3L70E

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l70E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l70E02
3CXHE 2QJYC 1UUWA 2BMRA 4HM5A 1KB9E 1SJGA 4OGQD 3H1IE 1O7HA 3GCEA 5KKZC 1P84E 2IBZE 4QDFA 2BMQA 2XSOA 4HM8A 2XR8A 1ULJA 3GL2A 4QUPA 5CXMA 3L73E 2YFJA 1SQXE 5HL4A 1O7PA 1RFSA 2NVGA 2XRXA 2B24A 3VCPA 1O7WA 3VMID 1SQQE 2DE5D 1NYKA 1ZRTE 4QURA 4NBCD 4NBDD 4QUQA 1KYOE 2JZAA 4NBGD 1SQVE 2XSHA 1G8JB 3C0DA 3N0QA 3H1KE 2B1XA 1EG9A 5AEWA 3TGUE 3GB4A 3L70E 2BCCE 1BGYE 2CKFA 1O7NA 4NBAD 4H13D 3EN1A 3VMHD 1O7GA 2NVEA 4NBBD 3AZCA 4NBFD 4NBHD 2YFIA 3L71E 4P1CH 4HM1A 4HM7A 2FYUE 4QCKA 3CX5E 4U3FE 2A06E 3L72E 1BCCE 2FYNC 2GBXA 2JO6A 1NDOA 3D89A 2I7FA 4H0LD 3GZXA 4HJLA 1FQTA 2BMOA 3EQQA 4NB9D 2E76D 2HMKA 1NTZE 1BE3E 5BOKA 3DQYA 1PPJE 4PV1D 4AIVA 3BCCE 3GZYA 3GKEA 4NBED 4HM6A 4H44D 2NUMA 2Q3WA 3GOBA 2YIUC 1NU1E 4D6TE 1UUVA 1Q90C 4HM2A 2DE7D 3GTEA 4P1BH 5KLVE 2HMMA 3GTSA 2QPZA 2NVFA 3L74E 2D2CD 2GBWA 3GL0A 1VM9A 2E74D 2ZT9D 2HMJA 1RIEA 4EMJB 2YFLA 2HMLA 3H1LE 4HM0A 1WQLA 4QDCA 1SQPE 3CWBE 2DE6D 2HMOA 5AEUA 1L0NE 1O7MA 1SQBE 1L0LE 3FOUA 2E4QA 2NUKA 2E4PA 1EZVE 4HM3A 4NB8D 1JM1A 3L75E 1VCKA 2NWFA 4HM4A 1NTKE 1VF5D 4HKVA 2ZYLA 1ULIA 4QDDA 3H1JE 5KLIC 1PP9E 1G8KB 2QJPC 2E75D 2QJKC 4QDFB 2HMNA 3VCAA 4PD4E 1NTME 3H1HE 2YVJB 4AAYB 3VMGD
chains in the Genus database with same CATH superfamily
3CXHE 2E76B 1YITP 1SFCB 1VQPP 1EQ7A 1P84E 1RH5B 3H1LD 2GUVA 1SQXE 4TT3H 1UIIA 2WPQA 1EDLA 1NVOA 1R5SA 2P10A 1KYOE 4JPZB 1NOHA 1G8JB 1OW8A 3H1KE 1YJNP 4I6MC 2POHA 5APWA 1BGYE 4Y99C 1JM0A 1X79B 3JC22 2N9YB 2JO1A 1PP9D 1S3JA 3L71E 5AW0B 1URQB 2IZ0A 5B5EE 3HUSC 2A06E 2FYNC 2YIUB 1NTMD 3H1HD 3AEBC 3C8VA 1IC2A 1AJYA 2OYIA 3PTZA 5M1BA 2FY8A 2AEMA 2Z5IA 2FXMA 2N1TA 2H88C 4NBED 1FJKA 1SQBK 1J1DC 3L73D 3HE5B 4LGDE 4JYCA 5BU8B 2H7HA 1E79H 4K3AA 1PP9J 1SQPE 3FX0A 2KXPB 4AUWA 1IFDA 3OA7A 3U1AA 1IK9A 4HM3A 1K73Q 2ZVNB 1NTKE 1S5LX 3B5NA 1MFZA 2O1JA 1GL2B 3V4WA 1VQKP 1OX3A 2D2CC 4Y99B 3RL0B 2FBWC 2R5BA 1AFOA 2O1KA 2NPSC 1MFTA 2IFMA 1T3JA 3M91A 1NKNA 2BEZF 2KB7P 5C39A 1KD1Q 1M8OB 1RHZB 3H1IJ 3H32B 1N7LA 2FXOA 1IZNB 3F5HA 1O7PA 2PRRA 1EZVG 2XRXA 3L70G 1ZR2A 1XTGB 1SQQE 1DD4A 3Q5RA 4K35A 2OYIB 3V6IA 1P84I 5KTBA 4TLFA 4U3FJ 2E76C 3KZIH 1USEA 3L35A 3A0HH 1M56D 1Y47A 1N7SB 4U7JA 3AZCA 2QJPB 1FZCA 2XZRA 1J1EB 4QCKA 2H89C 2IDBA 2FYUD 5AVYB 1BCCD 1ZV8A 2KZJA 2N1TC 1AVYA 4ZNCA 3CCQP 2BCCG 3TSIA 2Q3EA 1VQ4P 1JO5A 1FAVA 4DJGA 3HUSA 5E79H 2A45I 2YKPA 3WMM0 1GW4A 5APQA 1FDMA 1SFCA 5AVRB 4H44C 4EMJB 2KZIA 1VF5B 3H1JJ 2DE6D 5CJ0A 3P8MC 5CHXA 3D71A 1EZVE 2OGUA 2LKMA 2OYHA 1IFJA 3AEEC 1SFCD 3BATA 4L76A 2QJKC 1K9MQ 2R3SA 1FJPA 3L72J 2N9BA 3CPWO 1S5LH 1SJGA 4U3FD 5KJ7C 3VN0A 1OWAA 3H25A 2R3CA 5AW3B 3HE4B 2J59M 2NVGA 4C46A 1GW3A 2IX7C 4GIFA 5AVTB 2B1XA 2C9LY 1VF5C 1KTMA 3L70E 4H13D 3GHGC 2YNYA 1MKMA 3Q3DA 2A45H 4NBFD 5KLIB 2CK3H 1KB9D 3O8ZA 2VRSA 2W6JH 2I7FA 2LXBA 3VP8A 2Q5UA 1RE4C 3W67A 3Q5PA 3H1JD 2G3AA 3HTKB 3TGUG 3T97A 1FZFA 2JJLA 3TGUJ 5CBOA 1U7MA 1FZGA 3A5TA 3AEGC 1BE3J 3BCCG 1YTZI 2ZYDA 2I1KA 2RH0A 3MHVA 3P7KA 1OVVA 1Z56A 1NTKK 1VQ6P 4EIJA 4PD4D 1HBWA 3CCJP 1SQBE 2OYIC 1L0LE 3L75D 2WTYA 4ASVA 2JR8A 3RGUA 4HKVA 3M06A 5KLIC 4OGQB 2NRGA 3CCUP 1GMJA 1A02J 2YXRB 1EXJA 3WUUA 1JUNA 1AA0A 1KB9E 2QIWA 3CC7P 1O7HA 1KORA 4H0LC 5GTHE 1S2EA 1ZOYC 4IFMA 5KLVK 5H2FH 1KYOH 1OIPA 1SQXK 2IBZI 3N0QA 4N78E 5AEWA 1WT6A 1N7SA 3RL0g 3VMHD 5TJHA 3H6PA 4BRYA 4HM7A 3ABVC 4H0LD 5L8RJ 1T3UA 1DH3A 2M3BA 1J2JB 2KLVA 2Q3IA 3L75J 3Q1MA 5DJUB 1EDIA 1IFNA 1HF9A 1ZW0A 1MV8A 1JNMA 2FYNB 2YIUC 1YHQP 1R5LA 3M9QA 1FU1A 2WT7B 2D2CD 2FFDB 2WWWA 4W7ZA 4DOJA 2ZT9B 3CX5D 4QDCA 5CCGC 5AEUA 1K04A 1PL5A 3S1KA 2GM4A 1JY2P 3WU2E 2FFDA 2CPBA 3L75E 1HUCA 3CC4P 3E1IA 2KSEA 1J1EC 3TK1A 3LW5J 2QJPC 2B87A 3V4QA 2HMNA 2WITA 1PGOA 1USDA 2Q1KA 2KSJA 1YTZT 1OW6A 2WSCJ 2KOGA 2V7QH 2KLUA 5KKZC 4HB1A 4BRYB 2PP6A 2KK7A 1LT9A 1LP1B 2YFJA 1M1JA 4YPCA 1YI2P 1ZRTD 2KP8A 1SQVD 2WQYC 1URQA 2GUSA 3H1IG 3G9RA 1K8AQ 4UB6H 2IYOA 3GF7A 1JMBA 1EZVI 3CLQA 5KLVG 1DIPA 3H1LJ 3PH0A 4MN4C 4HJLA 3H1LG 1KV4A 3CCRP 2E75C 2Q7CA 1Q2NA 1L2PA 2W83C 1SQPG 3L4FA 1JY3N 1L0LJ 1FBMA 1L0LG 3B5ND 4RKUJ 3SFDC 2IPPA 2QPZA 3VP9A 1JY3P 1IFIA 2M0BA 1SS1A 2J58A 2O01N 1FZBA 1H0TB 3A7OA 5APUA 2E4QA 2E4PA 2AEJA 1JM1A 1GU5A 2G8YA 4B86A 1URQD 1GD2E 1W2EA 5KAFE 1SQVJ 1FDOA 5APVA 1RE3C 2IZ1A 1BGYG 3BRTB 3L71D 5BU5A 2IBZE 1QL2A 4HYTB 5AW9B 1BCCG 4Y28J 5AW1B 1VQ8P 1RE3A 1LT9B 3LIEA 1FC2C 1T2KD 2KS1B 4QUQA 3EWKA 4IL6H 1M1JB 3SWFA 3MIWA 4HKZH 4NBAD 2M3EA 1VQNP 3MZWB 2NVEA 1SLQA 1L0NJ 1NTZG 3L72E 4DZOA 1Y8AA 2L91A 5TISH 1SQQG 3KXDA 2P2UA 2Y0CA 3VYIA 1GL2A 3HD7C 1ZLLA 4D6TE 2WSFJ 1SQBG 3L72G 3TNUB 3ITKA 1DEBA 1RE4A 2HPCA 2AEFA 1NTMJ 3H1HJ 4OVNF 3CWBD 2YFLA 4HM0A 1WQLA 1SQXJ 3MUDC 3VOPA 1WRGA 3CWBE 1PPJG 3FOUA 1IK7A 4WB4A 1KILD 5CJ4A 2I8DA 5APTA 3H32A 2WSEJ 4QMAA 4YTPC 3HTKA 5CCGD 1SQXG 1G8KB 3A0BE 2KI7B 4UB8E 1G1JA 3MD0A 2ZXXA 1W2BO 2IYPA 3PJSK 2QJYC 4OWFA 2YO2A 2L5GB 3H1IE 3NTNA 2N1TD 2Q6QA 2BCCJ 1HJBA 4IL6X 1KQLA 5AVQB 2B24A 4ZKUA 5AVWB 5CCHC 3NXSA 4NBGD 4JQ0D 2FXPA 2QRXA 3L73J 1MZ9A 2JEEA 1KILE 4H44B 1YJ9P 1KQGB 3CMAP 3L70J 4OGQC 2HPCB 3RK2C 3H1KJ 1BCCE 1EXIA 3VMZA 2MJZA 2WSCH 2ZXEB 3I5CA 5CMZA 2BCCD 2Y9ZA 1PFIA 2WPVB 1SP4A 4AIVA 1BDCA 2N1TB 4I7ZB 1FDIA 1KZUB 2OYHB 2B89A 4WY4B 1BCCJ 2A06D 3L71J 3KQGA 3IFMA 1BGYJ 1HTLC 2NZ2A 2HYNA 3B5NB 2J5UA 3AECC 1M1KQ 2NWFA 4JF7A 4EOTA 1KC8Q 3M9BA 3OW2O 4QDFB 3CCEP 3TGUD 4H13B 1NTME 3H1HE 2YVJB 1S5LE 1VL2A 3D70A 4EI2A 3K5BA 1L0LK 3IAOA 2Y9YA 1LTBC 2XNDH 1X9VA 4NPEA 5AW8B 2PFXA 3MTUE 2WZ7A 1S9KD 3HE4A 3GB4A 2JWAA 1RF1C 1NH4A 1O7NA 2R44A 1OXZA 1NHLA 1GU4A 1J1DB 1L4AA 2WMMA 3SFEC 2JO6A 1SQVK 3KHUA 5GTIH 3UIAA 4NB9D 3AE8C 2XNXA 1PPJE 3RK3C 3CWBG 3HE5A 3GZYA 1LTSC 3B8EB 4H44D 4YXDC 3CXHH 3AE3C 3T97B 2ZVOB 3FXDA 1N73A 1CZQA 3HUSB 3VMYA 3CMEP 2JP3A 1JOCA 1EDJA 4XFJA 1A02F 5AW6B 2HMOA 2B87B 1KN7A 2LR2A 5CBNA 3QH9A 2WPSA 1L0NK 1SQPJ 3H1ID 4RJTA 1JCDA 3VCAA 2K9JB 1SQQK 2PGDA 1AVOA 4L75A 4ZKPA 3I55P 1EZVD 2P58A 3CCLP 3M0DC 4QDFA 3WUVA 4HM8A 1S4XA 3B71A 3IN6A 1QVGO 2XR8A 4BXLA 3GLMA 3L71G 5AVSB 5CXMA 2ZJSE 3D6ZA 2HG5D 4R4MA 2QM7A 2C0XA 1X8YA 2DE5D 1NYKA 3M0DA 1VQ7P 4NBCD 4NBDD 1AV1A 1CW5A 4U3FG 1ZMEC 2XSHA 5AVUB 2NPSB 4ASWA 1OVRA 3SWKA 1EG9A 1LTAC 1VDFA 5KAIH 2ZT9C 3Q5SA 2D2CB 3KPEA 1O7GA 2FYUE 1KMIZ 2JWDA 3S4RA 4C7NB 1JTHA 2WT7A 2GA1A 1NTZE 2E42A 4JBZA 1SQVG 4YXWH 4ZMDA 3HRNA 3GOBA 3V2RA 1U7JA 3A3YB 1GZLA 1S9KE 1W5CE 1NU1E 1UUVA 3IF4A 4PV1C 3MUDA 2A06G 2WVRA 1ZN5A 2GBWA 1RF1B 1X0TA 4DT0A 2QE7H 1L0NE 3HD7A 5AW7B 4IFFA 2FKWB 1N7SD 4NB8D 1PPJD 1G2CA 3E7KA 3CWBJ 3C9IA 1DX7A 3A0BH 2Y0DA 3L74J 1H0TA 2C0WA 4PJ0H 1RF1A 3VTPC 4DCKA 1SQXD 1UUWA 3M0AA 1L0NG 2YMKA 2RMZA 4NPDA 1IO4A 3TF5A 1DD3A 4WWIA 1ULJA 3AEDC 2WPRA 2UWJE 4LC1A 1E5WA 1PZQA 3BRVB 1XTCC 1BDDA 2K37A 3B5NC 1YQ4C 1S1CX 4R4LA 1SQVE 1NU1K 2XKMA 2E74C 3EN1A 1HGVA 3PHLA 4NBHD 3LIDA 1PGQA 3BCCD 2OTKE 2HODA 1LWUC 2WSFH 3A0HE 3D89A 3PRJA 5B66E 2C9NY 4I7ZC 1YIJP 3QWOC 1VQOP 2HMKA 3G3ZA 3MP7B 4PD4I 1LNQA 3H1KG 4GT1A 2P67A 2K1AA 2IFNA 3O6QA 1OVUA 2NUMA 1KILB 1LTGC 2OTJP 1Q90C 1JB0J 5KLVE 2YMYA 3GMAA 1UIXA 1N86A 1TU3F 4W80A 2SPZA 3H1LE 1O7MA 1VQ5P 3CXHD 3GF3A 2H43A 4IFDK 1ZP0C 5AW5B 4NPFX 3AEAC 2E5YA 1GK6A 1LTJB 4PD4E 1KB9I 3L74G 3U1CA 2HFED 3GW6A 1Q86Q 4WY4A 4A7PA 3OJAB 2BMQA 1VPCA 3BASA 3II6A 2ZAEB 2NPSA 4WBAA 1Q82Q 2Y0EA 1N8RQ 2V7QJ 1HH0A 2JZAA 1NTMG 3H1HG 3WUTA 1X22A 5AW2B 1PP9G 1NO4A 2YKQA 4GOEA 4PD4H 3A2AA 3WU2H 4L74A 2WSSH 4GOFA 4C7NA 2K88A 1BSNA 3CX5E 1NTZK 1NU1G 3V2QA 1KILC 3L70D 2JKVA 1FQTA 3L37A 1LWUA 5BOKA 1QVFO 1IFMA 2V4HA 1G2CB 4I1LA 2R5DA 1R8EA 4WY4C 2FYUG 2AXTE 3G71P 3IR9A 2OYHC 3AEFC 2KYVA 4IOIH 2E5TA 4I2LC 1BSHA 1SQPD 3H1KD 1M57D 1KYOD 1H8AA 2IBZG 2Z4EA 2YXQB 3M9HA 1LT9C 3H1JE 2XU6A 4OH8B 3AE5C 2M5AA 3D6YA 2ZYAA 1L4AD 4LLHA 3GG2A 3ZDMA 3CCSP 1LTJA 4L73A 1PIXA 1LTTC 1HVVA 2Z5HA 5KJ7A 3SSUA 1H89A 3C1LA 1VQ9P 2KNCA 3FWLA 1SQBJ 4Z1MH 1BE3G 1GL2C 3BCCJ 1PV3A 2NPSD 1JEKA 1RFSA 1BGYD 3KDPB 1HGZA 1O7WA 4QURA 1NTMK 2LXCB 3R2PA 3CCMP 5KAIE 3CI9A 3F89A 1QLED 2BCCE 3G4SP 3CC2P 1LTJC 4XE5B 2OARA 3U59A 2YFIA 1IJDB 4IL6E 1T8ZA 3FGAD 4M3LA 4U3FE 4BWNA 1D7MA 4O9BA 3B4SA 3GZXA 1KFMA 3EQQA 3CXHI 1BE3E 3P32A 1NWQA 2DW3A 2E75B 3BCCE 1SQQD 3EFFK 5APSA 1NU1D 2Q3WA 5H2FE 2QG4A 5APYA 5AVVB 2DE7D 1FZCB 2ZT9D 3H1JG 4HJGH 2YKOA 4D6TJ 2FYUK 4RO0A 3RK3E 2MKVA 2O3JA 3G6EP 4N3YB 5B5EH 1ULIA 3AE6C 1PP9E 1VQMP 1CI6A 1M1JC 3W68A 3AE9C 2QEXP 1SFCC 1FE6A 2QM8A 1YBKA 1OZHA 2ZYGA 4QUPA 2H8PD 5GTIE 1NGMB 3CD6P 3FWNA 1JY3O 3VCPA 3CX5H 1ZRTE 2AXTH 1AQTA 2WSEH 3RK2D 3C0DA 3RBZA 1Q81Q 1RY3A 3RL0C 1FOSF 2KUBA 3SWYA 1JY2O 1FZCC 1LP1A 3L72D 4UB6E 2JDIH 4KT0J 3P8CE 1NDOA 2P7JA 1Y9BA 2BMOA 3RK3B 1EC5A 3S9OA 4KHXA 1QL1A 3RL0D 1QGKB 2QVAA 3GHGA 2NVFA 2K9JA 1EDKA 2IBZD 3NMDA 2E74D 5GTHH 1RIEA 3RK3D 1SVFA 4KJMA 5KAFH 1FOSE 2AXCA 2W90A 1AQ5A 3CCVP 1NTZJ 4H0LB 3I56P 2B9BA 2A45G 2KS1A 1CI6B 2O01H 2BMRA 3KYQA 5KLVD 5APXA 2W6AA 1BE3D 3L74D 3JCUH 2XSOA 4H13C 5BVZA 3GL2A 1H88A 4N78D 1KFNA 2KNCB 5AW4B 1JY2N 1VQLP 3VMID 3TDKA 1M90Q 2XDJA 1G1IA 2CPSA 1NTKJ 3TGUE 1N73B 2CKFA 1M7LA 1P84H 4HH2A 1LT1A 4EDFA 3USSA 1KQFB 1SQPK 2HLOA 1HJ0A 2W8ZA 4D6TG 2K9YA 1SQQJ 2RKLA 1S72P 4W7YA 5AVXB 3GKEA 4CPGA 2FFDC 3EQ2A 3AE1C 2HR3A 5DJTB 4P1BH 3GTSA 3PLNA 1HWTC 1LJ2A 3GHGB 1L4AB 1VM9A 5KLVJ 1NTKG 3N4XA 1L0LD 3VMAA 2W27A 1NJIQ 2O01J 1NKZB 2OTLP 1NAFA 1QX8A 3HD7D 3TYYA 1YQ3C 1RF0C 4AAYB 3VMGD 3JSVC 1OMIA 4OGQD 3GCEA 1P84D 1QEXA 2QJKB 5HL4A 5B66H 1KYOI 5CCGA 4PJ0E 1NAYA 1PGPA 1RQUA 1SQBD 2FYUJ 1YJWP 1K05A 4NBBD 2BEQD 2K3RA 5K5GB 2GBXA 1U57A 4C7RA 4GODA 1OFCX 1PGJA 1ZR4A 2E76D 2M8RA 4AQRD 1FZEA 1JTHB 3FXEA 4PV1D 1T6AA 1GDTA 5CCHD 1GL2D 1N2DC 3KZIE 3JCUE 3V2NA 4HM6A 3CX5I 4D6TD 2R32A 3BVHA 2OQQA 3O6QB 1LWUB 4HM2A 5E79E 1NTZD 4AYCA 2ITAA 3TNUA 4RESB 1N7SC 3GL0A 2I1JA 3AE2C 2E74B 2HMLA 1LGHB 3L73G 2YO3A 1NU1J 2M5AB 3L36A 1KB9H 5CCHA 4N6JA 3PP5A 1FZAA 3N7NA 4HM4A 2P1JA 1VF5D 3RK2B 2ZYLA 3CL3D 2B88A 4WVZA 5TISE 3E1RA 4QDDA 1GK4A 2KIKA 4HM5A 1NTKD 1IFPA 4GKGA 2RN0A 3RBXA 3Q2YA 2XV5A 3L73E 3R4YA 1RF0A 2QA4P 4WY4D 2PAJA 3L75G 3EFGA 2Q9IA 1WMKA 3V5BA 4EYYQ 3LW5H 2QJYB 3AE4C 1MUUA 1YYCA 5KJ7D 1ZXGA 2BASA 5AVZB 4P1CH 1NYHA 4PV1B 4HM1A 3V2PA 1GTWA 1DEEG 1Q90D 5EFWB 3DQYA 3OAKA 4UB8H 1L4AC 1CSBA 2OYOA 2FYZA 3AE7C 2E43A 4JYBA 2QSIA 1KILA 3GTEA 1URQC 3HD7B 2HMMA 1JMMA 3L74E 1OW7A 2HMJA 2HODB 1L0ND 3P8CD 1Q7YQ 3MGNA 1LTIC 2ZFCA 4XA4A 2NUKA 2W6BA 1VCKA 1RQVA 3VMXA 1FS0E 1JCCA 2E75D 3NFQA 1KQSO 4GDOA 1T2KC 1N73C 5KKZB
chains in the Genus database with same CATH topology
3CXHE 2QJYC 1UUWA 2BMRA 4HM5A 1KB9E 1SJGA 4OGQD 3H1IE 1O7HA 3GCEA 5KKZC 1P84E 2IBZE 4QDFA 2BMQA 2XSOA 4HM8A 2XR8A 1ULJA 3GL2A 4QUPA 5CXMA 3L73E 2YFJA 1SQXE 5HL4A 1O7PA 1RFSA 2NVGA 2XRXA 2B24A 3VCPA 1O7WA 3VMID 1SQQE 2DE5D 1NYKA 1ZRTE 4QURA 4NBCD 4NBDD 4QUQA 1KYOE 2JZAA 4NBGD 1SQVE 2XSHA 1G8JB 3C0DA 3N0QA 3H1KE 2B1XA 1EG9A 5AEWA 3TGUE 3GB4A 3L70E 2BCCE 1BGYE 2CKFA 1O7NA 4NBAD 4H13D 3EN1A 3VMHD 1O7GA 2NVEA 4NBBD 3AZCA 4NBFD 4NBHD 2YFIA 3L71E 4P1CH 4HM1A 4HM7A 2FYUE 4QCKA 3CX5E 4U3FE 2A06E 3L72E 1BCCE 2FYNC 2GBXA 2JO6A 1NDOA 3D89A 2I7FA 4H0LD 3GZXA 4HJLA 1FQTA 2BMOA 3EQQA 4NB9D 2E76D 2HMKA 1NTZE 1BE3E 5BOKA 3DQYA 1PPJE 4PV1D 4AIVA 3BCCE 3GZYA 3GKEA 4NBED 4HM6A 4H44D 2NUMA 2Q3WA 3GOBA 2YIUC 1NU1E 4D6TE 1UUVA 1Q90C 4HM2A 2DE7D 3GTEA 4P1BH 5KLVE 2HMMA 3GTSA 2QPZA 2NVFA 3L74E 2D2CD 2GBWA 3GL0A 1VM9A 2E74D 2ZT9D 2HMJA 1RIEA 4EMJB 2YFLA 2HMLA 3H1LE 4HM0A 1WQLA 4QDCA 1SQPE 3CWBE 2DE6D 2HMOA 5AEUA 1L0NE 1O7MA 1SQBE 1L0LE 3FOUA 2E4QA 2NUKA 2E4PA 1EZVE 4HM3A 4NB8D 1JM1A 3L75E 1VCKA 2NWFA 4HM4A 1NTKE 1VF5D 4HKVA 2ZYLA 1ULIA 4QDDA 3H1JE 5KLIC 1PP9E 1G8KB 2QJPC 2E75D 2QJKC 4QDFB 2HMNA 3VCAA 4PD4E 1NTME 3H1HE 2YVJB 4AAYB 3VMGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH E;  2QJY C;  1UUW A;  2BMR A;  4HM5 A;  1KB9 E;  1SJG A;  4OGQ D;  3H1I E;  1O7H A;  3GCE A;  5KKZ C;  1P84 E;  2IBZ E;  4QDF A;  2BMQ A;  2XSO A;  4HM8 A;  2XR8 A;  1ULJ A;  3GL2 A;  4QUP A;  5CXM A;  3L73 E;  2YFJ A;  1SQX E;  5HL4 A;  1O7P A;  1RFS A;  2NVG A;  2XRX A;  2B24 A;  3VCP A;  1O7W A;  3VMI D;  1SQQ E;  2DE5 D;  1NYK A;  1ZRT E;  4QUR A;  4NBC D;  4NBD D;  4QUQ A;  1KYO E;  2JZA A;  4NBG D;  1SQV E;  2XSH A;  1G8J B;  3C0D A;  3N0Q A;  3H1K E;  2B1X A;  1EG9 A;  5AEW A;  3TGU E;  3GB4 A;  3L70 E;  2BCC E;  1BGY E;  2CKF A;  1O7N A;  4NBA D;  4H13 D;  3EN1 A;  3VMH D;  1O7G A;  2NVE A;  4NBB D;  3AZC A;  4NBF D;  4NBH D;  2YFI A;  3L71 E;  4P1C H;  4HM1 A;  4HM7 A;  2FYU E;  4QCK A;  3CX5 E;  4U3F E;  2A06 E;  3L72 E;  1BCC E;  2FYN C;  2GBX A;  2JO6 A;  1NDO A;  3D89 A;  2I7F A;  4H0L D;  3GZX A;  4HJL A;  1FQT A;  2BMO A;  3EQQ A;  4NB9 D;  2E76 D;  2HMK A;  1NTZ E;  1BE3 E;  5BOK A;  3DQY A;  1PPJ E;  4PV1 D;  4AIV A;  3BCC E;  3GZY A;  3GKE A;  4NBE D;  4HM6 A;  4H44 D;  2NUM A;  2Q3W A;  3GOB A;  2YIU C;  1NU1 E;  4D6T E;  1UUV A;  1Q90 C;  4HM2 A;  2DE7 D;  3GTE A;  4P1B H;  5KLV E;  2HMM A;  3GTS A;  2QPZ A;  2NVF A;  3L74 E;  2D2C D;  2GBW A;  3GL0 A;  1VM9 A;  2E74 D;  2ZT9 D;  2HMJ A;  1RIE A;  4EMJ B;  2YFL A;  2HML A;  3H1L E;  4HM0 A;  1WQL A;  4QDC A;  1SQP E;  3CWB E;  2DE6 D;  2HMO A;  5AEU A;  1L0N E;  1O7M A;  1SQB E;  1L0L E;  3FOU A;  2E4Q A;  2NUK A;  2E4P A;  1EZV E;  4HM3 A;  4NB8 D;  1JM1 A;  3L75 E;  1VCK A;  2NWF A;  4HM4 A;  1NTK E;  1VF5 D;  4HKV A;  2ZYL A;  1ULI A;  4QDD A;  3H1J E;  5KLI C;  1PP9 E;  1G8K B;  2QJP C;  2E75 D;  2QJK C;  4QDF B;  2HMN A;  3VCA A;  4PD4 E;  1NTM E;  3H1H E;  2YVJ B;  4AAY B;  3VMG D; 
#chains in the Genus database with same CATH topology
 3CXH E;  2E76 B;  1YIT P;  1SFC B;  1VQP P;  1EQ7 A;  1P84 E;  1RH5 B;  3H1L D;  2GUV A;  1SQX E;  4TT3 H;  1UII A;  2WPQ A;  1EDL A;  1NVO A;  1R5S A;  2P10 A;  1KYO E;  4JPZ B;  1NOH A;  1G8J B;  1OW8 A;  3H1K E;  1YJN P;  4I6M C;  2POH A;  5APW A;  1BGY E;  4Y99 C;  1JM0 A;  1X79 B;  3JC2 2;  2N9Y B;  2JO1 A;  1PP9 D;  1S3J A;  3L71 E;  5AW0 B;  1URQ B;  2IZ0 A;  5B5E E;  3HUS C;  2A06 E;  2FYN C;  2YIU B;  1NTM D;  3H1H D;  3AEB C;  3C8V A;  1IC2 A;  1AJY A;  2OYI A;  3PTZ A;  5M1B A;  2FY8 A;  2AEM A;  2Z5I A;  2FXM A;  2N1T A;  2H88 C;  4NBE D;  1FJK A;  1SQB K;  1J1D C;  3L73 D;  3HE5 B;  4LGD E;  4JYC A;  5BU8 B;  2H7H A;  1E79 H;  4K3A A;  1PP9 J;  1SQP E;  3FX0 A;  2KXP B;  4AUW A;  1IFD A;  3OA7 A;  3U1A A;  1IK9 A;  4HM3 A;  1K73 Q;  2ZVN B;  1NTK E;  1S5L X;  3B5N A;  1MFZ A;  2O1J A;  1GL2 B;  3V4W A;  1VQK P;  1OX3 A;  2D2C C;  4Y99 B;  3RL0 B;  2FBW C;  2R5B A;  1AFO A;  2O1K A;  2NPS C;  1MFT A;  2IFM A;  1T3J A;  3M91 A;  1NKN A;  2BEZ F;  2KB7 P;  5C39 A;  1KD1 Q;  1M8O B;  1RHZ B;  3H1I J;  3H32 B;  1N7L A;  2FXO A;  1IZN B;  3F5H A;  1O7P A;  2PRR A;  1EZV G;  2XRX A;  3L70 G;  1ZR2 A;  1XTG B;  1SQQ E;  1DD4 A;  3Q5R A;  4K35 A;  2OYI B;  3V6I A;  1P84 I;  5KTB A;  4TLF A;  4U3F J;  2E76 C;  3KZI H;  1USE A;  3L35 A;  3A0H H;  1M56 D;  1Y47 A;  1N7S B;  4U7J A;  3AZC A;  2QJP B;  1FZC A;  2XZR A;  1J1E B;  4QCK A;  2H89 C;  2IDB A;  2FYU D;  5AVY B;  1BCC D;  1ZV8 A;  2KZJ A;  2N1T C;  1AVY A;  4ZNC A;  3CCQ P;  2BCC G;  3TSI A;  2Q3E A;  1VQ4 P;  1JO5 A;  1FAV A;  4DJG A;  3HUS A;  5E79 H;  2A45 I;  2YKP A;  3WMM 0;  1GW4 A;  5APQ A;  1FDM A;  1SFC A;  5AVR B;  4H44 C;  4EMJ B;  2KZI A;  1VF5 B;  3H1J J;  2DE6 D;  5CJ0 A;  3P8M C;  5CHX A;  3D71 A;  1EZV E;  2OGU A;  2LKM A;  2OYH A;  1IFJ A;  3AEE C;  1SFC D;  3BAT A;  4L76 A;  2QJK C;  1K9M Q;  2R3S A;  1FJP A;  3L72 J;  2N9B A;  3CPW O;  1S5L H;  1SJG A;  4U3F D;  5KJ7 C;  3VN0 A;  1OWA A;  3H25 A;  2R3C A;  5AW3 B;  3HE4 B;  2J59 M;  2NVG A;  4C46 A;  1GW3 A;  2IX7 C;  4GIF A;  5AVT B;  2B1X A;  2C9L Y;  1VF5 C;  1KTM A;  3L70 E;  4H13 D;  3GHG C;  2YNY A;  1MKM A;  3Q3D A;  2A45 H;  4NBF D;  5KLI B;  2CK3 H;  1KB9 D;  3O8Z A;  2VRS A;  2W6J H;  2I7F A;  2LXB A;  3VP8 A;  2Q5U A;  1RE4 C;  3W67 A;  3Q5P A;  3H1J D;  2G3A A;  3HTK B;  3TGU G;  3T97 A;  1FZF A;  2JJL A;  3TGU J;  5CBO A;  1U7M A;  1FZG A;  3A5T A;  3AEG C;  1BE3 J;  3BCC G;  1YTZ I;  2ZYD A;  2I1K A;  2RH0 A;  3MHV A;  3P7K A;  1OVV A;  1Z56 A;  1NTK K;  1VQ6 P;  4EIJ A;  4PD4 D;  1HBW A;  3CCJ P;  1SQB E;  2OYI C;  1L0L E;  3L75 D;  2WTY A;  4ASV A;  2JR8 A;  3RGU A;  4HKV A;  3M06 A;  5KLI C;  4OGQ B;  2NRG A;  3CCU P;  1GMJ A;  1A02 J;  2YXR B;  1EXJ A;  3WUU A;  1JUN A;  1AA0 A;  1KB9 E;  2QIW A;  3CC7 P;  1O7H A;  1KOR A;  4H0L C;  5GTH E;  1S2E A;  1ZOY C;  4IFM A;  5KLV K;  5H2F H;  1KYO H;  1OIP A;  1SQX K;  2IBZ I;  3N0Q A;  4N78 E;  5AEW A;  1WT6 A;  1N7S A;  3RL0 g;  3VMH D;  5TJH A;  3H6P A;  4BRY A;  4HM7 A;  3ABV C;  4H0L D;  5L8R J;  1T3U A;  1DH3 A;  2M3B A;  1J2J B;  2KLV A;  2Q3I A;  3L75 J;  3Q1M A;  5DJU B;  1EDI A;  1IFN A;  1HF9 A;  1ZW0 A;  1MV8 A;  1JNM A;  2FYN B;  2YIU C;  1YHQ P;  1R5L A;  3M9Q A;  1FU1 A;  2WT7 B;  2D2C D;  2FFD B;  2WWW A;  4W7Z A;  4DOJ A;  2ZT9 B;  3CX5 D;  4QDC A;  5CCG C;  5AEU A;  1K04 A;  1PL5 A;  3S1K A;  2GM4 A;  1JY2 P;  3WU2 E;  2FFD A;  2CPB A;  3L75 E;  1HUC A;  3CC4 P;  3E1I A;  2KSE A;  1J1E C;  3TK1 A;  3LW5 J;  2QJP C;  2B87 A;  3V4Q A;  2HMN A;  2WIT A;  1PGO A;  1USD A;  2Q1K A;  2KSJ A;  1YTZ T;  1OW6 A;  2WSC J;  2KOG A;  2V7Q H;  2KLU A;  5KKZ C;  4HB1 A;  4BRY B;  2PP6 A;  2KK7 A;  1LT9 A;  1LP1 B;  2YFJ A;  1M1J A;  4YPC A;  1YI2 P;  1ZRT D;  2KP8 A;  1SQV D;  2WQY C;  1URQ A;  2GUS A;  3H1I G;  3G9R A;  1K8A Q;  4UB6 H;  2IYO A;  3GF7 A;  1JMB A;  1EZV I;  3CLQ A;  5KLV G;  1DIP A;  3H1L J;  3PH0 A;  4MN4 C;  4HJL A;  3H1L G;  1KV4 A;  3CCR P;  2E75 C;  2Q7C A;  1Q2N A;  1L2P A;  2W83 C;  1SQP G;  3L4F A;  1JY3 N;  1L0L J;  1FBM A;  1L0L G;  3B5N D;  4RKU J;  3SFD C;  2IPP A;  2QPZ A;  3VP9 A;  1JY3 P;  1IFI A;  2M0B A;  1SS1 A;  2J58 A;  2O01 N;  1FZB A;  1H0T B;  3A7O A;  5APU A;  2E4Q A;  2E4P A;  2AEJ A;  1JM1 A;  1GU5 A;  2G8Y A;  4B86 A;  1URQ D;  1GD2 E;  1W2E A;  5KAF E;  1SQV J;  1FDO A;  5APV A;  1RE3 C;  2IZ1 A;  1BGY G;  3BRT B;  3L71 D;  5BU5 A;  2IBZ E;  1QL2 A;  4HYT B;  5AW9 B;  1BCC G;  4Y28 J;  5AW1 B;  1VQ8 P;  1RE3 A;  1LT9 B;  3LIE A;  1FC2 C;  1T2K D;  2KS1 B;  4QUQ A;  3EWK A;  4IL6 H;  1M1J B;  3SWF A;  3MIW A;  4HKZ H;  4NBA D;  2M3E A;  1VQN P;  3MZW B;  2NVE A;  1SLQ A;  1L0N J;  1NTZ G;  3L72 E;  4DZO A;  1Y8A A;  2L91 A;  5TIS H;  1SQQ G;  3KXD A;  2P2U A;  2Y0C A;  3VYI A;  1GL2 A;  3HD7 C;  1ZLL A;  4D6T E;  2WSF J;  1SQB G;  3L72 G;  3TNU B;  3ITK A;  1DEB A;  1RE4 A;  2HPC A;  2AEF A;  1NTM J;  3H1H J;  4OVN F;  3CWB D;  2YFL A;  4HM0 A;  1WQL A;  1SQX J;  3MUD C;  3VOP A;  1WRG A;  3CWB E;  1PPJ G;  3FOU A;  1IK7 A;  4WB4 A;  1KIL D;  5CJ4 A;  2I8D A;  5APT A;  3H32 A;  2WSE J;  4QMA A;  4YTP C;  3HTK A;  5CCG D;  1SQX G;  1G8K B;  3A0B E;  2KI7 B;  4UB8 E;  1G1J A;  3MD0 A;  2ZXX A;  1W2B O;  2IYP A;  3PJS K;  2QJY C;  4OWF A;  2YO2 A;  2L5G B;  3H1I E;  3NTN A;  2N1T D;  2Q6Q A;  2BCC J;  1HJB A;  4IL6 X;  1KQL A;  5AVQ B;  2B24 A;  4ZKU A;  5AVW B;  5CCH C;  3NXS A;  4NBG D;  4JQ0 D;  2FXP A;  2QRX A;  3L73 J;  1MZ9 A;  2JEE A;  1KIL E;  4H44 B;  1YJ9 P;  1KQG B;  3CMA P;  3L70 J;  4OGQ C;  2HPC B;  3RK2 C;  3H1K J;  1BCC E;  1EXI A;  3VMZ A;  2MJZ A;  2WSC H;  2ZXE B;  3I5C A;  5CMZ A;  2BCC D;  2Y9Z A;  1PFI A;  2WPV B;  1SP4 A;  4AIV A;  1BDC A;  2N1T B;  4I7Z B;  1FDI A;  1KZU B;  2OYH B;  2B89 A;  4WY4 B;  1BCC J;  2A06 D;  3L71 J;  3KQG A;  3IFM A;  1BGY J;  1HTL C;  2NZ2 A;  2HYN A;  3B5N B;  2J5U A;  3AEC C;  1M1K Q;  2NWF A;  4JF7 A;  4EOT A;  1KC8 Q;  3M9B A;  3OW2 O;  4QDF B;  3CCE P;  3TGU D;  4H13 B;  1NTM E;  3H1H E;  2YVJ B;  1S5L E;  1VL2 A;  3D70 A;  4EI2 A;  3K5B A;  1L0L K;  3IAO A;  2Y9Y A;  1LTB C;  2XND H;  1X9V A;  4NPE A;  5AW8 B;  2PFX A;  3MTU E;  2WZ7 A;  1S9K D;  3HE4 A;  3GB4 A;  2JWA A;  1RF1 C;  1NH4 A;  1O7N A;  2R44 A;  1OXZ A;  1NHL A;  1GU4 A;  1J1D B;  1L4A A;  2WMM A;  3SFE C;  2JO6 A;  1SQV K;  3KHU A;  5GTI H;  3UIA A;  4NB9 D;  3AE8 C;  2XNX A;  1PPJ E;  3RK3 C;  3CWB G;  3HE5 A;  3GZY A;  1LTS C;  3B8E B;  4H44 D;  4YXD C;  3CXH H;  3AE3 C;  3T97 B;  2ZVO B;  3FXD A;  1N73 A;  1CZQ A;  3HUS B;  3VMY A;  3CME P;  2JP3 A;  1JOC A;  1EDJ A;  4XFJ A;  1A02 F;  5AW6 B;  2HMO A;  2B87 B;  1KN7 A;  2LR2 A;  5CBN A;  3QH9 A;  2WPS A;  1L0N K;  1SQP J;  3H1I D;  4RJT A;  1JCD A;  3VCA A;  2K9J B;  1SQQ K;  2PGD A;  1AVO A;  4L75 A;  4ZKP A;  3I55 P;  1EZV D;  2P58 A;  3CCL P;  3M0D C;  4QDF A;  3WUV A;  4HM8 A;  1S4X A;  3B71 A;  3IN6 A;  1QVG O;  2XR8 A;  4BXL A;  3GLM A;  3L71 G;  5AVS B;  5CXM A;  2ZJS E;  3D6Z A;  2HG5 D;  4R4M A;  2QM7 A;  2C0X A;  1X8Y A;  2DE5 D;  1NYK A;  3M0D A;  1VQ7 P;  4NBC D;  4NBD D;  1AV1 A;  1CW5 A;  4U3F G;  1ZME C;  2XSH A;  5AVU B;  2NPS B;  4ASW A;  1OVR A;  3SWK A;  1EG9 A;  1LTA C;  1VDF A;  5KAI H;  2ZT9 C;  3Q5S A;  2D2C B;  3KPE A;  1O7G A;  2FYU E;  1KMI Z;  2JWD A;  3S4R A;  4C7N B;  1JTH A;  2WT7 A;  2GA1 A;  1NTZ E;  2E42 A;  4JBZ A;  1SQV G;  4YXW H;  4ZMD A;  3HRN A;  3GOB A;  3V2R A;  1U7J A;  3A3Y B;  1GZL A;  1S9K E;  1W5C E;  1NU1 E;  1UUV A;  3IF4 A;  4PV1 C;  3MUD A;  2A06 G;  2WVR A;  1ZN5 A;  2GBW A;  1RF1 B;  1X0T A;  4DT0 A;  2QE7 H;  1L0N E;  3HD7 A;  5AW7 B;  4IFF A;  2FKW B;  1N7S D;  4NB8 D;  1PPJ D;  1G2C A;  3E7K A;  3CWB J;  3C9I A;  1DX7 A;  3A0B H;  2Y0D A;  3L74 J;  1H0T A;  2C0W A;  4PJ0 H;  1RF1 A;  3VTP C;  4DCK A;  1SQX D;  1UUW A;  3M0A A;  1L0N G;  2YMK A;  2RMZ A;  4NPD A;  1IO4 A;  3TF5 A;  1DD3 A;  4WWI A;  1ULJ A;  3AED C;  2WPR A;  2UWJ E;  4LC1 A;  1E5W A;  1PZQ A;  3BRV B;  1XTC C;  1BDD A;  2K37 A;  3B5N C;  1YQ4 C;  1S1C X;  4R4L A;  1SQV E;  1NU1 K;  2XKM A;  2E74 C;  3EN1 A;  1HGV A;  3PHL A;  4NBH D;  3LID A;  1PGQ A;  3BCC D;  2OTK E;  2HOD A;  1LWU C;  2WSF H;  3A0H E;  3D89 A;  3PRJ A;  5B66 E;  2C9N Y;  4I7Z C;  1YIJ P;  3QWO C;  1VQO P;  2HMK A;  3G3Z A;  3MP7 B;  4PD4 I;  1LNQ A;  3H1K G;  4GT1 A;  2P67 A;  2K1A A;  2IFN A;  3O6Q A;  1OVU A;  2NUM A;  1KIL B;  1LTG C;  2OTJ P;  1Q90 C;  1JB0 J;  5KLV E;  2YMY A;  3GMA A;  1UIX A;  1N86 A;  1TU3 F;  4W80 A;  2SPZ A;  3H1L E;  1O7M A;  1VQ5 P;  3CXH D;  3GF3 A;  2H43 A;  4IFD K;  1ZP0 C;  5AW5 B;  4NPF X;  3AEA C;  2E5Y A;  1GK6 A;  1LTJ B;  4PD4 E;  1KB9 I;  3L74 G;  3U1C A;  2HFE D;  3GW6 A;  1Q86 Q;  4WY4 A;  4A7P A;  3OJA B;  2BMQ A;  1VPC A;  3BAS A;  3II6 A;  2ZAE B;  2NPS A;  4WBA A;  1Q82 Q;  2Y0E A;  1N8R Q;  2V7Q J;  1HH0 A;  2JZA A;  1NTM G;  3H1H G;  3WUT A;  1X22 A;  5AW2 B;  1PP9 G;  1NO4 A;  2YKQ A;  4GOE A;  4PD4 H;  3A2A A;  3WU2 H;  4L74 A;  2WSS H;  4GOF A;  4C7N A;  2K88 A;  1BSN A;  3CX5 E;  1NTZ K;  1NU1 G;  3V2Q A;  1KIL C;  3L70 D;  2JKV A;  1FQT A;  3L37 A;  1LWU A;  5BOK A;  1QVF O;  1IFM A;  2V4H A;  1G2C B;  4I1L A;  2R5D A;  1R8E A;  4WY4 C;  2FYU G;  2AXT E;  3G71 P;  3IR9 A;  2OYH C;  3AEF C;  2KYV A;  4IOI H;  2E5T A;  4I2L C;  1BSH A;  1SQP D;  3H1K D;  1M57 D;  1KYO D;  1H8A A;  2IBZ G;  2Z4E A;  2YXQ B;  3M9H A;  1LT9 C;  3H1J E;  2XU6 A;  4OH8 B;  3AE5 C;  2M5A A;  3D6Y A;  2ZYA A;  1L4A D;  4LLH A;  3GG2 A;  3ZDM A;  3CCS P;  1LTJ A;  4L73 A;  1PIX A;  1LTT C;  1HVV A;  2Z5H A;  5KJ7 A;  3SSU A;  1H89 A;  3C1L A;  1VQ9 P;  2KNC A;  3FWL A;  1SQB J;  4Z1M H;  1BE3 G;  1GL2 C;  3BCC J;  1PV3 A;  2NPS D;  1JEK A;  1RFS A;  1BGY D;  3KDP B;  1HGZ A;  1O7W A;  4QUR A;  1NTM K;  2LXC B;  3R2P A;  3CCM P;  5KAI E;  3CI9 A;  3F89 A;  1QLE D;  2BCC E;  3G4S P;  3CC2 P;  1LTJ C;  4XE5 B;  2OAR A;  3U59 A;  2YFI A;  1IJD B;  4IL6 E;  1T8Z A;  3FGA D;  4M3L A;  4U3F E;  4BWN A;  1D7M A;  4O9B A;  3B4S A;  3GZX A;  1KFM A;  3EQQ A;  3CXH I;  1BE3 E;  3P32 A;  1NWQ A;  2DW3 A;  2E75 B;  3BCC E;  1SQQ D;  3EFF K;  5APS A;  1NU1 D;  2Q3W A;  5H2F E;  2QG4 A;  5APY A;  5AVV B;  2DE7 D;  1FZC B;  2ZT9 D;  3H1J G;  4HJG H;  2YKO A;  4D6T J;  2FYU K;  4RO0 A;  3RK3 E;  2MKV A;  2O3J A;  3G6E P;  4N3Y B;  5B5E H;  1ULI A;  3AE6 C;  1PP9 E;  1VQM P;  1CI6 A;  1M1J C;  3W68 A;  3AE9 C;  2QEX P;  1SFC C;  1FE6 A;  2QM8 A;  1YBK A;  1OZH A;  2ZYG A;  4QUP A;  2H8P D;  5GTI E;  1NGM B;  3CD6 P;  3FWN A;  1JY3 O;  3VCP A;  3CX5 H;  1ZRT E;  2AXT H;  1AQT A;  2WSE H;  3RK2 D;  3C0D A;  3RBZ A;  1Q81 Q;  1RY3 A;  3RL0 C;  1FOS F;  2KUB A;  3SWY A;  1JY2 O;  1FZC C;  1LP1 A;  3L72 D;  4UB6 E;  2JDI H;  4KT0 J;  3P8C E;  1NDO A;  2P7J A;  1Y9B A;  2BMO A;  3RK3 B;  1EC5 A;  3S9O A;  4KHX A;  1QL1 A;  3RL0 D;  1QGK B;  2QVA A;  3GHG A;  2NVF A;  2K9J A;  1EDK A;  2IBZ D;  3NMD A;  2E74 D;  5GTH H;  1RIE A;  3RK3 D;  1SVF A;  4KJM A;  5KAF H;  1FOS E;  2AXC A;  2W90 A;  1AQ5 A;  3CCV P;  1NTZ J;  4H0L B;  3I56 P;  2B9B A;  2A45 G;  2KS1 A;  1CI6 B;  2O01 H;  2BMR A;  3KYQ A;  5KLV D;  5APX A;  2W6A A;  1BE3 D;  3L74 D;  3JCU H;  2XSO A;  4H13 C;  5BVZ A;  3GL2 A;  1H88 A;  4N78 D;  1KFN A;  2KNC B;  5AW4 B;  1JY2 N;  1VQL P;  3VMI D;  3TDK A;  1M90 Q;  2XDJ A;  1G1I A;  2CPS A;  1NTK J;  3TGU E;  1N73 B;  2CKF A;  1M7L A;  1P84 H;  4HH2 A;  1LT1 A;  4EDF A;  3USS A;  1KQF B;  1SQP K;  2HLO A;  1HJ0 A;  2W8Z A;  4D6T G;  2K9Y A;  1SQQ J;  2RKL A;  1S72 P;  4W7Y A;  5AVX B;  3GKE A;  4CPG A;  2FFD C;  3EQ2 A;  3AE1 C;  2HR3 A;  5DJT B;  4P1B H;  3GTS A;  3PLN A;  1HWT C;  1LJ2 A;  3GHG B;  1L4A B;  1VM9 A;  5KLV J;  1NTK G;  3N4X A;  1L0L D;  3VMA A;  2W27 A;  1NJI Q;  2O01 J;  1NKZ B;  2OTL P;  1NAF A;  1QX8 A;  3HD7 D;  3TYY A;  1YQ3 C;  1RF0 C;  4AAY B;  3VMG D;  3JSV C;  1OMI A;  4OGQ D;  3GCE A;  1P84 D;  1QEX A;  2QJK B;  5HL4 A;  5B66 H;  1KYO I;  5CCG A;  4PJ0 E;  1NAY A;  1PGP A;  1RQU A;  1SQB D;  2FYU J;  1YJW P;  1K05 A;  4NBB D;  2BEQ D;  2K3R A;  5K5G B;  2GBX A;  1U57 A;  4C7R A;  4GOD A;  1OFC X;  1PGJ A;  1ZR4 A;  2E76 D;  2M8R A;  4AQR D;  1FZE A;  1JTH B;  3FXE A;  4PV1 D;  1T6A A;  1GDT A;  5CCH D;  1GL2 D;  1N2D C;  3KZI E;  3JCU E;  3V2N A;  4HM6 A;  3CX5 I;  4D6T D;  2R32 A;  3BVH A;  2OQQ A;  3O6Q B;  1LWU B;  4HM2 A;  5E79 E;  1NTZ D;  4AYC A;  2ITA A;  3TNU A;  4RES B;  1N7S C;  3GL0 A;  2I1J A;  3AE2 C;  2E74 B;  2HML A;  1LGH B;  3L73 G;  2YO3 A;  1NU1 J;  2M5A B;  3L36 A;  1KB9 H;  5CCH A;  4N6J A;  3PP5 A;  1FZA A;  3N7N A;  4HM4 A;  2P1J A;  1VF5 D;  3RK2 B;  2ZYL A;  3CL3 D;  2B88 A;  4WVZ A;  5TIS E;  3E1R A;  4QDD A;  1GK4 A;  2KIK A;  4HM5 A;  1NTK D;  1IFP A;  4GKG A;  2RN0 A;  3RBX A;  3Q2Y A;  2XV5 A;  3L73 E;  3R4Y A;  1RF0 A;  2QA4 P;  4WY4 D;  2PAJ A;  3L75 G;  3EFG A;  2Q9I A;  1WMK A;  3V5B A;  4EYY Q;  3LW5 H;  2QJY B;  3AE4 C;  1MUU A;  1YYC A;  5KJ7 D;  1ZXG A;  2BAS A;  5AVZ B;  4P1C H;  1NYH A;  4PV1 B;  4HM1 A;  3V2P A;  1GTW A;  1DEE G;  1Q90 D;  5EFW B;  3DQY A;  3OAK A;  4UB8 H;  1L4A C;  1CSB A;  2OYO A;  2FYZ A;  3AE7 C;  2E43 A;  4JYB A;  2QSI A;  1KIL A;  3GTE A;  1URQ C;  3HD7 B;  2HMM A;  1JMM A;  3L74 E;  1OW7 A;  2HMJ A;  2HOD B;  1L0N D;  3P8C D;  1Q7Y Q;  3MGN A;  1LTI C;  2ZFC A;  4XA4 A;  2NUK A;  2W6B A;  1VCK A;  1RQV A;  3VMX A;  1FS0 E;  1JCC A;  2E75 D;  3NFQ A;  1KQS O;  4GDO A;  1T2K C;  1N73 C;  5KKZ B; 
#chains in the Genus database with same CATH homology
 3CXH E;  2QJY C;  1UUW A;  2BMR A;  4HM5 A;  1KB9 E;  1SJG A;  4OGQ D;  3H1I E;  1O7H A;  3GCE A;  5KKZ C;  1P84 E;  2IBZ E;  4QDF A;  2BMQ A;  2XSO A;  4HM8 A;  2XR8 A;  1ULJ A;  3GL2 A;  4QUP A;  5CXM A;  3L73 E;  2YFJ A;  1SQX E;  5HL4 A;  1O7P A;  1RFS A;  2NVG A;  2XRX A;  2B24 A;  3VCP A;  1O7W A;  3VMI D;  1SQQ E;  2DE5 D;  1NYK A;  1ZRT E;  4QUR A;  4NBC D;  4NBD D;  4QUQ A;  1KYO E;  2JZA A;  4NBG D;  1SQV E;  2XSH A;  1G8J B;  3C0D A;  3N0Q A;  3H1K E;  2B1X A;  1EG9 A;  5AEW A;  3TGU E;  3GB4 A;  3L70 E;  2BCC E;  1BGY E;  2CKF A;  1O7N A;  4NBA D;  4H13 D;  3EN1 A;  3VMH D;  1O7G A;  2NVE A;  4NBB D;  3AZC A;  4NBF D;  4NBH D;  2YFI A;  3L71 E;  4P1C H;  4HM1 A;  4HM7 A;  2FYU E;  4QCK A;  3CX5 E;  4U3F E;  2A06 E;  3L72 E;  1BCC E;  2FYN C;  2GBX A;  2JO6 A;  1NDO A;  3D89 A;  2I7F A;  4H0L D;  3GZX A;  4HJL A;  1FQT A;  2BMO A;  3EQQ A;  4NB9 D;  2E76 D;  2HMK A;  1NTZ E;  1BE3 E;  5BOK A;  3DQY A;  1PPJ E;  4PV1 D;  4AIV A;  3BCC E;  3GZY A;  3GKE A;  4NBE D;  4HM6 A;  4H44 D;  2NUM A;  2Q3W A;  3GOB A;  2YIU C;  1NU1 E;  4D6T E;  1UUV A;  1Q90 C;  4HM2 A;  2DE7 D;  3GTE A;  4P1B H;  5KLV E;  2HMM A;  3GTS A;  2QPZ A;  2NVF A;  3L74 E;  2D2C D;  2GBW A;  3GL0 A;  1VM9 A;  2E74 D;  2ZT9 D;  2HMJ A;  1RIE A;  4EMJ B;  2YFL A;  2HML A;  3H1L E;  4HM0 A;  1WQL A;  4QDC A;  1SQP E;  3CWB E;  2DE6 D;  2HMO A;  5AEU A;  1L0N E;  1O7M A;  1SQB E;  1L0L E;  3FOU A;  2E4Q A;  2NUK A;  2E4P A;  1EZV E;  4HM3 A;  4NB8 D;  1JM1 A;  3L75 E;  1VCK A;  2NWF A;  4HM4 A;  1NTK E;  1VF5 D;  4HKV A;  2ZYL A;  1ULI A;  4QDD A;  3H1J E;  5KLI C;  1PP9 E;  1G8K B;  2QJP C;  2E75 D;  2QJK C;  4QDF B;  2HMN A;  3VCA A;  4PD4 E;  1NTM E;  3H1H E;  2YVJ B;  4AAY B;  3VMG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...