3L70E

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l70E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l70E02
5HL4A 3VCAA 3BCCE 2QJKC 5KLIC 4QCKA 3H1HE 3GZXA 4HM6A 1VCKA 4H13D 2NUMA 1O7HA 4P1CH 2E75D 3N0QA 1SQPE 4QUPA 2JO6A 2E74D 1UUWA 2E76D 2E4QA 2XRXA 1JM1A 1ULIA 3GL2A 1BCCE 1UUVA 2E4PA 2Q3WA 2BMRA 3TGUE 1EZVE 2QJPC 4HM1A 1BGYE 1SQBE 4HM4A 4HJLA 3H1IE 5KKZC 4NB8D 3L72E 3EN1A 2ZT9D 4OGQD 3VMID 3DQYA 4P1BH 2DE5D 1L0LE 2DE6D 1NDOA 1VM9A 1Q90C 2QJYC 5AEWA 1NTZE 4AIVA 3L71E 3L73E 1G8JB 1ZRTE 2B1XA 4HM8A 4NB9D 1VF5D 3VMHD 3C0DA 1O7WA 3GL0A 4HM5A 1NYKA 2BMOA 4QUQA 1KYOE 1P84E 1BE3E 2HMLA 2HMNA 4QDFB 4D6TE 1WQLA 3GTEA 3H1KE 1ULJA 1RIEA 4PD4E 1PPJE 3L74E 3GOBA 3VCPA 4QDFA 2A06E 4QDDA 2IBZE 1SQVE 1O7PA 1O7NA 2GBWA 4HM0A 2NVEA 4PV1D 4HM3A 3D89A 2XSHA 3GTSA 1RFSA 2ZYLA 2YIUC 4HM2A 3H1JE 5CXMA 4QDCA 2BCCE 1O7GA 2QPZA 3AZCA 3GB4A 3EQQA 4H44D 2YFLA 4AAYB 1SJGA 2YFJA 3CX5E 3L75E 3CWBE 4NBCD 4EMJB 4U3FE 4NBFD 1NU1E 2CKFA 2NVFA 5BOKA 2FYUE 2GBXA 3CXHE 2NVGA 2YVJB 3FOUA 1SQQE 2HMKA 2NUKA 2XR8A 4NBHD 1KB9E 1O7MA 4NBAD 4HKVA 2YFIA 2HMOA 1G8KB 4H0LD 4NBGD 4NBDD 1NTKE 2I7FA 3GZYA 4HM7A 4NBED 3VMGD 5KLVE 2DE7D 1PP9E 4QURA 2B24A 2HMJA 1L0NE 2JZAA 1EG9A 2FYNC 1SQXE 2D2CD 2BMQA 3H1LE 3GCEA 1NTME 4NBBD 3GKEA 3L70E 5AEUA 1FQTA 2HMMA 2XSOA 2NWFA
chains in the Genus database with same CATH superfamily
5E79E 5KAIE 1JM0A 1S9KD 1KQSO 3CCVP 1JTHA 1FOSF 2OYIB 4H13D 4RESB 2FBWC 1QVFO 2ZVOB 4GODA 1P84D 1VQ7P 1Q81Q 1FE6A 5M1BA 2FFDB 2KUBA 1NTZG 3SWYA 1SQBK 3JCUH 3K5BA 3H6PA 3AE8C 2OYIC 5AW9B 2QVAA 3A2AA 2ZYDA 1KQFB 2B1XA 2HG5D 2YO3A 1NTZK 2W6BA 1S5LX 1PFIA 5E79H 1PGJA 1KB9I 2GUSA 5CCHD 1S2EA 5KJ7A 4PV1D 4AUWA 3UIAA 2WSFH 1AV1A 1YQ3C 3CCSP 1QVGO 3KQGA 2BCCE 4QDCA 1U7MA 2WT7A 2W90A 1Y8AA 3M0AA 3B5NC 1NWQA 1NTMG 1MUUA 1NHLA 2I1JA 2YXRB 3S4RA 1PGQA 1JY3N 1OWAA 1QL2A 5AW1B 2CPSA 1SQPD 4NBGD 1DD3A 1LJ2A 2P1JA 2AXTH 2WSEH 1LGHB 3L35A 4TLFA 2D2CD 2WSCH 3HE5B 4Y99C 2ZVNB 3L37A 1L0NK 3CMEP 4LGDE 1U7JA 3MIWA 1A02F 1ZOYC 1UIIA 1HH0A 1WMKA 1H0TB 1YBKA 1JCDA 1U57A 1NYHA 1NJIQ 1L2PA 2L91A 2XRXA 3P8MC 4GIFA 1EQ7A 1BCCE 3GW6A 2BMRA 4WY4B 2IYPA 1S5LH 3L71J 2NPSD 3EN1A 2ZT9D 2I8DA 5CCGA 1QX8A 3CX5D 1S1CX 1YITP 1OW6A 3H1KD 4I6MC 4H13C 2WMMA 3I55P 2N1TC 5KAFH 4U3FJ 1AA0A 3PJSK 3VCPA 2GBWA 3V2RA 3AEEC 1KV4A 2P10A 1PPJD 3AEBC 2WPQA 1QL1A 3FX0A 1ZMEC 1LT9A 2KB7P 1EDJA 2YFJA 4H13B 3L70J 2MKVA 2PRRA 1NTKE 1NTKD 5KLVE 3H1HD 1SQQG 3GHGB 1BGYG 2YNYA 1EZVG 2AXTE 1LT1A 2PFXA 2M5AB 3L74D 2N1TA 3GG2A 5KTBA 2PGDA 5APYA 1CZQA 3FXDA 1L0NJ 3AEGC 2Y0DA 5CHXA 2C0XA 3CC2P 1RY3A 3V2PA 1SQVG 5GTIH 4L73A 4HM4A 3JSVC 2Q1KA 1E5WA 1BE3G 2WPRA 3VMAA 1GL2D 3H1KJ 1FDOA 1PP9G 2DW3A 2QEXP 4NPDA 1ZR2A 1VF5D 1R8EA 1ZV8A 4KT0J 2OYHB 3KDPB 4OWFA 1BE3E 4QDFB 2WWWA 4D6TE 4UB8E 3SFEC 2CPBA 3L74E 1KN7A 5AVRB 1H89A 1W5CE 4HM0A 3WUUA 2NVEA 3GTSA 1DX7A 5K5GB 4YPCA 1O7GA 2OTKE 2QG4A 3SWKA 2YFLA 3D6YA 3ITKA 4K3AA 1BCCD 3P7KA 4PJ0E 3GMAA 2OYHC 1NH4A 1PPJG 1LTTC 5AW6B 2YVJB 4D6TG 1ZXGA 5B66H 2YFIA 2HMOA 2I7FA 2O01N 1TU3F 4BRYB 3B71A 1YI2P 2DE7D 5AW3B 2JZAA 2QM7A 3MUDA 2K1AA 4HB1A 1X22A 2O1KA 4PD4I 1PP9J 2CK3H 3TSIA 4PV1B 2NUMA 1L0LJ 3HUSA 2C9LY 1VQ9P 2PP6A 2YIUB 3CC4P 2ZXXA 1UUVA 2A45G 3VMYA 3RK2D 3L72E 2LXBA 2POHA 4OGQD 3VMID 3DQYA 4P1BH 3L75D 4PV1C 1EDLA 4AIVA 4ZMDA 1Z56A 4U3FG 5APXA 2UWJE 4YTPC 1NYKA 1N7SD 4UB6H 5AVQB 3L70D 1NTMD 3A0BH 4JBZA 1W2EA 2Z4EA 2B87A 3AE4C 3Q5RA 4ASVA 2A45I 4H44D 3KXDA 4AAYB 4NBCD 3CWBE 4U3FE 1GL2B 1JY2N 1GW4A 2WZ7A 2G8YA 4NBHD 1N73A 2M3BA 4AYCA 3OW2O 5APVA 1VQ5P 1KILC 1QEXA 2BASA 2XDJA 3GF7A 2C9NY 1URQB 3LIDA 2O01J 5CBOA 4JYCA 1VQOP 1VCKA 2KZIA 3A0HH 3KZIH 1L4AD 2E74D 1N8RQ 2FXMA 4W7YA 1SP4A 1FJKA 2HLOA 1KYOD 3Q2YA 1Q90D 1L0LK 1KQGB 3CL3D 1HBWA 3RL0D 3SWFA 2DE6D 2QJYC 3CCMP 4NB9D 2FYZA 1KYOH 4HM5A 1L0LG 1JY2O 2WPSA 1K9MQ 1E79H 3GOBA 5AW2B 3FWNA 3RL0C 4QDDA 1O7PA 4YXWH 3L75J 4I7ZC 4HM3A 2P7JA 3BRTB 3I5CA 2K37A 3O6QA 3RK3D 1GL2A 2QJYB 2P67A 3II6A 3MZWB 1YIJP 3EQQA 4C7NB 1YYCA 1HJ0A 3A7OA 3LW5H 1BE3J 3H1LG 4C46A 4I1LA 2YKPA 2FYUD 2ZAEB 3L74J 3I56P 2Q5UA 1OZHA 2NUKA 1KB9E 2I1KA 1OW8A 2ZT9B 3GZYA 3F5HA 5APTA 2KK7A 4JF7A 2FYNC 3ZDMA 2BMQA 4CPGA 3L4FA 3L71D 3HUSC 2QE7H 3GZXA 5APSA 1J2JB 1SQBJ 1M1JC 1T2KC 2KSEA 2KNCB 1SQXD 1YJ9P 3G3ZA 4H44C 2FYNB 3CD6P 2KS1B 3VYIA 2E4PA 5TJHA 1NTZJ 3M9BA 1BGYE 1KB9H 4OGQB 1MV8A 2JDIH 3HD7D 3HUSB 1L0LE 1K04A 1GDTA 1VL2A 4YXDC 4WVZA 2KI7B 3C8VA 2WITA 1KYOE 1N7SA 1WQLA 2E76B 3PHLA 4ZKPA 3USSA 1DH3A 5B66E 1SQVE 4OGQC 2RH0A 2E75B 2BEQD 4N78E 3CWBD 1X9VA 3AEDC 1LTJB 3TNUA 5GTIE 3HD7B 1AVYA 1T6AA 1G1IA 2NPSA 2HPCA 2O01H 3MUDC 2E76C 4R4LA 2H43A 2E75C 2BCCJ 1YJWP 1LTJC 2B88A 2BEZF 4RJTA 1G1JA 1FQTA 2IX7C 3AE6C 1IFMA 3H1LJ 5H2FH 2KYVA 1UUWA 2L5GB 1W2BO 3VTPC 3H32A 5BU5A 2P2UA 3TF5A 1NAYA 4IFDK 1L4AB 4JQ0D 3WU2H 1Q7YQ 1RH5B 1HGVA 1T8ZA 1T3UA 3WMM0 2M5AA 1HTLC 3MGNA 3M91A 2HMLA 2AXCA 1AFOA 3GHGA 2YKOA 2MJZA 3E7KA 3NXSA 2P58A 5KLIB 1LTSC 1MZ9A 1KYOI 2ZYLA 4NPFX 4N3YB 3O8ZA 3AZCA 1ZP0C 2HYNA 1L4AA 1LT9B 2FFDC 1RQUA 1CW5A 3A3YB 3H32B 1DIPA 5APQA 2XNDH 4QMAA 3H1HJ 3VMGD 5AW0B 2V7QH 1FAVA 5AVXB 1EG9A 1PGPA 1YTZT 3L70E 2NWFA 1GU5A 5HL4A 5KAFE 1CSBA 1MFZA 3Q5SA 4LLHA 1BGYD 1NTKJ 1RF0A 4N78D 2JO6A 1PL5A 1R5SA 3L74G 5BVZA 4WWIA 2K9YA 2WSEJ 3L70G 4WY4A 4D6TD 2QSIA 3BRVB 2OGUA 1RQVA 5DJTB 1EZVE 2RKLA 2NPSB 2HPCB 1ZW0A 4L75A 1OIPA 3HD7A 4ASWA 4WY4D 5KAIH 5H2FE 1PGOA 3CMAP 3TNUB 1LTJA 1KILD 4Y99B 3VMHD 1JY2P 1M56D 2W27A 5CCHA 2IZ0A 1T2KD 1FZEA 3HE5A 4W80A 1NU1J 1BSHA 1SQBG 3A0HE 1VQMP 1N7SB 5KJ7C 1BDDA 3IF4A 1RFSA 3W67A 2D2CB 2W6AA 1NO4A 3G9RA 3N7NA 1A02J 4WY4C 1KILE 4D6TJ 2WT7B 3TDKA 2NVFA 2IZ1A 4PD4H 4UB6E 2GBXA 1IO4A 1NU1D 1SQQE 3AE5C 2KS1A 5KLVK 1EZVD 1DD4A 5APWA 2H89C 1N7SC 2R3CA 1SQPJ 1FDMA 2KNCA 3V5BA 5DJUB 4EDFA 2D2CC 2J5UA 1K8AQ 3PH0A 2IDBA 1VQ8P 3GLMA 2AEJA 1FZAA 1L0LD 2LR2A 2YMKA 1LTBC 1SVFA 1S3JA 4EI2A 4IOIH 1NTMJ 1YQ4C 2E5YA 2BCCD 2WPVB 3CCEP 3GF3A 5AVUB 1IFPA 1GZLA 4TT3H 4DCKA 4LC1A 4WBAA 4C7NA 2YO2A 1JOCA 1NDOA 1VM9A 2OYIA 1Q90C 1IJDB 1N2DC 1IFIA 5AW8B 3GHGC 3O6QB 3L71E 4HM8A 3C0DA 1P84H 3CWBG 1M7LA 4IL6E 3NTNA 2OTLP 1IFDA 3MHVA 2N9BA 2QRXA 2A06E 3VMZA 2IBZI 4WB4A 3TK1A 4PD4D 3S1KA 2HODA 1X79B 3OJAB 2KLVA 1NTZD 3L36A 1NU1K 3ABVC 1T3JA 1WT6A 2Q6QA 4NBFD 1SQXG 2KOGA 4EOTA 4IL6X 2NZ2A 4W7ZA 1O7MA 4OVNF 4NBDD 1H8AA 2B9BA 1SQXK 1JCCA 1PP9E 4U7JA 5AVTB 2R32A 3M0DA 3AE7C 4NBBD 2E42A 3TGUJ 5KLVJ 4A7PA 1XTGB 1SQPK 4HM6A 1URQA 2H88C 4AQRD 3G4SP 3A0BE 3IN6A 1KB9D 1X8YA 3H1LD 4L76A 3L72J 1OVUA 1N73B 2Y9YA 1OX3A 1OVRA 1KZUB 4K35A 4BXLA 4I2LC 1EC5A 1VQPP 5AVYB 2WTYA 3L71G 3P8CD 2J59M 1RE3A 1M1KQ 1QLED 3SFDC 2B87B 4L74A 3FGAD 2QA4P 3B5ND 3L75G 2BMOA 1P84E 2A06D 2PAJA 1BCCG 5TISH 3CCUP 1OXZA 5B5EE 2C0WA 1SQVK 2YIUC 4HM2A 3OAKA 4GKGA 1KC8Q 1OW7A 1HVVA 4XA4A 3G71P 1M57D 3VP9A 3H1KG 3CXHE 1LP1A 1M1JA 1NVOA 3G6EP 2GA1A 1VDFA 3PP5A 3M9HA 3MD0A 4IFMA 4QURA 2J58A 2FYUG 1ZRTD 1HJBA 2OTJP 5KJ7D 2FY8A 3CX5I 3M06A 1S4XA 5AEUA 3EFFK 3R2PA 1SQQJ 3H1IJ 3H1JG 1UIXA 1N86A 1GMJA 4QCKA 3AE2C 2JJLA 1ZR4A 1SQPE 1FU1A 2Q3IA 1RE3C 1NKNA 2E4QA 1VF5C 2GUVA 4BRYA 1NOHA 2R5DA 3PTZA 3B5NB 2LKMA 5EFWB 1EZVI 2WSSH 1JNMA 1GL2C 4IFFA 5CJ4A 3D70A 1SQQD 1K73Q 3P8CE 1RF1C 4HJGH 4C7RA 3BATA 1QGKB 1HGZA 1KILB 5CCGD 1IZNB 3RK3C 1G8JB 1GD2E 3IR9A 3H25A 1VF5B 1S9KE 2YXQB 3VP8A 1RIEA 1PPJE 2FYUJ 2IYOA 1FZFA 4QDFA 1O7NA 1JB0J 3M0DC 1SS1A 2OYHA 1RF1B 3B4SA 1P84I 3FWLA 2QPZA 3CCQP 3RK3B 2KP8A 2E43A 2R3SA 1OMIA 2XNXA 1KMIZ 2HMKA 1LWUA 4H0LD 1G8KB 3F89A 3CWBJ 2Z5IA 1JY3O 1PIXA 2IBZD 2IFMA 2JWDA 1AQ5A 2LXCB 5KKZB 1Q2NA 1FZCA 2N1TB 3RL0B 3VOPA 4U3FD 2JR8A 2QJKC 1DEEG 1YTZI 3OA7A 4GDOA 4KJMA 4I7ZB 2XU6A 3HE4A 2N1TD 2N9YB 4N6JA 1Q86Q 1KFNA 1JUNA 2OQQA 2Y0EA 3KPEA 2Y9ZA 1S72P 1NKZB 4DZOA 1NAFA 3H1ID 4HJLA 5KKZC 2ZT9C 2QJKB 4BWNA 1MFTA 2XZRA 4ZNCA 1SQVD 1URQD 1ZN5A 3AE9C 3L73E 2K9JA 2YMYA 3AECC 4XFJA 1BE3D 3EWKA 2ZYGA 2ITAA 2O1JA 3GTEA 1G2CB 1J1EB 1PV3A 1JO5A 1H88A 1VQNP 3EFGA 1WRGA 1YJNP 2JKVA 4H44B 3KYQA 2M3EA 1FDIA 1SQPG 2W6JH 2VRSA 2FYUK 2IFNA 3L75E 3P32A 3PLNA 1FJPA 1JMBA 2WSCJ 1J1EC 4HKVA 3RBXA 4HM7A 3LIEA 2R44A 1NTKK 1JY3P 1NTKG 1PZQA 1EDIA 3PRJA 1H0TA 2JEEA 1BCCJ 3M9QA 5CCGC 3HTKB 5CCHC 3H1HE 1ZLLA 3JCUE 2IBZG 4QUPA 1FBMA 1M90Q 2RN0A 4Y28J 3HD7C 1N7LA 3GL2A 2NRGA 3NMDA 1OFCX 1SQBE 3RK3E 1S5LE 2Q9IA 1M8OB 2KXPB 1NTZE 2W83C 3HTKA 3Q3DA 3U59A 3H1IG 3H1JJ 4Z1MH 3GL0A 3CX5H 3NFQA 3H1KE 1ULJA 1IFJA 3CXHD 2Q3EA 1RHZB 2XSHA 1IK7A 2SPZA 1R5LA 3EQ2A 1GK4A 2XV5A 1VPCA 3AEAC 1NU1E 2V4HA 2FYUE 4MN4C 2NVGA 2OARA 2FFDA 3FOUA 2QIWA 3BCCJ 2E5TA 2GM4A 1AVOA 1XTCC 1LNQA 5L8RJ 2B24A 5AW5B 1G2CA 1L0NE 1NTMK 3A5TA 1NU1G 4EIJA 2Y0CA 2QJPB 1JTHB 1Q82Q 4NPEA 1GU4A 4DOJA 2K9JB 3VN0A 1SFCD 3VCAA 1MKMA 5KLIC 2FKWB 3L72D 5GTHH 3C1LA 2H7HA 3CXHI 1HWTC 1KTMA 4PJ0H 1JM1A 4XE5B 1LT9C 3AEFC 3BVHA 2QJPC 4HM1A 1PP9D 5KLVD 1NGMB 4NB8D 3CCJP 2XKMA 4ZKUA 2A45H 1LTGC 2ZFCA 3HE4B 2E74C 3SSUA 5APUA 1FZCB 1IFNA 3C9IA 1O7WA 3WUVA 1EXJA 1URQC 3L72G 4PD4E 2O3JA 3TGUD 3WU2E 2KSJA 3S9OA 3AE1C 2JO1A 1LWUB 2JP3A 3L73J 1JEKA 2E74B 4DT0A 3H1JD 1SLQA 1SQXJ 1GTWA 3B8EB 2W8ZA 1FZCC 3MP7B 3CX5E 1IC2A 1OVVA 2NPSC 3FXEA 3JC22 1USDA 4RO0A 1HUCA 2AEFA 4NBAD 1RF1A 2JWAA 4NBED 1DEBA 1BSNA 5AVWB 2WVRA 3L73D 1KD1Q 4RKUJ 3E1IA 1LWUC 1GK6A 3TGUG 3GCEA 1NTME 4GT1A 3GKEA 1SFCB 2K3RA 2XSOA 1CI6B 2BCCG 3WUTA 1KILA 3V4WA 2FXPA 1HF9A 2YKQA 2KZJA 1O7HA 2E75D 3N0QA 1BGYJ 5GTHE 2E76D 1FS0E 5AW4B 2KIKA 3B5NA 3T97A 3LW5J 3H1HG 2Q3WA 3TGUE 1BDCA 2RMZA 3U1CA 3RK2C 1USEA 3L73G 5BU8B 1SFCC 1FC2C 3V4QA 1KQLA 3BCCD 3KZIE 3U1AA 1FZBA 5AEWA 3AE3C 2ZYAA 2AEMA 5AW7B 1SQVJ 5KLVG 1KFMA 4DJGA 3IAOA 2Q7CA 1VQ4P 4QUQA 3HRNA 5CJ0A 3MTUE 4M3LA 3RK2B 5B5EH 4R4MA 1D7MA 2H8PD 3D89A 1M1JB 3H1JE 1LP1B 2V7QJ 3GB4A 5AVVB 4HKZH 2ZJSE 4GOFA 1Y47A 2HFED 3BCCG 5BOKA 3D6ZA 1VQLP 2R5BA 5CMZA 3T97B 1SQQK 1AQTA 4EYYQ 2QM8A 3BASA 4JYBA 1JMMA 3N4XA 4JPZB 3QH9A 3H1LE 3V6IA 2M8RA 4OH8B 3V2QA 2HMMA 1KORA 1CI6A 3QWOC 3BCCE 1SFCA 3R4YA 4UB8H 1LTIC 4P1CH 5AVZB 2IPPA 1X0TA 1YHQP 1IK9A 3E1RA 2Z5HA 2G3AA 1ULIA 2HR3A 3H1IE 4HYTB 1AJYA 2WQYC 1EXIA 5AVSB 4H0LC 3CXHH 2DE5D 5TISE 1RE4A 3RBZA 1ZRTE 1L0ND 1FZGA 1FOSE 2WSFJ 1LTAC 4GOEA 2OYOA 3CCRP 1RF0C 2HMNA 1GW3A 2B89A 1RE4C 2IBZE 3TYYA 3Q5PA 4HH2A 3RL0g 2M0BA 1Y9BA 2ZXEB 4H0LB 2A06G 5CBNA 3RGUA 5CXMA 3IFMA 1J1DB 1N73C 4O9BA 3CPWO 4IL6H 3KHUA 1SJGA 3CCLP 4EMJB 5C39A 2CKFA 4B86A 1L0NG 1VQKP 2HODB 1K05A 2XR8A 3VMXA 1L4AC 3V2NA 2FXOA 2K88A 3CC7P 1EDKA 1SQBD 2HMJA 1SQXE 3W68A 4KHXA 1J1DC 1VQ6P 3CLQA 2KLUA 3D71A 3CI9A 3Q1MA
chains in the Genus database with same CATH topology
5HL4A 3VCAA 3BCCE 2QJKC 5KLIC 4QCKA 3H1HE 3GZXA 4HM6A 1VCKA 4H13D 2NUMA 1O7HA 4P1CH 2E75D 3N0QA 1SQPE 4QUPA 2JO6A 2E74D 1UUWA 2E76D 2E4QA 2XRXA 1JM1A 1ULIA 3GL2A 1BCCE 1UUVA 2E4PA 2Q3WA 2BMRA 3TGUE 1EZVE 2QJPC 4HM1A 1BGYE 1SQBE 4HM4A 4HJLA 3H1IE 5KKZC 4NB8D 3L72E 3EN1A 2ZT9D 4OGQD 3VMID 3DQYA 4P1BH 2DE5D 1L0LE 2DE6D 1NDOA 1VM9A 1Q90C 2QJYC 5AEWA 1NTZE 4AIVA 3L71E 3L73E 1G8JB 1ZRTE 2B1XA 4HM8A 4NB9D 1VF5D 3VMHD 3C0DA 1O7WA 3GL0A 4HM5A 1NYKA 2BMOA 4QUQA 1KYOE 1P84E 1BE3E 2HMLA 2HMNA 4QDFB 4D6TE 1WQLA 3GTEA 3H1KE 1ULJA 1RIEA 4PD4E 1PPJE 3L74E 3GOBA 3VCPA 4QDFA 2A06E 4QDDA 2IBZE 1SQVE 1O7PA 1O7NA 2GBWA 4HM0A 2NVEA 4PV1D 4HM3A 3D89A 2XSHA 3GTSA 1RFSA 2ZYLA 2YIUC 4HM2A 3H1JE 5CXMA 4QDCA 2BCCE 1O7GA 2QPZA 3AZCA 3GB4A 3EQQA 4H44D 2YFLA 4AAYB 1SJGA 2YFJA 3CX5E 3L75E 3CWBE 4NBCD 4EMJB 4U3FE 4NBFD 1NU1E 2CKFA 2NVFA 5BOKA 2FYUE 2GBXA 3CXHE 2NVGA 2YVJB 3FOUA 1SQQE 2HMKA 2NUKA 2XR8A 4NBHD 1KB9E 1O7MA 4NBAD 4HKVA 2YFIA 2HMOA 1G8KB 4H0LD 4NBGD 4NBDD 1NTKE 2I7FA 3GZYA 4HM7A 4NBED 3VMGD 5KLVE 2DE7D 1PP9E 4QURA 2B24A 2HMJA 1L0NE 2JZAA 1EG9A 2FYNC 1SQXE 2D2CD 2BMQA 3H1LE 3GCEA 1NTME 4NBBD 3GKEA 3L70E 5AEUA 1FQTA 2HMMA 2XSOA 2NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL4 A;  3VCA A;  3BCC E;  2QJK C;  5KLI C;  4QCK A;  3H1H E;  3GZX A;  4HM6 A;  1VCK A;  4H13 D;  2NUM A;  1O7H A;  4P1C H;  2E75 D;  3N0Q A;  1SQP E;  4QUP A;  2JO6 A;  2E74 D;  1UUW A;  2E76 D;  2E4Q A;  2XRX A;  1JM1 A;  1ULI A;  3GL2 A;  1BCC E;  1UUV A;  2E4P A;  2Q3W A;  2BMR A;  3TGU E;  1EZV E;  2QJP C;  4HM1 A;  1BGY E;  1SQB E;  4HM4 A;  4HJL A;  3H1I E;  5KKZ C;  4NB8 D;  3L72 E;  3EN1 A;  2ZT9 D;  4OGQ D;  3VMI D;  3DQY A;  4P1B H;  2DE5 D;  1L0L E;  2DE6 D;  1NDO A;  1VM9 A;  1Q90 C;  2QJY C;  5AEW A;  1NTZ E;  4AIV A;  3L71 E;  3L73 E;  1G8J B;  1ZRT E;  2B1X A;  4HM8 A;  4NB9 D;  1VF5 D;  3VMH D;  3C0D A;  1O7W A;  3GL0 A;  4HM5 A;  1NYK A;  2BMO A;  4QUQ A;  1KYO E;  1P84 E;  1BE3 E;  2HML A;  2HMN A;  4QDF B;  4D6T E;  1WQL A;  3GTE A;  3H1K E;  1ULJ A;  1RIE A;  4PD4 E;  1PPJ E;  3L74 E;  3GOB A;  3VCP A;  4QDF A;  2A06 E;  4QDD A;  2IBZ E;  1SQV E;  1O7P A;  1O7N A;  2GBW A;  4HM0 A;  2NVE A;  4PV1 D;  4HM3 A;  3D89 A;  2XSH A;  3GTS A;  1RFS A;  2ZYL A;  2YIU C;  4HM2 A;  3H1J E;  5CXM A;  4QDC A;  2BCC E;  1O7G A;  2QPZ A;  3AZC A;  3GB4 A;  3EQQ A;  4H44 D;  2YFL A;  4AAY B;  1SJG A;  2YFJ A;  3CX5 E;  3L75 E;  3CWB E;  4NBC D;  4EMJ B;  4U3F E;  4NBF D;  1NU1 E;  2CKF A;  2NVF A;  5BOK A;  2FYU E;  2GBX A;  3CXH E;  2NVG A;  2YVJ B;  3FOU A;  1SQQ E;  2HMK A;  2NUK A;  2XR8 A;  4NBH D;  1KB9 E;  1O7M A;  4NBA D;  4HKV A;  2YFI A;  2HMO A;  1G8K B;  4H0L D;  4NBG D;  4NBD D;  1NTK E;  2I7F A;  3GZY A;  4HM7 A;  4NBE D;  3VMG D;  5KLV E;  2DE7 D;  1PP9 E;  4QUR A;  2B24 A;  2HMJ A;  1L0N E;  2JZA A;  1EG9 A;  2FYN C;  1SQX E;  2D2C D;  2BMQ A;  3H1L E;  3GCE A;  1NTM E;  4NBB D;  3GKE A;  3L70 E;  5AEU A;  1FQT A;  2HMM A;  2XSO A;  2NWF A; 
#chains in the Genus database with same CATH topology
 5E79 E;  5KAI E;  1JM0 A;  1S9K D;  1KQS O;  3CCV P;  1JTH A;  1FOS F;  2OYI B;  4H13 D;  4RES B;  2FBW C;  1QVF O;  2ZVO B;  4GOD A;  1P84 D;  1VQ7 P;  1Q81 Q;  1FE6 A;  5M1B A;  2FFD B;  2KUB A;  1NTZ G;  3SWY A;  1SQB K;  3JCU H;  3K5B A;  3H6P A;  3AE8 C;  2OYI C;  5AW9 B;  2QVA A;  3A2A A;  2ZYD A;  1KQF B;  2B1X A;  2HG5 D;  2YO3 A;  1NTZ K;  2W6B A;  1S5L X;  1PFI A;  5E79 H;  1PGJ A;  1KB9 I;  2GUS A;  5CCH D;  1S2E A;  5KJ7 A;  4PV1 D;  4AUW A;  3UIA A;  2WSF H;  1AV1 A;  1YQ3 C;  3CCS P;  1QVG O;  3KQG A;  2BCC E;  4QDC A;  1U7M A;  2WT7 A;  2W90 A;  1Y8A A;  3M0A A;  3B5N C;  1NWQ A;  1NTM G;  1MUU A;  1NHL A;  2I1J A;  2YXR B;  3S4R A;  1PGQ A;  1JY3 N;  1OWA A;  1QL2 A;  5AW1 B;  2CPS A;  1SQP D;  4NBG D;  1DD3 A;  1LJ2 A;  2P1J A;  2AXT H;  2WSE H;  1LGH B;  3L35 A;  4TLF A;  2D2C D;  2WSC H;  3HE5 B;  4Y99 C;  2ZVN B;  3L37 A;  1L0N K;  3CME P;  4LGD E;  1U7J A;  3MIW A;  1A02 F;  1ZOY C;  1UII A;  1HH0 A;  1WMK A;  1H0T B;  1YBK A;  1JCD A;  1U57 A;  1NYH A;  1NJI Q;  1L2P A;  2L91 A;  2XRX A;  3P8M C;  4GIF A;  1EQ7 A;  1BCC E;  3GW6 A;  2BMR A;  4WY4 B;  2IYP A;  1S5L H;  3L71 J;  2NPS D;  3EN1 A;  2ZT9 D;  2I8D A;  5CCG A;  1QX8 A;  3CX5 D;  1S1C X;  1YIT P;  1OW6 A;  3H1K D;  4I6M C;  4H13 C;  2WMM A;  3I55 P;  2N1T C;  5KAF H;  4U3F J;  1AA0 A;  3PJS K;  3VCP A;  2GBW A;  3V2R A;  3AEE C;  1KV4 A;  2P10 A;  1PPJ D;  3AEB C;  2WPQ A;  1QL1 A;  3FX0 A;  1ZME C;  1LT9 A;  2KB7 P;  1EDJ A;  2YFJ A;  4H13 B;  3L70 J;  2MKV A;  2PRR A;  1NTK E;  1NTK D;  5KLV E;  3H1H D;  1SQQ G;  3GHG B;  1BGY G;  2YNY A;  1EZV G;  2AXT E;  1LT1 A;  2PFX A;  2M5A B;  3L74 D;  2N1T A;  3GG2 A;  5KTB A;  2PGD A;  5APY A;  1CZQ A;  3FXD A;  1L0N J;  3AEG C;  2Y0D A;  5CHX A;  2C0X A;  3CC2 P;  1RY3 A;  3V2P A;  1SQV G;  5GTI H;  4L73 A;  4HM4 A;  3JSV C;  2Q1K A;  1E5W A;  1BE3 G;  2WPR A;  3VMA A;  1GL2 D;  3H1K J;  1FDO A;  1PP9 G;  2DW3 A;  2QEX P;  4NPD A;  1ZR2 A;  1VF5 D;  1R8E A;  1ZV8 A;  4KT0 J;  2OYH B;  3KDP B;  4OWF A;  1BE3 E;  4QDF B;  2WWW A;  4D6T E;  4UB8 E;  3SFE C;  2CPB A;  3L74 E;  1KN7 A;  5AVR B;  1H89 A;  1W5C E;  4HM0 A;  3WUU A;  2NVE A;  3GTS A;  1DX7 A;  5K5G B;  4YPC A;  1O7G A;  2OTK E;  2QG4 A;  3SWK A;  2YFL A;  3D6Y A;  3ITK A;  4K3A A;  1BCC D;  3P7K A;  4PJ0 E;  3GMA A;  2OYH C;  1NH4 A;  1PPJ G;  1LTT C;  5AW6 B;  2YVJ B;  4D6T G;  1ZXG A;  5B66 H;  2YFI A;  2HMO A;  2I7F A;  2O01 N;  1TU3 F;  4BRY B;  3B71 A;  1YI2 P;  2DE7 D;  5AW3 B;  2JZA A;  2QM7 A;  3MUD A;  2K1A A;  4HB1 A;  1X22 A;  2O1K A;  4PD4 I;  1PP9 J;  2CK3 H;  3TSI A;  4PV1 B;  2NUM A;  1L0L J;  3HUS A;  2C9L Y;  1VQ9 P;  2PP6 A;  2YIU B;  3CC4 P;  2ZXX A;  1UUV A;  2A45 G;  3VMY A;  3RK2 D;  3L72 E;  2LXB A;  2POH A;  4OGQ D;  3VMI D;  3DQY A;  4P1B H;  3L75 D;  4PV1 C;  1EDL A;  4AIV A;  4ZMD A;  1Z56 A;  4U3F G;  5APX A;  2UWJ E;  4YTP C;  1NYK A;  1N7S D;  4UB6 H;  5AVQ B;  3L70 D;  1NTM D;  3A0B H;  4JBZ A;  1W2E A;  2Z4E A;  2B87 A;  3AE4 C;  3Q5R A;  4ASV A;  2A45 I;  4H44 D;  3KXD A;  4AAY B;  4NBC D;  3CWB E;  4U3F E;  1GL2 B;  1JY2 N;  1GW4 A;  2WZ7 A;  2G8Y A;  4NBH D;  1N73 A;  2M3B A;  4AYC A;  3OW2 O;  5APV A;  1VQ5 P;  1KIL C;  1QEX A;  2BAS A;  2XDJ A;  3GF7 A;  2C9N Y;  1URQ B;  3LID A;  2O01 J;  5CBO A;  4JYC A;  1VQO P;  1VCK A;  2KZI A;  3A0H H;  3KZI H;  1L4A D;  2E74 D;  1N8R Q;  2FXM A;  4W7Y A;  1SP4 A;  1FJK A;  2HLO A;  1KYO D;  3Q2Y A;  1Q90 D;  1L0L K;  1KQG B;  3CL3 D;  1HBW A;  3RL0 D;  3SWF A;  2DE6 D;  2QJY C;  3CCM P;  4NB9 D;  2FYZ A;  1KYO H;  4HM5 A;  1L0L G;  1JY2 O;  2WPS A;  1K9M Q;  1E79 H;  3GOB A;  5AW2 B;  3FWN A;  3RL0 C;  4QDD A;  1O7P A;  4YXW H;  3L75 J;  4I7Z C;  4HM3 A;  2P7J A;  3BRT B;  3I5C A;  2K37 A;  3O6Q A;  3RK3 D;  1GL2 A;  2QJY B;  2P67 A;  3II6 A;  3MZW B;  1YIJ P;  3EQQ A;  4C7N B;  1YYC A;  1HJ0 A;  3A7O A;  3LW5 H;  1BE3 J;  3H1L G;  4C46 A;  4I1L A;  2YKP A;  2FYU D;  2ZAE B;  3L74 J;  3I56 P;  2Q5U A;  1OZH A;  2NUK A;  1KB9 E;  2I1K A;  1OW8 A;  2ZT9 B;  3GZY A;  3F5H A;  5APT A;  2KK7 A;  4JF7 A;  2FYN C;  3ZDM A;  2BMQ A;  4CPG A;  3L4F A;  3L71 D;  3HUS C;  2QE7 H;  3GZX A;  5APS A;  1J2J B;  1SQB J;  1M1J C;  1T2K C;  2KSE A;  2KNC B;  1SQX D;  1YJ9 P;  3G3Z A;  4H44 C;  2FYN B;  3CD6 P;  2KS1 B;  3VYI A;  2E4P A;  5TJH A;  1NTZ J;  3M9B A;  1BGY E;  1KB9 H;  4OGQ B;  1MV8 A;  2JDI H;  3HD7 D;  3HUS B;  1L0L E;  1K04 A;  1GDT A;  1VL2 A;  4YXD C;  4WVZ A;  2KI7 B;  3C8V A;  2WIT A;  1KYO E;  1N7S A;  1WQL A;  2E76 B;  3PHL A;  4ZKP A;  3USS A;  1DH3 A;  5B66 E;  1SQV E;  4OGQ C;  2RH0 A;  2E75 B;  2BEQ D;  4N78 E;  3CWB D;  1X9V A;  3AED C;  1LTJ B;  3TNU A;  5GTI E;  3HD7 B;  1AVY A;  1T6A A;  1G1I A;  2NPS A;  2HPC A;  2O01 H;  3MUD C;  2E76 C;  4R4L A;  2H43 A;  2E75 C;  2BCC J;  1YJW P;  1LTJ C;  2B88 A;  2BEZ F;  4RJT A;  1G1J A;  1FQT A;  2IX7 C;  3AE6 C;  1IFM A;  3H1L J;  5H2F H;  2KYV A;  1UUW A;  2L5G B;  1W2B O;  3VTP C;  3H32 A;  5BU5 A;  2P2U A;  3TF5 A;  1NAY A;  4IFD K;  1L4A B;  4JQ0 D;  3WU2 H;  1Q7Y Q;  1RH5 B;  1HGV A;  1T8Z A;  1T3U A;  3WMM 0;  2M5A A;  1HTL C;  3MGN A;  3M91 A;  2HML A;  2AXC A;  1AFO A;  3GHG A;  2YKO A;  2MJZ A;  3E7K A;  3NXS A;  2P58 A;  5KLI B;  1LTS C;  1MZ9 A;  1KYO I;  2ZYL A;  4NPF X;  4N3Y B;  3O8Z A;  3AZC A;  1ZP0 C;  2HYN A;  1L4A A;  1LT9 B;  2FFD C;  1RQU A;  1CW5 A;  3A3Y B;  3H32 B;  1DIP A;  5APQ A;  2XND H;  4QMA A;  3H1H J;  3VMG D;  5AW0 B;  2V7Q H;  1FAV A;  5AVX B;  1EG9 A;  1PGP A;  1YTZ T;  3L70 E;  2NWF A;  1GU5 A;  5HL4 A;  5KAF E;  1CSB A;  1MFZ A;  3Q5S A;  4LLH A;  1BGY D;  1NTK J;  1RF0 A;  4N78 D;  2JO6 A;  1PL5 A;  1R5S A;  3L74 G;  5BVZ A;  4WWI A;  2K9Y A;  2WSE J;  3L70 G;  4WY4 A;  4D6T D;  2QSI A;  3BRV B;  2OGU A;  1RQV A;  5DJT B;  1EZV E;  2RKL A;  2NPS B;  2HPC B;  1ZW0 A;  4L75 A;  1OIP A;  3HD7 A;  4ASW A;  4WY4 D;  5KAI H;  5H2F E;  1PGO A;  3CMA P;  3TNU B;  1LTJ A;  1KIL D;  4Y99 B;  3VMH D;  1JY2 P;  1M56 D;  2W27 A;  5CCH A;  2IZ0 A;  1T2K D;  1FZE A;  3HE5 A;  4W80 A;  1NU1 J;  1BSH A;  1SQB G;  3A0H E;  1VQM P;  1N7S B;  5KJ7 C;  1BDD A;  3IF4 A;  1RFS A;  3W67 A;  2D2C B;  2W6A A;  1NO4 A;  3G9R A;  3N7N A;  1A02 J;  4WY4 C;  1KIL E;  4D6T J;  2WT7 B;  3TDK A;  2NVF A;  2IZ1 A;  4PD4 H;  4UB6 E;  2GBX A;  1IO4 A;  1NU1 D;  1SQQ E;  3AE5 C;  2KS1 A;  5KLV K;  1EZV D;  1DD4 A;  5APW A;  2H89 C;  1N7S C;  2R3C A;  1SQP J;  1FDM A;  2KNC A;  3V5B A;  5DJU B;  4EDF A;  2D2C C;  2J5U A;  1K8A Q;  3PH0 A;  2IDB A;  1VQ8 P;  3GLM A;  2AEJ A;  1FZA A;  1L0L D;  2LR2 A;  2YMK A;  1LTB C;  1SVF A;  1S3J A;  4EI2 A;  4IOI H;  1NTM J;  1YQ4 C;  2E5Y A;  2BCC D;  2WPV B;  3CCE P;  3GF3 A;  5AVU B;  1IFP A;  1GZL A;  4TT3 H;  4DCK A;  4LC1 A;  4WBA A;  4C7N A;  2YO2 A;  1JOC A;  1NDO A;  1VM9 A;  2OYI A;  1Q90 C;  1IJD B;  1N2D C;  1IFI A;  5AW8 B;  3GHG C;  3O6Q B;  3L71 E;  4HM8 A;  3C0D A;  1P84 H;  3CWB G;  1M7L A;  4IL6 E;  3NTN A;  2OTL P;  1IFD A;  3MHV A;  2N9B A;  2QRX A;  2A06 E;  3VMZ A;  2IBZ I;  4WB4 A;  3TK1 A;  4PD4 D;  3S1K A;  2HOD A;  1X79 B;  3OJA B;  2KLV A;  1NTZ D;  3L36 A;  1NU1 K;  3ABV C;  1T3J A;  1WT6 A;  2Q6Q A;  4NBF D;  1SQX G;  2KOG A;  4EOT A;  4IL6 X;  2NZ2 A;  4W7Z A;  1O7M A;  4OVN F;  4NBD D;  1H8A A;  2B9B A;  1SQX K;  1JCC A;  1PP9 E;  4U7J A;  5AVT B;  2R32 A;  3M0D A;  3AE7 C;  4NBB D;  2E42 A;  3TGU J;  5KLV J;  4A7P A;  1XTG B;  1SQP K;  4HM6 A;  1URQ A;  2H88 C;  4AQR D;  3G4S P;  3A0B E;  3IN6 A;  1KB9 D;  1X8Y A;  3H1L D;  4L76 A;  3L72 J;  1OVU A;  1N73 B;  2Y9Y A;  1OX3 A;  1OVR A;  1KZU B;  4K35 A;  4BXL A;  4I2L C;  1EC5 A;  1VQP P;  5AVY B;  2WTY A;  3L71 G;  3P8C D;  2J59 M;  1RE3 A;  1M1K Q;  1QLE D;  3SFD C;  2B87 B;  4L74 A;  3FGA D;  2QA4 P;  3B5N D;  3L75 G;  2BMO A;  1P84 E;  2A06 D;  2PAJ A;  1BCC G;  5TIS H;  3CCU P;  1OXZ A;  5B5E E;  2C0W A;  1SQV K;  2YIU C;  4HM2 A;  3OAK A;  4GKG A;  1KC8 Q;  1OW7 A;  1HVV A;  4XA4 A;  3G71 P;  1M57 D;  3VP9 A;  3H1K G;  3CXH E;  1LP1 A;  1M1J A;  1NVO A;  3G6E P;  2GA1 A;  1VDF A;  3PP5 A;  3M9H A;  3MD0 A;  4IFM A;  4QUR A;  2J58 A;  2FYU G;  1ZRT D;  1HJB A;  2OTJ P;  5KJ7 D;  2FY8 A;  3CX5 I;  3M06 A;  1S4X A;  5AEU A;  3EFF K;  3R2P A;  1SQQ J;  3H1I J;  3H1J G;  1UIX A;  1N86 A;  1GMJ A;  4QCK A;  3AE2 C;  2JJL A;  1ZR4 A;  1SQP E;  1FU1 A;  2Q3I A;  1RE3 C;  1NKN A;  2E4Q A;  1VF5 C;  2GUV A;  4BRY A;  1NOH A;  2R5D A;  3PTZ A;  3B5N B;  2LKM A;  5EFW B;  1EZV I;  2WSS H;  1JNM A;  1GL2 C;  4IFF A;  5CJ4 A;  3D70 A;  1SQQ D;  1K73 Q;  3P8C E;  1RF1 C;  4HJG H;  4C7R A;  3BAT A;  1QGK B;  1HGZ A;  1KIL B;  5CCG D;  1IZN B;  3RK3 C;  1G8J B;  1GD2 E;  3IR9 A;  3H25 A;  1VF5 B;  1S9K E;  2YXQ B;  3VP8 A;  1RIE A;  1PPJ E;  2FYU J;  2IYO A;  1FZF A;  4QDF A;  1O7N A;  1JB0 J;  3M0D C;  1SS1 A;  2OYH A;  1RF1 B;  3B4S A;  1P84 I;  3FWL A;  2QPZ A;  3CCQ P;  3RK3 B;  2KP8 A;  2E43 A;  2R3S A;  1OMI A;  2XNX A;  1KMI Z;  2HMK A;  1LWU A;  4H0L D;  1G8K B;  3F89 A;  3CWB J;  2Z5I A;  1JY3 O;  1PIX A;  2IBZ D;  2IFM A;  2JWD A;  1AQ5 A;  2LXC B;  5KKZ B;  1Q2N A;  1FZC A;  2N1T B;  3RL0 B;  3VOP A;  4U3F D;  2JR8 A;  2QJK C;  1DEE G;  1YTZ I;  3OA7 A;  4GDO A;  4KJM A;  4I7Z B;  2XU6 A;  3HE4 A;  2N1T D;  2N9Y B;  4N6J A;  1Q86 Q;  1KFN A;  1JUN A;  2OQQ A;  2Y0E A;  3KPE A;  2Y9Z A;  1S72 P;  1NKZ B;  4DZO A;  1NAF A;  3H1I D;  4HJL A;  5KKZ C;  2ZT9 C;  2QJK B;  4BWN A;  1MFT A;  2XZR A;  4ZNC A;  1SQV D;  1URQ D;  1ZN5 A;  3AE9 C;  3L73 E;  2K9J A;  2YMY A;  3AEC C;  4XFJ A;  1BE3 D;  3EWK A;  2ZYG A;  2ITA A;  2O1J A;  3GTE A;  1G2C B;  1J1E B;  1PV3 A;  1JO5 A;  1H88 A;  1VQN P;  3EFG A;  1WRG A;  1YJN P;  2JKV A;  4H44 B;  3KYQ A;  2M3E A;  1FDI A;  1SQP G;  2W6J H;  2VRS A;  2FYU K;  2IFN A;  3L75 E;  3P32 A;  3PLN A;  1FJP A;  1JMB A;  2WSC J;  1J1E C;  4HKV A;  3RBX A;  4HM7 A;  3LIE A;  2R44 A;  1NTK K;  1JY3 P;  1NTK G;  1PZQ A;  1EDI A;  3PRJ A;  1H0T A;  2JEE A;  1BCC J;  3M9Q A;  5CCG C;  3HTK B;  5CCH C;  3H1H E;  1ZLL A;  3JCU E;  2IBZ G;  4QUP A;  1FBM A;  1M90 Q;  2RN0 A;  4Y28 J;  3HD7 C;  1N7L A;  3GL2 A;  2NRG A;  3NMD A;  1OFC X;  1SQB E;  3RK3 E;  1S5L E;  2Q9I A;  1M8O B;  2KXP B;  1NTZ E;  2W83 C;  3HTK A;  3Q3D A;  3U59 A;  3H1I G;  3H1J J;  4Z1M H;  3GL0 A;  3CX5 H;  3NFQ A;  3H1K E;  1ULJ A;  1IFJ A;  3CXH D;  2Q3E A;  1RHZ B;  2XSH A;  1IK7 A;  2SPZ A;  1R5L A;  3EQ2 A;  1GK4 A;  2XV5 A;  1VPC A;  3AEA C;  1NU1 E;  2V4H A;  2FYU E;  4MN4 C;  2NVG A;  2OAR A;  2FFD A;  3FOU A;  2QIW A;  3BCC J;  2E5T A;  2GM4 A;  1AVO A;  1XTC C;  1LNQ A;  5L8R J;  2B24 A;  5AW5 B;  1G2C A;  1L0N E;  1NTM K;  3A5T A;  1NU1 G;  4EIJ A;  2Y0C A;  2QJP B;  1JTH B;  1Q82 Q;  4NPE A;  1GU4 A;  4DOJ A;  2K9J B;  3VN0 A;  1SFC D;  3VCA A;  1MKM A;  5KLI C;  2FKW B;  3L72 D;  5GTH H;  3C1L A;  2H7H A;  3CXH I;  1HWT C;  1KTM A;  4PJ0 H;  1JM1 A;  4XE5 B;  1LT9 C;  3AEF C;  3BVH A;  2QJP C;  4HM1 A;  1PP9 D;  5KLV D;  1NGM B;  4NB8 D;  3CCJ P;  2XKM A;  4ZKU A;  2A45 H;  1LTG C;  2ZFC A;  3HE4 B;  2E74 C;  3SSU A;  5APU A;  1FZC B;  1IFN A;  3C9I A;  1O7W A;  3WUV A;  1EXJ A;  1URQ C;  3L72 G;  4PD4 E;  2O3J A;  3TGU D;  3WU2 E;  2KSJ A;  3S9O A;  3AE1 C;  2JO1 A;  1LWU B;  2JP3 A;  3L73 J;  1JEK A;  2E74 B;  4DT0 A;  3H1J D;  1SLQ A;  1SQX J;  1GTW A;  3B8E B;  2W8Z A;  1FZC C;  3MP7 B;  3CX5 E;  1IC2 A;  1OVV A;  2NPS C;  3FXE A;  3JC2 2;  1USD A;  4RO0 A;  1HUC A;  2AEF A;  4NBA D;  1RF1 A;  2JWA A;  4NBE D;  1DEB A;  1BSN A;  5AVW B;  2WVR A;  3L73 D;  1KD1 Q;  4RKU J;  3E1I A;  1LWU C;  1GK6 A;  3TGU G;  3GCE A;  1NTM E;  4GT1 A;  3GKE A;  1SFC B;  2K3R A;  2XSO A;  1CI6 B;  2BCC G;  3WUT A;  1KIL A;  3V4W A;  2FXP A;  1HF9 A;  2YKQ A;  2KZJ A;  1O7H A;  2E75 D;  3N0Q A;  1BGY J;  5GTH E;  2E76 D;  1FS0 E;  5AW4 B;  2KIK A;  3B5N A;  3T97 A;  3LW5 J;  3H1H G;  2Q3W A;  3TGU E;  1BDC A;  2RMZ A;  3U1C A;  3RK2 C;  1USE A;  3L73 G;  5BU8 B;  1SFC C;  1FC2 C;  3V4Q A;  1KQL A;  3BCC D;  3KZI E;  3U1A A;  1FZB A;  5AEW A;  3AE3 C;  2ZYA A;  2AEM A;  5AW7 B;  1SQV J;  5KLV G;  1KFM A;  4DJG A;  3IAO A;  2Q7C A;  1VQ4 P;  4QUQ A;  3HRN A;  5CJ0 A;  3MTU E;  4M3L A;  3RK2 B;  5B5E H;  4R4M A;  1D7M A;  2H8P D;  3D89 A;  1M1J B;  3H1J E;  1LP1 B;  2V7Q J;  3GB4 A;  5AVV B;  4HKZ H;  2ZJS E;  4GOF A;  1Y47 A;  2HFE D;  3BCC G;  5BOK A;  3D6Z A;  1VQL P;  2R5B A;  5CMZ A;  3T97 B;  1SQQ K;  1AQT A;  4EYY Q;  2QM8 A;  3BAS A;  4JYB A;  1JMM A;  3N4X A;  4JPZ B;  3QH9 A;  3H1L E;  3V6I A;  2M8R A;  4OH8 B;  3V2Q A;  2HMM A;  1KOR A;  1CI6 A;  3QWO C;  3BCC E;  1SFC A;  3R4Y A;  4UB8 H;  1LTI C;  4P1C H;  5AVZ B;  2IPP A;  1X0T A;  1YHQ P;  1IK9 A;  3E1R A;  2Z5H A;  2G3A A;  1ULI A;  2HR3 A;  3H1I E;  4HYT B;  1AJY A;  2WQY C;  1EXI A;  5AVS B;  4H0L C;  3CXH H;  2DE5 D;  5TIS E;  1RE4 A;  3RBZ A;  1ZRT E;  1L0N D;  1FZG A;  1FOS E;  2WSF J;  1LTA C;  4GOE A;  2OYO A;  3CCR P;  1RF0 C;  2HMN A;  1GW3 A;  2B89 A;  1RE4 C;  2IBZ E;  3TYY A;  3Q5P A;  4HH2 A;  3RL0 g;  2M0B A;  1Y9B A;  2ZXE B;  4H0L B;  2A06 G;  5CBN A;  3RGU A;  5CXM A;  3IFM A;  1J1D B;  1N73 C;  4O9B A;  3CPW O;  4IL6 H;  3KHU A;  1SJG A;  3CCL P;  4EMJ B;  5C39 A;  2CKF A;  4B86 A;  1L0N G;  1VQK P;  2HOD B;  1K05 A;  2XR8 A;  3VMX A;  1L4A C;  3V2N A;  2FXO A;  2K88 A;  3CC7 P;  1EDK A;  1SQB D;  2HMJ A;  1SQX E;  3W68 A;  4KHX A;  1J1D C;  1VQ6 P;  3CLQ A;  2KLU A;  3D71 A;  3CI9 A;  3Q1M A; 
#chains in the Genus database with same CATH homology
 5HL4 A;  3VCA A;  3BCC E;  2QJK C;  5KLI C;  4QCK A;  3H1H E;  3GZX A;  4HM6 A;  1VCK A;  4H13 D;  2NUM A;  1O7H A;  4P1C H;  2E75 D;  3N0Q A;  1SQP E;  4QUP A;  2JO6 A;  2E74 D;  1UUW A;  2E76 D;  2E4Q A;  2XRX A;  1JM1 A;  1ULI A;  3GL2 A;  1BCC E;  1UUV A;  2E4P A;  2Q3W A;  2BMR A;  3TGU E;  1EZV E;  2QJP C;  4HM1 A;  1BGY E;  1SQB E;  4HM4 A;  4HJL A;  3H1I E;  5KKZ C;  4NB8 D;  3L72 E;  3EN1 A;  2ZT9 D;  4OGQ D;  3VMI D;  3DQY A;  4P1B H;  2DE5 D;  1L0L E;  2DE6 D;  1NDO A;  1VM9 A;  1Q90 C;  2QJY C;  5AEW A;  1NTZ E;  4AIV A;  3L71 E;  3L73 E;  1G8J B;  1ZRT E;  2B1X A;  4HM8 A;  4NB9 D;  1VF5 D;  3VMH D;  3C0D A;  1O7W A;  3GL0 A;  4HM5 A;  1NYK A;  2BMO A;  4QUQ A;  1KYO E;  1P84 E;  1BE3 E;  2HML A;  2HMN A;  4QDF B;  4D6T E;  1WQL A;  3GTE A;  3H1K E;  1ULJ A;  1RIE A;  4PD4 E;  1PPJ E;  3L74 E;  3GOB A;  3VCP A;  4QDF A;  2A06 E;  4QDD A;  2IBZ E;  1SQV E;  1O7P A;  1O7N A;  2GBW A;  4HM0 A;  2NVE A;  4PV1 D;  4HM3 A;  3D89 A;  2XSH A;  3GTS A;  1RFS A;  2ZYL A;  2YIU C;  4HM2 A;  3H1J E;  5CXM A;  4QDC A;  2BCC E;  1O7G A;  2QPZ A;  3AZC A;  3GB4 A;  3EQQ A;  4H44 D;  2YFL A;  4AAY B;  1SJG A;  2YFJ A;  3CX5 E;  3L75 E;  3CWB E;  4NBC D;  4EMJ B;  4U3F E;  4NBF D;  1NU1 E;  2CKF A;  2NVF A;  5BOK A;  2FYU E;  2GBX A;  3CXH E;  2NVG A;  2YVJ B;  3FOU A;  1SQQ E;  2HMK A;  2NUK A;  2XR8 A;  4NBH D;  1KB9 E;  1O7M A;  4NBA D;  4HKV A;  2YFI A;  2HMO A;  1G8K B;  4H0L D;  4NBG D;  4NBD D;  1NTK E;  2I7F A;  3GZY A;  4HM7 A;  4NBE D;  3VMG D;  5KLV E;  2DE7 D;  1PP9 E;  4QUR A;  2B24 A;  2HMJ A;  1L0N E;  2JZA A;  1EG9 A;  2FYN C;  1SQX E;  2D2C D;  2BMQ A;  3H1L E;  3GCE A;  1NTM E;  4NBB D;  3GKE A;  3L70 E;  5AEU A;  1FQT A;  2HMM A;  2XSO A;  2NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...