3L6RA

The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
319
Chain Sequence
AQYDISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFIRGALNAVRSLVPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Serine racemase
total genus 110
structure length 319
sequence length 327
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2009-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6rA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l6rA02
2CLLB 4D9MA 5B53A 2PQMA 3IQHX 2CLIB 1CW2B 4HN4B 1Z7WA 5I7RA 5BW6B 4HPXB 5J43A 5B1IA 1WBJB 3X43A 1K3UB 2TSYB 4L28A 1WDWB 1K8XB 3R0XA 4L3VA 2CLHB 5B3AA 1M54A 5DBEX 4XUGB 2ZPUA 4JBNA 2BHSA 4HO1X 5CGQB 4D8UA 5I7AA 5D87A 1BKSB 1K7FB 1E5XA 3DWIA 4F4FA 3L6CA 3ZEIA 1TZKA 2DH5A 4HPJB 1V7CA 4ZU6X 1C29B 1TTPB 1QOQB 2ISQA 1Z7YA 4D9KA 4JBLA 5E0KB 1VE5A 1VB3A 4QYSA 1X1QA 2EFYA 3SS7X 4D9CA 4AECA 1V8ZA 5DVZA 1C9DB 2GN0A 4LMBA 4D9EA 1TJPB 3TBHA 1J0AA 5B36A 1K8ZB 5I7HA 1K7EB 4NU8X 1J0EA 4LMAA 5I7WA 3V7NA 4KKXB 5D85A 1A50B 1P5JA 3AEYA 2DH6A 1F2DA 1WTCA 2O2JA 1O58A 2C2BA 2TYSB 4COOA 4L0DA 3BM5A 5HBGA 1TZJA 4D99A 5IWCA 4D9GA 3L6RA 3AEXA 4L27A 3VC3A 4D9IA 1C8VB 4LI3X 2GN1A 1A5SB 2Q3CA 3FCAA 1A5AB 5JJCA 1VE1A 1Y7LA 1TYZA 2BHTA 5D86A 3VSCA 4D97A 1KFCB 4D92A 1TTQB 1TZ2A 3DKIA 1UBSB 3R0ZA 5DW0A 1KFJB 3T4PA 5I6DA 1J0CA 2ZR8A 5DW3A 2V03A 3PR2B 5EY5B 1PWHA 5KZMB 5DBHX 3PC4A 4ZU1X 4AIRA 1KFBB 4NEGA 1KFKB 1J0BA 2TRSB 2CLMB 4WX2B 4Y6GB 1TZMA 2JC3A 4D9NA 2WSYB 1UINA 4OFXA 1FCJA 1D6SA 2RKBA 1KFEB 4I1YA 1PWEA 5KINB 4ZQCB 3DWGA 4HT3B 5B55A 3SS9X 2CLEB 2ECOA 2ECQA 2RHGB 1K7XB 2CLFB 5CVCA 2D1FA 1FUYB 1WKVA 2GN2A 1QOPB 3IQGX 2EGUA 4H27A 1RQXA 5C3UA 2CLKB 1TDJA 3VBEA 1KL7A 4D8TA 3PC2A 4D9BA 4D96A 1V71A 3CEPB 1K8YB 3IAUA 1J0DA 4OREX 3VSAA 5IXJA 3VSDA 3X44A 3L6BA 4PCUA 4D9FA 5J5VA 2J9YB 4D8WA 1A5BB 3HMKA 2ZSJA 5I7OA 1OASA 1UIMA 2J9ZB 5B1HA 3RR2A 4IL5A 2RH9B 2C2GA 2CLOB 5D84A 2Q3BA 2J9XB 5IW8A 3PC3A 3SPXA 1JBQA 3FGPA 3IQIX 5JISA 2O2EA 1BEUB 1CX9B 2Q3DA 5T6MA
chains in the Genus database with same CATH superfamily
1MTOA 4AQDA 2NTJA 4C05A 4WERA 2X0FA 1L7QA 1WG8A 2XYPA 3A2LA 1AIPA 4R2XA 2V1UA 1C14A 5CDUA 1ISHA 3RYCA 3FZGA 3WLFA 4R8SA 2QT9A 3DMFA 1EHYA 1ZIYA 1VLHA 2AT1A 2V1XA 3MWKA 3OU7A 4O4LA 3KX2A 4ER3A 5H0IA 1X0VA 3V2UA 4QGAA 3TZBA 5KWSA 1GGNA 2IV3A 4KAFA 5JT1A 3OTQA 1QQTA 5JNSA 2RAVA 3F71A 4YJDA 3WRYA 2HSJA 1C81A 1FTSA 4OM8A 3QKSB 2JL1A 4UHFA 2NO5A 5HG0A 4QKQA 2BEUA 4KX5A 5KEIA 2C00A 1E3TA 2WKSA 4QOIA 3JARA 1XPOA 3ZVKA 1W4CA 5U9CA 3SZUA 2DQSA 2VQFB 5DI3B 1P7WA 2PM8A 1UT6A 2IU4A 2KBFA 5JYCA 4P22A 3ZE8A 1M34E 4MQEA 4N82A 4YIHA 1TM2A 3EMKA 4Q1BA 4PAWA 1AN9A 4J0QA 3ZE9A 4D4GA 2ZWAA 4EH1A 3O6VA 2NSJA 4HNQA 2RK3A 2V0CA 4FLFA 5INTA 4IJ6A 3CIOA 3ZK8A 1JPVA 4B40A 3HZOA 3HUTA 2CKMA 1KIMA 4OXRA 2W70A 3B3FA 1XRPA 1T10A 4W7SA 3FKSD 2O8NA 2GJSA 2JIDA 3HBMA 2CB0A 4WCVA 2PKRA 2MMGA 1P77A 2VPQA 2BR4A 2IE8A 3K2IA 3VDMA 5IHXA 2HWKA 5C7LO 3RQIA 3C1AA 3EAGA 1FUUA 5F4BA 4ID3A 3SI7A 4E6PA 2BKAA 1N6IA 2Q0HA 1CWUA 4FHFA 5JTUA 1Y1SA 1MH9A 1FMLA 1JG2A 2AK3A 3IUEA 4IDNA 4G1CA 1XU4A 2Q2QA 1GPNA 4ODIA 1Z06A 5ALFA 5AWFC 3T7IA 2VDOB 4IDCA 4EVRA 2QG4A 3M1AA 4DSUA 2NP6A 1R8QA 4AKTA 4C78A 2DQYA 1VBNA 2G3YA 5GOZA 1UKVY 2SICE 3TLCA 2G5CA 2QMQA 5KREA 1PYGA 1XEWY 2ECKA 1X42A 1ZGZA 2O1XA 1OILA 2H1CA 3N0WA 3FHCB 1K3TA 3JALB 3UKJA 5EHXA 3EBPA 4PTZA 2I0FA 4INPA 4DLBA 3GT4A 4O5AA 5DHRA 4ZXPA 4D44A 3H0EA 2GARA 1YJBA 2VK1A 3NM4A 3CLSC 5LA6F 2PMEA 3U62A 3IELA 3PDIA 3DZBA 2WUVA 2ENWA 4OGLA 2QTGA 3T5DA 4WLNA 3WISA 5CDFA 1DFHA 4ZALA 1NUAA 1XTBA 4RM2A 1J1IA 1XL1A 3HU5A 3ZCQA 2FZKA 3TSOA 3WX0A 3HXMA 4RFSA 3U1BA 5IKXA 4CEIA 1FBTA 3ITEA 4MK4A 4WKPA 5E7JA 2PNJA 1IXYA 1LFDB 3TBFA 3QX3A 3NHUA 4EPRA 1V6AA 1ZG3A 3RRMA 3P96A 3R20A 3NVMB 4RF5A 4MHTA 1QF6A 1ZIPA 4TXLA 4EY7A 1JYEA 1CRQA 5DHSA 2NU7A 1JHZA 1CR6A 1H1LB 2Y1LA 2BEJA 3A3OA 1OCEA 4LTDA 4QAJA 4E5SA 5EJ5A 4CEHA 4EUKA 1TQ4A 2GKOA 1ML3A 3AVQA 1ZKDA 4YP9A 2BEWB 1BQ3A 3BB1A 5FYQA 1WABA 4BKMA 1OC4A 2WFZA 1M10A 1FFGA 1TYBE 1HA3A 2Z9CA 4FSDA 1ISFA 4ZEXA 2MYPA 3V7FA 2AX3A 9LDTA 1B1CA 3DYVA 1NTRA 1F2VA 1P2VA 3AM4A 3LHDA 2FP3A 2P6PA 2WJWA 4FIDA 4TLEA 3C6QA 1E1YA 3KEFA 5AVVA 3FZEA 4US2R 2ZTVA 3ES9A 3LK7A 4MLPA 1NBME 1IPFA 3RVQA 1N2OA 2IEBA 1UFRA 3E0QA 4B3GA 1S4MA 3LT5A 3LUFA 1LI5A 2WFMA 3B8HA 3GF4A 1G4AE 3TMYA 4A3SA 5KVVA 1NBAA 1Z26A 3OZAA 4GWKA 5K0LA 3PLNA 1WZUA 1C0EA 4DTCA 4LK2A 2O2IA 1PZEA 3H4VA 2R1TB 3VH1A 4A73A 3U6KA 2DHDA 1L5SA 2X0RA 3C6MA 3DGFC 2LP4Y 3DHNA 5GZ1A 1ZM4A 5JS6A 2Y1OA 5GZ3A 2VO1A 2WKQA 1F0KA 4Q01A 1N5RA 2V4MA 2AOVA 3FHJA 3NO4A 5A6SB 2P3LA 3QIVA 5AQ1A 1ZGGA 4TTQA 1C3LA 4B35A 3TMAA 4EG3A 5BSUA 3TR6A 4MUYA 2FP4A 3LVFO 2HAEA 3SEFA 4Q1FA 3E23A 2IYUA 2CDCA 4RZUA 1LBSA 2F9LA 5IUJC 3LPLA 4KQ2A 3ELWA 2GZDA 3NPMA 4AY3A 4M55A 1AS2A 1MKYA 5FPKA 3RAFC 1TTTA 1GDDA 4O3MA 4ME6A 4DV4B 1T5SA 3C14C 2YOHA 3H1TA 2ZQYA 1L7DA 1A96A 1T5TA 2NYAA 3GRVA 3KJGA 4ROTA 4ZOEA 1UXIA 2IU6A 4I1OA 4TT3A 1R9JA 3TW8A 3KETA 1NMQA 1HURA 3IVAA 3K3PA 4RHTA 4FOPA 1R9GA 2ZWMA 5BOVA 5E0OA 3AP1A 3DMGA 3QE3A 4GXQA 2I91A 5AKXA 1I5OA 1R6DA 4B81A 2OCKA 5H02A 5C51B 1NX6A 1XDGA 3QLVC 4FEAA 3T6KA 3R3SA 4YUWA 5LQJA 1SQ0A 3QZUA 2MHCA 2VJDA 2HGZA 4ICIA 2O4CA 2VK8A 3O75A 5KZMB 3GO4A 4YR9A 4F8JA 2OYSA 2YJ5A 3FI0A 4GFDA 1XV5A 3PZRA 1CF9A 2TRSB 1WD5A 4FFBB 4LPKA 4LXIA 4CL3A 1ZJYA 2BFPA 2ZAIA 3MPOA 1GUDA 4IGAA 1CY0A 1C3OB 2EVWX 4FFNA 2QTNA 2C42A 3C8ZA 4KE6A 4IICA 1O97C 3FLBA 3ZCSA 4DTIA 3OJEA 2W0MA 3UICA 3GMSA 4I9FA 1YU9A 2BP7A 3U44B 1PLJA 4QQ8A 4J0DA 4Q03A 5GOTA 2BEKA 1BS1A 2QN9A 1TAHA 3SJAA 2CLKB 4TWBA 1U1EA 1QG2A 4OOEA 1CC1S 1VQ1A 1AKTA 1L7EA 4MTCA 3F98A 4MITA 4LJ6A 3RG8A 4WVFA 5EE9A 2AFVA 3E2IA 1AQIA 2QRLA 2OVFA 4PO1A 1SVSA 2I7XA 3RIHA 4PFSA 3V4LA 2UYYA 2X41A 4WN3A 2H57A 1GQYA 2DWPA 2PJUA 1A0OA 2R5WA 2ZREA 3IVCA 4KQEA 2WMOB 4A8TA 3UCEA 2BTEA 4L02A 3SX0A 1Y1TA 4R2MA 4D4LA 3KU4A 3RWMB 1JJ7A 3WHKA 1HNZB 3Q7IA 3VM6A 3HWWA 3G1UA 4LC0A 4JL5A 5DYWA 4P1ZA 4PZ9A 1RPNA 3O93A 5CVEA 3EF1A 1ICIA 5JEDA 2CNWA 2CJWA 3L93A 4I3GA 3KFXA 3CR3C 4DEVA 1WHTB 3KT3A 3GA0A 4BO2A 4RMJA 2WHRA 4BTVA 3U80A 1P9NA 4A7PA 4KTVE 3E4DA 3K1AA 1XNQB 2NU6A 3BZWA 4LQ4A 1QIDA 2BKLA 2PO5A 4PPQA 1IB6A 1VKRA 4LDAA 3VYUB 5D87A 4YY3B 3VR6D 2DEUA 3IMCA 1RXYA 3VSBA 4G8CA 1E2LA 5HOEA 2E6UX 1Z5WA 2OGUA 1DG9A 4ZVNA 3OTIA 3R3ZA 4REQB 3P71T 3QKWA 2GO1A 3T1HB 1R1DA 1I13A 1QHHA 4OMFG 1U0RA 5LLSA 1G17A 1K6JA 3UQZA 4ALLA 3IVGA 1GPAA 3ZWPA 2VJNA 4N0MA 1T9HA 1DG3A 4JLWA 1Z4MA 2QRGA 4EI7A 4F7WA 4KAXA 1Z22A 4H1HA 3ZKWA 1CRWG 3UAXA 2PG3A 3LUJA 4ENVA 5IJWA 1K66A 4ZCTA 4YDRA 4I4NA 4FR0A 5K3DA 2VDPB 3B1JA 3O2SB 2HCBA 3GGCA 4P93A 2P11A 1C0PA 4CF6A 2PH5A 4WFIA 5AXAA 1QE5A 2IH4A 4AK9A 3NHAA 4DMFA 2WTUA 4OUKX 4KAAA 2ZJ4A 3QPBA 4KG7A 5B7GA 3NHYA 1FVXA 1QIMA 4B5KA 1DC7A 3W77A 3G49A 2CF6A 5CB4A 5JYBA 1LBEA 3UAVA 4QBHA 1UJNA 4FKMA 4FXOA 3VC3A 4EZBA 2WA2A 1ATZA 3FPAA 2XECA 4RYDA 3ESXA 3P26A 4TZKA 1G98A 1FP4A 4NOLA 3H2JA 4CWAA 1HZZC 4G2TA 5AXDA 3MT0A 5IT5A 1D04A 3M9LA 1AK2A 1SUEA 5CM9C 4UC0A 4YASA 4AYXA 3G0GA 4J7AA 1GGKA 4UAJA 1SU6A 3VVBA 2DKNA 3UGTA 2IXTA 1DUIA 2YJGA 1EDBA 3DL0A 1IB0A 3O8QB 4UVGA 4CLXA 1KFKB 4ARZB 3HPRA 2HBYA 1MOQA 1Q1NA 2G07A 3EIEA 5E2IA 4EYEA 1OX4B 1P0IA 2WILA 3ASVA 3P9NA 1T2EA 4X3OA 4KKVA 4FC6A 1D6SA 1NMYA 4IKEA 4XYLA 3W5IA 3MT7A 2QGNA 3HYNA 2XUHA 2GFQA 1YDMA 3LW7A 4I50B 4Z9BA 1VKHA 1U9YA 3QFHA 3ST7A 4X41A 3BMOA 3DQZA 4GT1A 4MB0A 1KAHA 3HKDB 1KVTA 1FOEB 1M72A 3A9SA 4WLOA 4DSZA 4R05A 5BWOA 1A27A 2CLFB 1FVHA 3KZKA 3TFQA 5I3CA 4BGUA 1W47A 4WACA 4FTWA 3V8QA 1HH4A 1T1IA 3QP9A 4XFJA 4CFZA 3P9QA 4NYMR 4M8SA 4P84A 3VSAA 5FBRB 4ID9A 4QBGB 5I7VA 4J1TA 1F2TA 4WSOA 4ZZ3A 2PGXA 4F2GA 2IYXA 2MR6A 3LSYA 1CR0A 1UAAA 2QTCA 3W4IA 1BIFA 1AGXA 5IKEA 1NVVQ 2VHTA 4R2IA 3PX7A 4ZTBA 4U63A 1QBKC 1OKKA 2Y0BA 1V2GA 4RLQA 3QJ5A 2MIIA 5D2CA 1WL8A 1VCOA 2WQ6A 4PGFA 5MHTA 1E6KA 4WXRA 4NCXA 4S1TA 3O4JA 2ANBA 4B3MB 1TQ8A 5ALSA 4I2VA 5JAUA 1WB9A 3OI7A 3R0JA 1PQ4A 2KLBA 1TZCA 3OLXA 4UTVA 4HLNA 1LK5A 3HBFA 3IAAA 2VJKA 4QDOA 1TF2A 3KSZO 1DKMA 3WLAA 3NBZC 5A4MS 1DBWA 1U3DA 1Q15A 1R00A 4IZ6A 2NQ2C 1LQTA 2ROQA 5K0ZA 2BUCA 1NW3A 3AUYA 3GFSA 4PFJA 5AI9A 4CXMA 3SAJA 4CLRA 4XUGB 4J4HA 3KUDA 4YV2A 5SY6A 4C06A 3SHQA 4P4TA 3FPGA 3HNRA 4I6JA 4QNNA 4ER6A 1NNSA 5LBUA 5BQXA 3I2GA 4GD3Q 2JKZA 5BV2P 1YA8A 2YJ6A 3K94A 1EFPA 2J3QA 2UUPA 3GK3A 1ZK1A 3S4YA 2NTYC 3O31A 3TLZA 1KAQA 3IV9A 5E0KB 1NVBA 4UTXA 3NUZA 4BECA 3DJYA 5LWQA 1N6LA 4Z8XA 3GCGA 4B8WA 2V7XA 4YRLA 1D7OA 4L72A 4KPEC 4LAFA 3AJ8A 1ZVVA 4DIOA 2RGYA 4H4DA 3UQYS 1GUBA 2WWIA 3M2PA 3Q98A 5HE9A 1VZ2A 4DUGA 5K99A 1A4IA 1YZTA 3X2FA 1IN5A 5I9NA 2F48A 5LCXA 2X8JA 3GJ6A 1GV1A 1W88A 4B6JA 4RA9A 5K3SA 3T3DA 2O2GA 4RQBA 5JCOA 4WMLA 1U3GA 3E3AA 2HY7A 3CBQA 4FDLA 5FEUA 1VCNA 3E7DA 4UEOA 1LNSA 3VJKA 3B48A 3K09A 4QFDA 5AVYA 1A5AB 2FV8A 1YZQA 1QV9A 3CHYA 3GZTB 1JDNA 1TECE 3KKOA 4Q4AA 2RONA 1VSBA 2I3BA 4PLFA 1WXWA 2W7TA 3G8YA 5IVDA 4K9KA 3RV3A 3V34A 3ZHQA 3B6JA 4Q1DA 4BNLA 1YVPA 1WX1A 1Y4DE 3DKIA 1QH0A 3ADOA 1KRHA 4Z0TA 1FJ2A 5GAJA 3UKOA 2Y0DA 1Z15A 3LWBA 2V03A 3ODPA 4L74A 4UDXX 1TX4B 4F5WA 5BXYA 4NG4A 2A35A 1HTBA 4PRKA 3PUYA 4TSRA 3V1KA 2FWBA 3QUSA 5LSAA 2P9GA 1PNQA 3U4QA 2AQIA 4K6FA 2BGIA 2JLYA 2AJBA 3SQDA 4WFKA 1PS9A 3ZXSA 4CCYA 3HXKA 1ZSNA 4FJ1A 5HF9A 5F3RA 4LDJA 4PBSA 2ZB2A 1IXKA 1RCFA 1SUIA 4XUDA 5J4KA 1W46A 2B7LA 1ZJ4A 1NJFA 2PTHA 4DV7B 1LK7A 1SVIA 2Q6IA 5GGXA 1NVKA 1QOPB 2M6RA 2AG6A 1IM5A 2JHPA 1M1YA 2VNSA 4KB5A 5EXEA 5I4KA 2O8FB 4HKTA 2RBKA 1PWYE 4FHZA 1OI3A 2YNMA 4BQPA 1GKUB 4C0LA 2VYVD 1CR1A 3EMVA 4LVNA 1NPYA 1X80B 3BIXA 1SEVA 3QVUA 4KQGA 4ZVKA 4XYGA 4EM6A 2FWMX 4Q9KA 1S02A 3K0CC 4URZR 1Z47A 3MTQA 1CY8A 4PS0A 5HZMA 3D8BA 1TZBA 1S3SA 1LLDA 3HV2A 4OAQA 2QTFA 4HDKA 2Q45A 1H3NA 2IELA 3P0FA 1COWA 2W8ZA 3RBVA 4MDFA 2WDZA 2FPOA 1KDPA 3WGZA 2XVYA 2HW8A 1V8BA 2H1HA 3KQPA 1LC0A 3VU9A 1CFZA 1SCBA 2R7KA 2ZTUA 3O4IA 1WP9A 2O4UX 2YWCA 4PC3A 1UBKS 3FH0A 3S5UA 3RS2A 1PK9A 1C1DA 4CU2A 3B6ZA 3R5HA 5KYKA 4QECA 1YAHA 1B14A 3FYCA 4PZUA 1AUXA 2GRUA 4U9UA 1ZAKA 4AY2A 1CEEA 2B3DA 3USES 4YT8A 1NR1A 3DBIA 2Y9PB 2A84A 3SZ3A 4KTTE 2IP4A 1GNTA 3DEKA 1LF0A 4YS6A 4JI4B 1T3SA 4HPJB 3RIYA 3TECE 4TMXA 4F5ZA 3U7HB 2ZYSA 1HSOA 1WW2A 3K0HA 5J5AA 4K26A 4XD2A 2GERA 1E7YA 1L7AA 2JFNA 3DB1A 4NXNB 2L18A 3GN2A 4UUPA 2O52A 2HA5A 3FIJA 4ZCPA 5ALUA 3K9HA 4LNUB 2OWEA 4IG9A 1SD1A 4LXXA 4R84A 4U5QA 3UM9A 4NV3A 2Q41A 1G9SA 3EJWA 5JAZA 4AO8A 1IQRA 1J25A 8MHTA 3NWJA 1XJ5A 1Y34E 5F2EA 4MUJA 2XPCA 1KKMA 1L5WA 3RAJA 4GQIA 1XTTA 4KH1A 3PGXA 3QVKA 2I3ZA 3GLHA 4FI3F 3V9PA 2VRCD 1HGXA 2ILTA 3KR9A 2C5BA 3OPYA 4OKSA 3S2ZA 4AMUA 4BX3A 1G6OA 1U2DA 4B6GA 2ZAGA 2G09A 3FAZA 4D99A 2R00A 3GLHE 1QWSA 1JG1A 1D5WA 1J2YA 1U2QA 2EHJA 4I1SA 2J31A 2XKBA 3G8CA 3LYAA 3MWEB 2RFLA 3NNDA 4YCDA 5TEVA 4BEJA 4C3VA 4UHKA 2RHBA 1U1DA 4ZAYA 1JV2B 4YLGA 2QUIA 3I9JA 2A7QA 3K72B 4DABA 1RXVA 3C3WA 4EELA 5JWRA 2NVWA 1CRPA 1VSTA 1IK4A 2BMJA 3OMXA 2A9QA 1ODKA 2KQUA 2PLAA 1Q0HA 2QD4A 2OAQ1 1RFLA 4O3FA 4QX6A 3IMEA 5B58T 3EVGA 1IOLA 2DUWA 2EJTA 2JAQA 1W2GA 5U4QA 4AZSA 2CVZA 1L7VC 1CXZA 3L5KA 1BOFA 4DSAA 3HZZA 3BYZA 4RESA 4V0QA 1ZGBA 3QPVA 3NHBA 2RHDA 1T1JA 1KC3A 1FFHA 1NKTA 4IR7A 4YH1A 4ALJA 4KI0A 2JFHA 3QOYA 4WY5A 2J0SA 2RARA 3LBAA 1VKJA 3HA2A 2L69A 3E2PA 3C1TA 3K35A 3RADC 1VG8A 4B3XA 4Y6LA 2VNKA 3K9BA 2R48A 2A86A 4N3GA 1W5AA 3VR1A 4F8YA 1HNXB 1W5EA 4LMPA 1RVV1 3W5UA 3LOQA 4YO8A 4O4IA 1RVDA 3BHMA 5AJWA 4G0UA 3IXLA 3NLLA 2CEKA 1P9OA 2VTEA 2DSNA 3RRZA 4I5GA 4AUNA 1MB0A 3DV0B 1IATA 2PRKA 1UJ2A 2V7TA 2EARA 1H4SA 1TM5E 2EFGA 4BO5A 5DWVA 3W5BA 2VWPA 4POAA 2O2DA 2WJVA 5LD2B 1ZN7A 2ZUUA 5JV5A 1QVVA 3HU3A 2P3OA 2GXUA 2C2GA 1G6KA 3EGIA 4KO8A 4PRYA 7YASA 4PWYA 3GR6A 3EEBA 2AXQA 3PR1A 4PR0A 1JI3A 2CMHA 4GICA 1DEHA 3GQVA 4Z99A 2QS9A 3RTBA 3W9UA 4Z53A 1FSSA 2DJ5A 3JQEA 2WR8A 4N40A 5HTKA 2VLIA 4N41A 2UV8A 3IRUA 3L6EA 4GNRA 1TYEB 4BKQA 5AW2A 1HK7A 4DV2B 1K8RA 2W2NA 1JBKA 3N6XA 3SDBA 4PYIA 4RPCA 3DZDA 3WKCA 1B6TA 1YKFA 4E11A 5L7TA 4MV7A 2IPXA 4NBRA 3URMA 3FKQA 4EARA 1BKSB 1TJ3A 2EERA 2RHMA 3GJ5A 3IR5A 2GNPA 5LXTF 2AOUA 4F45A 1JMVA 5LBIA 1R0BA 5F3DA 3L9WA 1C29B 1P7ZA 2OCLA 3OM8A 3R74A 1OH8A 2OHHA 3SQXA 1TB4A 3ORRA 4QYSA 1KEKA 2J6HA 4IY1A 1ZJ5A 5L45A 4BFUA 4AF8A 1HDIA 2JCXA 4L8WB 1Z6XA 4AS1A 4DM3A 4ENWA 4AU1A 1GCGA 1ISMA 2WC1A 4O08A 2D5IA 4P8RA 4Y67A 1KO1A 3VDXA 3WVNA 4BO7A 4D1YA 3B20A 5GQSA 3CH5A 1OZGA 1FXUA 1RKXA 4A4DA 5LXTB 1A4UA 5DSTA 4C29A 1XYYA 2B1GA 3IMKA 3IPYA 4G8DA 1B43A 5MF6A 3KKMA 4N3BA 1AK9A 1Q14A 5G53C 1IBKB 4BBPA 4YP5A 5IM4F 4G1VA 1A9RA 5HJEA 4EDFA 1O4WA 1NUUA 2FEWB 3AW8A 4CEJB 2AJLI 3MJVA 2BDUA 1R5OA 2B1IA 5M2QA 4K0RA 4NX2A 4M7WA 1D09A 4ZRNA 3SKVA 2BFNA 2XNHA 4N54A 1YQWA 1ELOA 1TYZA 1WD7A 3CEMA 3GJZA 1PFKA 4XKJA 4BU1A 5C18A 5J2TF 4D43A 3R77A 2QN7A 4JMLA 4HAYA 4BGEA 4BGVA 5KSYA 4M83A 2P4QA 2BUAA 4L07A 5CEEA 3OZRA 4MUAA 4LE2A 3NKFA 5JJIA 1YQEA 2W6ID 4UM9D 2Q9BA 1MV8A 3QY9A 4PBRA 3IFSA 1W2WB 4HDNA 1FJGB 2VJOA 4FBGA 5HSGA 2WKWA 4HB0A 2XOKA 2JW5A 5FUYA 5EP3A 3EG9B 2OGZA 2VHZA 4DDHA 3VDNB 1YL6A 3VA7A 2CXNA 5DXAA 3U4GA 1P0QA 1TCBA 1UM9B 1Z0IA 2AKAB 2C59A 5D7NA 4PG6A 3W4JA 1V4VA 4XYEA 2I6UA 1JA0A 3JD0A 1HFWA 3EMDA 3MBOA 1ILEA 2HQBA 3NOXA 3A4LA 4YK7A 2GVZC 5JISA 1RYDA 3TZQA 4J1QA 3TSAA 2QN3A 3WADA 4QRHA 2YHIB 3GDFA 4N6OA 1U63A 3AU9A 2IYPA 2JZCA 4G0XA 4HLDA 4OEHA 4PCAA 5LR6A 4BO1A 1RAGA 3TW0A 1JFFB 2ALJA 2J67A 2JFUA 3AR2A 3ILXA 4MHSA 2A0KA 4E22A 5JFOA 5JAHA 3T3IA 1E1RA 1NFQA 1UIMA 3KZCA 4ZRDA 3SHFA 2VNIA 4NDAA 4XGRA 1OFUA 5LQUA 4CKBB 1W7AA 3QW2A 1QV7A 1M2OB 4Q00A 3HC7A 1NSFA 3R1IA 6ADHA 3JYPA 3M1LA 2NO1A 4NY1A 4R1LA 1XYVA 2PH1A 3K71B 4FN5A 1EI9A 1MEJA 4JLKA 4AMBA 3DV9A 3LE8A 1UAYA 3N39C 2R0QC 1GG2A 3TR5A 1UEIA 4F6CA 1GR1A 3RLFA 2HD4A 4E1BA 2X5KO 4LZWA 3R0QA 1YK1A 3OT5A 3A1WA 4C3UA 3K73O 3ROQA 1Z5PA 3B1VA 4L3VA 5CFPA 5BR4A 3A9UA 1SHKA 2BCJQ 3PHIA 1O6CA 1P4GA 3D7LA 3SC3A 2RKWA 5G3YA 1XLWA 2WOOA 2Q7DA 3ZGXA 4KZPA 3O4FA 1NN1A 3L77A 3WLOA 2DZDA 2I8AA 2WF6A 1SK9A 3H5VA 4X5OA 3WK7A 4AQ7A 4B3SB 2ZRPA 1Z73A 1M6WA 1ZEJA 1LZLA 1LSOA 2X40A 3JQRA 3LXMA 4BVGA 5FLEX 3TAUA 4HEA1 5HWSA 3DBOB 2UYOA 4D56A 5C8VA 1P8JA 2PVPA 1J22A 1NPTO 4L0QA 3T9EA 4D3YA 1WB5A 2OORC 5LOVA 3OFVA 1YCFA 2B8WA 1N2SA 4MQ6A 5CCBA 1JDPA 2NT3A 3Q7EA 1ZNXA 2WWXA 3EPLA 2CHFA 1BMQA 1L4UA 3CW2A 4O25A 2C4MA 2FX2A 3EVEA 3CG4A 3UMFA 2BM0A 1GP2A 3MRXA 1E1LA 2PXXA 2UUCB 1KSHA 1EBUA 4I9HA 3IOEA 5IK2D 2WJYA 2H4FA 2GI4A 3L84A 2PPLA 1ZW1A 1H4QA 4FDVA 1YIDA 4WN9B 4PZLA 3ZE7A 4P81A 4TXJA 4F06A 2D2XA 4KITB 2VWHA 1GZSA 3WBJA 5ADWA 3ECAA 4MQUA 4F5EA 4TX1A 5EZ6B 1JR2A 4PO3X 2JA1A 3OTGA 4JP5A 3OHPA 3LO5A 1XMJA 2NUPA 3Q8KA 3GJ4A 3QHPA 1ID1A 3CNEA 4NCKA 4EOGA 5CW1A 1JIJA 3REQA 3WL8A 1BE0A 3JRNA 1G8JA 5DX8A 5KOHA 4D02A 2GWRA 4GPEA 4JC0A 2ZUFA 3Q3HA 2W37A 3ZWKA 2YJZA 4CM3A 2QE6A 3HVIA 4WBSA 3E8MA 4ROSA 3OH8A 4GYYA 3EOZA 3BGWA 4X20A 1QYVA 4WCFA 2XODA 3B9BA 3DT6A 4JFAA 4L2IB 1G8PA 5CA1F 1S3GA 4UXHA 4ARAA 2P9JA 4GYKA 3I62A 4BB9A 1Y98A 3IH5A 3JRXA 3AK4A 5BQPA 1ESCA 3X2SA 4HX9A 3ZZUA 4Z4GA 1BROA 3RNOA 4JUFA 2FJ0A 1EGMB 3E1GA 1N1GA 3I32A 4IVPA 4QUBA 2HDWA 2KE5A 3CTMA 2O3SA 5H82A 1AQJA 4DQLA 1FUIA 1NVGA 4NBVA 1Q6ZA 4YCNA 4IIUA 3B82A 1LH0A 1SVNA 2KJQA 3UT5A 1C5KA 3B78A 4ZVQA 2XBMA 3T3OA 2XRMA 2XOXA 4HYTA 4QDTA 4G41A 1V45E 1Y3FE 1E9DA 3C8DA 1KI3A 1BJKA 3AQIA 2YW2A 2GILA 4O4JB 1C8LA 4OJQA 1ZH8A 3EXG2 4BNUA 1GU7A 1PT7A 4KLZA 5L6MB 4X7PA 3SC6A 1N4DA 2YIJA 1YS6A 1A98A 2YV5A 1DS6A 1LNZA 3AB7A 4GI1A 4LRUA 4ZQGA 5AVJA 1E2EA 2OCXA 4KGVA 2O2EA 3RLIA 2AFIE 4JCCA 5JADA 4ZXFA 5AW9A 3N70A 2IPOA 1XNJA 3RJZA 1P5FA 3M83A 3A31A 5BYKA 4TYQA 3ZUPA 3D3KA 1NBOA 2EF1A 3R4CA 1Z7EA 4JXJA 2Y1XA 5H9WA 5IFKA 3LBHA 2FR1A 3ILSA 3LTEA 5JJBA 1WIWA 1I6MA 3VNVA 2A3NA 2HCRA 3H5WA 1XQWA 2VA9A 5IH7A 1BDJA 5ALVA 4YT4A 1MENA 3FTCA 2VH1A 2X3YA 1BH2A 2H1WA 2YXLA 4IQ4A 4KPUB 2AHRA 4RK0A 4IMIB 1XZKA 1C3VA 3OT1A 4X44A 3UXMA 4RF4A 1ISPA 1J2RA 4PY2A 3RVJA 4A0HA 3KIPA 3EQ7A 1FFDA 2FSVA 2ZWIA 3KLMX 3OF3A 2QW1A 3W2FA 1Z7BA 5IAKA 5HW0A 4CM5A 1MIOA 1XKLA 3B12A 5JAQA 5C4GB 2HJWA 3GH3A 2EFCB 3AR7A 3DPSA 5LP6F 1B8NA 2RIRA 2XT0A 3C97A 3EGCA 5C1BA 3BTSA 4ILKA 3G2LA 4WNYA 1K5DA 4DDWA 3AZOA 3WL6A 2A78A 5A3VA 1QP0A 3TI7A 3BF7A 3IP7A 2WG1A 1XRMA 4BCDA 5BOSA 3HRHA 4RIGA 2JHGA 1V3QE 2WRZA 3MTAA 4U2FA 1G38A 2F7SA 4IWXA 3COSA 1PR1A 1NL3A 1G0NA 4KQCA 1TD9A 1E1QA 3C6YA 3T4EA 4DV1B 4GUAA 1PG0A 3F0TA 1JZQA 4K7JA 1FX0A 2WF9A 1PWZA 1CJUC 3QQ5A 2A9OA 2ZVQX 2VH2A 3SF0A 1AA6A 2AQKA 2WAYA 3QNUA 3H42B 3GLVA 4UREA 1IHDA 3O2NA 2FZCA 4YAFA 5JYDA 1QHYA 1S7CA 1EUYA 1D2HA 3BD6A 1CJKC 1SG6A 2YZ7A 3OOWA 1ADCA 1YIOA 3DHYA 3FWNA 4OHRA 4R81A 5EJ7A 1YA4A 5JS7A 2WFLB 4CKZA 1KJYA 3PLRA 3EAFA 3F4KA 4KGXA 3RUHA 2HRCA 1AK1A 2Q6LA 4N8DA 1ABBA 2F8SA 1L4YA 3DT9A 4M46A 4G9BA 4TKUB 3V8EA 2DKOA 1GZVA 2BFMA 2JH8A 1M2KA 1TO2E 2Q99A 3MGGA 4ZDJA 2DGDA 1UJBA 1FXWA 3KJFA 1X7ZB 3WWOA 1XAHA 5B7PA 4Z49A 2R2AA 3KSAC 2XXAB 3OECA 1V9LA 1DWOA 5E7MA 4EY6A 5E1DA 2GBFA 4UNQA 2ORWA 3DOHA 2PZLA 3MB5A 4W82A 5LP6A 2OV4A 1KOGA 1DUVG 2H5IA 4X1YB 4OVKA 4PXYA 4D0LB 3VYRB 1GTSA 5JFGA 5IZCC 2GHQA 4C6RA 3F5MA 1GADO 3TQFA 3L8GA 1EJ0A 3DL4A 1ITZA 1JQDA 1IRIA 2IZ1A 2WIJA 3D7RA 3KTOA 1WNFA 3FAKA 4M1WA 5JEEA 2XA9A 3HR7A 2YIDA 1J99A 2ONZA 4MPDA 1QHIA 3FRHA 4K6KA 4YAOA 3G9UA 1JH8A 1SUCA 1PZMA 1TNDA 1WULS 2A0WA 4IQGA 2XVAA 4G4SO 2ZSHA 1R0RE 1EYZA 4INZA 3AF4A 5BWLA 2IHTA 3HLYA 3EULA 5DLYA 3JQ9A 5GJVC 3PA8A 3ZWWA 1VXRA 3RTDA 1TLLA 2YFYA 2JHAA 1X38A 1S5PA 2F62A 3RVNA 4NPCA 3GJ3A 4YRQA 4AN4A 4BO4A 4YN3A 1OWPA 2I7TA 4JT4A 3AY7A 2MOKA 1R4MA 1UF9A 4LG1A 4US1R 3WLRA 5DYYA 2O06A 2JI7A 2W8BB 4EHFA 2QXTA 2ES4A 1CUVA 4LDQA 4X7BA 4HK4A 1E2UA 3IPRA 3BHNA 2BKUA 2N3ZA 2WM2A 2XNSA 1JJAA 5DNVA 3VKHA 3RQSA 5HCNA 5DFAA 5C4MA 2ZQZA 5BRJA 1KSGA 3VGPA 1SKQA 2QM8A 3GRFA 4K6GA 4UE2A 4DC1A 3LDFA 5HDBB 4M86A 1BYIA 5A3QA 3B89A 2BGKA 5FI1B 3UJ9A 5JR3A 3PQ7A 2YV3A 4N03A 2ZANA 1IBRA 2F4NA 1DDIA 3OIWA 2PIDA 4AD8A 3NTQA 1JJFA 1KKUA 1V41E 3DOUA 3M6FA 5JSYA 5LMUB 4KREA 4UTZA 3ZEIA 2FKAA 3FNBA 3A9TA 1AURA 5KTYA 1THTA 1ZOIA 2LDXA 1HYGA 1H0HA 1MQ9A 1AE1A 3U7GA 3THWB 4DBVO 4PN3A 3Q0IA 3L7NA 1ECBA 2HFJA 1LRLA 4G1UC 4E88A 3S6JA 4U2KA 4RPGA 2OCBA 5IK2A 1JEEA 2D1QA 1JB1A 4JL6A 1K3FA 4KPUA 4Q7KA 3L92A 1KH3A 3FFXA 4FQ8A 5FA5A 4AJ9A 4D82A 4Z4HA 1YS4A 3FUUA 4BASA 5AVQA 4A0GA 1D2MA 4J4TA 4B7UA 4X24A 1RNLA 3GAZA 3LT2A 1L5NA 2HR1A 1JH9A 1QNLA 3OFNA 4QO7A 1A4RA 4JVMA 4BKPA 1V9SA 5C7YA 3EPPA 2ATCA 4MP8A 1I30A 1GL7A 1T8SA 1ENPA 1U9IC 3B7PA 3HYRA 1PQUA 4K9PA 1ESMA 3HFJA 2ZRNA 4LZLA 2VJPA 4MS4B 4TWZA 3V4VB 1YQUA 5M34A 5L7YA 3KFLA 1Q95A 3IOMA 3CIFA 4KP7A 2QD1A 3GQBB 3EPRA 3HACA 4U6QA 3ZWXA 2IH2A 4IXMA 1SHLA 2WSLA 3JQ6A 4FFVA 1O87A 1HRKA 1R0ZA 4LJLA 3EG5A 3EVAA 1QXSA 4X7RA 4C30A 1RPTA 4PLCA 4ZHQA 1PR5A 4J2OA 4MJLA 4YRCA 1RC0A 1F38A 4YPOA 2XRFA 4INOA 4JAVC 3AR3A 3W7VA 4XUEA 1KY2A 1L1RA 3WIDA 4O0LA 2EX1A 3RTEA 3EGVA 5LOVF 4DYVA 4Q4HB 4LYYA 3N0VA 3WXBA 4D9NA 5C37A 2WJIA 2ZM5A 3T3HA 3WE7A 2RKBA 5F2OA 1U31A 5KDOA 1CJTC 1LLCA 1U5AA 3IAS1 3K4PA 3RANA 4DIEA 4W5RA 2EDCA 4R2JA 1NUTA 7MHTA 1HE5A 4FX5A 2ERYA 3IXQA 1N2EA 1VFNA 5BSTA 3OY7A 2HHHB 2WD7B 3RC8A 1XTSA 4KWTA 1HDGO 2NTEA 4G26A 5FWYB 4HNVA 4JVSB 3LQ1A 1Q6YA 1ZIOA 1EXWA 2AFIB 1INLA 2JKYA 3R0VA 2AX4A 1W0KD 2BEVA 1XRLA 3BMNA 2QMYA 4A36A 4JHXA 5CM8B 4QTYA 5KVSA 1E99A 4FNGA 4M38A 4FWIB 2AOTA 2GCGA 1HLPA 1RQGA 3ZBUA 4AJKA 4PLVA 3AUTA 1FU7A 4I08A 4JU8A 4ZPJA 4EG1A 2W42A 5CRIA 2JEZA 1OZFA 3DDCA 5HQ3A 2PRJA 4KDFA 2RH9B 2ZAOA 5KYUB 2Z0MA 2QRMA 5GV7A 5LLTA 3J7AC 2ORED 5IABA 1BEUB 1KDTA 5E38A 1N5OX 3I4LA 4D4IA 2QZJA 3QA9A 3H1PA 4NZOA 3ETGA 1G5HA 1RYMA 3DE2X 1WSAA 4GR5A 2QAGB 3ZGOA 5MDHA 3W6OA 2FGJA 4YONB 2V7PA 1CJVC 1H0RA 2AQHA 3ND5A 2IXFA 3DOEA 3I01A 4XWGA 1NPDA 5J9FA 3WG9A 2FUEA 5U4XA 3C0KA 1WXGA 3CLTD 3BQNB 1NBIA 2OHJA 4UPVA 2OBXA 3GRPA 3AZPA 3QX9A 5EIXA 2WF7A 4WOCA 3H3FA 2PUFA 1E3IA 3AFOA 2HLPA 4MUNA 4OA8A 4PZAA 4KR7A 4XQ9A 2WLSA 3VKGA 5BRAA 1DC4A 2EBWA 2B8NA 3MINA 3OZSA 3RJMA 3UHAA 3JD3A 1NAIA 5CG1A 2XEDA 2O48X 4D80A 2Q1TA 4RHUA 2FPPA 3TLXA 1L5LA 1KI4A 2MSWA 3KR2A 3RC3A 3OWOA 1GKYA 2YBEA 2HCJB 4E7OA 1XDBA 3LECA 2AQ8A 4K87A 3TLGB 1RABA 4DIKA 3GLFA 2NV2B 4MYUA 4QPZA 1P73A 1OAKA 4C4SA 2FFJA 1NZDA 1MGOA 2P65A 1MDBA 1FDOA 3KOOA 3NHLA 3WL4A 3P52A 5CPBA 4ZKDA 5TIIA 2X0KA 2C7OA 2IITA 4MJXA 1J1ZA 3IEKA 4RKRA 5ESXA 3TINA 2C07A 4UTOA 4MKGA 3F3SA 1N2GA 4NZZA 3F4LA 1KHHA 4RD4A 2LBPA 4ZCSA 4U7PB 3D3WA 2BC9A 2QNIA 4CN8A 3IALA 2B4QA 1ZONA 3WMFA 1RYHA 1WAMA 2GEJA 2I4IA 3GYBA 3M1YA 3OEWA 1Q91A 3QEAZ 4JYAB 1GUAA 4NS1A 1XLVA 4ZO8A 3IHLA 4LHYA 2D06A 4ZT2A 3U1TA 3VSEA 2J5XA 3AF2A 3V00A 3KE9A 4H15A 1DC3A 5BW8A 1JIKA 2FZVA 4WHMA 2FW0A 5GPBA 2PYZA 2GMWA 3E9RA 1V95A 4MV9A 3MOSA 5JNRA 4Z4FA 4R3NA 4YGXB 2FXVA 3TX6A 3OZVA 4PG5A 3ZS9A 4F6RB 2WT4A 2XMBA 1BHJA 3RS7A 1PWHA 2BJWA 1B3RA 3H9JA 3O73A 5B3LA 4CMEC 3KPWA 4NEGA 5DXJA 1FLDA 3NBXX 3ZE2B 1GL9B 2QZ9A 3E8XA 1O5OA 1SXJA 4FYIA 4G5SA 4W8HA 4WX2B 2QD5A 4RZ2A 1JDVA 3LBIA 1JHPA 4NRDA 1JTFA 2ZSIA 3I2YX 3N8HA 2VP2A 4JA0A 5EP2A 3RROA 3ANYB 4DKXA 4KNVA 1ZD3A 4F60A 4QUKA 5LFAA 4OK5A 2XITA 2C8KA 1M2EA 3IAHA 2AJDA 4MW6A 3RKUA 2BEWA 4DPMA 4Z4EA 1SBIA 1WQ3A 4FFWA 4W1RA 1HOXA 1R12A 3WGNA 2VSNA 2SCUA 4B09A 1NVAA 3NRJA 4GBED 3T3GA 1UIRA 1AVTA 3DR3A 3NT4A 3RT7A 1Y1PA 2BPOA 4H4EA 2ZRGA 2V96A 4D9FA 2FZ5A 1NVTA 2O2YA 1YDFA 1AX9A 2YZGA 1Z4PX 2VYQA 1J8QA 4MIYA 4YJFB 4YYEA 4BAGA 4Z3KA 4KQWA 2DLNA 4B7XA 1V16B 4DLNA 3EA0A 1Z45A 4U7JA 4BWYA 4CI0B 5C46F 2A0FA 2YRWA 4XWOA 3ENVA 4I50A 2WNSA 3F5FA 1QMGA 2PGAA 4CE6A 1Z39A 1Z56C 5AUPB 4HG2A 1L5KA 2QIOA 3UANA 2E18A 3KBOA 3A6KA 4PHHA 4S2EA 4E4YA 1NI4A 5I7UA 4MQ5A 2V98A 4IYRA 4EEKA 2FE4A 4QGSA 2OD7A 2GUGA 1MNQA 3JPWA 3ER8A 1U2RA 1FU4A 1NT2A 1SKUA 2FK7A 4HDSB 4BB0A 5I7RA 3SHTA 1UKEA 1P2DA 1ZIDA 5I7FA 3Q5GA 3W3AA 1QQAA 3ZIDA 3OU2A 5C32A 2R4UA 2R97A 4I50F 1NF8A 2CK3A 3IA7A 4G85A 4X6YA 3KO8A 3MGCA 3U7JA 3ZV5A 5KTPA 4TOIA 1M66A 4BLTA 1R5BA 4N7RA 2HRZA 1V7CA 1NJ5A 1EWQA 4OSPA 2PWZA 2V65A 2QAGA 3K8ZA 1OR8A 3OY2A 3ONDA 4R1NA 4EUFA 1D1QA 3L7JA 1B7GO 3PQ8A 1NVFA 1USIA 1H3EA 5IBQA 5K01A 3TBHA 1JSCA 3AFNA 3I61A 5DMHA 2I1WA 5JUWA 4XIGS 4MMYB 4ZO9A 4Y3UA 3TB4A 1Z36A 2B36A 1WNTA 3DP7A 2O0MA 2OC4A 1U6IA 4CQMA 1TKRA 3IOBA 5GONF 1TRHA 3AR6A 4KFSA 3VKUA 3D7KA 4KKXB 3ICOA 4G5GA 3DVQX 5JAMA 1S0UA 3KZNA 1CRLA 2RHHA 3HNPA 2O07A 4BNKA 1M34A 1C0IA 3MXTA 4M9SA 3RYTC 5AK3A 2IH5A 1JIIA 4RV4A 2H0QA 3R7AA 2HH9A 3HR4A 4DNPA 1JNYA 1ZDMA 4OQYA 1LPBB 1IQ0A 3D02A 4UFPA 5D01A 1ZD8A 5DMXA 3PNSA 4IIGA 1LSSA 5BV8A 3FMPB 1P4HA 1M0SA 3BMOB 1IQPA 1TT7A 1UBFA 1UBHS 2ZRMA 2RSLA 4HDCA 1T2CA 3EIHA 3VR4A 4B46A 1SHTX 4EMSA 5A1TA 2H48A 5KNCD 1QPZA 1U0EA 2M2IA 1V1JA 3P19A 3TRFA 1PEDA 1WLSA 2LZ0A 3QYJA 1MD9A 2BH9A 5C7IO 4KNYA 2BFCA 2C88A 5HCUA 5AIAA 1XFDA 1J0XO 1P1FA 4L7QA 2I34A 3AOEA 2EGGA 3CJQA 1KMNA 3F8SA 3K0EA 4P4SB 2IWHA 3TAHA 1TEHA 2D8MA 2P5TB 1VPWA 2JGAA 1NNLA 2VF7A 1S9HA 4RIIA 4ZQBA 1PD1A 1D07A 2LD4A 3H18A 2JFXA 1V8OA 1Y4ZA 3CX8A 4YAJA 3RFTA 9GPBA 1ZW6A 4OI4A 1KXJA 2C31A 1L5HA 1GTJ1 4YAEA 1E4YA 2B99A 1IPHA 2Q62A 2Z6QA 1DKNA 1I5RA 3ZHSA 1OVMA 4ZZ2A 4M0CA 3FJ1A 5L95A 2XKKA 3IAFA 3HG7A 2Y71A 5E4TA 3V4SA 4DANA 1IL0A 4DWWA 4B2YA 5A4FS 1UKBA 2P5UA 1NZJA 3HS3A 5HKKD 1MH1A 1RXCA 4BFSA 2QX9A 1T4GA 2OAEA 1EWRA 2V6BA 3UNXA 2HYIC 4KSCA 1H1DA 4HRVA 3ZCUA 2CXTA 1VGQA 1FRNA 1JDZA 1H2FA 2NO7A 4IYJA 3WFJA 3ZK7A 3P2JA 2ECFA 1IVYA 1J9GA 5BXQC 1E32A 2QG6A 3LCCA 3CZMA 1ZQ1A 2X2OA 1USWA 4X1YA 4XH9B 5GM2A 3X1JA 4ETNA 1YB1A 3C3BA 3WLPA 3IQXA 3O9VA 4IUYA 1UBOS 2RD2A 3CS3A 3RK1A 2HREA 3CH4B 4RVGA 1L4NA 4EZEA 3AEUA 3BULA 1VOTA 3PXXA 1XMOB 4GM1A 2W0SA 1W34A 4PANA 4OYYA 2JFFA 3VR5A 2VTKA 3BEOA 1QV6A 1JE1A 2XD4A 4XSGA 121PA 3D6UA 3DXFA 1Z4JA 5C80A 3UBTA 5KYWA 1Q0TA 3K1AB 1NUPA 1Q16A 3EWIA 1V37A 2DBYA 4K3UA 2OCDA 3AP2A 5CURA 1MQ8B 1DJNA 1MQAA 4E12A 4ZI2A 2JD0A 1EH5A 1VDZA 4QJ4A 1L4EA 2QTMA 1IJEA 3NR2A 3WMEA 3GLGB 4MWTA 5K8VA 1GRQA 3B13B 1YZFA 5GJBA 2PFGA 3T7SA 1ZCBA 5HJ2A 3E9YA 3SYRA 1BGWA 4OHFA 3SJCA 1HE2A 5DX1A 2AEFA 1E3DA 2QYHA 4RACA 3W9YA 1Y0BA 2ZCUA 3H83A 3CBGA 4INAA 1RZ3A 2MYNA 3UK7A 4L8LA 1MN6A 2I6XA 1YH3A 3I9V6 2VF8A 3F49S 3SF8B 1ZNYA 3DHEA 4QRIA 3SF8A 4TRMA 1CIPA 1HEIA 2XB6A 3NG1A 4DKJA 5J2UA 4ZZIA 1NUSA 1M7GA 2YASA 4E94A 5IAGA 2FDCA 3AEXA 5HMMA 1T4CB 2GM3A 4PPNA 2YFKA 2HPVA 1G4UR 1LPSA 3GQBA 3IUSA 1C0KA 1Z2OX 1ZH6A 2NPOA 3WNCA 5CD1A 3C1UA 2EG5A 1R8SA 2C7RA 1RKUA 2ZRBA 4KR6A 3L1JA 4Q48A 1EUDB 1NWHA 4LE1A 1TPZA 4WCFC 3T7CA 4CKWB 4DJAA 5I6DA 2EYUA 2FP4B 3N6RA 4XUCA 2XMQA 3JQQA 5BSHA 1VLQA 1SM4A 2XZLA 5I5EA 1XCPA 1EDZA 1SD2A 2VJAA 4RLHA 5T8KA 4WXYB 1QGUA 2PJZA 2NM0A 1LTQA 3WJ1A 4TTVA 1E8MA 1XTVA 4M76B 3C74A 3UJ7A 1TTHA 1X1DA 2QYSA 2ZULA 5GTDA 5ICFA 1OGJA 4F9GA 1T5IA 1RHRA 2Z4TA 1X3LA 4P4LA 3CJTA 5AVTA 4PR3A 4ZO4A 4CG0A 1P9WA 5BW5A 2FG6C 2MU1A 4RMHA 4V1CB 3HEBA 4FVTA 1WHSA 2LNDA 2V9PA 1JXAA 2VXBA 2DOKA 2EX0A 4W5QA 1TDJA 3E58A 3K9LA 1I36A 3PENA 4GC5A 1EVEA 3VQTA 3KOXA 3AEZA 1FNCA 5MFPA 3NEAA 4MA4A 3CN9A 3K31A 4HGRA 3O8LA 1WMDA 2SKDA 1NR7A 1JP7A 4DG5A 4KQFA 3RAEC 4DMCA 3Q3JB 4Q4AB 4E46A 1RPJA 2NQ8A 3NBFA 4DLRA 1T3TA 4G81A 4UNIA 2HHCA 2EFHB 4YV7A 1RM4A 5KC8A 5AHOA 4B4VA 4A23A 4CT0A 2FEKA 3UMYA 4CMBA 2CK3D 1WKBA 4QLOA 4BU0A 1QS0A 1WZEA 2XEXA 4FZRA 2Q50A 4DA8A 1VE9A 3P4UA 4B3RB 2GCEA 3G2OA 1N1EA 3MWLA 4BMSA 2YYSA 1JAIA 1THMA 2FQQA 3DVRX 4FNAA 4PE5B 4ATNA 1Z0FA 1ZJ6A 4X3PA 5EIEA 1P2FA 1Q0UA 3RT1A 3VX4A 3UK0A 3WZ2A 2F8MA 2J6IA 1JEYA 1RKVA 1JTEA 2P78A 3TIIA 4Y98A 5BSFA 4G0PA 1PL0A 4HB3A 2XHEA 4RFVA 4BXOB 3FYTA 3CLUC 2WW8A 5A7FA 1JDUA 3O4VA 1E9CA 4LJYA 5CIYA 1X8XA 2GD0A 3AM5A 3CF2A 5JNLA 2C99A 3D3NA 2IE0A 3RAGA 3D3JA 1LVGA 3G2NA 3ZHZA 1P3JA 3IE2A 1JR3E 1JHMA 3NS7A 4N5LA 4PX9A 4AF6A 4E2XA 2W2MA 2Y1GA 2H92A 4O4JA 1GSAA 3VR2D 3FX2A 1H2YA 3M9WA 3OOJA 1F60A 2K2WA 2XCUA 3WFZA 1JLMA 4N49A 1E6CA 5ALLA 4UHHA 2VLBA 4J43A 1MOZA 2FTKE 3AJAA 1AGYA 1M2VB 2WMYA 3K9QO 3CN7A 5EE1A 4EW6A 4H16A 2ATVA 4D4MA 4ETMA 1NV8A 1ID8A 4FOLA 2VPWA 4WBXC 1A5SB 1PD0A 4OY3A 4UW9A 4IKOA 4LECA 1HSZA 1VJ0A 3A6EA 1DJPA 5C5DA 1Y82A 2H3EA 3CONA 1Z0SA 2QM7A 4IJKA 1M74A 1RFGE 4NBLA 2OBYA 3C3YA 2QLJA 5T41A 5BVGA 2P9YA 1VKZA 4LZJA 3UN1A 1PTJC 3JV7A 3NDRA 3T7DA 3RU7A 1LDYA 4DMGA 4XRGA 2FPLA 4PQFA 4JFRA 3C70A 3HJUA 1SZDA 4XGNA 2NZ2A 5EGSA 3MGBA 3FOAA 3QM1A 1FL9A 1O97D 4EA7A 2PSFA 5TQ0A 4E4TA 3RTAA 3WQBA 1PGNA 3ASYA 2PKCA 1PL8A 3PUHA 5HRCA 5BYBA 1JKFA 2F43B 3U40A 2UYQA 3FWPA 2I71A 7REQA 1PO7A 1L7RA 3NQ41 2P90A 3OEEA 2VQEB 1W4ZA 2OXTA 1U7PA 5FADA 4CM4A 2GR9A 1EK1A 1KWGA 1QAQA 3V4ZA 4BRSA 1E3JA 1J56A 5GONB 5JXWA 2ECQA 5WRFA 4DLAA 1E1MA 3L8EA 3ORFA 4F46A 1NNUA 1UQUA 4TLMB 4YALA 1WDMA 2VNHA 3WDMA 4KXMA 2PGNA 2AG1A 4OKNA 3G6KA 3SJ7A 2NTVA 4UBLA 3ZD6A 4YRRA 3IP9A 3TRHA 5DPMA 5J4HA 3O03A 3PX3A 3ZGVA 4CM6A 3K5WA 1NXTA 1XMQB 4F1KA 3GXBA 4F6RA 2F9MA 2GWHA 2NZXA 2PZ8A 2Y1FA 4QEKA 4KACA 2ECPA 1WW8A 2H08A 2JAUA 3G5TA 5CNKA 2P9EA 3K05A 2IHKA 3PT5A 1KK1A 2I2FA 4CCSA 4DR6B 1KDOA 3F73A 4XE5A 1SZJG 4MQEB 3IUMA 4HJRA 3DL2A 1L4LA 1Z07A 1XKQA 1Z35A 5CB4B 4HDRA 4Z1MA 2CNWD 1GFSA 1R6UA 3HCFA 3BZUA 4YCJA 4EHLA 6Q21A 5L40A 2AF3C 3KLNA 3KV1A 4J0IA 4BP1A 1OXUA 2D1SA 2P6UA 3GLTA 3KAPA 1GRVA 4LHEA 1PYOA 2HBRA 2WSMA 3K7EA 3Q7TA 3TOSA 3U3ZA 4MKZA 4IZHA 4N7JA 5JECA 2DM6A 3W7BA 4B31A 1TXGA 1RLOA 1QFJA 1VPTA 1U8YA 1FDRA 3FPFA 3NASA 3RABA 2JJQA 1WVMA 2BDTA 4DLVA 2JI6A 1YQXA 2Y2VA 2JJMA 3NTRA 1DC6A 4KXYA 4FT2A 1WF6A 3VO8A 4BNFA 1RJGA 3AXTA 1H2HA 2A9RA 4PZZA 2MINB 1QAOA 5F33A 3TLBA 4F04A 1U1FA 1JTVA 1VHTA 2EZ4A 2ZUDA 4CCAA 2I62A 2X9LA 3F2VA 3LLVA 4JR0A 3Q88A 2CFOA 1VPEA 3B2QA 3LUHA 5TMBA 4OHYA 3LX8A 4JLBA 3C4VA 1E2GA 4KXNA 3WGTA 3IL2A 4DCMA 1NP7A 2NU6B 5CFQA 1EMDA 2X8JB 4H18A 1MF7A 3VHQA 1ZQ9A 3AHHA 5TY0A 3BT7A 3UOWA 1TYCA 1YQDA 4N48A 2ZSFA 2CNNA 2VUIB 3IUQA 4FDUA 4U1RA 1F9AA 2GK6A 2OOSA 1TZJA 3L04A 4UULA 5IEJA 3HKDA 3EZNA 2YCBA 4GP6A 4ZQFA 3ML1A 2EJVA 3I5YA 5ALGA 1GV0A 1JF8A 1NN5A 1WHSB 2OLJA 1DADA 3UC9A 5TC4A 1V3TA 4MV5A 3KNZA 2DFNA 1IHOA 1R16A 2FPSA 3LNCA 4O2BF 4RJ2A 3EPHA 2W6IA 3WHPA 5HQ3B 4CF4A 2VR1A 5KQLA 2CBZA 2H4WA 2JH3A 4N3CA 4OI1A 3PE3A 3EZ2A 3JAKB 4HH4A 4NDNE 5ITSA 3GPCA 3HB0A 5ED4A 5EY5B 3WZMA 1MO3A 3OCYA 3P9YA 2J59A 4LSMA 1LI4A 5EWMB 1V25A 5CH3A 1BXRB 3C16C 5PNTA 5D5HA 4D4HA 1I3KA 3M6VA 2COEA 4DB4A 5DK6A 2W2KB 3NH6A 4BBZA 3Q8XB 3HDQA 2DETA 3PCTA 1E3LA 2O5RA 4OJMX 4RHCA 3C7KA 5BV7A 5F73A 3BTUA 4URXR 5F23A 4M21A 3F7NA 3GLGA 4E5KA 1ILWA 4ZOQI 4LSWA 4BPRA 2BJVA 3NVDA 3T99A 4CU5A 4JBGA 4F96A 3EODA 5I4BA 5K8CA 3PFNA 1I94B 1Q74A 3S27A 2KHZA 4TRNA 1VDMA 3NW9A 3WA6A 4I9UA 3GRKA 4EQZA 1DHRA 4X92A 2DR0A 4D8XA 3ZDQA 3PJGA 5C2JB 2AMJA 4UMVA 1U2DC 2BN4A 2QLNA 3QLUA 3IPXA 1D7AA 2AMYA 1YZKA 1FFCA 1OVGA 1ZRHA 1UOPA 4CM7A 5DNCA 2X8BA 1XCOA 1GR0A 1F1BA 2Q29A 1AF7A 2HF8A 4JI8B 3IB6A 3ZTYA 1L5MA 5LMCA 2AK2A 2W2LA 3VMFA 3U5TA 1YQGA 5B57C 1ZBQA 1NYTA 3KAKA 2IBMA 5KX5F 5KOYA 2NUBA 4XQEA 1G7RA 3KUCA 5JSQA 2AN4A 3K1ZA 5EGNA 4C6HA 4P0PB 1DP4A 3JQDA 4J0HA 3WBKA 3I76A 4NV0A 3VYSB 3AINA 3FSGD 3HDVA 2NTNA 2GS9A 2F1HA 1K68A 1W30A 1T1SA 1PYDA 2F1JA 2R1VB 3TDKA 1PR9A 4FHDA 1NJGA 5J43A 4NYJQ 2QLFA 1H6AA 3ZWBA 2C78A 4QNRA 2FFBA 2GF2A 3I73A 4QSHA 3W6PA 3BIJA 2XJ4A 1ZSVA 2Q5FA 3O7WA 1XMVA 5F21A 2G1UA 1GDHA 4OP3A 4LKRA 4BEVA 2YW9A 4WNIA 1M8KA 5TGZA 3A6FA 4IHKA 4BLRA 3UHOA 5LLDA 2BGJA 3KYCA 3L06A 1CKEA 2XJ9A 1KMCA 3O91A 4WJZA 5K8IA 3DKRA 4I46A 5ALZA 4X66B 5KPDA 2B94A 2C98A 5BUQA 1DBPA 3GW8A 4DCOA 1MO4A 1T36A 5KHAA 1E1RD 3F6EX 3TVDA 1IEQA 4TL7A 2AZXA 3MIIA 3QVTA 1JHUA 3WMWA 3ZD8A 4UOQA 5A4IS 1PS8A 4KXWA 4S1VA 1HDOA 3U4AA 5TPZA 3RWOA 1TVKB 3CZ4A 3ODGA 4GPZA 3UH0A 4TGLA 4N5DA 2A67A 3DBRA 4KLRA 3HP1A 1E9EA 1OFIA 4A0FA 4DWVA 5M5BA 1E9FA 4NIMA 1U0SY 5JNVA 2H1OA 3WKEA 3ZU3A 2H2GA 1U7WA 4L78A 2GZHA 4YRMA 3TCNA 3BPSA 1JWBB 1PUJA 2G40A 2NAFA 5LWHA 5A7HA 3W5CA 1W1WA 2WWRA 4LZPA 4G63A 4XDHA 3ESZA 3ZW8A 2FJPA 4TSFD 4CEHB 4G5FA 4GVPA 5E4FA 4YQYA 2XUQA 1O77A 1CQJA 5CNMA 2GM9A 2PXAA 1OXTA 4OLHA 4Y1EA 3THWA 2QORA 4GNKA 1KAOA 1M34B 3Q1KA 4RVSA 3VZQA 2D54A 1F48A 1Z4OA 1YUMA 2HIHA 3TSCA 1XHEA 3P2IA 5MGNA 2ZBQA 1GPH1 4DN6A 1T2NA 5DM60 4FD3A 1XP5A 4KO1S 2Y9MB 1F8XA 4JB3A 4TMZA 2QQ5A 1OF1A 1I4LD 3NHWA 2AN5A 4H7IA 3B6EA 3FN4A 2Q9AA 1SC4A 1GU0A 3PPYA 5THKA 3VU9B 1BWQA 2G76A 3GPIA 4R40A 3X3HA 2NXJA 1JUDA 4GZ3A 3MF4A 5AW4A 1RTKA 2NAPA 3L8ZA 1N25A 3ABIA 2BZSA 4QQRA 4PHFA 1A8HA 3T8YA 5CVTA 1RHJA 2COKA 4DILA 4EY5A 4NI5A 3JXEA 1TEXA 3B5EA 3ENQA 3PNQA 2J4CA 3K0KA 4JYMA 5DOZA 5F5LA 4AYTA 1CZKA 2W2KA 3L02A 1CU1A 4P4UA 1NV9A 4TTAA 1Z8NA 5JXGA 4R83A 3ZJ4A 2R47A 2C77A 4MO2A 3DBLA 1AY0A 3W04A 1TYDE 1FQKA 3D6VA 1YKSA 4WESA 1FTGA 6REQA 3C6XA 1B23P 3L4BA 2ZBDA 4FMCF 2OZLB 2XE6A 1HT2E 5K3OA 4IGFA 4WL0A 3FYSA 1RD4A 1JVNA 4PLZA 3NAMA 4BQRA 1WETA 1NYLA 3T7EA 3EC2A 4M0PA 4TWAA 4ZT3A 2P2NA 1JU9A 3UWPA 3O83A 1QFZA 3FXAA 5K03A 4G0ZA 1CB0A 2W2OA 4M6WA 4ACAA 3KKZA 1QVAA 3FYUC 1NLUA 5BW6B 3TZEA 4YX9A 3WKBA 3JZIA 2H29A 1OI2A 2VDWA 4EGAA 2Q4EA 3THYA 5DT9A 1B3BA 3I4CA 3HY6A 3TZHA 3NMUF 1DIAA 4F1JA 3DV0A 4G36A 1I6KA 5CT8A 5ALNA 3CNBA 4WXHA 3Q11A 2NZJA 4RV5A 2H17A 3HBJA 1DAOA 1H66A 3N2IA 2VDLB 3MNFA 2Z1DA 4G4IA 2D59A 4EMBA 4D9KA 4HDSA 4DR4B 2X76A 3KJIA 3VGJA 4Y9TA 3U3DA 3IEUA 1ONSA 4KOAA 4R3UC 1MX9A 1GXSA 3VOSA 2QPTA 2C0CA 4LJSA 3GJQA 2W6MA 4K0KB 1JECA 4ALNA 4M49A 1K5PA 4V2UA 3SLRA 4UOEA 2VKTA 4I6GA 3WR5A 4XR9A 4U2GA 1GA6A 3I30X 2A5YB 3AUXA 4K6CA 5LVAA 3UJAA 1JIUA 1Q84A 1FRQA 1RWWA 2DBQA 2O1EA 2VJMA 2XX3A 3KR0A 3OQHA 4E6EA 4DCNA 3NHPA 3ICCA 2TYSB 5JDIC 3V4RA 2REOA 1HDCA 2ZS9A 5JZVA 2ONYA 1B16A 5AM4A 1ZK2A 5IWCA 1O54A 1DBQA 2VHEA 1SCNE 1Z2PX 5CA0A 4F4HA 2TMGA 3HYSA 4K8OA 3TUIC 1AB5A 4AY4A 1OH6A 2C3PA 3IEXA 3MOGA 3O2JA 2WDPA 3VHRA 3DOOA 2XDWA 5TT1A 3MINB 3A11A 1L8QA 2A0YA 2HWYA 3I0MA 1LW6E 2PLFA 4GO1A 5KVAA 3L4JA 3U48A 4G01B 5BN1A 3H6GA 2QIPA 1XQ1A 4DDUA 1KI1A 1TZ2A 3D8UA 3OBBA 4KYTA 2HMYB 2JF0A 4ZYXA 5K0GA 2B0CA 4XASA 1TUBA 4RABA 3SHWA 2MYTA 3THYB 5HPYB 4F2PA 2O7SA 5L3QB 1UDRA 1T6NA 5JAOA 1IBCA 5KJFA 3PXGA 1SO8A 1ENOA 1K98A 1T9DA 3FMIA 4IO1A 4BE9A 4YYZA 2IYQA 2FWIA 2PUVA 3HCPA 3IKJA 3ORYA 3KQOA 4C7MA 1QG0A 3TLKA 1CUUA 2QTTA 3OZWA 3GG2A 4YRSA 4C1BA 3HHPA 1ZWLA 3GDGA 3Q3GE 3QXJA 5GJCA 1PJ8A 5GONA 3MS2A 4GOMD 2XQKA 4XSHA 2OP0A 3ITDA 4BEWA 4HWTA 2YMQA 4IIJF 3FTDA 2CXUA 3E81A 2E7ZA 5DHQA 2GZMA 1LKZA 4X1IA 4ONEA 3N6VA 2K7FA 3PHJA 4RA9B 5CT9A 1E3EA 3QVWA 3UZUA 1I3NA 4W9MC 2IYWA 3U17A 2B5WA 3S8EA 1UZUA 2PNFA 5DWQA 4HL6A 1YSCA 1ULAA 1ULHA 6GPBA 4GWLA 3RUPA 5EZSA 1KZGB 4LVUA 5LQNA 4KFCA 3WJ2A 4EG6A 3F78A 1LI7A 4N4AA 3SBDA 3OF2A 4DCSA 1I01A 3TRKA 4BZZA 4I5FA 4J1NA 5TF0A 1JX6A 4AUEA 5ENZA 4TL6A 4CIVA 4HQLA 4Q7QA 1ARZA 4G0WA 3OKPA 1CUWA 3EJ6A 3BJMA 3KP1A 5CU7A 4CUJA 4QDUA 2GTHA 4DR2B 1RBZA 1M2VA 1FFBA 2OZLA 2ZRKA 1K88A 2G9NA 1P2GA 3B70A 3LK6A 1VC2A 5EMKA 3WSTA 2H11A 3TOVA 5BRNA 2ZXUA 5EUBA 1CHNA 2H4YA 1D4FA 1SXHA 1T4DA 1YZUA 3Q1LA 2WWYA 1RLJA 2GTIA 2JJYA 2QX6A 3VVCA 3RJ9A 4M0KA 3U61B 3W4KA 1LPAB 1JHRA 1VBKA 1KY4A 3GHYA 4LVCA 3UHPA 4Z1OA 3M70A 5BQ3A 4U8GA 1EESA 1ZCFA 2HA0A 1M1YB 3KQMA 1XTJA 1QPBA 4MWCA 4A6EA 3S2GA 2EKDA 3PNOA 4CV2A 5JALA 4DHEA 1SOMA 3QV2A 4D3ZA 1RHQA 3GMDA 2QTHA 3V4OA 4PC6A 1H85A 4HXFB 3BRSA 3CLVA 3UC5A 1EG2A 5EP4A 3JQ8A 1GAQA 1U81A 3DS8A 3SD7A 1Z8HA 2IUTA 5IJ0A 5B7QA 2D4AA 4DWJA 1HE1C 1FB5A 1Y9ZA 2FPGA 3FE2A 3G17A 3QFSA 5JG7A 5I9BA 4DA4A 4NP6A 1K97A 1T5LA 2BL4A 1YR6A 3G02A 4Q0MA 3SIRA 4G23A 3CVJA 1D2EA 2AYYA 4FHGA 5E7QA 1T36B 2ORIA 1F2TB 2Q1SA 1Q77A 1AD2A 4EHIA 4WV3A 2BGWA 3P9PA 2AG8A 2FY8A 4S1WA 3VOAA 3PYLA 5JI3E 1IDN1 2FWJA 4EENA 3ZS8A 4YACA 2PRSA 1J8DA 4TTTS 2C5AA 1ZUWA 4F72A 1AGNA 5FV4A 1KDZA 3LIPA 1PZXA 5I9SA 3HY3A 1CUZA 3RYIB 2WUGA 4ZDKA 2VDNB 5JARA 4JVLA 4ZI3A 3R7DA 2G71A 4L76A 3L0ZA 3R6WA 3EW7A 1UUFA 3MZ0A 2W5UA 3R5SA 5KSZA 1HEUA 1U0FA 3ROEA 3TNDA 2GAFA 1U6JA 3GAMA 2H1SA 3K70B 1SOVA 2B37A 4P08A 4G37A 2I2BA 3VV3A 3PQFA 4OL0A 3SK0A 2I4OA 4R51A 4BQSA 4HNAB 4EI2A 4PQEA 1JR4A 1D0IA 2WSSA 4TKMA 4U3JB 4GX5A 1WXEA 3A26A 4II3A 1UMCA 4ZQCB 3I9OA 4NULA 2O5VA 5CB8A 1MCZA 5DNUA 2WUDA 2G1JA 2QJOA 2RHGB 2VT3A 4IDBA 2Y4NA 3ESQA 4F3YA 1IOWA 1C9YA 2O59A 4O02B 1G2IA 1L7PA 1P0PA 2G88A 1LX7A 3RSZA 1DJMA 1GT91 2K7ZA 2ACWA 2JIQA 2OXCA 1K8YB 3HN7A 3OA2A 4MRMA 3TUZC 2Y76A 3JCZA 4ZMBA 2Q6TA 4HDNB 4US0R 2YXDA 1THGA 3T7KA 3U7IA 3V80A 1YTLA 3ROPA 3BXGA 3KWJA 2HBQA 2Y3IA 2ZIFA 3V2IA 3L8HA 3OKCA 2VRCA 2ZDQA 3D7SA 1ECGA 1G9TA 1E6EA 2C9DA 2DY0A 4IDHA 1HLDA 4TN5A 4AZ3B 3U56A 2GCPA 2VHUA 2D62A 2EW2A 2ODWA 3H2HA 3H5OA 3H65A 3CUWA 4EGSA 1E2JA 1LWNA 4UHDA 3IJEB 4RK7A 3RRXA 3PLAE 2AMFA 3IEVA 3I0ZA 4HRAA 2C0QA 1T3GA 4RL6A 3TLAA 2AOUB 2UUBB 1E2FA 3OZUA 2OUIA 4GW3A 4D5EA 4D9MA 3GLSA 1FZTA 1FYVA 1PZFA 4HNRA 3GDWA 3DXXA 3IDQA 3NBKA 5JZ9A 3J80A 1UC8A 3L1HA 4UFOA 4RD1A 1W4AA 3IAM1 1WDWB 1I80A 2H2HA 5BQOA 5KNBH 4WADA 3JWGA 2RC6A 4HAZA 4BO9A 4BVBA 5ELXA 3FMFA 1EX9A 3OKFA 3OZXA 1YR1A 3ECSA 3KQUA 1YB2A 4J0FA 4YJ2F 421PA 1EBBA 4IZIA 4A10A 2G1KA 1LV7A 1FFWA 1ISSA 2AFHA 2HJVA 3NBYC 2NO9A 3KD3A 5DCLA 2JGFA 5KYYB 5DHAA 2R4QA 2VSOA 3PB3A 3VPGA 4R68A 1YE3A 4EFNA 4NCIA 4J1SA 4BJ5A 2IXDA 4FZJA 2IIPA 1VCMA 5LU8A 1FNSA 4OHOA 5HBRA 2PZBA 1NW6A 1DXOA 4PO9A 3GUHA 1QSGA 3MOIA 3EX7C 3T41A 1H9CA 4A5SA 2XIQA 1BDIA 5A5FA 3TQQA 2ZW9A 4OB6A 3T94A 1G20A 4R6XA 1NGSA 4HYEA 4ARZA 5CMLA 4M60A 2X2FA 1KAEA 1U2GA 1ZGHA 1KEPA 1XKTA 1HDRA 1RR6A 2G80A 2VBIA 5KJEA 4MW4A 3TPFA 4M4SA 1T8WA 4PYLA 4ESEA 2D5BA 2UYGA 2OT3B 2OPHA 1NAHA 4C6TB 1NR5A 3HCAA 3HCRA 2NNWB 3OSZA 3EGDA 2CV1A 2EP7A 2GK4A 1K75A 4MYRA 1ZGJA 4LHVA 5CX4A 4CG2A 1E0SA 3CMMA 1QVZA 1NKVA 2VYND 1ADBA 4ZYYA 5K8JB 5LIPA 4NNOA 1XZEA 2PK3A 4QLAA 2ZBFA 3HCBA 1RRMA 1WDKA 4QHSA 4Y2UA 1XVAA 2PS3A 2ZJFA 4FLMA 2IFTA 4HWGA 1ESZA 1CZHA 2ZR8A 4MR7A 5CTAA 4DSTA 1MB2A 1Z6YA 2RJOA 4HMQA 1NXWA 4IJ5A 4HUTA 2IBSA 2XAAA 3NZEA 4PIVA 5ALDA 3GNQA 5A6SA 2AE2A 3IHWA 5AI6A 4OB7A 2LKCA 2WP0A 3LDUA 1ZK0A 3PHLA 1AF4A 2WSYB 1O1YA 1OXBB 1RBQA 1GPLA 1HTTA 2B8TA 4KE7A 1XCBA 3O8DA 1OXMA 3VUFA 2YTZA 5KQPA 1V47A 2WE8A 4NC9A 4UTNA 2X7HA 2GDZA 3TWOA 4XCQA 3RPEA 3JAMA 1XF1A 4CCYB 5A02A 1BAPA 3BRCA 3GMIA 3DVLA 3GGSA 3PWKA 4YCCA 1UM8A 2BFAA 4LV6A 4ZHQF 3R41A 3DTYA 3QNMA 4TVOA 4YI5A 5BNWA 3LKVA 1E0KA 3LQKA 4HNAA 5IEBA 3AIIA 2BSQA 2VN8A 1U2GC 1N57A 2C9MA 2XVMA 5FNVA 4EGJA 2IIVA 3EVNA 4GLFA 2BM8A 1JEOA 3A1UA 1EK5A 2H9YA 3U4CA 4U2DA 1HYQA 3ZCXA 4FSXA 1AS3A 4GGPA 2ZB3A 1GU1A 1GPYA 3JYQA 4JYBA 4MV3A 5FIUA 1RYYA 2HA6A 3P0HA 1O0BA 1P44A 4BNGA 4JLAA 2DHEA 5LB2A 2C83A 1F7UA 4FGUA 1DMRA 2D6FA 4AI6A 1F4VA 2JGDB 1SVMA 1BX0A 3IQIX 1GO2A 1X9IA 4JSRA 4RV9A 5E3HA 1JHAA 2E48A 3MFQA 4ZRMA 4Q21A 2JAHA 1DBRA 1N0WA 5EIAA 3T7AA 3FTQA 4BFVA 1CLEA 4B47A 3PVSA 3I01M 3PC6A 3P1JA 3PFFA 3KHTA 4D74A 1PU2A 4OHUA 3UT6A 1DU4A 3HB7A 3TSYA 3BWXA 1Y3AA 3IKLA 1XZJA 1YD7A 1E1NA 2AVDA 3ACBA 1SUFA 1AZTA 3CZAA 3RUCA 5CG2A 3P0EA 1G2PA 3KTDA 3IHKA 3NX4A 1Q92A 3I5MA 4UBIA 1X3SA 5IJXA 3VJLA 1RQ2A 2RGGA 1QGDA 2G72A 3K5IA 3ZNQA 2QN1A 4L50A 1PVVA 4C0XA 3C6KA 2BZ0A 2QY6A 3E03A 1UBGA 3TG8A 2Z3WA 2JLXA 3H0CA 4EYGA 3DTVB 1NM5A 4JUDX 5EWLA 4F0JA 1Y5NA 4TQAA 4Z2AA 2W4QA 3Q7SA 1QZ3A 1DXYA 3PE4A 3LC2O 2ZI9A 2FQ1A 3T4UA 3I1FA 3COWA 3OPYI 4MWDA 4P2BA 4QDKA 4RD0A 5BUSA 3O8RA 3DLTA 3MWEA 2FW8A 1YTUA 4QPJC 2GZ3A 2VBCA 2VF2A 1L5GB 3T9CA 3AR4A 1EAYA 3AW9A 3ONVA 2YWJA 3ZGNA 3V48A 2A5JA 4OK6A 3KL2A 2VDWB 1NRJB 2PXHA 4Y30A 3Q9UA 4EPVA 2Z1MA 2B61A 3A6GA 2VVTA 3R5XA 2NVUB 4Y7CA 2FPXA 1KY3A 2RBEA 4RVUA 1KORA 1F2UB 1BJRE 3H8JA 3HXOA 1CQIA 4DXDA 5HF5A 4MQ4A 4AJ4A 5I5GA 4RY8A 3GRUA 4Z1MD 3DE0X 3LP8A 3MRSA 4MRPA 3FDIA 4QUGA 1GVHA 5ES3A 3ENKA 1DB3A 4UTRA 3OE5A 3UKDA 1V7ZA 1OBHA 5EXSA 7ADHA 1RJ9B 2IP2A 4V3BA 4FYYA 4G3XA 4C7XA 3N2LA 1JDTA 1Z8DA 2F3SA 2QTRA 3ESYA 5CVJA 5CCEA 2I9PA 5LQAA 3HY4A 3N7UA 3QF4B 3ZDAA 2GHIA 4N3AA 2I80A 5DBIA 2IKQA 3SC4A 1ORIA 4KQXA 4NAUA 4BOYA 3NIGB 4IFTA 3M4ZA 5TQ2B 4R01A 4ERNA 1TFRA 3JARB 4L7VA 4I2NA 1C2TA 1RZUA 4PNHA 1CZOA 3G9TA 3BDIA 4II7A 2Q6OA 4D98A 1B6GA 1NBMA 1QP8A 2VT7A 2FZ4A 2X2PA 4XQ0A 3OQPA 3SVLA 5IANA 1V26A 1C7JA 4MULA 2BKXA 4GM4A 3GEBA 1T3ZA 2IYFA 2DPHA 3JQ7A 2HQRA 1GTL1 2FOXA 1ADFA 2QMZA 3EY4A 4EIWA 2WZQA 4DG8A 1BFKA 3GHHA 3VR4H 1II9A 2AMLA 1WUHS 1W96A 4TN1A 4AUKA 1U0TA 4X94A 4HDRB 4HPWA 4URFA 1DVRA 4PSUA 2RH8A 1JWAB 3WDLA 1IUOA 2PPVA 4MA5A 1P4RA 2I87A 2JA2A 4XGKA 1KE2A 1CE8A 1AXGA 1PJLA 2CFIA 1DOHA 2ZJOA 3BBLA 2J7PA 3HU2A 1DG1G 4CQMD 1ZD9A 2HSWA 4MKIA 5IP5A 1VA5A 1Z0UA 3X1ZA 1FMJA 2Q1UA 3KJXA 4U8HA 2M98A 2H51A 2X1VA 3T35A 3NKVA 5IBCA 1OPRA 4JODA 2ZPUA 4FZVA 4HNHA 4J29A 4LNAA 1Y6RA 3LHSA 3QELA 2ZFUA 1CUFA 5EIHA 3UFBA 3IAS6 4M1KA 4CT4B 2MYUA 5TMDA 3EFBA 4OMDA 4DM4A 1B2LA 1RS0A 2ZJ1A 4FGKA 3SNHA 3HO6A 5DNDA 1O96A 5IBPA 5JZMA 4JR1A 1ZMBA 3S8YA 4UE6A 3TRIA 2ZTLA 4RH3A 4MPJA 4R1UA 1P72A 1T43A 1XBTA 2HK9A 1NOIA 4D79A 1D6MA 3KWMA 1AO0A 3WYEA 1J0AA 4ZVUA 4CKEB 4AURA 2GXAA 1IMOA 4I81A 1EE1A 2GYWA 1SU8A 1QDEA 2WI8A 2Z1NA 3KQSA 1G63A 1PZNA 2OHOA 3AI7A 1RXUA 2XUZA 1ISRA 1HLFA 2WHEA 4GOND 3K6SB 4MEAA 4ZV4A 1M1XB 2VZLA 2P77A 2VDKB 2I22A 1O58A 1BEEA 4F4JA 4J3NA 2D0DA 1WTAA 4EJ0A 3I37X 4OBEA 1JKMA 2O1SA 3L6RA 1DJOA 1Z0AA 4WE3A 3ZQUA 3ZVNA 1NE2A 2OK8A 2GJ4A 1MJHA 1KBZA 5FPTA 1MA3A 1ZVMA 2WABA 4URUR 1F12A 4XVUA 1M2GA 3UHJA 1WXFA 3L40A 1ST3A 1KERA 3INNA 3N07A 3DE6X 1VG0B 2J3MA 4EYSA 5D00A 5AVZA 2WTMA 3JWJA 3LQQA 1D9ZA 4DRXA 1GIAA 2NVUA 3FF1A 3RSCA 3T9FA 2AOTB 4MWGA 1J0CA 5DW3A 2NUTA 4DMHA 3VPBA 4YLEA 4CMEA 5HM8A 3PQEA 3GLQA 3MJEA 3DBLB 1ZOSA 3MW8A 3N59A 3ZI4A 2PXCA 3PEWA 3M34A 1IG3A 1P2TA 2HMTA 2X22A 3LPDA 4Q3NA 4YRIA 4S05A 3G7NA 3UW1A 2XXBA 4LZNA 2GEVA 3UIEA 2PEZA 3DJFA 3DOFA 3FDZA 1ESDA 2ACEA 5DGIA 3MWGA 1A1SA 3RG2A 5F12A 3U31A 3I09A 4G2NA 4Q7LA 4EG0A 4L4YA 1L7XA 1QORA 3LT4A 3ETLA 1SIBE 4PIMA 1NXSA 4XB2A 4B4OA 4UCFA 5AW8A 2DR2A 2OG1A 1QM5A 3W0LB 4ARVA 5F4ZA 3I9NA 1MAAA 3QEKA 3M4YA 3I1IA 4XFKA 3WK8A 3UV6A 5IMSA 5JDIA 1JT2A 2QU7A 4MS1B 4O1MA 4LOLA 2V8BA 1A2BA 1QG4A 3K9NA 3L8MA 3PXUA 1WE2A 4Q7EA 2BZGA 2GZSA 3NEYA 5FA6A 3ZDXB 3ZQ4A 1W1IA 4QAQA 1MFZA 5DBGA 1S96A 1T6BY 3C3JA 2CFSA 2QDKA 2BLNA 1GZ5A 1VLLA 4DLKA 3TM4A 3FY4A 4J07A 4ZVMA 1JBQA 2DSTA 3LJKA 4M8LA 1HFJA 4BLQA 4BY9E 3RBAA 8OHMA 2PWYA 2BGNA 2ZJ8A 4G4JA 5JOQA 3D6FA 1XRRA 4DDKA 5K0NA 4L75A 4QFMA 2XBLA 4CM8A 5JCPA 3ICEA 5FYDA 2EBFX 5A2GA 4FMDB 5CDGA 2RHLA 2QWXA 4HFMA 3EVDA 3L7KA 5B12A 3C85A 3QXCA 3RVBA 1LLUA 2R1VA 5AH0A 5KTKA 5KYWB 3LCMA 3DBRB 3IBSA 4JQZA 1QIKA 2B6NA 2BM9A 1ZL2A 2JLAA 4FFSA 5IASA 1NHGA 2GB4A 2OMEA 4Q93A 4ZAVA 1FBNA 3KBBA 3L8CA 4XGIA 1T0BA 3WLJA 5CDTA 1JLSA 4RIEA 2XTAA 1TL7C 4EABA 1RI1A 5ERGB 2BD0A 2XMSA 5AMXA 4HQKA 1G8HA 2W98A 3T5MA 4NZPA 4LQDA 1BGXT 5DDIP 3RIMA 4GX0A 3H04A 4I55F 4Z9XA 1Q11A 4DGSA 5HUQA 2F55A 4RTNA 1ZM7A 1LJ8A 3C48A 2CV2A 1EDEA 2ZIGA 1Q0PA 4KJXA 4YCMA 5HRUA 1E6LA 1SUWA 1U5BA 3RS3A 1QQBA 1DQYA 2DQZA 5DZSA 1HNNA 4TMTA 3NTUA 5BNZA 2JNWA 2I3DA 3I58A 3L1VA 3OOEA 1BVUA 4L57A 1YRQA 4X1OA 3W2EA 2D74A 3PFIA 3P0RA 4B33A 5F5NA 3EZ6A 5H3CA 1E6MA 3AWIA 4MRMB 4B43A 4DG9A 1GLVA 5LZ9A 4YT2A 1KP3A 4BQEA 1P0CA 1QHSA 2X9VA 2OOKA 3TNJA 4P3OA 3WGLA 4OL9A 1FTWA 5K8TA 3NVKI