 3OX7U 3P6ZB 3PM3A 3OU0A 3TGIE 1FZZA 2ODPA 3EA9A 4CH2B 4XBCA 3A8CA 6ESTA 2KCPA 1O3GA 3OSYA 7KMEH 2ZDVH 1YC0A 2OK5A 1YLCA 2BLWA 4CRAA 3ZVBA 3A86A 5C1UA 3A81A 3N7OA 1QGFA 1IQFA 2CV3A 3DFJA 4ABEA 1W7GH 3ATLA 1NBMD 2FODA 2G00A 1A7SA 2Q6FA 1ZJDA 1Y3VA 7LPRA 2VIDA 2FI5E 3SI3H 4K8YA 1BRAA 2H5DA 2ZU4A 4GHTA 4CHAC 5FX5A 1FY5A 2TRMA 3LGTA 1TNKA 3T5FH 2BY6X 1THSH 3E91A 1UVSH 3LT3A 4JYVH 1F7ZA 3LH1A 4A6LA 5ABWA 3W94A 1BA8B 2KAIB 2W3KA 4OS5A 1AB9B 2CHAC 2TGDA 3MO3A 2IJOB 4NIWA 2KCYA 1O3IA 1O39A 3WY8A 1WU1A 1GMCG 2OTVA 1O36A 2C90B 3O8BA 1LO6A 2BLQA 1V2VT 5E0HA 1PFXC 2VU8E 4WMDA 2DE8A 3TH2H 5T3HA 4TPYA 3RXIA 2H1UA 1O2HA 3ENSB 2GV6A 5JYIA 2ZDKA 3SU0A 3PTBA 1UK4A 1C5QA 2GVFA 4Y7BA 4CH8B 2RDLA 3BTHE 4SGBE 2GCTC 1O5GH 1GBLA 3LGWA 4Y10E 2QF3A 1SI5H 2C8XB 2UUJB 3SGBE 3UNRA 3Q00A 2WPLS 2PWXA 1C2DA 4UDWH 1THPB 4D9QA 4NG9H 4Y8YA 1DANH 1UTPA 3BF6H 1AO5A 1O3PB 4GHQA 1ID5H 1C1SA 3RMOH 2A5IA 1UMAH 1OWEA 1Z8RA 1W7XH 5DP9A 1VR1H 3RXHA 3E90B 1A5GH 1ETRH 2O8MA 4B6FA 6CHAC 4CRBA 3BEFB 5FAHA 3T26A 1QB9A 1OOKB 4NIVA 1EKBB 1AZ8A 2OC0A 1TPPA 3GY8A 3URCA 2XTTB 1MQ5A 3O8DA 2FIRH 2ZDAH 4U32A 3SJOA 4WWYA 3GCHC 1C5SA 3A83A 5DKMA 2NU0E 3O8RA 1WQSA 2I6SA 4DVAU 3ZIAD 2PTNA 1NRQH 3PV5A 2CXVA 1KLTA 2HNTC 3DSPA 3I78A 1S5SA 3U8TH 2VIVA 1LKAA 3SHCH 2ZA5A 6CHAB 4X0WU 1O2PA 4Y11E 4H6SB 1GI9B 1A0HB 1BMMH 1SFIA 2J38A 5E2OA 3T28A 3E1XB 1VITG 1P12E 4Y6DA 3SORA 1EASA 1GBIA 3O8CA 2CJIA 3GICB 1FUJA 1ZMLA 2VVVA 3LGYA 4FETA 3UB0A 1F0RA 1MAXA 2ZU5A 3ESTA 4ABGA 3SNAA 2ZCKP 1SSXA 1TLDA 1W10U 5C3NA 3BN9A 2PFEA 1TA6A 1SR5C 1HAVA 1WXRA 3MU5A 4WXIA 4F55A 1O3NA 2HLDD 1BTYA 2H6MA 4MPUA 1DX5M 3S69A 2L6OA 2DE9A 2KCAA 4FUGA 5GPIB 5A2MH 3ATWA 3KF2A 1YPGH 1C9TA 1H1BA 1AB9C 1JRSA 2TGTA 1TX6A 1E35B 4X1PU 5JBAS 1OYQA 1GVZA 1AQ7A 2JETB 1SGCA 1NTPA 1E79D 1HLTH 3H09A 4O97A 1XMNB 3VXFH 1Q31A 4X2YA 1KYNA 4KGAA 1YCPK 4TPIZ 3GS9A 4IS5A 2AERH 5FX6A 2XRCA 5B6OA 1MKWK 3BTME 1F5KU 3ZVCA 3M61U 4X1SU 1EZXC 1EPTA 1C5LH 1RTKA 4LZ1H 1DPOA 2ZU1A 4HI3A 3K6YA 1UTQA 3A8BA 5HM9A 3QGJA 1TMUH 4X8TH 3S9CA 1HAVB 5EODA 2OP9A 3PO1B 1J16A 4BNRA 2DUCA 4JZDH 4YT6H 4E7RG 1F0TA 1NRPH 5EOKA 3MNXA 1GHAG 1VITF 2V0BA 2AMQA 4XD7D 2PSXA 3F0PA 1SC8U 1IQMA 3BTDE 1SQAA 4IC5A 1YPKH 1S0RA 2ZU2A 1O2VA 2JETC 3TK9A 3RXCA 4TSFD 2ZKSA 1SGEE 1AI8H 4FUJA 1CE5A 2BB4A 2J34A 1Y5UT 2WPDD 3GY6A 4WJG2 3NWUA 1C5MD 2GTBA 5L6NH 3N99A 3LC5A 4DCDA 3MFJA 4I32A 5FXLA 2WYGA 4NA7A 1SLWB 2ASUB 3K65B 1UTOA 1P2IA 5EXLA 2VH0A 1S0QA 3SJ9A 1W0JD 2P94A 5LPRA 4I8LA 2QE7D 1G3BA 3RXDA 4X1RU 3MH4A 2KM0A 2VJ1A 5AFZH 1PPFE 2TGAA 3I29A 4ASHA 2ZU3A 1QTFA 5T6FA 3HK3B 4XFQA 2QXIA 4ZKSU 4BAHB 3SO3A 1HAXB 1OYTH 1S82A 3A87A 3ZZ9A 2PLXA 2ZHWH 4A5TS 1HJAC 3OY6U 5G4BA 4BANB 2GT7A 4X8SH 1BMAA 3LONA 1IQGA 3F9EA 4NFFA 2AFQB 3BTTE 4AGKA 1L0ZA 3TITA 4BTUB 2HPPH 1BZXE 1AHTH 1DUAA 4NSVA 1D4PB 2A31A 1VJ9U 3VFEA 4ABIA 1A0LA 1NESE 4X8VH 3DA9B 2HALA 3MH6A 1EAXA 3T29A 3DT0H 1KXFA 1VGCB 1PJPA 1C1TA 1YF4A 2YMSC 1DSTA 1Y8TA 4A92A 1ZPBA 3SU1A 1XXDA 1QJ1B 2Y82A 3EAJA 3S9BA 3TLOA 1EP6A 1AN1E 1DDJA 2I6QA 1CT4E 4AG1A 1GL0E 3ATMA 2UWLA 1O2RA 3GCOA 2OD3B 4H6TA 1QJ7B 3RP2A 1UHBB 4AFZA 1IOEA 1OWIA 3UWJH 1K28D 2RCEA 3ZYDA 1ORFA 1KTSB 1HCGA 4I8KA 7GCHF 1A46H 3RXUA 2GKVE 1Q2WA 1EAWA 2UUYA 3FKSD 1C1RA 1O5CB 1XVMA 4JCNA 1O3OA 3M3SA 2AIPA 3UOPA 1NO9H 3ZVFA 3W1EA 1E38B 1MBQA 1N8OC 2FZZA 2G5NA 3AAUA 1FPCH 2GZ7A 3V7TA 2KAIA 3E0NB 1NM6A 4YXWD 2ZP0H 2P3FH 1QA7A 3MU1A 4K69A 4YOIA 2OINA 3UY9A 1W3CA 1O5FH 4CRDA 1UTKA 1HUTH 4DURA 2SGDE 3VB5A 3DCLA 4YESB 8KME2 1T4VH 2UWPA 3SV9A 5J4SA 3RXPA 4D8NA 1IQJA 3BSQA 4GCHG 3A80A 4IMZA 1P2NA 2YMSD 1FV9A 3A7XA 1K9OE 5TCAA 1EJNA 1MKXH 4UFEH 1GG6C 1GBBA 2Z9JA 4ZCNA 1HAGE 1K21H 1SGFG 4JYTA 1SG8B 1BTPA 1V2MT 2SFAA 3OTJE 1GBJA 1BRUP 1C2EA 3MI4A 1CHGA 2EA3A 2YMSB 1C5YB 1FMGA 1K2I1 3M3VA 1BT7A 2BD9A 3Q3YA 5DPAA 5E2PA 3K9XB 1FONA 1KLJH 1B0EA 1FY1A 4Y0ZE 3ELAH 2GZ9A 1P06A 3STIA 1VCWA 1O3KA 3FFGA 3RC6A 1FIZA 3RC4A 1TABE 1NFWA 5C0UA 1ZTJA 1L1NA 1P3CA 1DXPA 4KELA 4Y76A 3RXOA 4YOGA 1BRCE 3SUFA 2XNDD 1V2KT 4CR5A 2WZQA 1IQEA 3ZZ5A 1MU6B 2NU3E 1NN6A 1NFXA 1Z7KA 2J4IA 2GCTB 3SZNA 1N6XA 3L33A 4ZXXH 3KHVA 3PROA 4A1VA 3SNCA 2OBQA 1G32B 1TRMA 3PLPA 1F0UA 1YCPM 2BOKA 2O8WA 1LVYA 3TH3H 2ALVA 1TQ7B 2GCHG 1FLEE 3UQOA 1WCZA 3M36A 1ESTA 2A45B 1ACBE 2CF8H 1EJMA 1LCYA 1TYNA 3TH4H 4YTAA 1BTXA 2TBSA 3GCNA 3ZZBA 2AYWA 4O3UA 1E34B 1O0DH 3B23B 2XCNA 4BAOB 3RMMH 2ZNKH 8ESTE 1IQNA 2HPQH 1TAWA 2A0QB 1C5TA 1SGYE 1ESAA 1H9LB 1C5VA 4DJZB 1VCPA 2ZGHA 2OC8A 2XC5A 1HXEH 1Z1IA 3LPRA 1C1QA 2Z3EA 2AMDA 2ZECA 4IW4E 2PKAB 2O9QA 2BVRH 1P01A 2FWWA 3C27B 3PTNA 5C5NA 5PTPA 3PO1C 4ZHAA 3BG4C 4RSPA 3VGCB 4NA8A 1GBMA 3SBKA 1Z71A 3UWIA 1P2MA 3VG8A 2ZHDA 3GCTF 2KR7A 3STJA 3TVJB 5GWZA 5E0JA 3ATIA 1EQ9A 1IQIA 1SBWA 1GDNA 1FN8A 1NBME 1BHXB 4UEHH 1MBMA 3KQBA 4CR9A 1HDTH 4ZUHA 6GCHF 1EPTB 1SKYE 1ANDA 1HJ9A 1UK3A 1MCVA 1O3DA 2Z6BD 2FPZA 3OFND 1BB0B 2G52A 3R0FA 3UPEA 5ESTE 3RXTA 1INCA 2NU4E 3U69H 1NRRH 3M5OA 4WMFA 3F0OA 5FBEA 4FUEA 1O2JA 4OS7A 1RD3B 2VWMA 1IQLA 3TJOA 1CA0B 1TPAE 3BEUA 4MLFB 4B6EA 1V2PT 4OS4A 1HIAB 2BDHA 5EQRA 1T8MA 1HGTH 2FEQH 2RG3A 2A1DB 1BJVA 1P2OA 2BD2A 2QF4A 2TGPZ 5FPTA 1E1QD 2BDBA 4NFEA 1JIMA 2ZDLA 2ALPA 2ZGXH 5CMXH 2H9EH 3MU4A 2GDEH 4GAWA 1L4DA 3RU4D 6LPRA 1LHCH 1V2UT 3QN7A 1RFNA 1DXWA 1LDTT 2WUCA 1SGNE 1XKAC 4I8JA 2SGAA 1L2EA 1LQEA 2V35A 1TGSZ 3MO9A 3RU4E 2FP7B 4DGJA 2RA3A 1ZR0A 1UTJA 2A2XH 2OBOA 1K1JA 4MPVA 1Y5BT 3LOXA 4Q63A 4BTIB 1GL1A 3N7DA 1C4Y2 1EATA 1ZJKA 2ZFQH 1CGIE 1LHFH 2FOAA 1HNEE 4BAQB 1A3BH 2HNTE 1EUFA 1K1MA 3UUZA 3SU5A 3M35A 3F9FA 2XBVA 1GI3A 3BTFE 2HWLB 1GMDF 3PWBA 2VB0A 3QWCH 3RDZA 4MNVA 1ZSLA 2FI4E 3ZVGA 1ZRBA 3TIUA 1GDUA 5B6LA 4B2AA 3BTGE 4RKOB 1O33A 1TE0A 5A8XA 1QRXA 3URDA 4ABFA 2UUKB 1J14A 1A4WH 5FCKA 3NKKA 1GHZA 1TBQH 1YPMH 1GCDA 5GDSH 4M9FA 1MCTA 3EYDA 4E06H 1GMCF 1MUEB 4CBNA 1TPOA 1WUNH 2J95A 4LZ4B 2JJ2D 1TX7A 2A4RA 2YNBA 4A1XA 3M5LA 1O2IA 3QZQA 2R0LA 1GI1A 2VNTA 2AGGX 2UUFB 1FAKH 2Z9KA 1P2JA 2ZFSA 3SUGA 4INKA 2BM2A 4X2WA 3MYWA 1C5PA 5ETXA 7GCHG 5TCCA 3HKIB 3LGUA 3M5MA 4Q2KA 3MH7A 2FDAA 5DG6A 1S6LA 5FHTA 2AGIX 4WH8A 1ELCA 1OPHB 1IQKA 2J2UA 1QY6A 4I8HA 2BMGB 1C2MA 3L3TA 1XUKA 3OAAD 1GBTA 4ZXYH 2CMYA 1QB1A 3ITIA 3RU4T 1F0SA 3NZIA 4AFQA 1AUTC 2Z3CA 1UVUH 3F68H 2F9NA 1W14U 1UHBA 3RXLA 1EOJA 2A5AA 3LU9B 1SQOA 5LPEA 3SV2H 1O3LA 1PPEE 1UVPA 2BX3A 3GY3A 4X6NA 4WXVA 4GLYA 4E05H 1P2KA 2ZHEH 3TNTA 3D65E 1K1IA 5E0GA 1DWBH 3A7ZA 2BDIA 2XC0A 4CRGA 2FM2A 2XBWA 4UFDH 1O2UA 5GNDA 4DIIH 3F6UH 4A7IB 2B5TB 2KFWA 4UD9H 2W3IA 2P8OC 4IN2A 1DY8A 1ETSH 1MAYA 1VGCC 2ZTZA 4I8GA 4GUXA 4OGYA 3GDUA 4I33A 1E37B 2ANWA 4AFUA 4D76A 1ZRKA 3PV2A 4XBDA 2XWAA 2BZ6H