3L70E

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l70E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l70E02
4EMJB 1P84E 5BOKA 3CX5E 2NVGA 2XSOA 1UUVA 2GBWA 2YFLA 5KLIC 3TGUE 4HKVA 1PPJE 4AAYB 4U3FE 2BMQA 1SQBE 2YVJB 3GZYA 3BCCE 1NDOA 3DQYA 4HM4A 2HMMA 1O7WA 3C0DA 3CWBE 2QPZA 1SQVE 2XSHA 4HJLA 3VCPA 2E4QA 4QDFA 1Q90C 2JO6A 4H13D 4P1CH 2HMKA 5KKZC 4HM7A 1SQXE 1ZRTE 3L70E 1L0LE 1BGYE 4NBHD 2QJPC 4QCKA 3FOUA 3L73E 1FQTA 2E74D 2JZAA 1BE3E 3GB4A 4NBCD 2HMNA 2NVFA 4PD4E 3VMID 3GTSA 1EG9A 1VM9A 1KB9E 4NBGD 2BCCE 2QJYC 3AZCA 5AEUA 4NBED 1NTME 3H1IE 2FYNC 3EN1A 4QDFB 4AIVA 2IBZE 2CKFA 3GOBA 1O7MA 4HM6A 1O7HA 2QJKC 1O7NA 4NBFD 2HMOA 3N0QA 1NTKE 3H1HE 3L71E 4OGQD 2HMLA 5AEWA 2BMRA 3VMGD 5KLVE 1G8KB 1UUWA 1RIEA 2NUKA 2Q3WA 1NTZE 2A06E 1RFSA 4HM8A 3L72E 4D6TE 2DE7D 4HM0A 2NVEA 4NB9D 2FYUE 4HM1A 3L75E 1ULIA 2E76D 3VMHD 2NUMA 1O7GA 1BCCE 3H1JE 2YFJA 4QURA 2DE5D 3L74E 4HM5A 3D89A 3VCAA 3H1LE 3EQQA 3GTEA 2B24A 5CXMA 4NBAD 4H44D 2NWFA 1O7PA 4QDDA 2YFIA 1PP9E 4H0LD 4HM3A 3GL0A 3CXHE 3H1KE 1VCKA 3GCEA 4QUQA 2YIUC 2ZYLA 1VF5D 1L0NE 2BMOA 3GL2A 2D2CD 1EZVE 2E4PA 3GZXA 2B1XA 1SQPE 4QUPA 1JM1A 2GBXA 1KYOE 2ZT9D 2XR8A 1SJGA 2E75D 1G8JB 5HL4A 1SQQE 1NU1E 3GKEA 4PV1D 4HM2A 4P1BH 1NYKA 4NBDD 2HMJA 4NBBD 4QDCA 4NB8D 2DE6D 1ULJA 1WQLA 2I7FA 2XRXA
chains in the Genus database with same CATH superfamily
1NTMG 3IFMA 1N7SD 2BMQA 4HM4A 1LNQA 3WU2H 2ZYDA 1EXJA 1USDA 2R5DA 1VPCA 2H7HA 1L0LE 2P10A 1M1KQ 4NBCD 1BE3E 1ZOYC 5AW0B 2HLOA 4NBGD 3AZCA 3VTPC 5APYA 1JMMA 3H1JG 3HD7A 1DEBA 3TK1A 4WVZA 4U3FG 1PGJA 1YBKA 1K05A 1CW5A 1QGKB 1U7MA 5B5EH 2Y0DA 4K3AA 2HYNA 2HFED 2E43A 4HM1A 1DIPA 1DEEG 5AW9B 3P32A 3G4SP 2E75B 2FYUJ 3A0HH 3CWBD 1OVUA 5TISE 1ZRTD 1VF5D 1N7SB 3CPWO 2V7QH 2V4HA 1YJ9P 1X79B 1HUCA 1S1CX 4C7NB 3H1KJ 1H0TA 4NBDD 1Y8AA 1QL2A 1OVVA 2P1JA 2QJKB 1FZAA 1NTMD 1RY3A 3HUSB 4EIJA 2KXPB 3V2NA 3HD7D 1OMIA 3CWBE 3FWNA 1LWUC 1L0LK 1KV4A 1ZRTE 2O01J 4RJTA 3B5NB 1ZMEC 4QCKA 2ZJSE 2E74D 1X0TA 5KAIE 3VOPA 2R32A 3PRJA 3PH0A 1NTME 2ZXEB 2QSIA 2ZVNB 1RF0C 4HM6A 2HODB 1BSNA 1SLQA 3BCCG 4IFFA 1ZP0C 5GTHE 3AEGC 1SQPD 1JB0J 2WTYA 4ASWA 1LTGC 1SQXG 5KLIB 2K9JB 3IR9A 1AFOA 2FXOA 3K5BA 3CXHI 2R3CA 4QURA 2R5BA 1FZGA 3EQQA 1NTZJ 2G3AA 3G9RA 1MFTA 3G6EP 4UB8E 2QJPB 1GL2B 2HPCA 3H32A 1NWQA 1S5LH 1PGOA 2KI7B 1BGYG 1JEKA 2KLUA 1SQPE 3ZDMA 3KZIH 3L73G 2HG5D 4HM2A 1NYKA 1LTBC 1Q82Q 2R3SA 1N73B 2AEJA 1KFMA 2E74B 2LXCB 3Q5RA 3AE3C 3H1JJ 3L71G 3MUDA 1KB9I 4P1CH 5APVA 5TJHA 2A06D 4D6TD 3SFEC 2KYVA 4BRYB 1HVVA 1S9KD 3O6QA 2JKVA 2ZYGA 3MZWB 1BCCD 4JQ0D 4WY4C 1OVRA 1NTMK 3F89A 5AW7B 1RE3A 1URQA 4UB8H 3KYQA 2CKFA 3V5BA 2A45H 2W6AA 3L72J 3VMXA 1O7NA 3GF3A 2O3JA 2FFDC 1FAVA 3CCVP 1H89A 5EFWB 3LIEA 1K9MQ 2OYIC 3F5HA 2A06E 4D6TE 5KJ7C 2JJLA 4MN4C 2KUBA 3QH9A 1S9KE 1J1DC 4AUWA 2ZVOB 1BCCE 2OTJP 2W90A 2WMMA 3W68A 5CXMA 4H13B 4QDDA 1LGHB 2WWWA 3GHGA 3CCUP 1EDKA 2QEXP 2W27A 2RMZA 2GM4A 3PTZA 1LTTC 3L70D 1L4AD 2ZXXA 1BGYD 2B1XA 3L73D 3WUTA 3BATA 3T97B 5HL4A 4PD4D 2WPQA 3S9OA 4NBBD 1WQLA 1KYOI 3R4YA 5M1BA 2LKMA 3G71P 2FYZA 2HR3A 2OYHA 1LTJA 3CCQP 1CI6B 3V6IA 3H1LG 1M90Q 1URQD 2KSJA 1EXIA 2C0XA 1VQ8P 4I7ZC 3WUUA 3L71D 5E79E 1Q90D 1KQGB 5KLVD 3L70E 1LT9B 1BGYE 3RL0g 1IFIA 3BCCJ 3FWLA 3C9IA 3L73E 2RN0A 4PD4E 2B88A 1FOSE 1GW4A 1H8AA 1SQXJ 5H2FE 4GOFA 1T8ZA 2K1AA 1DD4A 5DJTB 1PP9D 1OFCX 1PPJG 2FXPA 1O7HA 1WT6A 3L71E 1MV8A 5KLVE 1KYOD 1SVFA 1FBMA 4IFMA 1L4AB 3D89A 2L5GB 3IF4A 1L0NJ 3CL3D 4KHXA 2FFDB 1PP9E 5AW3B 4H0LC 3HTKB 1GZLA 1ZLLA 3GCEA 2OYIB 4DCKA 1EC5A 4WBAA 1PZQA 2GBXA 2E76C 1KYOE 3TGUJ 2PFXA 3H6PA 3MP7B 5BOKA 2NPSC 4I2LC 5H2FH 2YFLA 1FZCC 3M0DC 1KQFB 3A0BH 3V4QA 3CX5I 2PP6A 1YTZI 2QPZA 3RK3D 5CMZA 1NHLA 3P8MC 2FYUG 2KLVA 5APQA 1KORA 2JO1A 4GIFA 1AJYA 3EN1A 2OGUA 3MHVA 1WRGA 3JSVC 4CPGA 2WPVB 2C0WA 5KLVK 1QVGO 4JPZB 3RK3E 2N1TB 2NUKA 2GA1A 1EDIA 5CCHC 2DE7D 3AEAC 2IZ1A 1N7SA 3L4FA 1RE4A 4PJ0H 1NTKJ 1O7GA 2W83C 3CX5D 4C7NA 1M8OB 3CMEP 1XTGB 3HUSA 1AQTA 2QJYB 1VQ7P 3TNUB 2C9LY 1JOCA 1Z56A 3W67A 1QEXA 1S5LX 1R5LA 3JC22 4AYCA 4QDCA 3B5NA 2DE6D 1G1JA 3CX5E 2NVGA 4C7RA 4XE5B 1SP4A 3L37A 1JNMA 3Q3DA 2AEMA 2W6BA 1ZW0A 1T2KD 2WVRA 1S72P 3V2QA 2C9NY 3D71A 4UB6E 2E76B 3PJSK 5KKZC 1KILD 1X8YA 2HODA 1NTZG 2Q1KA 1RHZB 2YKPA 3RK2D 2KS1B 2JZAA 2FKWB 2FYUD 2YNYA 2NPSB 1DX7A 2IPPA 1FZCB 2E5YA 1KQSO 2BCCE 1KD1Q 3SWKA 4GT1A 3AE1C 4O9BA 3H1KD 2NZ2A 2HMOA 1GL2A 5L8RJ 1RIEA 1KILE 2JWDA 1SFCB 1MZ9A 2JDIH 2WSEH 3D6ZA 4IL6E 3VMYA 2FYUE 3MTUE 1ULIA 2OYOA 3C8VA 3B5ND 5AVXB 2Z5IA 4XFJA 1SQBD 1HJ0A 1GTWA 1XTCC 3H1KE 1N73A 1NU1J 4L76A 4QUPA 1M1JA 3HE4B 2MJZA 1LJ2A 1IFNA 3S4RA 3L72G 1MUUA 4TT3H 1HWTC 2JWAA 4H44C 3AEBC 1KILB 4GOEA 4I1LA 2P7JA 3SFDC 4HKVA 4AAYB 3RK2B 3I56P 2V7QJ 1SQBE 3AE2C 1P84I 3HD7C 1VL2A 3FXEA 2M3BA 1BE3J 5APTA 2GUVA 2ZT9C 2G8YA 1NTZD 1GL2D 1KMIZ 5AVYB 1AV1A 2I1JA 4W80A 3EWKA 3KXDA 5CCGA 1NKZB 3GTSA 1IO4A 2YKQA 1RF1C 1GK6A 4Z1MH 5CBNA 3SWFA 3A2AA 2M5AA 3VP9A 3BRVB 4AIVA 4JYCA 5KKZB 3PP5A 1OX3A 3RBZA 3CCSP 3VMGD 1NKNA 1NTZE 2FYUK 1JY2N 1QL1A 3E1IA 2XNXA 2M8RA 3H1JD 1P84D 2KIKA 5BVZA 4U3FD 1JMBA 3FX0A 3H1IG 5TISH 3AEFC 3GL0A 3R2PA 1M57D 1VQOP 1JY2O 2IDBA 1S4XA 4GKGA 3I55P 5AVQB 2KOGA 1ZR2A 3EFFK 1LT9A 3U59A 5CCGD 3PLNA 4BWNA 3H1JE 1P84E 2XSOA 2GBWA 2H88C 3GF7A 2IYOA 1W2EA 1SQBK 1LP1B 1NH4A 4U3FE 1SQQJ 3RL0C 1ZXGA 2K3RA 2HMMA 3CI9A 5AVWB 4H13D 1YYCA 2QG4A 2K9YA 5KAIH 2NRGA 4GODA 2FBWC 2Q9IA 4DOJA 4PV1C 1L0NG 3B4SA 1EZVG 3SSUA 3GB4A 1EQ7A 5APWA 4H44B 1X22A 3VP8A 1HTLC 4NBED 2BASA 4QDFB 5GTHH 3TGUG 1L4AA 3CXHD 2ZT9B 4ASVA 4QMAA 3N0QA 4W7YA 1IJDB 1K8AQ 1NTZK 2YMYA 2QVAA 3HTKA 1VQMP 2NVEA 4K35A 1X9VA 1PGQA 1RF1B 1M56D 3CD6P 2BEQD 2DE5D 2XKMA 1LWUB 2AEFA 3A3YB 1EZVI 2XU6A 5APSA 3CCEP 2B24A 1O7PA 3BCCD 1SQPJ 3L75J 2QIWA 3CXHE 2FXMA 2Y9YA 3L74J 2YXRB 1KC8Q 4QUQA 1FE6A 1SQXD 3MUDC 4JYBA 3RBXA 4M3LA 2Q6QA 4HJGH 1H0TB 1OW7A 1OW6A 1GU5A 2RKLA 1KB9D 3GTEA 4EMJB 4U7JA 2H43A 3Q5SA 4L73A 2XDJA 4WY4D 5CHXA 1RE3C 1IZNB 3D70A 3BCCE 1BDCA 1NTKG 2Q3IA 3NMDA 1Q90C 1K04A 1SQXE 1E5WA 1WMKA 2K88A 1GU4A 3BVHA 1SQVJ 3E7KA 2KZJA 5KJ7D 2N1TA 2KNCB 1KZUB 1KB9E 4LLHA 3USSA 1UIIA 3JCUE 3OJAB 2M0BA 3TGUD 3GHGC 2L91A 3H1IJ 2HMLA 2BMRA 1YQ3C 4L74A 5APXA 4LC1A 3KHUA 1BDDA 3M0AA 1JO5A 2WQYC 3IN6A 1HGZA 3CC7P 3V4WA 3H1HJ 3KDPB 1Y9BA 3TNUA 3A5TA 2JP3A 2JEEA 2NWFA 3HRNA 5AVTB 2OYHC 1LTJC 4EDFA 4NPFX 4HM3A 1DD3A 5KAFE 3TSIA 2ZFCA 4WWIA 4EOTA 1HH0A 3GL2A 1JY3N 4WY4B 2E4PA 4HH2A 1AA0A 1J1EC 2ZAEB 1N86A 3VCAA 2IFMA 2I7FA 2N1TD 5B66E 1OXZA 2KS1A 4JBZA 1FZCA 5E79H 3CCJP 1NO4A 2KK7A 4AQRD 3C0DA 1JY3O 5APUA 2XSHA 1NTKD 2D2CC 1SQXK 3TF5A 2WITA 1J1DB 3VN0A 4B86A 4PD4H 1DH3A 4Y99C 2HMNA 2IYPA 3QWOC 3VMID 2WSSH 2J58A 2W6JH 3H25A 3VYIA 1SFCA 4JF7A 3H1LD 4IL6X 1NU1G 1AQ5A 1NTKE 4YTPC 1L0NK 2E5TA 1L0LG 1HBWA 4HM0A 3MD0A 2E76D 5CCHA 3OW2O 5GTIE 2QE7H 3B71A 1BE3G 1K73Q 3HE4A 4OVNF 2YFJA 4I7ZB 3AE4C 2AXTE 3H1LE 1PPJD 3FGAD 1NOHA 2NPSD 1RH5B 1ZN5A 3TDKA 1KILA 4OGQC 2IX7C 3B8EB 3GMAA 1KYOH 1J2JB 1FU1A 1PV3A 3M91A 3N4XA 2XR8A 3NXSA 2W8ZA 5CJ0A 2P67A 1JTHB 2B87B 1SFCD 1FDOA 1UUVA 5BU8B 3OA7A 2OYHB 1PPJE 2YVJB 1NDOA 3DQYA 1G2CB 3Q1MA 5AVZB 1EDJA 2E4QA 1E79H 4WB4A 2WT7B 2E75C 2H8PD 3WU2E 1CSBA 2B9BA 4N3YB 2NVFA 1GW3A 5CCHD 2YKOA 1EG9A 1N7SC 1JCCA 1RE4C 1JY3P 3WMM0 4H0LB 3FXDA 2OARA 1ZV8A 2YXQB 4Y28J 3KPEA 4A7PA 1NJIQ 3GG2A 4DZOA 1LTAC 1JCDA 1AVYA 1NTKK 2QJKC 2KB7P 3HUSC 1IFPA 2KZIA 1SQQG 4HM8A 2OTKE 2K9JA 3VMHD 3ITKA 4C46A 5KTBA 1RQUA 5B5EE 4GDOA 1NAYA 1YJNP 3M06A 1YI2P 1IC2A 2QM8A 1LTIC 2WSEJ 2IFNA 2ZYAA 1LP1A 3A0HE 2P2UA 2ZYLA 1Q7YQ 1A02F 3HE5B 1FDIA 3CX5H 1FS0E 1Q81Q 1ULJA 3NFQA 3Q5PA 5KLIC 4OGQB 3BRTB 2FY8A 3M9HA 3GZYA 4UB6H 2I8DA 2CPBA 1YHQP 1YJWP 1VF5C 1VQ9P 4HJLA 1GD2E 1FZFA 2RH0A 4QDFA 2A45G 1HGVA 4HM7A 1YITP 2BCCJ 2Y0EA 2QJPC 1GL2C 3FOUA 1SQPG 2YMKA 3L75G 4IOIH 4DJGA 1T6AA 4BRYA 3L74G 4HB1A 3AEEC 2K37A 1L0LJ 3Q2YA 3D6YA 4ZMDA 2FYNC 1RF1A 2H89C 1LWUA 1VDFA 3G3ZA 5K5GB 1IK7A 1NYHA 1TU3F 4IL6H 1N73C 5AEWA 2E74C 2YO3A 2BEZF 1UUWA 1QX8A 2Q3WA 1M1JC 1SQQD 3OAKA 3LIDA 2A45I 5DJUB 2Q7CA 4R4MA 2N9BA 3U1AA 4HM5A 1NU1K 3E1RA 2PRRA 3BASA 4NBAD 4H44D 1RF0A 3N7NA 1YIJP 1SQVG 1D7MA 3ABVC 2Q3EA 4N6JA 5AW2B 1VQNP 3GZXA 1S5LE 2ZT9D 4OWFA 1SQQE 3T97A 2A06G 2O1KA 1SQBJ 4D6TG 2JR8A 3KZIE 4OH8B 2O01H 5CCGC 2J59M 1KFNA 2POHA 1BCCG 4W7ZA 1JUNA 4HYTB 3MIWA 2IBZG 2KNCA 2PAJA 1CI6A 2KSEA 3H1HG 1PL5A 1NVOA 1SS1A 4H13C 2HMKA 1YQ4C 4NBHD 2R44A 3L72D 3SWYA 3CWBJ 3L75D 3AE7C 4BXLA 1Y47A 3L74D 3L35A 4EI2A 2OQQA 4XA4A 2Z4EA 3C1LA 3PHLA 1VF5B 3S1KA 1VQ5P 1GMJA 4I6MC 1T3UA 4HKZH 3VMAA 2WZ7A 1OIPA 2IBZI 1NTMJ 4N78D 3M9QA 1W2BO 2OTLP 4ZKUA 1VQPP 3L70G 1RFSA 3AE6C 3L72E 3P8CD 3L75E 4WY4A 3HD7B 2FYNB 1LT9C 3L74E 2AXCA 2XNDH 1RQVA 2SPZA 2QM7A 4RO0A 1GDTA 1SQVD 2FFDA 3RL0D 2Y0CA 2XV5A 1Q86Q 2YIUC 4YXDC 2OYIA 2BMOA 1M1JB 2IZ0A 4N78E 1PFIA 5KJ7A 2GUSA 1SQQK 3P7KA 5KLVG 1P84H 1USEA 1G8JB 3P8CE 4PV1D 4U3FJ 5AW8B 2HMJA 1IFMA 2UWJE 2XRXA 3H1ID 1FC2C 2IBZD 1N2DC 1MFZA 4PD4I 1L4AC 1S3JA 1SQVE 3II6A 3EFGA 1PP9G 3H1HD 2I1KA 2JO6A 1UIXA 1FDMA 4ZNCA 2Z5HA 1LTSC 1IFDA 2O01N 1T3JA 3CC4P 1JY2P 1URQC 2M5AB 3H1IE 4L75A 1OW8A 2IBZE 3AEDC 4NBFD 1VQ6P 3H1HE 4TLFA 1L0ND 4KT0J 4NPEA 1G1IA 1EZVD 1N8RQ 1H88A 1IK9A 1SQPK 5CBOA 5BU5A 4NB9D 2Y9ZA 3RL0B 1FZEA 3TYYA 3L36A 1HF9A 4YPCA 3CXHH 4D6TJ 1JTHA 2B87A 3O8ZA 3GW6A 2QRXA 2YFIA 4PV1B 2PGDA 1GK4A 4ZKPA 1BCCJ 1L2PA 1PIXA 1VCKA 2VRSA 4IFDK 1NAFA 1R5SA 1L0NE 3CCLP 1QVFO 1EZVE 1G2CA 2B89A 3AE5C 1JM0A 3GKEA 2WT7A 1MKMA 5AEUA 1N7LA 2N1TC 2HPCB 4R4LA 3TGUE 3H32B 3NTNA 2MKVA 4LGDE 1SQVK 4DT0A 2YIUB 3VCPA 3UIAA 3A7OA 3A0BE 3CCRP 4RESB 3KQGA 5AVRB 1EDLA 1KB9H 3JCUH 2NPSA 1VM9A 3M0DA 3L70J 1R8EA 2QJYC 1BGYJ 3L73J 5AW4B 2Q5UA 1CZQA 3GOBA 5C39A 5AW5B 5AVUB 3RK3C 1KQLA 3O6QB 1S2EA 2CK3H 3CCMP 1LT1A 3RGUA 3AE9C 1URQB 3L71J 2N9YB 1OZHA 3HE5A 1M7LA 5KLVJ 4PJ0E 5KAFH 1A02J 2BCCG 1KTMA 3CLQA 4H0LD 4NPDA 1PGPA 2M3EA 1FJPA 2WSCJ 2YO2A 5AVSB 3MGNA 2D2CD 5AW6B 2WSCH 1FZBA 1PP9J 3CMAP 3M9BA 5B66H 1SJGA 1YTZT 4P1BH 3VMZA 3GHGB 3CC2P 4EYYQ 1SFCC 1FJKA 2LR2A 2E42A 1Q2NA 3WUVA 1IFJA 5CJ4A 1O7WA 1VQKP 1AVOA 2WPSA 3H1KG 3V2PA 5AVVB 2O1JA 1W5CE 1U7JA 1FQTA 1ZR4A 3V2RA 1VQLP 1LTJB 3AE8C 2QA4P 3IAOA 2DW3A 1T2KC 1U57A 1O7MA 3U1CA 1KN7A 3AECC 1SQBG 1J1EB 1KILC 2CPSA 4KJMA 4OGQD 3RK2C 1G8KB 5GTIH 3H1LJ 1BSHA 2AXTH 2LXBA 5AW1B 4YXWH 1OWAA 2NUMA 1NU1D 2KP8A 2D2CB 2XZRA 3EQ2A 2BCCD 3GLMA 3RK3B 3CWBG 4RKUJ 4Y99B 1NGMB 3LW5J 1HJBA 2P58A 2J5UA 1L0LD 2WSFJ 3LW5H 1VQ4P 1FOSF 2WPRA 2ITAA 1JM1A 2WSFH 1BE3D 2E75D 1QLED 3B5NC 3I5CA 4NB8D 1NU1E
chains in the Genus database with same CATH topology
4EMJB 1P84E 5BOKA 3CX5E 2NVGA 2XSOA 1UUVA 2GBWA 2YFLA 5KLIC 3TGUE 4HKVA 1PPJE 4AAYB 4U3FE 2BMQA 1SQBE 2YVJB 3GZYA 3BCCE 1NDOA 3DQYA 4HM4A 2HMMA 1O7WA 3C0DA 3CWBE 2QPZA 1SQVE 2XSHA 4HJLA 3VCPA 2E4QA 4QDFA 1Q90C 2JO6A 4H13D 4P1CH 2HMKA 5KKZC 4HM7A 1SQXE 1ZRTE 3L70E 1L0LE 1BGYE 4NBHD 2QJPC 4QCKA 3FOUA 3L73E 1FQTA 2E74D 2JZAA 1BE3E 3GB4A 4NBCD 2HMNA 2NVFA 4PD4E 3VMID 3GTSA 1EG9A 1VM9A 1KB9E 4NBGD 2BCCE 2QJYC 3AZCA 5AEUA 4NBED 1NTME 3H1IE 2FYNC 3EN1A 4QDFB 4AIVA 2IBZE 2CKFA 3GOBA 1O7MA 4HM6A 1O7HA 2QJKC 1O7NA 4NBFD 2HMOA 3N0QA 1NTKE 3H1HE 3L71E 4OGQD 2HMLA 5AEWA 2BMRA 3VMGD 5KLVE 1G8KB 1UUWA 1RIEA 2NUKA 2Q3WA 1NTZE 2A06E 1RFSA 4HM8A 3L72E 4D6TE 2DE7D 4HM0A 2NVEA 4NB9D 2FYUE 4HM1A 3L75E 1ULIA 2E76D 3VMHD 2NUMA 1O7GA 1BCCE 3H1JE 2YFJA 4QURA 2DE5D 3L74E 4HM5A 3D89A 3VCAA 3H1LE 3EQQA 3GTEA 2B24A 5CXMA 4NBAD 4H44D 2NWFA 1O7PA 4QDDA 2YFIA 1PP9E 4H0LD 4HM3A 3GL0A 3CXHE 3H1KE 1VCKA 3GCEA 4QUQA 2YIUC 2ZYLA 1VF5D 1L0NE 2BMOA 3GL2A 2D2CD 1EZVE 2E4PA 3GZXA 2B1XA 1SQPE 4QUPA 1JM1A 2GBXA 1KYOE 2ZT9D 2XR8A 1SJGA 2E75D 1G8JB 5HL4A 1SQQE 1NU1E 3GKEA 4PV1D 4HM2A 4P1BH 1NYKA 4NBDD 2HMJA 4NBBD 4QDCA 4NB8D 2DE6D 1ULJA 1WQLA 2I7FA 2XRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMJ B;  1P84 E;  5BOK A;  3CX5 E;  2NVG A;  2XSO A;  1UUV A;  2GBW A;  2YFL A;  5KLI C;  3TGU E;  4HKV A;  1PPJ E;  4AAY B;  4U3F E;  2BMQ A;  1SQB E;  2YVJ B;  3GZY A;  3BCC E;  1NDO A;  3DQY A;  4HM4 A;  2HMM A;  1O7W A;  3C0D A;  3CWB E;  2QPZ A;  1SQV E;  2XSH A;  4HJL A;  3VCP A;  2E4Q A;  4QDF A;  1Q90 C;  2JO6 A;  4H13 D;  4P1C H;  2HMK A;  5KKZ C;  4HM7 A;  1SQX E;  1ZRT E;  3L70 E;  1L0L E;  1BGY E;  4NBH D;  2QJP C;  4QCK A;  3FOU A;  3L73 E;  1FQT A;  2E74 D;  2JZA A;  1BE3 E;  3GB4 A;  4NBC D;  2HMN A;  2NVF A;  4PD4 E;  3VMI D;  3GTS A;  1EG9 A;  1VM9 A;  1KB9 E;  4NBG D;  2BCC E;  2QJY C;  3AZC A;  5AEU A;  4NBE D;  1NTM E;  3H1I E;  2FYN C;  3EN1 A;  4QDF B;  4AIV A;  2IBZ E;  2CKF A;  3GOB A;  1O7M A;  4HM6 A;  1O7H A;  2QJK C;  1O7N A;  4NBF D;  2HMO A;  3N0Q A;  1NTK E;  3H1H E;  3L71 E;  4OGQ D;  2HML A;  5AEW A;  2BMR A;  3VMG D;  5KLV E;  1G8K B;  1UUW A;  1RIE A;  2NUK A;  2Q3W A;  1NTZ E;  2A06 E;  1RFS A;  4HM8 A;  3L72 E;  4D6T E;  2DE7 D;  4HM0 A;  2NVE A;  4NB9 D;  2FYU E;  4HM1 A;  3L75 E;  1ULI A;  2E76 D;  3VMH D;  2NUM A;  1O7G A;  1BCC E;  3H1J E;  2YFJ A;  4QUR A;  2DE5 D;  3L74 E;  4HM5 A;  3D89 A;  3VCA A;  3H1L E;  3EQQ A;  3GTE A;  2B24 A;  5CXM A;  4NBA D;  4H44 D;  2NWF A;  1O7P A;  4QDD A;  2YFI A;  1PP9 E;  4H0L D;  4HM3 A;  3GL0 A;  3CXH E;  3H1K E;  1VCK A;  3GCE A;  4QUQ A;  2YIU C;  2ZYL A;  1VF5 D;  1L0N E;  2BMO A;  3GL2 A;  2D2C D;  1EZV E;  2E4P A;  3GZX A;  2B1X A;  1SQP E;  4QUP A;  1JM1 A;  2GBX A;  1KYO E;  2ZT9 D;  2XR8 A;  1SJG A;  2E75 D;  1G8J B;  5HL4 A;  1SQQ E;  1NU1 E;  3GKE A;  4PV1 D;  4HM2 A;  4P1B H;  1NYK A;  4NBD D;  2HMJ A;  4NBB D;  4QDC A;  4NB8 D;  2DE6 D;  1ULJ A;  1WQL A;  2I7F A;  2XRX A; 
#chains in the Genus database with same CATH topology
 1NTM G;  3IFM A;  1N7S D;  2BMQ A;  4HM4 A;  1LNQ A;  3WU2 H;  2ZYD A;  1EXJ A;  1USD A;  2R5D A;  1VPC A;  2H7H A;  1L0L E;  2P10 A;  1M1K Q;  4NBC D;  1BE3 E;  1ZOY C;  5AW0 B;  2HLO A;  4NBG D;  3AZC A;  3VTP C;  5APY A;  1JMM A;  3H1J G;  3HD7 A;  1DEB A;  3TK1 A;  4WVZ A;  4U3F G;  1PGJ A;  1YBK A;  1K05 A;  1CW5 A;  1QGK B;  1U7M A;  5B5E H;  2Y0D A;  4K3A A;  2HYN A;  2HFE D;  2E43 A;  4HM1 A;  1DIP A;  1DEE G;  5AW9 B;  3P32 A;  3G4S P;  2E75 B;  2FYU J;  3A0H H;  3CWB D;  1OVU A;  5TIS E;  1ZRT D;  1VF5 D;  1N7S B;  3CPW O;  2V7Q H;  2V4H A;  1YJ9 P;  1X79 B;  1HUC A;  1S1C X;  4C7N B;  3H1K J;  1H0T A;  4NBD D;  1Y8A A;  1QL2 A;  1OVV A;  2P1J A;  2QJK B;  1FZA A;  1NTM D;  1RY3 A;  3HUS B;  4EIJ A;  2KXP B;  3V2N A;  3HD7 D;  1OMI A;  3CWB E;  3FWN A;  1LWU C;  1L0L K;  1KV4 A;  1ZRT E;  2O01 J;  4RJT A;  3B5N B;  1ZME C;  4QCK A;  2ZJS E;  2E74 D;  1X0T A;  5KAI E;  3VOP A;  2R32 A;  3PRJ A;  3PH0 A;  1NTM E;  2ZXE B;  2QSI A;  2ZVN B;  1RF0 C;  4HM6 A;  2HOD B;  1BSN A;  1SLQ A;  3BCC G;  4IFF A;  1ZP0 C;  5GTH E;  3AEG C;  1SQP D;  1JB0 J;  2WTY A;  4ASW A;  1LTG C;  1SQX G;  5KLI B;  2K9J B;  3IR9 A;  1AFO A;  2FXO A;  3K5B A;  3CXH I;  2R3C A;  4QUR A;  2R5B A;  1FZG A;  3EQQ A;  1NTZ J;  2G3A A;  3G9R A;  1MFT A;  3G6E P;  4UB8 E;  2QJP B;  1GL2 B;  2HPC A;  3H32 A;  1NWQ A;  1S5L H;  1PGO A;  2KI7 B;  1BGY G;  1JEK A;  2KLU A;  1SQP E;  3ZDM A;  3KZI H;  3L73 G;  2HG5 D;  4HM2 A;  1NYK A;  1LTB C;  1Q82 Q;  2R3S A;  1N73 B;  2AEJ A;  1KFM A;  2E74 B;  2LXC B;  3Q5R A;  3AE3 C;  3H1J J;  3L71 G;  3MUD A;  1KB9 I;  4P1C H;  5APV A;  5TJH A;  2A06 D;  4D6T D;  3SFE C;  2KYV A;  4BRY B;  1HVV A;  1S9K D;  3O6Q A;  2JKV A;  2ZYG A;  3MZW B;  1BCC D;  4JQ0 D;  4WY4 C;  1OVR A;  1NTM K;  3F89 A;  5AW7 B;  1RE3 A;  1URQ A;  4UB8 H;  3KYQ A;  2CKF A;  3V5B A;  2A45 H;  2W6A A;  3L72 J;  3VMX A;  1O7N A;  3GF3 A;  2O3J A;  2FFD C;  1FAV A;  3CCV P;  1H89 A;  5EFW B;  3LIE A;  1K9M Q;  2OYI C;  3F5H A;  2A06 E;  4D6T E;  5KJ7 C;  2JJL A;  4MN4 C;  2KUB A;  3QH9 A;  1S9K E;  1J1D C;  4AUW A;  2ZVO B;  1BCC E;  2OTJ P;  2W90 A;  2WMM A;  3W68 A;  5CXM A;  4H13 B;  4QDD A;  1LGH B;  2WWW A;  3GHG A;  3CCU P;  1EDK A;  2QEX P;  2W27 A;  2RMZ A;  2GM4 A;  3PTZ A;  1LTT C;  3L70 D;  1L4A D;  2ZXX A;  1BGY D;  2B1X A;  3L73 D;  3WUT A;  3BAT A;  3T97 B;  5HL4 A;  4PD4 D;  2WPQ A;  3S9O A;  4NBB D;  1WQL A;  1KYO I;  3R4Y A;  5M1B A;  2LKM A;  3G71 P;  2FYZ A;  2HR3 A;  2OYH A;  1LTJ A;  3CCQ P;  1CI6 B;  3V6I A;  3H1L G;  1M90 Q;  1URQ D;  2KSJ A;  1EXI A;  2C0X A;  1VQ8 P;  4I7Z C;  3WUU A;  3L71 D;  5E79 E;  1Q90 D;  1KQG B;  5KLV D;  3L70 E;  1LT9 B;  1BGY E;  3RL0 g;  1IFI A;  3BCC J;  3FWL A;  3C9I A;  3L73 E;  2RN0 A;  4PD4 E;  2B88 A;  1FOS E;  1GW4 A;  1H8A A;  1SQX J;  5H2F E;  4GOF A;  1T8Z A;  2K1A A;  1DD4 A;  5DJT B;  1PP9 D;  1OFC X;  1PPJ G;  2FXP A;  1O7H A;  1WT6 A;  3L71 E;  1MV8 A;  5KLV E;  1KYO D;  1SVF A;  1FBM A;  4IFM A;  1L4A B;  3D89 A;  2L5G B;  3IF4 A;  1L0N J;  3CL3 D;  4KHX A;  2FFD B;  1PP9 E;  5AW3 B;  4H0L C;  3HTK B;  1GZL A;  1ZLL A;  3GCE A;  2OYI B;  4DCK A;  1EC5 A;  4WBA A;  1PZQ A;  2GBX A;  2E76 C;  1KYO E;  3TGU J;  2PFX A;  3H6P A;  3MP7 B;  5BOK A;  2NPS C;  4I2L C;  5H2F H;  2YFL A;  1FZC C;  3M0D C;  1KQF B;  3A0B H;  3V4Q A;  3CX5 I;  2PP6 A;  1YTZ I;  2QPZ A;  3RK3 D;  5CMZ A;  1NHL A;  3P8M C;  2FYU G;  2KLV A;  5APQ A;  1KOR A;  2JO1 A;  4GIF A;  1AJY A;  3EN1 A;  2OGU A;  3MHV A;  1WRG A;  3JSV C;  4CPG A;  2WPV B;  2C0W A;  5KLV K;  1QVG O;  4JPZ B;  3RK3 E;  2N1T B;  2NUK A;  2GA1 A;  1EDI A;  5CCH C;  2DE7 D;  3AEA C;  2IZ1 A;  1N7S A;  3L4F A;  1RE4 A;  4PJ0 H;  1NTK J;  1O7G A;  2W83 C;  3CX5 D;  4C7N A;  1M8O B;  3CME P;  1XTG B;  3HUS A;  1AQT A;  2QJY B;  1VQ7 P;  3TNU B;  2C9L Y;  1JOC A;  1Z56 A;  3W67 A;  1QEX A;  1S5L X;  1R5L A;  3JC2 2;  4AYC A;  4QDC A;  3B5N A;  2DE6 D;  1G1J A;  3CX5 E;  2NVG A;  4C7R A;  4XE5 B;  1SP4 A;  3L37 A;  1JNM A;  3Q3D A;  2AEM A;  2W6B A;  1ZW0 A;  1T2K D;  2WVR A;  1S72 P;  3V2Q A;  2C9N Y;  3D71 A;  4UB6 E;  2E76 B;  3PJS K;  5KKZ C;  1KIL D;  1X8Y A;  2HOD A;  1NTZ G;  2Q1K A;  1RHZ B;  2YKP A;  3RK2 D;  2KS1 B;  2JZA A;  2FKW B;  2FYU D;  2YNY A;  2NPS B;  1DX7 A;  2IPP A;  1FZC B;  2E5Y A;  1KQS O;  2BCC E;  1KD1 Q;  3SWK A;  4GT1 A;  3AE1 C;  4O9B A;  3H1K D;  2NZ2 A;  2HMO A;  1GL2 A;  5L8R J;  1RIE A;  1KIL E;  2JWD A;  1SFC B;  1MZ9 A;  2JDI H;  2WSE H;  3D6Z A;  4IL6 E;  3VMY A;  2FYU E;  3MTU E;  1ULI A;  2OYO A;  3C8V A;  3B5N D;  5AVX B;  2Z5I A;  4XFJ A;  1SQB D;  1HJ0 A;  1GTW A;  1XTC C;  3H1K E;  1N73 A;  1NU1 J;  4L76 A;  4QUP A;  1M1J A;  3HE4 B;  2MJZ A;  1LJ2 A;  1IFN A;  3S4R A;  3L72 G;  1MUU A;  4TT3 H;  1HWT C;  2JWA A;  4H44 C;  3AEB C;  1KIL B;  4GOE A;  4I1L A;  2P7J A;  3SFD C;  4HKV A;  4AAY B;  3RK2 B;  3I56 P;  2V7Q J;  1SQB E;  3AE2 C;  1P84 I;  3HD7 C;  1VL2 A;  3FXE A;  2M3B A;  1BE3 J;  5APT A;  2GUV A;  2ZT9 C;  2G8Y A;  1NTZ D;  1GL2 D;  1KMI Z;  5AVY B;  1AV1 A;  2I1J A;  4W80 A;  3EWK A;  3KXD A;  5CCG A;  1NKZ B;  3GTS A;  1IO4 A;  2YKQ A;  1RF1 C;  1GK6 A;  4Z1M H;  5CBN A;  3SWF A;  3A2A A;  2M5A A;  3VP9 A;  3BRV B;  4AIV A;  4JYC A;  5KKZ B;  3PP5 A;  1OX3 A;  3RBZ A;  3CCS P;  3VMG D;  1NKN A;  1NTZ E;  2FYU K;  1JY2 N;  1QL1 A;  3E1I A;  2XNX A;  2M8R A;  3H1J D;  1P84 D;  2KIK A;  5BVZ A;  4U3F D;  1JMB A;  3FX0 A;  3H1I G;  5TIS H;  3AEF C;  3GL0 A;  3R2P A;  1M57 D;  1VQO P;  1JY2 O;  2IDB A;  1S4X A;  4GKG A;  3I55 P;  5AVQ B;  2KOG A;  1ZR2 A;  3EFF K;  1LT9 A;  3U59 A;  5CCG D;  3PLN A;  4BWN A;  3H1J E;  1P84 E;  2XSO A;  2GBW A;  2H88 C;  3GF7 A;  2IYO A;  1W2E A;  1SQB K;  1LP1 B;  1NH4 A;  4U3F E;  1SQQ J;  3RL0 C;  1ZXG A;  2K3R A;  2HMM A;  3CI9 A;  5AVW B;  4H13 D;  1YYC A;  2QG4 A;  2K9Y A;  5KAI H;  2NRG A;  4GOD A;  2FBW C;  2Q9I A;  4DOJ A;  4PV1 C;  1L0N G;  3B4S A;  1EZV G;  3SSU A;  3GB4 A;  1EQ7 A;  5APW A;  4H44 B;  1X22 A;  3VP8 A;  1HTL C;  4NBE D;  2BAS A;  4QDF B;  5GTH H;  3TGU G;  1L4A A;  3CXH D;  2ZT9 B;  4ASV A;  4QMA A;  3N0Q A;  4W7Y A;  1IJD B;  1K8A Q;  1NTZ K;  2YMY A;  2QVA A;  3HTK A;  1VQM P;  2NVE A;  4K35 A;  1X9V A;  1PGQ A;  1RF1 B;  1M56 D;  3CD6 P;  2BEQ D;  2DE5 D;  2XKM A;  1LWU B;  2AEF A;  3A3Y B;  1EZV I;  2XU6 A;  5APS A;  3CCE P;  2B24 A;  1O7P A;  3BCC D;  1SQP J;  3L75 J;  2QIW A;  3CXH E;  2FXM A;  2Y9Y A;  3L74 J;  2YXR B;  1KC8 Q;  4QUQ A;  1FE6 A;  1SQX D;  3MUD C;  4JYB A;  3RBX A;  4M3L A;  2Q6Q A;  4HJG H;  1H0T B;  1OW7 A;  1OW6 A;  1GU5 A;  2RKL A;  1KB9 D;  3GTE A;  4EMJ B;  4U7J A;  2H43 A;  3Q5S A;  4L73 A;  2XDJ A;  4WY4 D;  5CHX A;  1RE3 C;  1IZN B;  3D70 A;  3BCC E;  1BDC A;  1NTK G;  2Q3I A;  3NMD A;  1Q90 C;  1K04 A;  1SQX E;  1E5W A;  1WMK A;  2K88 A;  1GU4 A;  3BVH A;  1SQV J;  3E7K A;  2KZJ A;  5KJ7 D;  2N1T A;  2KNC B;  1KZU B;  1KB9 E;  4LLH A;  3USS A;  1UII A;  3JCU E;  3OJA B;  2M0B A;  3TGU D;  3GHG C;  2L91 A;  3H1I J;  2HML A;  2BMR A;  1YQ3 C;  4L74 A;  5APX A;  4LC1 A;  3KHU A;  1BDD A;  3M0A A;  1JO5 A;  2WQY C;  3IN6 A;  1HGZ A;  3CC7 P;  3V4W A;  3H1H J;  3KDP B;  1Y9B A;  3TNU A;  3A5T A;  2JP3 A;  2JEE A;  2NWF A;  3HRN A;  5AVT B;  2OYH C;  1LTJ C;  4EDF A;  4NPF X;  4HM3 A;  1DD3 A;  5KAF E;  3TSI A;  2ZFC A;  4WWI A;  4EOT A;  1HH0 A;  3GL2 A;  1JY3 N;  4WY4 B;  2E4P A;  4HH2 A;  1AA0 A;  1J1E C;  2ZAE B;  1N86 A;  3VCA A;  2IFM A;  2I7F A;  2N1T D;  5B66 E;  1OXZ A;  2KS1 A;  4JBZ A;  1FZC A;  5E79 H;  3CCJ P;  1NO4 A;  2KK7 A;  4AQR D;  3C0D A;  1JY3 O;  5APU A;  2XSH A;  1NTK D;  2D2C C;  1SQX K;  3TF5 A;  2WIT A;  1J1D B;  3VN0 A;  4B86 A;  4PD4 H;  1DH3 A;  4Y99 C;  2HMN A;  2IYP A;  3QWO C;  3VMI D;  2WSS H;  2J58 A;  2W6J H;  3H25 A;  3VYI A;  1SFC A;  4JF7 A;  3H1L D;  4IL6 X;  1NU1 G;  1AQ5 A;  1NTK E;  4YTP C;  1L0N K;  2E5T A;  1L0L G;  1HBW A;  4HM0 A;  3MD0 A;  2E76 D;  5CCH A;  3OW2 O;  5GTI E;  2QE7 H;  3B71 A;  1BE3 G;  1K73 Q;  3HE4 A;  4OVN F;  2YFJ A;  4I7Z B;  3AE4 C;  2AXT E;  3H1L E;  1PPJ D;  3FGA D;  1NOH A;  2NPS D;  1RH5 B;  1ZN5 A;  3TDK A;  1KIL A;  4OGQ C;  2IX7 C;  3B8E B;  3GMA A;  1KYO H;  1J2J B;  1FU1 A;  1PV3 A;  3M91 A;  3N4X A;  2XR8 A;  3NXS A;  2W8Z A;  5CJ0 A;  2P67 A;  1JTH B;  2B87 B;  1SFC D;  1FDO A;  1UUV A;  5BU8 B;  3OA7 A;  2OYH B;  1PPJ E;  2YVJ B;  1NDO A;  3DQY A;  1G2C B;  3Q1M A;  5AVZ B;  1EDJ A;  2E4Q A;  1E79 H;  4WB4 A;  2WT7 B;  2E75 C;  2H8P D;  3WU2 E;  1CSB A;  2B9B A;  4N3Y B;  2NVF A;  1GW3 A;  5CCH D;  2YKO A;  1EG9 A;  1N7S C;  1JCC A;  1RE4 C;  1JY3 P;  3WMM 0;  4H0L B;  3FXD A;  2OAR A;  1ZV8 A;  2YXQ B;  4Y28 J;  3KPE A;  4A7P A;  1NJI Q;  3GG2 A;  4DZO A;  1LTA C;  1JCD A;  1AVY A;  1NTK K;  2QJK C;  2KB7 P;  3HUS C;  1IFP A;  2KZI A;  1SQQ G;  4HM8 A;  2OTK E;  2K9J A;  3VMH D;  3ITK A;  4C46 A;  5KTB A;  1RQU A;  5B5E E;  4GDO A;  1NAY A;  1YJN P;  3M06 A;  1YI2 P;  1IC2 A;  2QM8 A;  1LTI C;  2WSE J;  2IFN A;  2ZYA A;  1LP1 A;  3A0H E;  2P2U A;  2ZYL A;  1Q7Y Q;  1A02 F;  3HE5 B;  1FDI A;  3CX5 H;  1FS0 E;  1Q81 Q;  1ULJ A;  3NFQ A;  3Q5P A;  5KLI C;  4OGQ B;  3BRT B;  2FY8 A;  3M9H A;  3GZY A;  4UB6 H;  2I8D A;  2CPB A;  1YHQ P;  1YJW P;  1VF5 C;  1VQ9 P;  4HJL A;  1GD2 E;  1FZF A;  2RH0 A;  4QDF A;  2A45 G;  1HGV A;  4HM7 A;  1YIT P;  2BCC J;  2Y0E A;  2QJP C;  1GL2 C;  3FOU A;  1SQP G;  2YMK A;  3L75 G;  4IOI H;  4DJG A;  1T6A A;  4BRY A;  3L74 G;  4HB1 A;  3AEE C;  2K37 A;  1L0L J;  3Q2Y A;  3D6Y A;  4ZMD A;  2FYN C;  1RF1 A;  2H89 C;  1LWU A;  1VDF A;  3G3Z A;  5K5G B;  1IK7 A;  1NYH A;  1TU3 F;  4IL6 H;  1N73 C;  5AEW A;  2E74 C;  2YO3 A;  2BEZ F;  1UUW A;  1QX8 A;  2Q3W A;  1M1J C;  1SQQ D;  3OAK A;  3LID A;  2A45 I;  5DJU B;  2Q7C A;  4R4M A;  2N9B A;  3U1A A;  4HM5 A;  1NU1 K;  3E1R A;  2PRR A;  3BAS A;  4NBA D;  4H44 D;  1RF0 A;  3N7N A;  1YIJ P;  1SQV G;  1D7M A;  3ABV C;  2Q3E A;  4N6J A;  5AW2 B;  1VQN P;  3GZX A;  1S5L E;  2ZT9 D;  4OWF A;  1SQQ E;  3T97 A;  2A06 G;  2O1K A;  1SQB J;  4D6T G;  2JR8 A;  3KZI E;  4OH8 B;  2O01 H;  5CCG C;  2J59 M;  1KFN A;  2POH A;  1BCC G;  4W7Z A;  1JUN A;  4HYT B;  3MIW A;  2IBZ G;  2KNC A;  2PAJ A;  1CI6 A;  2KSE A;  3H1H G;  1PL5 A;  1NVO A;  1SS1 A;  4H13 C;  2HMK A;  1YQ4 C;  4NBH D;  2R44 A;  3L72 D;  3SWY A;  3CWB J;  3L75 D;  3AE7 C;  4BXL A;  1Y47 A;  3L74 D;  3L35 A;  4EI2 A;  2OQQ A;  4XA4 A;  2Z4E A;  3C1L A;  3PHL A;  1VF5 B;  3S1K A;  1VQ5 P;  1GMJ A;  4I6M C;  1T3U A;  4HKZ H;  3VMA A;  2WZ7 A;  1OIP A;  2IBZ I;  1NTM J;  4N78 D;  3M9Q A;  1W2B O;  2OTL P;  4ZKU A;  1VQP P;  3L70 G;  1RFS A;  3AE6 C;  3L72 E;  3P8C D;  3L75 E;  4WY4 A;  3HD7 B;  2FYN B;  1LT9 C;  3L74 E;  2AXC A;  2XND H;  1RQV A;  2SPZ A;  2QM7 A;  4RO0 A;  1GDT A;  1SQV D;  2FFD A;  3RL0 D;  2Y0C A;  2XV5 A;  1Q86 Q;  2YIU C;  4YXD C;  2OYI A;  2BMO A;  1M1J B;  2IZ0 A;  4N78 E;  1PFI A;  5KJ7 A;  2GUS A;  1SQQ K;  3P7K A;  5KLV G;  1P84 H;  1USE A;  1G8J B;  3P8C E;  4PV1 D;  4U3F J;  5AW8 B;  2HMJ A;  1IFM A;  2UWJ E;  2XRX A;  3H1I D;  1FC2 C;  2IBZ D;  1N2D C;  1MFZ A;  4PD4 I;  1L4A C;  1S3J A;  1SQV E;  3II6 A;  3EFG A;  1PP9 G;  3H1H D;  2I1K A;  2JO6 A;  1UIX A;  1FDM A;  4ZNC A;  2Z5H A;  1LTS C;  1IFD A;  2O01 N;  1T3J A;  3CC4 P;  1JY2 P;  1URQ C;  2M5A B;  3H1I E;  4L75 A;  1OW8 A;  2IBZ E;  3AED C;  4NBF D;  1VQ6 P;  3H1H E;  4TLF A;  1L0N D;  4KT0 J;  4NPE A;  1G1I A;  1EZV D;  1N8R Q;  1H88 A;  1IK9 A;  1SQP K;  5CBO A;  5BU5 A;  4NB9 D;  2Y9Z A;  3RL0 B;  1FZE A;  3TYY A;  3L36 A;  1HF9 A;  4YPC A;  3CXH H;  4D6T J;  1JTH A;  2B87 A;  3O8Z A;  3GW6 A;  2QRX A;  2YFI A;  4PV1 B;  2PGD A;  1GK4 A;  4ZKP A;  1BCC J;  1L2P A;  1PIX A;  1VCK A;  2VRS A;  4IFD K;  1NAF A;  1R5S A;  1L0N E;  3CCL P;  1QVF O;  1EZV E;  1G2C A;  2B89 A;  3AE5 C;  1JM0 A;  3GKE A;  2WT7 A;  1MKM A;  5AEU A;  1N7L A;  2N1T C;  2HPC B;  4R4L A;  3TGU E;  3H32 B;  3NTN A;  2MKV A;  4LGD E;  1SQV K;  4DT0 A;  2YIU B;  3VCP A;  3UIA A;  3A7O A;  3A0B E;  3CCR P;  4RES B;  3KQG A;  5AVR B;  1EDL A;  1KB9 H;  3JCU H;  2NPS A;  1VM9 A;  3M0D A;  3L70 J;  1R8E A;  2QJY C;  1BGY J;  3L73 J;  5AW4 B;  2Q5U A;  1CZQ A;  3GOB A;  5C39 A;  5AW5 B;  5AVU B;  3RK3 C;  1KQL A;  3O6Q B;  1S2E A;  2CK3 H;  3CCM P;  1LT1 A;  3RGU A;  3AE9 C;  1URQ B;  3L71 J;  2N9Y B;  1OZH A;  3HE5 A;  1M7L A;  5KLV J;  4PJ0 E;  5KAF H;  1A02 J;  2BCC G;  1KTM A;  3CLQ A;  4H0L D;  4NPD A;  1PGP A;  2M3E A;  1FJP A;  2WSC J;  2YO2 A;  5AVS B;  3MGN A;  2D2C D;  5AW6 B;  2WSC H;  1FZB A;  1PP9 J;  3CMA P;  3M9B A;  5B66 H;  1SJG A;  1YTZ T;  4P1B H;  3VMZ A;  3GHG B;  3CC2 P;  4EYY Q;  1SFC C;  1FJK A;  2LR2 A;  2E42 A;  1Q2N A;  3WUV A;  1IFJ A;  5CJ4 A;  1O7W A;  1VQK P;  1AVO A;  2WPS A;  3H1K G;  3V2P A;  5AVV B;  2O1J A;  1W5C E;  1U7J A;  1FQT A;  1ZR4 A;  3V2R A;  1VQL P;  1LTJ B;  3AE8 C;  2QA4 P;  3IAO A;  2DW3 A;  1T2K C;  1U57 A;  1O7M A;  3U1C A;  1KN7 A;  3AEC C;  1SQB G;  1J1E B;  1KIL C;  2CPS A;  4KJM A;  4OGQ D;  3RK2 C;  1G8K B;  5GTI H;  3H1L J;  1BSH A;  2AXT H;  2LXB A;  5AW1 B;  4YXW H;  1OWA A;  2NUM A;  1NU1 D;  2KP8 A;  2D2C B;  2XZR A;  3EQ2 A;  2BCC D;  3GLM A;  3RK3 B;  3CWB G;  4RKU J;  4Y99 B;  1NGM B;  3LW5 J;  1HJB A;  2P58 A;  2J5U A;  1L0L D;  2WSF J;  3LW5 H;  1VQ4 P;  1FOS F;  2WPR A;  2ITA A;  1JM1 A;  2WSF H;  1BE3 D;  2E75 D;  1QLE D;  3B5N C;  3I5C A;  4NB8 D;  1NU1 E; 
#chains in the Genus database with same CATH homology
 4EMJ B;  1P84 E;  5BOK A;  3CX5 E;  2NVG A;  2XSO A;  1UUV A;  2GBW A;  2YFL A;  5KLI C;  3TGU E;  4HKV A;  1PPJ E;  4AAY B;  4U3F E;  2BMQ A;  1SQB E;  2YVJ B;  3GZY A;  3BCC E;  1NDO A;  3DQY A;  4HM4 A;  2HMM A;  1O7W A;  3C0D A;  3CWB E;  2QPZ A;  1SQV E;  2XSH A;  4HJL A;  3VCP A;  2E4Q A;  4QDF A;  1Q90 C;  2JO6 A;  4H13 D;  4P1C H;  2HMK A;  5KKZ C;  4HM7 A;  1SQX E;  1ZRT E;  3L70 E;  1L0L E;  1BGY E;  4NBH D;  2QJP C;  4QCK A;  3FOU A;  3L73 E;  1FQT A;  2E74 D;  2JZA A;  1BE3 E;  3GB4 A;  4NBC D;  2HMN A;  2NVF A;  4PD4 E;  3VMI D;  3GTS A;  1EG9 A;  1VM9 A;  1KB9 E;  4NBG D;  2BCC E;  2QJY C;  3AZC A;  5AEU A;  4NBE D;  1NTM E;  3H1I E;  2FYN C;  3EN1 A;  4QDF B;  4AIV A;  2IBZ E;  2CKF A;  3GOB A;  1O7M A;  4HM6 A;  1O7H A;  2QJK C;  1O7N A;  4NBF D;  2HMO A;  3N0Q A;  1NTK E;  3H1H E;  3L71 E;  4OGQ D;  2HML A;  5AEW A;  2BMR A;  3VMG D;  5KLV E;  1G8K B;  1UUW A;  1RIE A;  2NUK A;  2Q3W A;  1NTZ E;  2A06 E;  1RFS A;  4HM8 A;  3L72 E;  4D6T E;  2DE7 D;  4HM0 A;  2NVE A;  4NB9 D;  2FYU E;  4HM1 A;  3L75 E;  1ULI A;  2E76 D;  3VMH D;  2NUM A;  1O7G A;  1BCC E;  3H1J E;  2YFJ A;  4QUR A;  2DE5 D;  3L74 E;  4HM5 A;  3D89 A;  3VCA A;  3H1L E;  3EQQ A;  3GTE A;  2B24 A;  5CXM A;  4NBA D;  4H44 D;  2NWF A;  1O7P A;  4QDD A;  2YFI A;  1PP9 E;  4H0L D;  4HM3 A;  3GL0 A;  3CXH E;  3H1K E;  1VCK A;  3GCE A;  4QUQ A;  2YIU C;  2ZYL A;  1VF5 D;  1L0N E;  2BMO A;  3GL2 A;  2D2C D;  1EZV E;  2E4P A;  3GZX A;  2B1X A;  1SQP E;  4QUP A;  1JM1 A;  2GBX A;  1KYO E;  2ZT9 D;  2XR8 A;  1SJG A;  2E75 D;  1G8J B;  5HL4 A;  1SQQ E;  1NU1 E;  3GKE A;  4PV1 D;  4HM2 A;  4P1B H;  1NYK A;  4NBD D;  2HMJ A;  4NBB D;  4QDC A;  4NB8 D;  2DE6 D;  1ULJ A;  1WQL A;  2I7F A;  2XRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...