3L6RA

The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
319
Chain Sequence
AQYDISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFIRGALNAVRSLVPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Serine racemase
total genus 110
structure length 319
sequence length 327
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2009-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6rA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6rA02
4D96A 3VBEA 1TYZA 1TZ2A 4D9NA 3L6CA 4D99A 1KFBB 4IL5A 4AECA 4D9IA 1A5SB 2DH6A 4PCUA 1KFCB 3IQIX 4ZU1X 4QYSA 3PC3A 1J0EA 2PQMA 1K8YB 3RR2A 3FGPA 5KINB 1J0DA 1V7CA 2ZR8A 4D8UA 1A5AB 2GN0A 5D84A 4COOA 3VSDA 5IWCA 1K7FB 3IQHX 3L6BA 4I1YA 3TBHA 2RH9B 2ISQA 3AEYA 1VE1A 4Y6GB 5CVCA 3HMKA 2CLOB 2ZPUA 4OREX 5DW0A 5EY5B 1TTQB 5I7HA 1Z7WA 5DBEX 1K3UB 1BKSB 1PWHA 4LMBA 2CLMB 1KFKB 4L28A 5I7AA 3V7NA 4D9CA 2CLIB 4LI3X 1TZJA 1TTPB 2DH5A 3PC2A 5I7OA 5J5VA 3DWIA 1KL7A 4ZQCB 1WKVA 2GN2A 4NEGA 4L27A 1Z7YA 5I6DA 1D6SA 3VSCA 1P5JA 1WBJB 5D87A 3PR2B 2J9ZB 2TRSB 5I7WA 4LMAA 5DW3A 1WTCA 2D1FA 2ECQA 5B3AA 1KFEB 1QOQB 1CX9B 1K7XB 2EGUA 2Q3BA 2RHGB 1E5XA 2GN1A 5BW6B 1K8ZB 5D86A 4HT3B 2ZSJA 3SS9X 3CEPB 4HN4B 1C8VB 2BHSA 4L3VA 4D9FA 2O2EA 1TZMA 5KZMB 1FUYB 1J0BA 5B36A 4D8WA 2TYSB 2Q3DA 1FCJA 4WX2B 4D9BA 5I7RA 3VSAA 4D9EA 1UINA 1K7EB 4JBLA 1J0AA 1JBQA 5J43A 2CLFB 4L0DA 1A50B 3FCAA 2EFYA 1O58A 2C2GA 3PC4A 5HBGA 1BEUB 2ECOA 1UIMA 1M54A 1F2DA 3IQGX 5JISA 3ZEIA 4D92A 1OASA 3SPXA 3DWGA 5CGQB 3IAUA 4D9GA 2O2JA 1TZKA 2J9YB 4F4FA 5B1HA 1C29B 2C2BA 4NU8X 1A5BB 4HPJB 5B53A 3R0ZA 3SS7X 1WDWB 4JBNA 2CLLB 1V8ZA 2JC3A 5IW8A 1CW2B 3L6RA 3X43A 4OFXA 5D85A 4AIRA 3R0XA 5C3UA 4ZU6X 5DVZA 4HPXB 1VE5A 1TDJA 2CLEB 3BM5A 1VB3A 1K8XB 2CLKB 2Q3CA 1UBSB 5IXJA 2J9XB 4D9KA 5E0KB 5T6MA 5B1IA 3X44A 4D97A 4D8TA 2RKBA 4HO1X 2BHTA 5DBHX 1J0CA 3AEXA 1Y7LA 1TJPB 3VC3A 5B55A 3DKIA 1RQXA 1QOPB 2V03A 5JJCA 1V71A 4XUGB 4D9MA 1X1QA 1C9DB 2TSYB 4KKXB 2CLHB 1KFJB 1PWEA 3T4PA 2WSYB 4H27A
chains in the Genus database with same CATH superfamily
4E5PA 3FHCB 4R9NA 3I39X 3VTKA 4EG3A 2DZDA 4YN3A 2QTHA 3HKCB 1WUJS 1X70A 2NV6A 2IQ5A 2GM9A 3N0XA 4XR9A 1JWLA 4OQZA 1GXSB 3BXHA 3FPAA 1PVOA 3N07A 2NSYA 2PSJA 2W58A 3RASA 2VZ0A 3WKEA 2GKOA 1JYSA 4EELA 1VL2A 2QXTA 1GSOA 2VDLB 3EGVA 3MWEB 4HH1A 1N2OA 5IN4A 2Q1SA 3BF7A 3G2IA 2LVBA 5ISMA 3WY9A 4N0EA 3TQQA 4XLLA 5IVKA 2QRUA 2ZJFA 3ZCQA 4C04A 2GB4A 5GM2A 1W30A 1Z3CA 2Q5FA 4QU8A 5ARDA 4D6XA 4RKEA 5CIYA 4QM6A 4P35A 2VQSA 3FRJA 3NYQA 1UAAA 1EGVB 4U63A 1QPZA 1PZXA 3L79A 1OXUA 4D25A 3OCWA 3UC5A 4GOMD 3ZX4A 1ABBA 5B4VA 1NF9A 2QPTA 1I3CA 2CJFA 4A0FA 2DTDA 1PW7A 4EARA 3LX8A 5D7BA 5CLFA 3BMCA 1AKMA 3K1YA 1GKLA 3G8DA 2J9FB 5I4BA 2O2HA 2O5EA 2VWHA 1PQPA 5C34B 4YDSA 2ID7A 2BFNA 3U3MA 5KCZA 2PLFA 4EKYA 1KSFX 2QW0X 4CEHA 2VK4A 4JJEA 3WLNA 5JALA 2A88A 2B6HA 2AUTA 4JJ8A 3OBBA 5JDCA 3EIHA 3T35A 1OFTA 2D7JA 2PKEA 3H83A 4F9EA 2P90A 4YFVA 1KGSA 2F62A 1F7VA 2C1ZA 4TTPA 1G21A 2E85A 1I2AA 4NYIR 1DAEA 1JA0A 5T3UA 5HM6A 4LGYA 4DV2B 4B6RA 3WB1A 3N2GB 4EYSA 2HW8A 2OCAA 3JVEA 4ZGBA 1GZ4A 1S5PA 1WVIA 1D2CA 3AF5A 3H18A 1A95A 5IDYA 5SZHB 3TH5A 3X1YA 1IU9A 4D82A 5KOJB 2F64A 1XZKA 2A59A 4YPFA 2IYLD 4RCYA 1TIBA 3NATA 5CLQA 4UCXA 2YQ5A 4QFDA 2PKWA 4BBAA 4OYYA 3PUIA 4RH1A 3CA8A 5EFZA 2GN9A 1AS3A 1QHGA 2O06A 3B89A 4EITA 2EDAA 2XUDA 4WT7A 1K08A 4CKZA 2OP0A 1EVZA 3ZGZA 3O31A 5J2UB 1GPUA 2C2OA 5AWFC 1X1TA 1NATA 4EB6B 4Y18A 4HVCA 3GGDA 1VJGA 3OJEA 4RIEA 4BU1A 3KJFA 1A5BB 1C9MA 3R0IA 1IY0A 1G63A 3KLBA 3A25A 3GBSA 1N0UA 1T8RA 4RE6A 1JI0A 3TFQA 1PSZA 4O33A 4MO9A 1N77A 3U31A 4J29A 1Z6TA 1E1QA 3NH6A 2FPPB 4NCBA 2F8SA 2AFVA 2ZUDA 5KYUB 2NZ2A 3SD7A 4U3JB 2J67A 2O5VA 1Z0JA 3LTEA 1EFRD 4OI2A 3RYHB 6NULA 1B0PA 2PL1A 3M6AA 5IH7A 1KEVA 2DQSA 5LP6A 1E4EB 4KO3S 1YI8A 4DMCA 4ZN6A 1C0LA 2CHEA 3JRWA 4Z0HO 2P9EA 2V55B 4G09A 3IRUA 3NDPA 1KMHA 2V03A 2LZ0A 5FWAA 4YCSA 2ARKA 4K6MA 4OHVA 3PX2A 1Q0ZA 5LOVB 4ND8A 2CLHB 4BO6A 2WIGA 3SSOA 3VO1A 2PYDA 1YZGA 3S27A 2QE7D 2JGLA 4LRSB 2XUJA 3L84A 2PRSA 2BFAA 1M0SA 2EWMA 2NGRA 4GZMA 1E3MA 1S96A 2DKNA 2PMFA 4D9IA 3EWAA 4Z7NB 5JAMA 4J7CA 3UJ8A 4B3RB 5DYTA 4UNQA 3MUFA 5E8JA 4Q9JA 3L6OO 1J0EA 5J1SB 1QFZA 4UBOA 5TQJA 4GXQA 1SPXA 4F5ZA 2QX6A 1L4UA 2PDAA 3R0VA 4RH0A 5EXSA 1ISRA 4JLNA 5E0OA 5K0SA 3S2ZA 3AEYA 4WCDA 4S1VA 3W8FA 2YNMD 3UWSA 4DNXA 4QZVA 4NAUA 3F5DA 1VG8A 3CZ9A 3SDZA 4LI3X 3TAUA 4DE5A 3DE2X 1UZMA 2WM9B 3GCZA 1E2FA 4ZKDA 4K1LA 1FMJA 4BX3A 1EH5A 5C1IA 1E3EA 4YX9A 1QYIA 2AG1A 4V1CI 2BKAA 3A37A 4RL6A 3S70A 2HT6A 1YQXA 1T3HA 4NAHA 4N65A 4K1XA 1E4YA 1UBMS 1VPLA 2Y9MB 1BXKA 3LT2A 3LGAA 3S5UA 3ZV4A 1VDMA 4MTCA 1M0TA 5AOBA 3ZZUA 4ISCA 1XD8A 3DE3X 4K6OA 2B1RA 3TFOA 2XQIA 1L3CA 1LVUA 5DSXA 4F4DA 4I50A 1MC4A 1SWVA 3AHIA 2EJWA 1VCHA 2IX9A 1CR1A 2PHZA 1Q19A 1IWBB 1WHSB 1T25A 2D2XA 5ITZA 2W6IA 2FH5B 3CGWA 3OFNA 4F46A 5MN6A 4QOJA 5J47A 3Q15C 4PAWA 3JQ8B 3MWEA 4HZGA 3UBTA 2VAVA 1WCV1 2FG6C 1ZAKA 2KX7A 4M98A 5J4LA 4LHZA 5C53B 4JBWA 4BB9A 3ZY3A 1GZDA 3LT1A 4YMHA 4PYRA 4HUQA 1O1YA 4MW9A 3E7PA 5LYJA 1I5EA 2VYVA 1K97A 4DPLA 5AM3A 1IDN1 1LF0A 1UUFA 5C8DA 2P91A 2RAUA 2J09A 3C14C 2G36A 3FYUB 1PWXA 3L4JA 3IUPA 4R41A 4DQVA 2BR3A 2FSUA 5EZQA 1WIWA 4CMJA 2G1JA 5EKDA 4O5OA 1MO2A 3IUQA 4RGYA 5A6VA 3ORSA 4YHHB 2GZHA 2ISCA 1RHRA 1Y1KE 5AHKA 2PO7A 2V9PA 4F9GA 3OZSA 1OV4A 2PH7A 2ZIAA 5KYYB 4LX0A 4N3NA 3MZ0A 4HDKB 1U2QA 1Q50A 1GARA 2I7DA 3B2QA 4L4XA 1XX6A 1E99A 1VLQA 3SI7A 2VJYA 3KR9A 4G8CA 4MUHA 2HDHA 1QP7A 5CNKA 1I94B 4CJXA 4GVLA 1AKYA 1S3FA 4TLLB 3KCQA 3C39A 4BVJA 4MQEB 1SCKA 1AUOA 4NE7A 1DJNA 1BS1A 1GCUA 4ZP1A 1H05A 1HBJA 3KFXA 1SUWA 2X9QA 3RWBA 1IZYA 2IHTA 4WJLA 2H16A 4DIDA 4NK5A 1SO8A 4AFNA 2AI3A 2CD9A 3NEPX 3MFQA 1G4UR 1LQ2A 1ZIDA 3BCUA 3IO3A 2QJRA 4RKWA 4BNVA 1AHHA 3I58A 4AY3A 3AVPA 3GLRA 5EPUA 5E3HA 4HWSA 1YR3A 4OA5A 1U9YA 5GADl 1T4CA 2BTEA 4BUCA 2C5GA 4N5MA 1JQAA 3ZZMA 3AZOA 1G17A 4IGEA 4L1KA 1N1MA 4MR7A 2NM0A 2O3RA 3QA9A 5K4GA 1EUDA 1HNNA 4FR0A 4X20B 1CR2A 1T2AA 2W2PA 3IEXA 1WV0A 2QJFA 3PITA 2ZOSA 1VA4A 4LRYA 4IDCA 2FPXA 1TO6A 2YVLA 4F9TA 5ABPA 2X4LA 4Q9KA 4ZO9A 3MGGA 4POOA 5A4DA 1B2RA 2WU1A 1N6LA 1XJ5A 4EOGA 3PQ3A 5MF6A 2ZPUA 3HU3A 4B3HA 2CV0A 4ENRA 5CCBA 1I5OA 2ZRNA 4UTRA 5ILQA 1WUIS 2NVBA 4OK6A 1P1JA 3L0BA 3K96A 4ZDJA 3UMSA 4E09A 1I30A 2MSLA 2P30A 4PPQA 2P35A 4HXYA 4UEJA 3KHUA 2XCSB 1TU4A 1XMVA 2D5IA 3L7DA 1WV1A 2KW5A 4UQPA 2QZPA 1Z26A 2AZXA 2MCFA 3TUZC 1A77A 4TSRA 3GJ8A 1MGOA 1QVRA 4JK3A 3EW7A 4HQKA 3UK1A 5IZ4A 3RIGA 1SZPA 2Q2WA 1J1IA 4ZT2A 3TRJA 4IRUB 3OZIA 4AJKA 5LQKA 3Q9NA 3EAFA 4FZVA 3UT5A 1NBHA 1GPNA 1AB5A 4ZAFA 4A8JC 4MV7A 1F7UA 3HLKA 4O08A 1UMCA 2ZSJA 4IGKA 3DAFA 4INOA 1AXEA 3K72B 3NFYA 3GRKA 4QYIA 1ISIA 2ZLBA 1RM0A 4S1NA 1BCRB 4JCCA 1B73A 4FEEA 3ECCA 2H9IA 1MZVA 3Q7RA 3KYCB 5GONA 2H06A 3QBTA 5DE3A 2P68A 3KR1A 5CAEA 2I80A 3NKLA 4JI8B 3R6GA 4YQFA 2Q99A 1QYRA 2WHPB 4PLTA 1CTQA 2UV8A 3I76A 4MRAA 1TIPA 3H16A 4IIFA 1IE3A 1CZOA 2L17A 3C5VA 3ZR4B 4CI0B 1Z5GA 1DG1G 2OC9A 1MJGA 4OGKA 5D6NA 5A9SB 1DIOB 5DX0A 3WA6A 4AKGA 1XB2A 2BJHA 1I4OA 2ID4A 2SICE 2GGSA 5CIQA 1ZJ6A 1Z6AA 3G6WA 2I6QA 4G5HA 4PEVA 1DAFA 4KITB 3QY9A 1TT7A 2ZIFA 3CF2A 2R62A 5CH3A 2XYGA 2MR5A 5DHUA 1FTGA 1PKXA 1ZK2A 2GBCA 2VTBA 1X42A 4Z4HA 4C0KA 2O8NA 3M6MD 5SZJA 2X2EA 2FB9A 3O21A 5JCJD 3LHFA 4R6WA 4KN5A 3NP9A 3HKEB 3SU8A 1C4WA 1PGOA 2BI4A 3R41A 3Q87B 5NLLA 4AMBA 4KO8A 2BEVA 4P4SA 3WJAA 2W48A 4EQ6B 4J94A 1OXTA 3FDJA 1OROA 5EE0A 5IWAB 2WKSA 1SNYA 4HTFB 1CRZA 1X87A 5JHGB 4DUZB 2GCOA 1NBWB 3ELBA 3FWNA 5B30A 2P9ZA 1W0JD 5LR6A 3AIOA 3C4QA 4CHGA 4AZ3A 1TCCA 1DAKA 1XD2A 4MINA 3B78A 2ZIGA 1LI4A 3QWHA 3IMEA 2XTAA 5DP1A 1ULBA 5FWXB 1HDZA 1SXJE 1KKLA 5J9FA 1JKXA 1H65A 4B3IA 2FVYA 1FB5A 3DE1X 3ETLA 4J3FA 3RVJA 4WY5A 1P73A 4KX3A 4AG6A 1AGXA 3ETGA 2JLRA 1SBHA 3ZXIA 1JWAB 1YZTA 1MX5A 1WAMA 4XGIA 2MSEB 2P3LA 1SU7A 2AMFA 4JWTA 5CLIA 3V48A 3ROEA 4J6EA 5JMWA 4L07A 5DZSA 1QONA 2EFGA 1NQTA 5CA0F 5I4KA 2RH5A 3DPSA 2GTIA 1GPBA 3LDHA 2OGTA 3Q0IA 1K68A 1W6RA 2G63A 3SC2B 1U81A 2B92A 4RETA 1N5IA 1XU9A 1GFZA 1KFKB 4CODB 3V7YA 2CV2A 4EJ0A 3CRW1 5FO0A 2X8WA 1B3BA 1E3TA 4MV8A 3PYMA 1FVOA 3AERB 3QX7A 2HN9A 3O9MA 2C4HA 2JFUA 3RREA 4Q4CA 2H85A 4HQLA 4S2EA 3QIVA 4PYMA 4WFKA 1FLAA 2IHZA 3RAPR 4D81A 4UD2A 4CQMD 1YULA 5DBFA 1P3Y1 4UPDA 4MVWA 2XOEA 1ISJA 1FMTA 2WFAA 4JN6B 2I6GA 1L4LA 1XMJA 4JYAB 1I7QB 4M0KA 3KJEA 3UMCA 4DAEA 1UBUS 2QU7A 3QF7A 4ML3A 2GD6A 2BM0A 1ZLYA 1JA1A 4CF4A 2ZJ7A 1RQLA 3N59A 2RC6A 1U3UA 2GWHA 5ALFA 1DKOA 4OHXA 3DVQX 3DYVA 1P72A 5DT9A 1ZO8A 1II8B 3QYJA 4MLZA 1X9HA 3EA0A 2QSZA 3QG1A 4I8XA 4FWBA 2G8LA 3LFHA 5E4TA 3AF6A 1TM5E 3W77A 3V00A 3F9IA 3OFJA 5CVTA 4ZZ0A 1QO0A 1XDWA 2AG8A 2HADA 2A0KA 4OSOA 1VKJA 2DPHA 2RE8A 2BL4A 4PGGA 3RU7A 1L4KA 1NJ8A 2WJPA 2YVUA 3BJIC 1TLLA 2DBQA 2VSFA 1TQ4A 1YU6A 1SVWA 1F20A 2DWOA 1UT8A 1DC7A 2GLUA 1QV7A 2XMCA 4RY2A 4WSOA 4WXRA 1G4HA 5EEHA 5K2MA 5BNWA 2CJWA 1QR2A 3M5WA 3OUUA 4XW2A 2YZGA 4EGSA 4DDKA 4U7HA 1GTJ1 2ZE6A 3GFQA 1DBRA 1A8HA 2QI9C 4YCCA 2GFIA 1TKRA 2CGEA 4LXHA 4ICIA 3ILVA 1ZMTA 1SXPA 1EUDB 1XCJA 3L77A 1R15A 3DAGA 4NDAA 1DOAA 4PNEA 4PU0A 4CWAA 1KRHA 2FQQA 2IDMA 3UWDA 3DDZX 4PCLA 1T1SA 1GAJA 2VRNA 5C3MA 5HFNA 3T7SA 4MITA 3DHYA 4C7OB 1YRAA 4RIGA 4CKWB 2P2GA 5D3MA 2FSHA 1XLVA 2P0YA 3ANXA 4WAUA 2IS1A 4YMIA 4GZ5A 1Z06A 1E32A 2XT9A 1CZRA 1BCRA 2H5JA 3PQ5A 1LFDB 1JJBA 4QYTA 2GJ9A 2PS9A 3QEMB 1MB0A 2YKGA 2PWBA 3IKMB 3LUFA 1PK9A 3C24A 4BX0A 5CK5A 3WIDA 4I8IA 3I53A 4ZT5A 5ITWA 4WV3A 5KVSA 1Y5LA 5H1YA 4YNBA 3SR4A 1UJBA 4B32A 1VOTA 3DT6A 2EAUA 2XAAA 1DX6A 5B5SA 4HNRA 2NZVG 4K2HA 5CA0B 3ZTYA 1SEPA 1UMDB 1XQYA 2BEWB 5DK4A 3QKUA 1ETHA 4BP3A 3IAS6 2R85A 3AONB 5DBIA 4GXNA 3WRXC 2FKNA 4A36A 5LNK6 4JI2B 1M2OA 1EBFA 1LI7A 3UHAA 1NNLA 3Q9SA 4HDKA 1QKJA 3DFZA 3MYYA 4LY3A 1UFOA 1D2AA 2C4UA 3IE2A 1WZ2A 3UFXA 3CNEA 4FGLA 4HXFB 3E2PA 5F3WB 3VSDA 3IRVA 3RRYA 4MQ4A 3F6BX 4GX2A 2W2XA 5CVVA 2FMUA 2WY2D 3HA7A 1LEHA 4U2BA 8ATCA 4PVCA 3I64A 1UP7A 3OPXA 4C0BA 2BTQB 3TEJA 2GH1A 1XPOA 2QW8A 3DE0X 1N9KA 1YDFA 1ZMRA 3D7MA 1GAXA 3N75A 4QGGA 2UYCA 2JCXA 4X8MA 4GM1A 1LK0A 4HQRA 3ASYA 3R7FA 4ZQCB 1N1GA 3LUAA 2HA4A 4C22A 1DX9A 2BFDA 4N7BA 3OT4A 1H2YA 1MB9A 1YBAA 3RIMA 2YZKA 3BHMA 4A10A 5SY9A 1EFPB 1KYWA 5AUOB 2N1MA 5J40A 1LX6A 2WG1A 3H9QA 5IF3A 4ZWNA 2O2DA 4EHFA 3QMVA 4L76A 2B1JA 3CGGA 2R68A 1GDDA 4KZPA 1U94A 5C8YB 1Q0QA 1XN1A 1JG7A 5BY2A 1LRJA 3GEGA 3JRNA 4CLOA 1LPPA 1T2NA 5K8VA 4Q00A 3HUDA 2Q7OE 4XUDA 4EHBA 3P9YA 1LF5A 5KAPA 1P9RA 2HLPA 1EFTA 4W5WA 1S2MA 1GL7A 4LZNA 4OI0A 3QPUA 1OSNA 4MS3B 3E2MA 4JR0A 4UJ3A 4EQ6A 2ZRGA 2XWQA 2Q27A 1YCGA 2AD5A 3EODA 3W1WA 4UU8A 1ZNQO 2PH5A 5A02A 4YAJA 3HSYA 1TCUA 4XGKA 2N47A 621PA 4WNAA 2GEKA 1AHPA 2YHIA 5KU7A 2JD2A 3GUUA 3IQXA 4BFWA 2R2AA 5AW0A 2GBPA 3RFVA 3GMTA 2IEAA 3F3KA 5TNXA 3KOYA 2CMHA 1ZRSA 3TCNA 4D0GA 1ZESA 3LW7A 3VYRB 2X3YA 2BGRA 2ZANA 4UNIA 1LBSA 3ZIUA 5F64A 1I3OA 1WRBA 3AFGA 3WJ7A 4EGJA 5B6IA 2YYAA 5JNLA 3M9LA 4BEBA 2RC5A 3CVYA 4DV7B 1QZZA 1YSCA 1SEVA 3LI2A 1TDJA 1GD1O 2C00A 2R8YA 1O9BA 4P08A 1T6YA 3O3OB 1B16A 2AXNA 4I9GA 3ROTA 3ML1A 5T6MA 4NPCA 4QXOA 6REQB 4D42A 1NVVQ 1OI7A 2XDAA 1N5DA 4IHQA 3JD3A 1I01A 1WW2A 2ZI7A 4PBSA 3FFAA 2O0LA 2W6OA 3OWOA 4PLGA 4EKIA 3SQXA 2DQYA 3G88A 1KGDA 1U1DA 2G4CA 3H2YA 4I1UA 4IGAA 3C7TA 4JXJA 4KO1S 2XKBA 4XZ3A 4IF6A 3HZRA 1NN1A 4NFHA 5BUSA 2XNKA 4OHKA 1LV8A 3DJFA 4HMPA 3VBEA 2OCYC 3N2LA 4R71A 5C1BA 4EFLA 4I1OA 2HRDA 5K6AC 3CB4A 4Q21A 2I29A 5LPNA 1N92A 3EBPA 2IW1A 4JZYA 1PO7A 1TQHA 2F9MA 4Q0MA 2FRXA 2ONCA 2PFGA 4UDYX 3EXAA 3ZQKA 3T34A 3SF8A 5L4NA 5IS2A 2C4WA 5AUPB 3KYDA 1AGYA 2GSWA 3RUCA 4HWTA 4CEIB 4HVLA 1K5PA 1NLMA 1QH0A 1Y1LA 3KT8A 4DNFA 3ELYA 3TI7A 3O0TA 3SHOA 4Q9AA 2DERA 2HSWA 2G0NA 3KQOA 2D2VA 4BNDA 4GOLD 2VRWA 2P9CA 1J2RA 2DHQA 4Y2JA 3ITNA 1WCXA 3VR4H 1KYTA 3GLUA 3N05A 3EFEA 1J9EA 4HYYA 5HTKA 1U7XA 3HWRA 2IH4A 3SEQA 5SY4A 5ESDA 1PLJA 3H9CA 3ZCRA 4RENA 5BQ5A 5A5FA 4V03A 2BGTA 4M8NE 5FI0B 4M0FA 4BNMA 1NLYA 4QJ5A 3TAXA 2Q46A 1Z4IA 2P4QA 2PRJA 1G8MA 4C21A 4MH0R 4WLVA 1XRSB 3RVQA 2PSSA 1VG0B 3PDCA 4UHJA 1Z13A 6LDHA 3RHZA 4DR4B 4GL2A 4IDEA 1UT5A 3DV2A 3FCEA 4FZJA 5PGMA 4C1NA 3BAZA 3DT8A 3EWNA 4E2FA 2IEYA 2RHGB 3NASA 1QS0A 1KK3A 2OORC 5TT1A 1GAQA 2C9YA 1XEXA 3IULA 4J75A 4UAVA 1EQAA 3PB3A 1TK2A 4LJLA 2AEEA 3HGQA 4WZBE 4DV6B 3SP1A 5FTWA 2VQ3A 3GHYA 3U16A 2EL9A 5LNK1 5FOUA 3DQZA 4HR7A 2XA1A 4BGUA 2W6JD 4Z7JA 1TYAE 5JSQA 1EGQA 3N70A 4Q1AA 3W1VA 4FBGA 5B12A 1LDBA 3GJSA 1G3IA 1W5BA 2MYTA 3H6KA 4JC0A 1FSGA 2JH8A 1TZCA 4QFBA 4KX5A 3VSBA 4B48A 2H2GA 1WXDA 1XK7A 3DKVA 3BJMA 1O54A 1PNTA 4QTYA 4CLRA 5JSHA 3OC0A 2IZOA 2R84A 5G0TA 5BSFA 4AXXA 3CWCA 3KKKA 2XXBA 4MUEA 4QUIA 2X1MA 4EUKA 3EE6A 1QYWA 1BO6A 2NU7B 3FUCA 3EUEA 3KJNA 5CH8A 1SVUA 1HQDA 1M6NA 2C2MA 2F67A 1CHNA 1P8AA 2QAJA 4MV0A 4OM7A 2MYNA 4KR9A 4ZTUB 1PL7A 3RJMA 2VP5A 1MX3A 4RADA 3OTQA 1D2GA 4EEXA 1YWGO 1BE8A 1REQA 2QVLA 2ZJ6A 4UTOA 1PR5A 1PGQA 2CJXA 1CEQA 2R86A 4MK4A 1L5KA 3ZH9B 4R0VA 3HWSA 2ZIUB 2JL1A 1EWTA 1B6TA 1QH8A 3DZFA 1O6BA 2OBYA 1S1CA 1K5HA 2QKYA 3GEPA 4JHXA 3EAQA 3T7IA 3A4MA 3BB3A 4GKKB 4ETNA 2QVXX 2Z9CA 2ZRHA 3G8BA 4Z8XA 4E03A 5DT2A 5I01A 5BPFA 2FN7A 4H3SA 1QLJA 1IY8A 3PXCX 2OB1A 1SOWA 4ON9A 3SHFA 1UDRA 1Y1RA 4X8OA 4EVQA 4W5RA 3FVWA 2ZM6B 3E70C 3L92A 4LWPA 2OHOA 4WY2A 4N0PA 4ZCMA 4GR4A 3L5KA 3PC3A 1CR0A 2Y9PB 4MKGA 5KYUA 5JTUA 4ZJUA 2QMHA 2EBWA 3EPJA 2ACKA 1AGNA 3ABZA 2XUIA 3IBTA 4AX4A 1S2LA 1KIMA 2VJBA 4DV4B 3GWZA 1G1AA 4JC4A 4RSHA 1EGAA 2ACEA 2M2IA 5KQSA 5A3JA 3A2NA 5E4YA 3DD1A 4K46A 1DAPA 4BYGA 2NO7A 1PD0A 3KYCA 5GONB 5KUTA 3HBNA 3F73A 4UDNA 1E9BA 2H1VA 2IFTA 4H7IA 5F7OA 2X1LA 3MLBA 4PWZA 4ZO4A 4KE6A 1ZM7A 3T5CA 1QFJA 3PQEA 4W5TA 2ZYHA 3GD5A 2O7NA 1O96A 3BTUA 5CVCA 2F3UA 4UUNA 3T54A 3ENQA 4MUMA 3VYSB 2R6ZA 4GPAA 2YJ5A 4J07A 4HAWA 3KBBA 5B64A 1IQRA 3UY4A 4B2PA 2VHWA 3R24A 5BW8A 4LHSA 3CINA 3SZ3A 3RK1A 2WD9A 3JWHA 2WA2A 3L3BA 1VPVA 3HYLA 2O2XA 3GLIA 5GJCA 5D87A 1IZ8A 4RXTA 1AV7A 1U7TA 1UXHA 3W3AA 4QBHA 3TRIA 2YL2A 5SZIA 3JPWA 3GB9A 1SA0A 3A1NA 3LT4A 4GZ6A 5JV5A 3AEQA 3F6SA 5T3YA 4WOKA 3BS4A 1RP7A 4PSCA 2W22A 2XMGA 2I6TA 3JQFC 4Q05A 8MHTA 1GU1A 2QTMA 4CQJA 3KOWA 3NWEA 2DUNA 1SZCA 3ZE9A 3CW9A 5KHAA 1FUYB 5TF4A 3WRVA 4LRXA 2VL7A 4BO3A 2OAEA 2XD9A 1GJRA 2OSBA 4I2VA 4W6ZA 2XBUA 3OHSX 1Y6FA 1Y8ZA 2ODNA 2FUG6 5JNTA 3GFBA 4FLMA 1M9NA 3FZGA 2ZUUA 4GP6A 4A82A 3RSHA 1Y3AA 3UMVA 3O93A 4UULA 1OXVA 2FJUA 4HLNA 3EGDA 3FDFA 1OAOC 2HF9A 4RDCA 4FDLA 4TMKA 1KO5A 5KJCA 1NYQA 2H7VA 3DEJA 5CJ2A 3UJ3X 3PHJA 1E2KA 4A0HA 2XYHA 3JATB 3BUSA 4KHZA 3GEBA 1MQ9A 5K8UA 1N3BA 2EEZA 3GVIA 1L8AA 4Q4AB 4X45A 2XEXA 4BJ6A 2LPMA 5FA5A 1HMPA 1MGPA 3EEIA 4MWGA 3B3FA 5TQ0A 4Y3UA 4W9NA 1C3EA 1KC3A 2DP4E 2Q07A 3Q41A 4TYNA 1MR3F 1S8NA 1DBPA 3AI2A 3C43A 3K0AB 4OP2A 4W1RA 3R7SA 2I4RA 2UUCB 1KVUA 1FVFA 3DQQA 3HKEA 3QLVC 5J2UA 2FLVA 2ZRAA 3THYA 5CA0A 2IKQA 1J6UA 4Y0AA 1KJIA 4HAZA 1FEZA 3OE7D 1OUMA 3OOHA 5REQA 4AQ7A 1D1QA 2OLKA 2WWIA 2C96A 2CXXA 4ALJA 1LXCA 2CMGA 2I91A 2BCEA 2Q5JA 3TZLA 3KTAB 4AZSA 3UVEA 5HRUA 3I04A 5JJCA 1E9SA 2SKDA 4HDRB 3WDKA 4C6TA 1T1RA 1HYBA 2P2YA 1O08A 3K5PA 1MW8X 5KHLB 1OLSA 3BMOA 6ABPA 1GTVA 2F7SA 2JFBA 4G5XA 4GPBA 2HK7A 2VRBA 3DAOA 3F8TA 1ZRNA 2D0IA 3JD2A 4PPNA 3ZJUA 3M89A 4KIJA 2W83A 3LUDA 4ZQIA 1OWOA 3WAGA 2DPXA 4FMDF 2WP0A 2FR1A 3IT2A 4R1QA 3NGLA 3AFOA 4K0RA 1ULZA 2A94A 5GINE 3K6JA 1R88A 1VXOA 2ZT8A 3ZXXA 2C1EA 5JZSA 2AJLI 2HPZA 1UEIA 1A1VA 4FNAA 3EOAI 2Z2ZA 3IIEA 3C6MA 4WIAA 1UQTA 3ZE0B 5F9HA 4ZARA 5LQJA 2MTBA 4JB3A 4RQAA 1O94C 2P4HX 3QVVA 2HIHA 1R8YA 4CN9A 2PPLA 2F3PA 4J0CA 3UANA 2UUOA 2WZDA 3HMKA 4TXLA 1I9GA 1BTOA 1W88B 3WJ1A 1Z4PX 1XRQA 3NP7A 3ZD8A 4A3SA 1LJUA 4X3OA 2NO1A 5LZ8A 1SCAA 1S8OA 4EJSA 3GLHA 3HYTA 4RY0A 3SZRA 4F56A 3JWPA 3WI7A 4CM3A 4F2DA 3CLRD 5KBYA 3STYA 4E46A 3F49S 2QT1A 4IYRA 2JCGA 2R8EA 2RGGA 2BKXA 1HE4A 1Z7YA 1YIDA 3D8TA 1O8BA 1T5BA 4FP9A 4CL3A 3O83A 1AB6A 5K4AA 4CM9D 3PFFA 3OM9A 1QGED 1BGXT 3DB2A 3K9LA 4BAZA 4UUMA 5DN9A 5F98A 2HX1A 1SC4A 4G9EA 3C7AA 5ICSA 3LOQA 2HAEA 2CXNA 4N7MA 3K53A 1L7VC 3RBVA 4B3JA 2PXXA 4LZPA 3I0ZA 3TNJA 3UPTA 3F78A 3KKNA 1CEYA 4BJ1A 3TQTA 2RGEA 2O9JA 1PEAA 2B3DA 1CZLA 5THXA 2FCRA 3SJZA 1PIWA 2I5PO 4DLUA 4E6EA 1V6AA 3IAXA 1XDZA 2GHIA 1NDUA 1HQKA 2YWGA 1JBQA 2I4MA 4CIWA 5KDDA 3QKTA 2G9ZA 2YIMA 1SMKA 4QNNA 4WLOA 3UCFA 5F2NA 1JQ3A 1EP2B 1UPXA 3GZNA 4MR9A 5DBOA 1GNLA 3F5SA 1MH9A 4I1PA 4IDFA 4IILA 3PXAA 5LKAA 1ELOA 2IPOA 1U7HA 1C7ZA 3KB8A 1RC0A 2AYZA 2HPHA 3FYUC 3NBZC 3LSYA 1KC1A 3P8ZA 5AI6A 3O8QB 4NOMA 5HILA 1FY2A 2REOA 2AW3A 1QCZA 1O4WA 2VPWA 3KOMA 2GPAA 4IVQA 4MA5A 1H8ED 1O97C 1ZWKA 2MU1A 1OAOA 2ZATA 2ZVJA 1M2EA 4P36A 4UUAA 1I8TA 4XFDA 2J0VA 3RABA 3WJ2A 4Q3BA 4C0XA 4P81A 4N01A 4PG8A 2PGJA 2QAGB 5LQSA 3AUKA 1LS6A 1J23A 3D0RA 1ODTC 4ZOAA 3HVKA 1EX1A 4I46A 3WMEA 4B80A 2F43A 3ZDAA 5FORA 1OT5A 2YVAA 2QUAA 3QLUC 4FFLA 4RABA 5C9ZA 3ES9A 1QZUA 1RXCA 2H18A 2NSJA 2X2PA 3EVZA 4QVIA 2DOKA 1BMFD 1P0CA 2JZOA 1ZNXA 3Q3GE 4NMLA 2C8JA 1PYOA 1RZUA 1GPDG 1WSWA 3IV6A 1A7KA 1OKKD 2PGIA 1P2GA 1WSDA 1SCDA 5I7VA 3UJCA 1E63A 2E4UA 4LOHA 1JI3A 2A3NA 2JJ2D 1IH8A 5LA6F 4A91A 3TQHA 5KPJA 2DJIA 5H4GA 4KQ9A 4R0MA 4DREA 1QRAA 2FFBA 4L95C 4PG7A 4F8YA 5I9MA 2PXCA 4MB2A 4MR8A 1W46A 2FDXA 2HY7A 3R44A 4K3VA 4RPKA 2A2ZA 5DASA 1RXWA 1D2NA 4CHTA 1DADA 3WL7A 5A0TA 3IQIX 4ZVVA 3SYMA 2UZ3A 3OO1A 4A6XA 4X95A 4AWAA 4Q01A 2W70A 4JJGA 3VH4A 2EIHA 4EUEA 4ZI2A 4F4HA 5ITVA 1MA0A 1U0HC 4X24A 3DVAB 1RXEA 5CGZA 4D0LB 4QOFA 3ZVMA 1K9VF 3DZIA 3SC3A 2GF2A 3A1UA 4LYGA 4HDCA 1U5BA 3LNCA 3TJMA 2C88A 3ZY2A 3G9XA 1RLMA 4KR6A 4HQ0A 5KTPA 4XVUA 2OC4A 4KXLA 2V9CA 5EE3A 4DR7B 2AZTA 1X8JA 1TO2E 3TFWA 1FDTA 1OFUX 3HRHA 3S81A 3WOVA 4PICA 2WUDA 1LKZA 1YB2A 5JEEA 3W4IA 3E8MA 1YDEA 2GZRA 2HIMA 1FMCA 1Z33A 2VNIA 3G89A 3QLJA 2CXRA 2HK9A 4KPFC 1Z68A 3O0DA 2IHBA 2WF6A 4Z3KA 3Q7SA 2IVFA 2ZJ2A 4GPZA 1J7JA 3LLCA 4G0QA 1SAYA 1ZKMA 1G5FA 1TA9A 2C03A 3V8PA 1ZR2A 5EQDA 2O5RA 2PA0A 1NU6A 3H84A 4YREA 2R6HA 1AO3A 2UZ0A 3NHBA 2AYXA 4AJ4A 3R7NA 4DG8A 7REQA 2J3MA 1Q11A 3OEEA 1JFSA 4NPAA 1FVXA 1U0FA 1U0EA 2EYQA 3H05A 5JARA 1IHUA 1Q16A 1I7NA 4Y1GA 1KMCA 4AXBA 4OSEA 4QVKA 4YT2A 3NXKA 4YLYA 3K6RA 1PSWA 1FXWF 3HP7A 4G1UC 1E1NA 3D7NA 4LDNA 5EWMB 4CM8A 1CIVA 1XALA 5AP9A 2GEBA 3UWOA 2H0RA 4QU9A 3DWEX 1WJGA 1NC1A 1MB4A 4W4TA 2PRKA 2I3ZA 3D8BA 4H59A 2YJGA 1TAHA 4RDHA 5AJVB 1IOWA 5G0WA 1MHTA 1D1PA 4EMBA 4KGXA 3W9YA 2ZQYA 4MS4A 1NFQA 3P4XA 1G1MA 3UHPA 2ATXA 2K7ZA 4D4MA 4HRVA 4MI3A 4BGIA 1E7RA 1XTJA 3L1JA 3N58A 4DA8A 3A4VA 5F77A 3KZNA 3BMOB 3QG5A 5B58C 2P2SA 2E4AA 2XHEA 3TK1A 3N7AA 5EP3A 2JHAA 2HEGA 4CM9A 1MEJA 3NJ4A 4A2CA 1SBNE 1VIDA 4Q1CA 1SQ5A 1NBMA 3OLWA 1E5QA 4FKZA 4M86A 2WWRA 1QQAA 4C43A 2BT4A 3KYIB 5D85A 2R7KA 1JA9A 4AL4A 3IP5A 2HU2A 1JPUA 1P80A 1M6VA 1YR2A 3L1KA 3Q2OA 2Y92A 4LJSA 4N41A 2ZYIA 1Y42X 4FS3A 1GPMA 4WUVA 4C7MA 3N8HA 3CJRA 2WFZA 4UVDA 5A3RA 4Q9DA 5FKJA 3NW9A 2F3RA 3M6UA 5GGXA 3FWZA 1VM6A 1Y3IA 1KDTA 1QDUA 2ZWOA 1QHXA 2WPDD 4QDXA 2JFXA 5DSZA 5K3SA 5TQVA 2HXYA 5JQWA 3GVCA 3SLGA 1EK5A 5DGTA 2HI0A 3OZAA 3N7UA 4LPKA 2PJUA 4BDTA 2VH2A 3KUKA 1OYOA 4RD0A 3T3OA 3HH8A 2QL5A 1GITA 3VTFA 5LZ7A 4YECA 3FSRA 1S3SA 3C87A 5FEUA 4KWHA 4FYVA 4XWKA 4PCVA 5BV1A 4GXTA 1UM8A 4BUZA 2WG2A 5JBNA 4KXMA 2FPIB 3KXLA 4MQEA 2EARA 1Z6ZA 3PC8A 3WVNA 2PUFA 3OWHA 4L4YA 4NMWA 5BWBA 4H16A 1Y8RA 2WKPA 3A8TA 3P45A 5AKZA 4G81A 5IABA 4AU1A 3OMWA 4W99A 2H1WA 5AJUA 5AM2A 3FKQA 4V3BA 16PKA 5AI4A 2XVMA 3SHQA 1IN8A 3RR2A 4DA6A 2WJ3A 1FFWA 3CB2A 1DJQA 3K31A 3RAJA 1A88A 1NHWA 3GUYA 4BE9A 1N32B 4WINA 1K4MA 4WRRA 1SVSA 5FQNA 1VJ5A 2XT6A 2HWWA 1QHSA 2QRGA 2WFLB 5CRIA 3IUBA 5KIAA 4M21A 2DWQA 4MV6A 1KE2A 3FCCA 1YJAA 1G8KA 3GY0A 1T5LA 2O6LA 2X6RA 3I6MA 1JFTA 1FDUA 4UMDA 1T4BA 1A8UA 3CKKA 1GR0A 2H65A 3A1EA 1P2TA 4G65A 2R6JA 3AEQB 3BWDD 4X6XA 1HEYA 3ENNA 4CKBB 4RTNA 1JB9A 2DH5A 1S2IA 5CJPA 5IJ0B 1GTRA 1J0XO 1Q1ZA 2BMVA 2AF3C 2YRXA 3K2EA 4H0CA 1UR5A 3TNYA 3VNQA 5KNDD 5LWHA 3LWZA 1USKA 4BRWA 2VF5X 2ZYWX 3G2MA 5JS1A 3H11A 2OD2A 1E9CA 2HCFA 3LK6A 4DJFC 1Q3TA 1IHPA 3T3NA 5F9FA 2FFQA 2QTAA 5CB0A 3ZIAA 1G3RA 1M1YA 3DOUA 3PPVA 5IBQA 2UYYA 4HNSA 5ED0A 2B82A 3NBMA 1DINA 1S2NA 1H2WA 5JCPA 5DISB 1FBNA 1MC8A 1RU3A 4AJEA 5A06A 2IP1A 4C6SA 3HM2A 2C2WA 4WX2B 4M99A 3VKVA 2FKAA 3ZYZA 1FP4B 1R4NA 2WDPA 3LYAA 3VHRA 4HVAA 5DTMA 3WFZA 3VPAA 2W2TA 3QMMA 1YZUA 3IHKA 3M5PA 4X1IB 3UAWA 2RK4A 3EPRA 3I2KA 4YRDA 1JNYA 3IMCA 3KKQA 1VG1A 4DCGA 1XDBA 3C1OA 3LZCA 4UFOA 2NUAA 4XTRA 1EDDA 1Q22A 4RQTA 4ZOQI 3JQRA 4JFAA 4UBNA 3U1BA 1J1UA 3A6ZA 1JHXA 4M9XA 3W5JA 4ZPJA 2ODAA 2W6ZA 1XF9A 2XVZA 5DYIA 1ZEMA 3RC1A 1RTTA 5B2ZA 2WIDA 5A0FA 3HA2A 2AR0A 1E2JA 3NUGA 2JGKA 2Z2XA 4C6TB 1YVUA 3OZXA 1T3ZA 2H92A 2C84A 3AJAA 4CFYA 1M8JA 1XF1A 3TUIC 3UWPA 3V55A 4BN5A 2VF4X 3LFTA 3PPYA 4N0MA 4AJIA 2O0MA 4BOYA 2VR1A 1KMNA 1HO3A 3D4OA 4UVIA 2HJVA 1K8XB 2B9EA 4QODA 2AWNA 2QN8A 5JYDA 3CZ5A 1C2YA 3GBPA 4HFRA 1FTNA 1XNJA 1W581 4TOIA 2V4UA 2Y77A 2QR5A 3C3JA 3VPFA 1B8PA 2X5XA 1URPA 5FFNA 3HLYA 1L8XA 5LOVA 3AETA 4D5EA 1M2FA 2A5FA 3O8OA 3D6UA 1M34B 3M82A 4GGPA 4PLVA 5AFSA 1G18A 3JQ8A 4OQMA 2UUBB 4US2R 1I2CA 1V3UA 2CJWB 2TSYB 1N6HA 1GUZA 2G0TA 1ZNZA 3I30X 1OBHA 3DFKA 2ZTHA 3OPMA 4UE3S 1B00A 1I33A 3EH1A 2ODEA 1L9XA 2Y1CA 4RVUA 4TYQA 4YT5A 3U48A 5TGTA 4E3ZA 4DNPA 4ECAA 4S0XA 1SC3A 3MB5A 4ALLA 5IUNC 3EXEB 4CIAA 3CPJB 1EXWA 3B3QA 3C2QA 4A5SA 3Q3HA 2XXJA 3U62A 1YL5A 2P2NA 5D5QA 2AFRA 5L95A 1R16A 1XRMA 3CURA 1P7YA 3JX9A 1EB8A 2CYBA 1GG2A 2IYOA 4NYJR 1AO0A 4MO2A 4MVJG 3SVZA 1W6UA 2K5UA 2FN3A 4LSMA 4A0GA 4ZFNA 4CIDA 4OB8A 3AB8A 4MCJA 3VR3A 3BD7A 1BXRB 2X40A 3MT9A 2AKEA 2QEQA 2JIDA 3RRJA 2Q6LA 4BBZA 4DR1B 4YP7A 1SHTX 4MGHA 2FI1A 2HQSA 1U63A 3MERA 1T29A 2YWJA 4ZCQA 2FMXA 1ADYA 1Z75A 1VSVA 4NYMR 4CM5A 3FDIA 2QRHA 2VZ9A 1W73A 2BIFA 4MUJA 2GPSA 3NQ41 5AI5A 4EMSA 7GPBA 4XPZA 1RAIA 4ZVTA 3CSSA 3OI7A 1XNRB 2KWIA 1L6IA 3P94A 3JQDA 3AR8A 3UV6A 1A9XB 2OAP1 1V25A 4ZV4A 3DGFC 1LWOA 3CZ4A 1TVKA 2ZBQA 1XQVA 4K05A 1RHUA 4PZEA 2V5AA 4ILKA 2RIRA 4QULA 4TQUS 4YLEA 5MGNA 5IX8A 4ABYA 4NE2A 2II6A 3ZGNA 2EXXA 2FK8A 2NSHA 1K4KA 4IIHA 2FOLA 4MROA 1IRIA 3E4DA 4YCDA 1D07A 3WRYC 4ENTA 4ENVA 4JR1A 4RGVA 5B7NA 5AW8A 4JI5B 1LSJA 3GIWA 1QGUB 1VJ1A 2CFSA 5CVDA 4PO8A 3VR0A 3P52A 3WYCA 4L5JA 3WMFA 3LQRA 1V2GA 1CJUC 5AKEA 3C4VA 3O1IC 4L6CA 4ZA2A 2Q4EA 1R8SA 1OREA 4YALA 1JIJA 3W5VA 2IUSA 1MG5A 3F3MA 4NZZA 2PV0A 4AN1A 5E7JA 2FSVA 2OV1A 4L8FA 1Q3KA 1Y82A 1R0KA 1AIPA 2J41A 2NU8A 4BVKA 5I8WA 3U4DA 3P2EA 4HYQA 4Q9IA 3G1TA 3PFWO 4CMEC 4U4AA 1OWPA 4V0ME 3BWEA 4W8HA 3NDIA 3OT1B 5GY7A 2QTWB 5FRDA 3AT1A 4NV1A 1UKYA 4GOOD 1S8FA 3ABRB 3Q7IA 1L5LA 1IPEA 4ZRNA 3L1IA 4I4TA 1PT5A 3BG5A 4S2UA 2JGAA 3Q0TA 3NB0A 4MW7A 2B9VA 3JYOA 4PINA 3AG6A 4REQB 4ASUA 3OLZA 4BJ5A 4J1SA 2I3AA 2FWJA 1T9ZA 4AIIA 1XEAA 1DIGA 2EQ5A 2BC9A 2Z6QA 3SQDA 3TIFA 3JQ6A 3V4ZA 2VDOB 4GMXA 3HACA 5IU6A 2Q6VA 5JXIA 4AKTA 3MTJA 4YRPA 3M5DA 3MLEA 1XUOA 3JALA 5BOSA 2R1TA 2X77A 4JROA 3VHQA 3LGXA 3ORQA 1UOOA 3ZW7A 2ZIEA 4C03A 1GU0A 5I9LA 3EGXB 4EVRA 4I1SA 4HAYA 3C97A 1SUBA 4AROA 1HXHA 2OCDA 4XCVA 5ALQA 1JJ7A 2B4QA 3K70C 3Q3VA 4CFSA 1T5IA 5LXTA 1ZHFA 1PU2A 4O1IA 1ZPDA 5B6PA 1BMTA 2FQXA 2R8OA 1KTIA 2AR7A 1OHHD 1HDOA 3I8SA 3WZLA 4L2IA 5H80A 2COKA 1GL3A 3PKIA 2WT9A 4D0SA 1ADFA 4TT3A 5F2OA 1LX7A 3TZCA 4MYCA 4R7TA 1FP6A 1IXKA 2LRHA 2I3GA 1Z6PA 3FTPA 4JP1A 4E5DA 1SBIA 4NV0A 3Q6IA 4EGQA 1IY2A 2CF6A 3PXXA 5BNIA 1ZD8A 1OXXK 2FNAA 4QYIB 1RQNA 5C52B 1VHWA 3JYNA 1QORA 4MIOA 3UJ7A 4R5MA 4KRYA 1SVNA 2PXHA 2PTGA 2Q0HA 3L1UA 4ZT4A 4DF3A 1O57A 1ZLXA 2H1HA 1YI1A 1AU9A 3M49A 5K3FA 3LT0A 4PX2A 1X7XB 2X8JA 2JVJA 3MM4A 3BH7A 5LP6C 4X6UA 2DLNA 1WULS 1TVCA 2JGRA 1XAHA 3BX1A 3A9TA 3TMYA 1IZ7A 3N2ZB 2OYRA 1L5OA 1OWMA 2PX4A 2HWYA 1KR2A 4V0OA 3S1LA 3HCWA 2OXRA 3U7GA 2ZVPX 1ZHOA 4RY8A 1YL7A 4RM3A 3W5DA 1T2VA 1ODLA 1PV1A 2YFQA 4GKJB 1GQQA 1HFKA 3GGSA 3M4NA 2AA3A 5DSTA 3RO7A 3RSGA 1YKSA 1YK0A 4BRUA 5JQGF 5U9CA 1OH5A 4JT2A 1K8ZB 3O7MA 2Q5HA 4B3MB 1EJ6A 1WMDA 4PLFA 3OZUA 3IX7A 2BKEA 2HUPA 4WOPA 3GNLA 4PNZA 4IF4A 4XTCS 4CR6A 2VNKA 3VPGA 4OUDB 4EIWA 1G7RA 2P9FA 3G5TA 1UF9A 2F9LA 5KDLA 2B7BA 2R1VA 4JOSA 4ZEOA 3UXYA 2YV5A 3DBLB 4HB4A 1NBIA 5KX5B 5DHFA 3WLFA 3NVKI 2BRUA 3FNRA 2XIJA 2JVKA 4CZ2A 4R1SA 2HK6A 1W0JA 3TSWA 1EFHA 2L19A 3WLJA 4GDMA 4B5LA 1G8FA 1YBFA 4R2LA 4OQLA 5CT4A 1ISSA 5DX1A 3PLAE 3I34X 4F5YA 1UM9A 2RAPA 4BNTA 1G2PA 2C2YA 3A1WA 3SIRA 4GR9A 4WLUA 3GPLA 1QG6A 3KKPA 3Q7PA 3BD6A 5JAZA 1F2TB 2W2QA 4KL8S 1UM9B 1LSUA 2YUTA 1VKZA 2PX6A 4F2WA 4JQSA 4PIVA 3DKRA 1QC5A 1G5RA 3MOIA 1SOAA 1D0SA 4MTLA 5CU7A 1K75A 2JNWA 5JRDS 3EPLA 2WMOB 1UANA 3JW8A 1E2NA 1QTIA 4QE3A 1P9OA 3X44A 4PANA 1MC5A 1NX9A 3BSWA 3X1WA 4TMXA 3JZAA 2QMUA 3TTTA 3SXJA 1SG9A 4BQEA 3W9UA 1WDKA 2PKRA 4K2AA 2DTEA 4NZPA 3FGZA 1CNMA 1DQSA 1E9RA 2QVZX 4WCFB 5F4BA 1NLFA 1PX0A 2Y0BA 2BVNA 3CZRA 3GJQA 3HDJA 1VIYA 2GYUA 4ITUA 1D5CA 4LBYA 4JVLA 1CNFA 2OCKA 2HCJB 3BTOA 4OI4A 5CVUA 4DPKA 4Y9RA 5D5PA 4O6VA 4PX5A 1GKUB 5J1TB 2GPTA 4QRDA 4IL5A 5LN1A 2PJZA 5FOTA 3GARA 2C9ZA 2YN2A 5CBKA 2ORYA 1BCSA 2BELA 3TLJA 4HB3A 1XCMA 1ZITA 3LXRA 3I2JA 1YOBA 3USZA 3PF9A 1X1SA 2A5LA 1E9VA 1RZ3A 4GE0A 1DXQA 1WPRA 1JXMA 2GN0A 3M34A 3TUJC 1WHSA 4Q4LA 1ENYA 2A9OA 4YJHA 4Y9TA 3F9CA 4ESOA 1QLWA 5IBPA 1DUVG 1E66A 1DAHA 4X97A 4DW8A 1JTVA 3IMKA 5BR4A 3W5HA 1YF3A 1ULTA 4DLNA 5M5BA 1MOSA 3A4NA 5AXAA 5FWYA 5ICEA 1Z5PA 1O96B 1QGYA 1XA0A 5LOVF 2FX5A 4L8GA 3FUUA 4O5AA 4JITA 1T4DA 3ZKAA 1SUIA 2AOUA 3VZDA 1IZ9A 1CY0A 1A98A 4ZI7A 3EGOA 2O8CA 3ZQJA 5ENZA 4LC1A 2XVXA 2IXBA 2O8DB 4II2A 2QGZA 4UHHA 3FZYA 1YE3A 3D8UA 3OE4A 1DXYA 3M4YA 3B5EA 2DM6A 4V0KA 2P11A 5TPWA 1UJCA 2D8AA 1SKYB 3I9V1 4YP9A 5BW6B 3K32A 1FYVA 1HURA 3W34A 4YEDA 3DEAA 4B4VA 4BVEA 2H31A 3MWLA 3QPWA 1W94A 2I7VA 2QMZA 1J0BA 2CUZA 2VZLA 3OE7A 2AQIA 4G0XA 3BKXA 3QJYA 3S55A 3RHTA 4KQKA 2GD2A 2VTEA 3D81A 4HSEA 2JASA 4MW4A 2FV8A 4UHEA 3RVRA 2FZEA 1M2HA 1M1YE 1Y37A 4DPMA 4DCJA 4N4AA 4PQYA 5C4MA 3O4IA 3V46A 5L3SA 2PLNA 2V7PA 4HRXA 3BTSA 3H5LA 1M76A 3SWWA 1EVJA 3DVRX 4ED9A 3CRNA 3CCFA 5CGQB 4YQZA 2A7XA 3EVEA 1VLHA 2VUSA 2HOQA 1TYEB 2IYAA 4H6PA 2GPBA 1XZEA 2N1BA 2PZFA 3MTQA 4PNPA 4EZEA 1AS0A 2HRRA 3PXEA 1IN6A 2XSZD 1IN1A 1CUSA 4PGHA 1H3NA 4WXPA 5IMSA 1QV6A 5EIWA 3FBGA 1LDYA 5HQJA 1Y9JA 2XRMA 4AUKA 4DC9A 3KYDB 3I6BA 1EE2A 5LBTA 1C1XA 1CSEE 4B71A 3QVTA 2ZK7A 3LQ2A 4YCNA 4UTNA 1VB3A 5DI3B 3UJPA 1SVKA 4GPTA 2PKYX 3QUSA 1HT2E 3IS3A 4GFDA 3I3OA 2XITA 3VV2A 2NYUA 1H2RS 1ZU5A 1E0DA 1FDRA 3MWDA 3N2KB 1PTKA 2P2CA 1GPWB 4URFA 2RI0A 4YK7A 5AH0A 1TF5A 4DLSA 2OCGA 4AMVA 2HGSA 3ZD9A 3M9WA 4IJKA 3G2JA 4U6QA 2ECFA 4MVXA 3ER9A 1UPBA 4U1RA 5IKEA 4WN9B 3ZK8A 1EWKA 4D96A 4CV1A 2DLDA 5E8RA 5BR1A 5C1OA 3LUKA 5A03A 2XWBF 3KOZA 3TOCA 4HC4A 2R4QA 2C2XA 1P81A 4N82A 3DOFA 4L15A 4DTCA 2C58A 4RESA 3PUYA 1BX3A 1JEEA 3N8KA 2PCLA 4CXMA 4PYKA 4B7UA 5KTOA 5AM0A 4J2OA 4LKOA 3UKJA 3CR3C 1TQDA 4A6DA 1XAGA 3AINA 3HV2A 3PVCA 1I2ZA 3HO6A 4L78A 4XRRA 2OXIA 2I4NA 4C2AA 2I1QA 3WDMA 1E3QA 1FDOA 3TBHA 2FDCA 1IOZA 3VNAA 2PUDA 4BPBA 4BNFA 5JXGA 4IRXA 3OPYI 3PNYA 3A1VA 3RIEA 4OYRA 2Q41A 5JC8A 1NVWQ 2I2XB 3VR5D 1M72A 2H4JA 4ZRMA 4IJVA 1YE8A 4ZHQA 3WMXA 4YJ2A 1A97A 5A71A 2C7VA 4E70A 1PEKE 2EFEB 1VIMA 3NC0C 3TD2A 3UOWA 5KTSA 3KOOA 4M7RA 1VMIA 3CRVA 2F48A 3ZDCA 3OJ0A 1JE0A 2UXCB 2A8YA 5ARCA 2FEMA 1HKUA 5M2QA 3REOA 1O77A 2VZ8A 1ODIA 2ERYA 4TKVB 3ZLVA 4DL9A 3CLTD 5AW7A 3E15A 3ZVKA 2YXNA 3V42A 3GPCA 4E07A 1UXOA 1OHHA 3AUYA 1HZZC 2EW2A 1ZA2A 3LO8A 4XX0A 3KE9A 3RHSA 4OMDA 3VV3A 1DTEA 1LQTA 3HYRA 2BUBA 3ILSA 3D6HA 2EF1A 4NCHA 3OTGA 5B7PA 3HB5X 3MYRA 1V26A 3EB9A 3TRFA 2OAGA 3ROKA 2OQRA 3PQ7A 2VBFA 3BWYA 1BS9A 2DWCA 1ZSVA 2GKGA 5JI3E 3ENZA 2ZQ5A 2GRJA 2VT6A 4Q15A 1L7XA 2IOYA 3UB4A 2YX1A 1TU3A 2YXPX 3O26A 5EXXA 2VTKA 5L53A 1IHDA 4E2WA 3VR6A 5TEWA 2Y8EA 1R50A 4I5FA 1E60A 3TB4A 1X3SA 2KMLA 4F2GA 2CLLB 1TJNA 3MEQA 3VZQA 3NX4A 1NLUA 4KR0A 1MRZA 3SHTA 3VR3D 5K03A 4ZO6A 1EHCA 5DVZA 1GGEA 3DKPA 3V2UA 3K35A 3RROA 2BF7A 1LBHA 4XPIA 4B4UA 4CG3A 4EG8A 2M32A 1UBSB 3ZVLA 4IX9A 2F3SA 2JVIA 3R9KA 1AKUA 1EAMA 1JEQB 4OXIA 521PA 3W6UA 2VK8A 4DN6A 3N3AC 2LCFA 1Z8DA 2ZQZA 3UAGA 3ABQB 1YFLA 4URZR 1Y8AA 3L41A 1MJHA 1UWVA 3R5JA 5HCUA 4EATA 3OFND 1XLTC 4KQJA 2A1TR 1EUZA 1BFUA 2H4XA 4YJ3F 3BMQA 5JSKA 3TW8A 3ZWCA 4BZXA 3I45A 1F2UB 2PH1A 2J8ZA 3EXIA 3K20A 4R1NA 1H3FA 1XQXA 2QZ4A 4DIKA 4YRZA 3LC1O 2ZYAA 1TEHA 1BWRA 4RVFA 3AJ9A 1KO1A 2CXHA 3P7MA 1IJEA 2AWOA 3EG5A 3QNWA 1TM3E 5KO2A 1DZIA 4N3BA 5L40A 4DSTA 5JWRA 4CT5A 4ZCRA 5JANA 1R0ZA 1T6ZA 1SOVA 1WP9A 4I19A 3DBLA 3AEKB 2CBZA 1UH5A 3BTVA 3DNMA 3GT4A 3FOAA 4FNGA 1W29A 1RYMA 3EQ6A 3USES 2HK8A 3JQCA 2WF9A 3MT7A 1CUWA 4U7FA 4RD2A 1GPYA 4IAOA 4DOMA 4O4HB 1C3XA 4A4DA 1SCNE 4CKBA 3I1YA 5JFGA 1W36C 3H3XA 2BFFA 5CA1F 1U99A 2QG4A 3K1JA 2I33A 5FV4A 1ZNYA 3CLSD 3P71T 4WNAB 1B26A 4B75A 2WSIA 1UDAA 1XZCA 2XZPA 4GLJA 1A8QA 3K4HA 1L7OA 4Q12A 4M1MA 4UNPA 3SQMA 5KNBH 2BZGA 4FT4A 3KKOA 4ZTBA 1QKKA 5JI2E 5BXYA 3NHWA 3PUZA 1GCGA 3VPCA 2O7QA 3EA4A 2PMCA 3PLNA 3VPBA 4L9SA 2CEAA 1P2SA 4FDVA 1FRNA 3TKYA 4QGBA 1Q1QA 2QS9A 3PX3A 3AB7A 1U2TA 3DW3X 3KQYA 3OETA 1IEVA 5D2CA 5TARA 5TVGA 1EE1A 3MQFA 1ZU4A 1SD2A 2V7EA 1RKUA 3VPDA 1BQEA 1RSZA 1QOQB 1F8FA 2XA9A 3PJEA 4LYJA 3KT6A 2OOSA 3RV4A 5EVJA 1OYWA 5KCMA 4R3WA 1N4DA 5DHPA 4L3VA 1I14A 4DSZA 1CQZA 1W2HA 3CVOA 3K7EA 5E7IA 4DA9A 2R6CA 1PQYA 2H7CA 2RGBA 3QV1A 4K8OA 2ONKA 2V7VA 2ZYSA 1KEWA 3D9QX 3WIUA 2H11A 4WECA 4UPEA 4ZANA 4G4JA 1AOXA 2AKYA 3OEHD 2Y93A 2IKSA 4MVJM 5AW5A 1QBGA 3RJ9A 3OU7A 4NIMA 4BMZA 2XCIA 3ED5A 2YV3A 4JP3A 1QHIA 3GO4A 1J8FA 1NJ2A 2BCJQ 5A4KA 5CFPA 2OHHA 5JNSA 4GKBA 2DULA 4QGFA 5CBPA 3UOAB 1YVPA 3EW9A 3ROFA 1RP1A 2V6JA 3KSDO 4V0LA 4UMVA 1GZHB 4UNNA 3AOEC 5A3SA 5JD3A 4OIFA 4Q93A 2VP6A 1SVIA 3QGMA 1YQEA 2F8MA 4URYR 3V4FA 1DX4A 1L3IA 1X1DA 1EFVA 2Q0QA 2Q9CA 3I9KA 1PFYA 1XO1A 1K3FA 2Q2QA 1TGYA 2D5AA 4C1BA 3HJFA 5EE5B 2NNLD 2O48X 1N33B 4LPSA 3JQEA 4I3GA 5DNUA 3H1AA 4RLSA 1LVGA 3WLQA 1GA4A 3WQQA 1GOTA 5TPZD 2DF8A 3GK3A 5HA5A 3G2LA 3PC6A 3ESXA 5IVPA 1TUGA 2HHHB 3GJ4A 3BT7A 4MS3A 1PDVA 1U5AA 1GG8A 1W48A 3QRWA 3I37X 1NSYA 3DEZA 2OZLB 5B55A 2X0KA 1MB2A 1IPHA 4OHRA 3JASB 4WE3A 3SN6A 3ZWNA 5KVCA 5CB8A 1U8ZA 2F4NA 3PZRA 3AY6A 1D03A 3QWBA 4V02A 5ENVA 4BMXA 5A4FS 1NZFA 3DBIA 3ZWXA 1JPJA 4I9FA 4NBLA 4QDUA 3CPEA 3VUFA 2CZGA 4O4HF 5ERGB 5KC8A 1MU0A 3ZCVA 1DQPA 1E3WB 2GX6A 2WIFA 2WWGA 2HA2A 3EEYA 3EZYA 4NYMQ 4X90A 5J2UF 2P65A 4RGQA 3D0OA 4GBMA 4AKEA 3PHLA 5KWVA 4MNTA 3BCRA 1UKCA 1E7SA 3WGQA 4LUCA 2ZAYA 1N2XA 1WF3A 3GRCA 3EC1A 4KWIA 3F5FA 3LX5A 3T4EA 5EI5A 4UM8B 1MXHA 1S9HA 1ZD2P 2YZNA 4G9BA 3TO5A 2C57A 4MPRA 3W9BA 4E5UA 1QH1A 4WKPA 3UFBA 5AVWA 2I4TA 4ENUA 1WE2A 2B36A 3UYLA 3ZVNA 4G0VA 4FDMA 2WWTA 3QMWA 2Q7XA 3B6ZA 2ZYGA 4M87A 1T2EA 1JHOA 1A9XA 4FWTA 4MAMA 3FJ1A 5BORA 1N9GA 4N5NA 4CEHB 3UW1A 2GJ8A 2HZBA 2W6QA 3B38A 4DIEA 3ONNA 4RGBA 4Y67A 2C2HA 4NS1A 3RRZA 2WMYA 1WBJB 4W8OA 4C4XA 1T43A 3WGLA 4O3MA 3ZX5A 2KQUA 1NUHA 4MICA 4Q7KA 3GWGA 2OLJA 4O4IA 4V0RA 3JQBA 2C4TA 3M3PA 4WOCA 5EESA 5FULA 2M6KA 4BVLA 4BE7B 2EJBA 1L4BA 1BEZA 1THTA 1INLA 1I3NA 2MT9A 3OJOA 4KXNA 4UM5A 4DWOA 1W36B 2ODPA 3IQEA 4CEJA 1TYBE 1ORTA 3P9SA 3DAYA 4JUFA 2NAFA 1E59A 3BK2A 4NXNB 5BWCA 2PU5A 4WH0A 3N2IA 3UMGA 3PSAA 3UJ9A 1OX6A 3OOWA 2QD1A 4YVFA 3KM0A 4EUSA 1C9JA 4R05A 1XC7A 4UBJA 3W4JA 1AQLA 5BXQC 4ESEA 4XB1A 3ZVRA 1CP3A 1D4OA 4M88A 6ADHA 2QLFA 2TMDA 2ZWVA 3V4LA 2PJDA 5A7GA 3GJ0A 5FCDA 4LV6A 1YB1A 1HDYA 3ZHQA 1NYTA 3REQA 2IXDA 4L9RA 1OGJA 1FK8A 1G21E 1LGYA 1R0SA 3ICCA 3OPNA 2ZAMA 3QBVA 1DUSA 3LKVA 4G1VA 4MUFA 3DTYA 3WMRA 1IXYA 4BO1A 1T2CA 4DLRA 1BU5A 1Q20A 5D00A 1GKIA 3GGCA 3P9PA 3AV0B 4XXHA 4PVDA 3RUFA 4EUHA 3TWOA 2QD5A 2R66A 2HQOA 3ZE6A 4LV8B 2VOEA 2QPOA 3D3WA 1QSGA 1DB3A 3NEYA 1R12A 5F2EA 1MHPA 4NI5A 2G1UA 2J5KA 4G8JA 4WGFA 1UJ6A 1BJRE 1D8TA 1XMPA 4UCQA 3PGMA 1JG1A 5ARBA 1DAIA 1JT9A 1OLXA 1Y6GA 1NONA 4PR3A 2IXEA 4TKUA 3K2QA 4MUGA 5TF0A 4OG2A 2W0MA 3IP6A 3NAZA 3NVMB 3ZS8A 1YR6A 5FWNA 5FNZA 4NCKA 1FUIA 3B20A 1D9ZA 1QZTA 3GRAA 1NKSA 1KOJA 1ZUD1 2O8VA 1IB0A 4QA9A 5YASA 1GRNA 3PI6A 4AUEA 1K5GA 2EHDA 4K9QA 4F4UA 1JILA 1SKQA 3EMBA 3SS8A 1V16B 4TKMA 4UBLA 4E33A 3LVBA 1CJTC 2JBWA 2Z6VA 3T7CA 3HZOA 2POQX 3CKLA 3HN2A 3KHTA 3BGIA 3S0JA 2NTYC 1SBQA 2XOKD 3EMVA 1Z73A 1WD5A 4IIYA 2IYFA 2PVPA 3HADA 4DEYA 3QU7A 1H6AA 1E2BA 3HVHA 4AULA 2Z58A 4EH1A 1R0BA 2YMPA 3I4FA 3C8UA 1QIDA 2BMFA 2P4UA 1KP2A 1LDNA 4WKBA 5G3ZA 1Y33E 3N1UA 1LPMA 4C4OA 1XWIA 4RK4A 1XVVA 2V4MA 3DHVA 1Q7BA 3ICVA 3OQVA 1WZNA 5AOCA 1DXHA 2NTJA 4DMUB 4EI8A 2PQMA 1VGRA 1ZSYA 3QEOA 5A4JA 3ZI4A 2V5UA 5T7BA 5G02A 2OHXA 2W8BB 4CM7A 1R1DA 1NXWA 3W05A 2RGNC 1WB4A 4ZYTA 3LQ1A 1GV0A 1OAAA 3BILA 4JI1B 5F7XA 1NG9A 3G0OA 4TV9F 3LV8A 5IXYA 4G5GA 4NECA 3KXIA 3U80A 3QXXA 3OZCA 2SECE 3ND6A 3ZUPA 4BQRA 5JMTA 4RKYA 3K09C 2PUWA 2YWDA 2J0QA 1AXGA 1EA7A 1TC2A 4OXKA 1CJKC 3WK4A 2OZEA 4OBBA 1V6CA 1W59A 2XCLA 2H8GA 4DDWA 4IJWA 5K4HA 3A27A 1TOAA 3RVBA 1H1TA 4D4GA 2X22A 1B8OA 4OI1A 1ETUA 4KN9S 2O8CB 3TMAA 4EK9A 2N0SA 3LECA 1UPCA 4KYUA 1VFPA 3QFHA 1KFEB 2QXUA 1MEEA 4IHAA 3WHIA 2AEJA 2RJOA 1EIZA 3OQ1A 5DNAA 4BMSA 5KYWB 1WUHS 2IHJA 2IZ1A 2GEUA 5HNKA 1I2MA 2GAJA 2QDXA 2JEZA 4LG1A 2ZI6A 5TGZA 2R4UA 3HK2A 3D2AA 1TK9A 4OGLA 2B5OA 3PNSA 3NDRA 3DWFA 1IQ0A 3U13A 3BMQB 2D0DA 2QF7A 4UMFA 4BAUA 5LDGA 2P3OA 3E03A 2AC7A 5IMBA 5CHEA 2CSXA 4R68A 4RXMA 2VJAA 4LDQA 3R9IA 3MNFA 1KU6A 2BJVA 3LOUA 4BEJA 1LRKA 1BDIA 2C2GA 1I24A 2IV2X 2ZBPA 1IG3A 2NVUB 3AFIA 1W4LA 1AURA 2G72A 3THYB 4QC2A 2I6XA 3E0QA 3TEMA 3QPVA 5IT0A 3GGOA 1D4AA 4V39A 4O8CA 4WK6A 1APBA 3QBEA 4UUQA 4AS3A 2ODTX 3ETCA 3MBKA 5EA2A 3PQDA 4HLUC 5L6LB 1ZK1A 2PT7A 2EEPA 3AI1A 2A4MA 1T0UA 5KVAA 1PZEA 3EIUA 3AHDA 4WA7A 3E9CA 4JT4A 3U7IA 3QUTA 4FHFA 3VUEA 4CMIA 3RFXA 3VRHA 1HWYA 1L7BA 5CM9C 3KL2A 3R9WA 1CUXA 1KZ9A 5J58A 3OQJA 2IZZA 5C46F 4N6GA 1ZCBA 1OLXB 2G6BA 1SXJC 2M6RA 4D8XA 3FCXA 4DV5B 4KRFA 1AQUA 3QP9A 1PT8A 1ZVQA 4J3JA 5GOZA 1B7GO 3U2QA 3WNVA 3FX2A 3WS7A 1ZCFA 5IKOA 3MBOA 1USWA 5EERA 4JDUA 5JRZA 2JI4A 3A6PC 5ALIA 2OOKA 4RMGA 5CW1A 1HLFA 4LX8A 1FLDA 2X14A 3WO1A 1U90A 2VH1A 4N6OA 4HWGA 3DDWA 5FTNA 2NADA 3Q88A 3R3VA 5AI9A 2EFCB 1KORA 3H5VA 3U9LA 1E5VA 4YYEA 3TINA 4ZGWA 2X5NA 3V80A 4BNGA 1HDIA 3JZMA 2PZKA 1SXJB 3O8RA 5D84A 4OQYA 1CY4A 2R47A 2XTZA 1DFIA 4YJGB 4FHGA 4F96A 3B1XA 3PCRB 2OV2A 3HZZA 1YJ5A 4H08A 3QMPA 2AXPA 1U4OA 2CLMB 2FW9A 5L51A 4LF6B 4YJGA 3I42A 2HA7A 4R4JA 4DYDA 4K9OA 1E3IA 3KV1A 1L6RA 3LYUA 4X41A 2Y6UA 5DYWA 3QTTA 4EA8A 2CZQA 4HPWA 1XRNA 3LYHA 1YIOA 4KPEC 3IJ5A 4JODA 2C3YA 3F2IA 2BSXA 2P8JA 3ONWA 1TMKA 4DAOA 3IBSA 3QF4A 3W79A 4ZMSA 2H52A 2EYUA 2BFCA 4RZXA 1LCIA 1XOIA 1L5ZA 1EFRA 3PF8A 3C6KA 4E5NA 2DB3A 2WJAA 1T6NA 1GUAA 4EA9A 2IUYA 4BFXA 1XMXA 4HNTA 4LA4A 1U1GA 4YDHB 4P7FA 5FO1A 1Y4AE 3VYWA 2D2EA 3VR4D 3HXOA 1A4IA 3FUWA 4NMHA 5B3KA 3EDRA 5EIBC 1E79D 2JLWA 3RS5A 3RKRA 3VVCA 1LV7A 1C0EA 1FP7A 2AV6A 3B3AA 2WIJA 4KRGA 3SNHA 4GPD1 2VVTA 4I3FA 1EZZA 5ALTA 3VQTA 3BIOA 3IIJA 4NE9A 1IIRA 1AZWA 4RPLA 5LL6P 2A0WA 2RK3A 2ZSEA 3KUCA 1TVMA 1XD2B 2V8BA 3EFBA 3OKPA 3QPDA 1X86B 3KPJA 4H4EA 2PZBA 4G9GA 1JKIA 3PL1A 4K8RB 4LI0A 1T10A 4D56A 3LHDA 3OQNA 1G2IA 1VLVA 2FE4A 2ZSHA 4L9WA 4AB1A 1X7DA 1E3LA 2IEDA 3UAVA 2WHEA 2WJGA 1UOQA 1VZ3A 1FDIA 2OZLA 4LQDA 3SJAA 2ZYTX 3OQPA 4Z2AA 1UDWA 2EFHB 3UBMA 3OQHA 2NQ2C 4H1UA 2CDAA 1JPVA 1NVUQ 2Q21A 4JX9A 2G1KA 1MJ5A 4C0LA 1VP9A 2I8LA 2UYOA 2BEVB 2B8JA 2Y1KA 4P4SB 2G4VA 3AW9A 3F5MA 2ZWAA 4XD7A 3TB6A 5IXJA 3RV3A 2QRKA 4H7PA 1KPGA 3B51X 1Q0UA 3NI2A 3DZGA 3OQBA 4JKIA 5IM5A 3SMVA 4LHXA 4BL5A 4CQMB 5I5EA 1XLWA 2BN4A 4LW8A 1CVIA 3DEYX 3C8ZA 5FJIA 3AF2A 2D13A 3D2BA 3TDMA 5DHRA 4LNUA 1GVNB 3D8SA 2GLXA 3KKZA 4D0RA 2PBZA 1Z5ZA 2VNHA 3CX6A 4LV5B 1HK7A 3LPCA 3BMNA 3GOHA 2CFIA 2DUJA 2WSYB 1I13A 1Z0FA 4UEOA 4E3WA 1KDPA 1MXFA 5CCEA 5AI0A 1UC8A 1WHTB 4JJAA 3FPJA 1NFFA 4NPHA 4ZOEA 4YCJA 1A5SB 4JEHA 2Q1YA 2UYHA 2QN2A 4OX9B 3VKGA 3F2VA 3IP7A 1EVLA 3UGQA 3NPMA 1X74A 3DMGA 1BFKA 2EP5A 4M8LA 5EXDA 3FGPA 4EHJA 1C41A 4MW6A 2FPGA 4TS1A 4QU0A 4YTEA 2WKRA 4V24A 4OGGA 2EW1A 2DQKA 4KGDA 1QUFA 1L1FA 3UV3A 4NOLA 3HP1A 1GQ2A 1CDZA 3NC1C 4H2DA 3RC7A 1IIBA 2AC4A 4FE4A 1WOMA 1PBTA 3OG9A 3IKLA 4QRHA 2ET6A 1Y9EA 3GD7A 5K01A 2IH5A 1JXAA 5B4UA 1X2EA 4MARA 1WMSA 2OHVA 3NWOA 2IIPA 5AT1A 2L2QA 4XGRA 1KH3A 3JYLA 4WKGA 1Z2EA 2XUFA 4TZ6A 3LHIA 1P3DA 1GGHA 2LP4Y 4MV5A 3JAKA 2ZBGA 3B8HA 2VLBA 4FYHA 4QL3A 5EYPA 4BFSA 3T52A 1D4ZA 4CETA 2PJRA 3I6IA 1IVNA 3ACCA 1E1KA 1M10A 1XBTA 2Q0SA 5FR2A 1M5UA 3VVMA 1BCSB 4UUPA 4Q1VA 2GESA 4B6SA 1DZ3A 1NXQA 3D8NA 3ENVA 3NT5A 1SH7A 5B3AA 3WLHA 4LXIA 3A6LA 4OBWA 1BS2A 1SG6A 1U1FA 1JDVA 1W88A 5DU2A 2WWVD 1ML3A 1H0RA 6Q21A 4HL6A 2XIQA 3SQWA 1DDGA 3AOGA 3NHAA 4BE4A 5GPBA 1Q77A 3DUWA 1NQWA 5FNVB 4N6NA 1SU4A 4RLQA 2FSPA 3SOZA 2GA8A 1KMHB 3EZNA 3HKDA 1N4AA 2R65A 4UHFA 4WFJA 4X1KB 3L7LA 4BJ3A 2OR3A 4F6LA 2ZDHA 4JUAA 5WRFA 5DTQA 5HF8A 3ZTWA 1RACA 1X9GA 3VTZA 1JJAA 3PC4A 3K1AA 1QZXA 2ATCA 2ADFA 3ROQA 5K3OA 2I2WA 5EUMA 3ZEIA 1P1HA 1GZSA 1PLLA 2XECA 3EF3A 3QTBA 4F4CA 2QTBA 4PLZA 2CBGA 4ER7A 1Z63A 4NR0A 1OH6A 3A6DA 1IBMB 2FN4A 4FOSA 3W2IA 3AVVA 1TQ6A 4NHEA 3EX7C 4QOGA 5EOVA 1WEKA 1C30B 5SICE 1A8IA 4A16A 3TZQA 1E6CA 1WKBA 3EC7A 2IYEA 1EP9A 3KVOA 1RDFA 3AETB 3LC7O 1UKBA 3OPQA 3PGKA 4M22A 3EDQA 3IBGA 3N2YA 3OZVA 2MSNA 4LSGA 3SGLA 3VOSA 4ZDIA 4FFDA 2P6MA 4PG5A 4FMPA 4ESVA 2B4RO 4UFPA 1T9AA 2ZWPA 3FMPB 3HEBA 4PZDA 4DUGD 1J07A 1LH0A 1U3TA 2R25B 4WW0A 4GBGA 1PR1A 4M0UA 3RWOA 3K9QO 1L5YA 3W90A 4FCTA 4KACA 4A8JB 1GCIA 1NDQA 1OYVA 4YS6A 4EY4A 1W36D 4GI1A 3GFTA 4ZAVA 1ID1A 4NESA 3BEOA 4M1QA 5FYQA 10MHA 1R8JA 1YJQA 2O3TA 4FR2A 4NLLA 2NPIA 3OPYB 4RHUA 5EHNA 2DX7A 1XTTA 4FN5A 4X00A 4ATNA 3GUHA 2JS7A 1HQCA 1O6CA 3FI0A 3L46A 4O4JA 5H02A 3T3HA 3C4JA 3DLHA 5GZ1A 1DDOA 2WZCA 4NH0A 4C3UA 5EE1A 3CH5A 1Q0PA 1S7GA 1P62B 1G3UA 5A5DA 4NBRA 1QE5A 5BURA 4EY8A 2VKQA 3FOFC 3WYDA 1MEOA 1YHNA 2DPLA 1U28A 2GXUA 5AIAA 5BN3B 3KQHA 4JQOA 3S2FA 5FR1A 1ABEA 3T0IA 2WSLA 4A1OA 2PVCA 1VMKA 3H5WA 5FA6A 2O50A 3W7BA 1FTQA 5E6SB 4EO7A 2CVOA 4N3GA 2Q3JA 5ER6A 3K05A 4YT8A 1M6WA 5CFZA 1FSZA 4ZODA 5C51B 1Z2PX 3MCTA 1GPKA 1CQJA 2ECPA 1HRKA 4BZWA 3BDVA 4GQBA 3ZNPA 1PK7A 5IJXA 5HUJA 4OH7A 4UU7A 2NUBA 3AZQA 1M1YB 2I6FA 4QX6A 3KLPX 5L45A 5KNBA 1T9DA 4F6RA 2C42A 5J23A 4OLAA 3SQNA 3T61A 5IUKC 1PNRA 3TKAA 5K0BA 4ROSA 2Y2UA 4YJFB 4TWIA 1W35A 1OPRA 4XLZA 4UBKA 1N5MA 2IPXA 1Z0AA 3B6MA 3B36A 5AVKA 3VSEA 1GZVA 3F5QA 2ACVA 1W75A 4ZHQB 3BHJA 3CNBA 3JD4A 4GL4A 5HW0A 3W06A 4Q7LA 3BORA 5T41A 1KS9A 1WY7A 1CIJA 4M0CA 4MOWA 2DPGA 1MAWA 2VDNB 2X8AA 3QE4A 3NKVA 2KB0A 3L8FA 3HXQA 1TM4E 4HI0E 5DM70 2CLCX 1AQNA 2MOKA 2H4HA 2J3KA 2IH2A 1ZD1A 3TZEA 3AKYA 3Q5EA 2BGLA 1N2CA 3MJCA 1SK9A 3LX4A 2FSGA 2FZ4A 4Z53A 4L5AA 1V48A 1XVLA 2I22A 4ZOBA 1H0HA 1FF9A 1QPBA 1G66A 1WQ4A 2A1UB 5K0LA 5EJ4A 2Q49A 5BUZA 2BM1A 4Q7JB 1JR4A 3PGLA 4M55A 2QXYA 4IEFB 4NCAA 1JT2A 1T0JB 3OEYA 5BYJA 4V1CA 5JW6A 1OLOA 1ZGHA 4NZOA 3WGGA 1T3GA 4C4AA 4G07A 3A9VA 2ZBRA 3DAHA 3NV9A 5K9ZA 3FF1A 4OL0A 2X58A 1XAJA 1M1XB 2VC2B 3LHKA 2J9YB 3PHHA 4QLAA 1G291 4R01A 3V8NA 3KL4A 2J33A 4ZVOA 1GZ6A 3B5IA 1C29B 2PX0A 3CX7A 4IG4A 4S35A 5HZHA 5IG2A 4ECEA 4LFBB 2HNBA 3KEOA 1WSAA 2EJCA 2VAXA 3B1WA 3MS7A 3WG9A 3AUSA 2B61A 1G6HA 3R9XA 4YWJA 3ESCA 1SBZA 2O14A 4D5GA 4DQUA 1J1ZA 3KB1A 5EWJA 4Z9BA 1ZR4A 4I4CA 5HKBA 3G59A 3GLFA 4LYFA 3OZBA 3R0QA 4FYIA 1EUCB 3IEIA 2QM7A 3A9SA 4HB0A 2HU7A 2RGXA 5EMKA 1XTIA 3U3OA 4BFZA 4C0QC 1B15A 4DMKA 5CLGA 2BUCA 3RTEA 1VRVA 1B0UA 5KMGB 4QTZA 2WM2A 3N6VA 3JASA 3K8QA 4OHUA 1YHZA 4ZCIA 1X92A 3O8OB 1KYVA 1E79A 3EN0A 4KE9A 1PFQA 1KEKA 3FSJX 1C8KA 3BIJA 3IL2A 3PHIA 1GT91 4ZVUA 1P2VA 3M7IA 2VA8A 5IM4F 1ZMOA 4NAVA 3IV7A 3ZDZB 3L6CA 2GJ4A 4AJJA 1YD7A 4E5SA 1QVWA 2C7GA 2H5LA 3Q5DA 4Y6PA 1IBKB 3S1AA 1UFVA 3PTAA 1SPBS 5HYVA 4O4LB 2XE7A 2C59A 2JIZD 2R8XA 3FTCA 4O4IB 3RK0A 3TXYA 4HDSB 2VTBB 1L4EA 4MPDA 4HNHA 3TGWA 1LPNA 2VCYA 4FWIB 2VQEB 3TSZA 4WOJA 1W47A 2QP9X 1CXZA 2X2OA 2VP4A 1DTSA 2H5EA 1XWWA 4U6NA 3UCXA 5EAIA 4X7RA 1Z16A 4PPFA 4EBBA 4W5QA 2IJGX 1Q7GA 4KV7A 2YWEA 2AMJA 1U28C 4NMMA 1VE6A 1TKCA 4DLXA 2HRCA 2PIDA 4JGGA 5IYZB 5SYNA 5CD9A 4FDAA 3K6KA 4BMVA 3CUKA 3PGJA 4L28A 3PFIA 4OFWA 1EFPA 3V7NA 1P2DA 1XZAA 4GZLA 4NFLA 5CNMA 4L0QA 4OHFA 1Z4JA 1NF3A 2C5HA 3FUVA 2AG5A 2GHRA 3T3MB 1OGIA 2OCBA 3RD5A 4X1YA 1NVDA 1AGPA 3E7DA 4KQGA 1F0NA 1Z0KA 4YAKA 4Y2QA 1QAQA 4BLTA 2VJQA 2XUOA 1PWZA 1YJ8A 3VYUB 1P1RA 4CIXA 2EQBA 3DZJA 3BWXA 2YCBA 2Z3WA 1PG5A 5G40A 3B3GA 1G20A 1I1NA 2YNMC 1Y6ZA 3OH8A 4JP5A 1FU8A 1SUFA 4IP0A 5T57A 3FLBA 5DDIP 5L9AA 3IPCA 3WRXA 5U4QA 3WLPA 3HABA 3RC2A 2HZ7A 4IPTA 4MPJA 4NICA 4OHOA 4Q1EA 4D3YA 2GM5A 1MABB 1WU8A 2RGDA 1JWBB 2DCUA 4HATA 1H2ZA 4YJHB 4H0NA 5DHAA 4EG7A 2E87A 3NBYC 4RF3A 2QYOA 2FDRA 821PA 4DMRA 2GVZC 5HJ5A 3EXFB 1KJ8A 1WP4A 3JQAA 4OVKA 1BA3A 3DC7A 4EVSA 2OCLA 2XMPA 3FCAA 5BMVA 3BXZA 2EWWA 2EFYA 2PS3A 1VE3A 3DH0A 1L7DA 5HMLA 3CHYA 2G67A 3P20A 2QBYB 3SY8A 4GM4A 5JH7B 5IBRA 4X3PA 4PZCA 1O0SA 2ON6A 4JX8A 1E0JA 4MI1A 4KLRA 1FSPA 3E9NA 4COKA 5BV8A 2D5CA 4J0FA 4YAUA 2HKIA 4ZQGA 4NOJA 5P21A 1K3TA 1O7JA 4TYYA 1PFKA 1E77A 4GECA