3L70E

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase
total genus 38
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l70E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l70E02
4HM8A 4QDCA 3VMID 2XRXA 1EZVE 1O7MA 2FYNC 2BMOA 3D89A 1SQXE 4QDFB 5AEUA 1SQVE 4HM2A 2E76D 4QCKA 2QPZA 2E75D 4NB9D 3VCPA 4PD4E 1BE3E 4NBFD 3L71E 4QUQA 1O7WA 2B1XA 1L0NE 5HL4A 2B24A 4NBBD 3CX5E 1PPJE 4D6TE 3L72E 2ZT9D 3CXHE 2FYUE 3GZYA 4H44D 4P1BH 3VMGD 1ZRTE 2Q3WA 3GL0A 2XSOA 3L73E 1SQPE 1SQBE 1SQQE 4HJLA 2JO6A 5KLIC 1O7PA 2NVFA 4HM0A 2GBXA 4HM3A 1NYKA 4AIVA 2XR8A 1WQLA 2ZYLA 3C0DA 3CWBE 4NBGD 4QDFA 1EG9A 4HM5A 2CKFA 2JZAA 2BCCE 3GL2A 2HMMA 5CXMA 2NVGA 1VF5D 3H1KE 3L70E 2BMQA 2YIUC 4NBAD 4QDDA 1BCCE 3N0QA 2HMOA 3FOUA 1RFSA 3L74E 3BCCE 5KLVE 3GB4A 4NBDD 4NB8D 1BGYE 4NBED 1JM1A 4NBHD 1NTZE 2DE5D 3EN1A 1NDOA 1G8KB 1G8JB 2E4QA 1P84E 2HMLA 2HMJA 4P1CH 5BOKA 1Q90C 1KB9E 3GTEA 4AAYB 4EMJB 2QJPC 3AZCA 2GBWA 1UUVA 2A06E 2I7FA 1UUWA 2NUKA 3GZXA 2E74D 1KYOE 1O7GA 4OGQD 2BMRA 5KKZC 1SJGA 3TGUE 3VCAA 2NVEA 2D2CD 3H1JE 1FQTA 2YFJA 1NTKE 3GKEA 2DE6D 1NTME 4U3FE 3EQQA 2YFIA 1ULIA 4NBCD 1VCKA 2NUMA 4H0LD 2XSHA 2YFLA 3GTSA 4HM1A 3GOBA 4HM6A 3L75E 2QJKC 2DE7D 2QJYC 3VMHD 2E4PA 4QUPA 1NU1E 1RIEA 5AEWA 3GCEA 4H13D 1O7HA 1PP9E 4PV1D 2HMKA 2NWFA 4QURA 2IBZE 3H1IE 1L0LE 3H1HE 2HMNA 4HM4A 1VM9A 4HM7A 3H1LE 2YVJB 3DQYA 1O7NA 4HKVA 1ULJA
chains in the Genus database with same CATH superfamily
1MZ9A 4ZMDA 1KZUB 2E75D 1PP9J 1GZLA 1LWUB 1SQPG 4W7ZA 1PPJD 1L0NK 2NPSD 4L74A 2JJLA 1YTZI 1ZRTE 3KDPB 3CCMP 1SQPE 3CMAP 4W7YA 1KQSO 3L71G 4AIVA 3VP9A 3TNUA 1T3UA 2IYPA 4QDFA 4HM5A 2K37A 1RE4C 1EDJA 3EQ2A 1DIPA 2KS1A 3IF4A 1K9MQ 4NB8D 2KZJA 4HJGH 4PV1B 1G8JB 5TISE 5AVYB 1U7MA 4C46A 1NHLA 2KNCB 2O01N 1GL2B 3GZXA 5APXA 1NTZG 3P8CE 3M0DC 1W2EA 1LWUC 3AEDC 1M1JB 1T2KC 2ZJSE 4C7NB 1PGPA 3R4YA 1GL2D 1EXJA 2JWDA 3K5BA 1NAYA 1OW6A 2XZRA 2QJKC 2OTLP 3JCUH 4N3YB 2QJYC 2Q5UA 3TGUD 1RF0A 1N7LA 1URQA 1L0LD 3A3YB 2AEFA 1NTMJ 1ZW0A 1HTLC 1SP4A 3S4RA 3NXSA 3H1IE 1GDTA 1BSNA 3BRVB 3DQYA 1O7NA 2HMLA 2CPSA 1LNQA 4TT3H 1ZR4A 5AEUA 1SQVE 2E76D 4NPEA 2QPZA 4PV1C 3B4SA 2LKMA 2OYIA 3MTUE 1OWAA 3KXDA 2B1XA 1SQBJ 2GM4A 1PPJE 4H44D 1SQPK 2XSOA 1VQ7P 2N1TD 3NTNA 2GBXA 2Q6QA 4WY4B 2RKLA 3M9BA 3H32B 2AXCA 4EDFA 2PAJA 5CXMA 5B66E 3L72D 4R4MA 3CXHD 3E1IA 4L76A 4NBAD 2KK7A 2HODB 3V4WA 1HGZA 3AE7C 1GTWA 3OW2O 1FE6A 4NBDD 3Q5RA 3C9IA 3CWBJ 1AFOA 1LTJB 1HUCA 1KB9E 3KPEA 4AUWA 3KZIH 4N6JA 4DJGA 2E43A 3L70D 2LXCB 3P7KA 3EWKA 4BRYA 3L74D 1XTGB 2GUVA 1EDIA 2FXOA 1KC8Q 2MKVA 2YKPA 1WMKA 2WQYC 3O6QB 3TGUG 5CJ4A 1CZQA 2L91A 5KAIH 1EDLA 4WY4C 3A0HH 3PLNA 3H1LD 1L0LE 1VM9A 2YVJB 1BDDA 3A5TA 3V2RA 3MD0A 1H0TA 1SQVK 3CCSP 1MUUA 2M0BA 2FYUD 1D7MA 1G2CA 1HJBA 4NBBD 1G1JA 1FOSE 2ZYGA 3CCEP 4KHXA 1VQLP 5AW8B 1K04A 2O01H 2RMZA 4GOEA 2P2UA 1LTGC 3L72G 2XNXA 3HE5B 4Y99B 3L73G 2HMMA 1SQBG 1IJDB 3C8VA 3A0BH 2V4HA 2WSCH 1RY3A 4AQRD 3I56P 1KORA 3RK2D 1GMJA 2A06D 3L70G 4UB6E 3HUSA 3HD7A 3ABVC 3F5HA 1M56D 3L74G 3H1KD 1ZN5A 1NTKJ 3T97B 3NMDA 4JYBA 3BCCD 5KLVD 3VCAA 2BEZF 3H1JE 1S5LE 2KB7P 1N73A 1LTSC 3CXHI 3O8ZA 3V5BA 4H0LD 4N78E 2XU6A 2YFLA 4Y28J 4EIJA 2OGUA 3GOBA 4HM6A 1DEEG 1KMIZ 1NAFA 2WTYA 4QMAA 1L0LK 3USSA 1J2JB 5BU5A 2HPCA 2IPPA 3H1LE 3RBXA 1PGOA 2KP8A 3B8EB 1LP1B 2FYUG 4QCKA 1NU1D 2QM7A 3AEGC 1U7JA 4UB8E 3CX5E 2K9JA 2FYUE 3VTPC 4OGQB 3S9OA 1VDFA 3RL0g 4C7RA 5AW6B 1BE3J 1KQGB 3CC7P 3GLMA 3FXEA 5AVZB 5GTIH 2N9BA 2G3AA 2NVGA 1OVRA 1Q7YQ 3AE1C 1YI2P 1R8EA 2E74B 2K9YA 4I7ZB 5AVSB 1Q82Q 2D2CB 3BRTB 3H1KG 4P1CH 1DX7A 1HBWA 1K8AQ 2GBWA 3BCCG 5KLVG 2A06E 1UUWA 4IOIH 2E74D 5AW9B 2H8PD 2P58A 2D2CD 3L75J 5CCHA 2FYNB 1AV1A 4NPDA 2OYHB 1VQ4P 3TNUB 3MUDC 4OGQC 3CMEP 3R2PA 3B5NC 3FWLA 3VMHD 2Q9IA 1BSHA 2FYZA 2Y0CA 1O7HA 2B87A 1ZXGA 3C1LA 1PGJA 1ZLLA 4JPZB 2FFDA 1Y47A 1EZVD 1LJ2A 1JMBA 1NU1G 1O7MA 4NB9D 2B88A 4R4LA 1KB9H 3LIEA 4KJMA 3GHGA 1SQPJ 2KLVA 1X22A 2HLOA 2JO1A 2WT7A 1UIXA 3E7KA 4P1BH 3U1CA 1FZGA 2E5TA 3SWKA 1OXZA 4HJLA 1ZMEC 2POHA 3P8MC 3KZIE 1L0NG 3E1RA 3L71J 3C0DA 3IR9A 1URQB 2CKFA 4W80A 1Y9BA 2J58A 2KYVA 1S72P 3QWOC 3A2AA 1VF5C 1LTAC 2OYIB 3HE4A 4PJ0E 2QJPC 2I7FA 5AW5B 2FXMA 5K5GB 4B86A 4GDOA 3RL0D 1N7SA 3IN6A 4TLFA 3II6A 4RKUJ 1NTZJ 1IFIA 1GU5A 2JDIH 1VCKA 2FXPA 3N7NA 4I1LA 1MV8A 2RH0A 2H88C 1S5LX 1MFZA 2LXBA 1YHQP 4WB4A 4U3FG 1VQOP 3M9QA 3VOPA 1RIEA 1EZVG 1URQC 1OW7A 2IDBA 4QURA 2O1KA 1M8OB 1EZVE 1VQ6P 2CK3H 4UB6H 4BRYB 1GK6A 3CCJP 4NBFD 1KILA 2OYIC 4BXLA 1FBMA 3TF5A 2W90A 4BWNA 1YYCA 1S5LH 1L4AA 2K3RA 1SQQE 2JO6A 1SQVD 4CPGA 2M3BA 2ZYLA 1EZVI 1U57A 2R3SA 1Q81Q 1PFIA 3FGAD 3FXDA 1M90Q 1BGYD 2YO2A 3N0QA 2HMOA 1NOHA 3L36A 1AA0A 2QJKB 2DE5D 1H0TB 2QJYB 3CL3D 5KTBA 3VMYA 1ZV8A 2PFXA 2QSIA 4GT1A 2NUKA 1G2CB 1FZBA 1JCCA 1LT9C 1SJGA 3G6EP 2QA4P 1YBKA 3GKEA 4UB8H 3CX5H 1VL2A 1IZNB 1GU4A 4IFMA 1KB9D 1SQXK 2W8ZA 3FX0A 4H13C 2NZ2A 4OH8B 3TGUJ 2YIUB 1FZAA 1PP9D 1GW4A 4QUPA 4PV1D 4IL6H 2WPRA 1CI6A 3H1HE 1S4XA 1VQPP 3CPWO 1EC5A 1WT6A 3HUSB 1IFJA 1FDOA 3HD7B 2KLUA 5GTIE 3D89A 3Q5SA 3H1IG 1LGHB 3AECC 4JF7A 3WUTA 1KQLA 4D6TE 3GZYA 3AE5C 1SQVG 3LW5J 1SQQK 2OARA 5GTHE 3CD6P 1IK7A 2BCCD 1AVOA 2IZ0A 1KN7A 1VQ9P 1PPJG 4YTPC 1HVVA 4IFDK 2HYNA 2YO3A 2WSEH 1BGYG 3L72J 1BCCD 3L73J 2HR3A 2FY8A 2YIUC 1OVUA 2HPCB 2O3JA 1BGYE 4GODA 1TU3F 2NRGA 1DH3A 1NDOA 1FJKA 2Y9YA 1MKMA 5APWA 1QX8A 2YKQA 2JR8A 2YMKA 2Y9ZA 1KYOD 4LGDE 3L70J 3N4XA 1HF9A 3HUSC 1OFCX 1EQ7A 3HD7C 3L74J 1NTMD 2YFJA 4WY4D 3WUVA 1SFCA 3TYYA 2XSHA 1N73C 2JWAA 1P84H 3BVHA 2DE7D 3EFFK 5CCGA 1LT9A 1VQNP 2OYOA 3H1JD 1HGVA 1PP9E 2ZXXA 3PRJA 1JOCA 1FU1A 2WSSH 2WWWA 4XA4A 4N78D 2BEQD 3KHUA 5APSA 1L0LG 2ZYDA 2E5YA 1KB9I 2FYUJ 3VYIA 4PJ0H 2Q3EA 2L5GB 3PJSK 2BCCG 4ZKPA 4OVNF 4HM0A 4LC1A 4L73A 2KZIA 2NPSA 1JNMA 2Y0EA 3MGNA 3G71P 4HKZH 2JZAA 2BCCE 3RK3B 3CX5D 2B87B 1BCCE 3W67A 1YQ4C 3D70A 3M9HA 4LLHA 1W5CE 4IFFA 3RBZA 5EFWB 3H1KJ 3AE9C 1VQ8P 1KYOE 3BCCJ 5KLVJ 2WT7B 5KLIB 1HWTC 1NTME 4NBCD 1DD4A 1AJYA 3MHVA 1IK9A 3NFQA 1L2PA 5AVUB 5CCHC 1AQTA 3GTSA 2AEMA 3H1JG 3VMXA 1GL2A 1R5SA 2E4PA 1QEXA 5AEWA 1KYOI 3KYQA 2KSJA 2IBZE 3RK3C 1QL2A 1M1JA 2KUBA 1ZOYC 4HM7A 4HKVA 2FFDC 1H89A 1NU1J 2BMOA 2H89C 1JY3N 3GG2A 1Q86Q 3CCVP 1N7SB 3H1LG 5KAFE 3GHGC 1Q2NA 2YXQB 2M5AA 1EDKA 1ZP0C 1IFNA 4I6MC 5KLIC 5C39A 1HH0A 2KXPB 3CWBE 3VMAA 1FJPA 1L0NJ 1YJNP 5B5EE 2ZXEB 2N1TA 5APTA 1OVVA 2ZVOB 3FOUA 1P84D 1NWQA 2E42A 2Q7CA 1J1EC 3CCLP 2R44A 3B5NB 1FZFA 3U1AA 4L75A 4EMJB 1RQVA 3Q1MA 1KILB 4IL6E 4OGQD 2BMRA 1GW3A 1NTMK 1N7SC 5APYA 3CX5I 2DE6D 2YFIA 2A06G 1EXIA 3MZWB 2WSFH 2ZT9B 1LTJA 5GTHH 2C9LY 1RF1A 3VP8A 2WVRA 4ZKUA 4U3FJ 1N8RQ 2O01J 1SVFA 3SFEC 2V7QH 3WU2E 2LR2A 2Z4EA 1J1DB 1SQXD 2XRXA 1BE3D 4QDFB 2Z5HA 2WSCJ 3VCPA 5M1BA 1LTIC 2O1JA 5AVVB 1KILC 2KS1B 1RH5B 2FBWC 3M0AA 1QVFO 1VF5B 2GA1A 1JTHA 1FZCA 1O7PA 4DT0A 2QJPB 4HM3A 3L35A 1JY2N 1L4AC 1EG9A 3MIWA 2ZT9C 3GL2A 1VF5D 3D6ZA 1CI6B 4QDDA 2W6JH 1SQQD 2P1JA 3GB4A 1H8AA 1P84E 1J1DC 3AEAC 4GOFA 3SWFA 4O9BA 2R5BA 3AZCA 2H7HA 2P10A 3HE5A 5KKZC 1FQTA 1JY3O 2I1KA 5AVRB 1Y8AA 4DZOA 2C0WA 1URQD 5BU8B 3WUUA 1P84I 1USEA 1VQKP 3D6YA 3KQGA 4DOJA 5KJ7D 1SQXG 1RE3A 1A02J 3CI9A 5APVA 1LT1A 1X0TA 3CC2P 3TSIA 2G8YA 5CJ0A 1SQXE 2YMYA 1QGKB 3L71D 1W2BO 3JC22 1QLED 3H1IJ 2WPSA 1BE3E 2FKWB 3H1HD 5HL4A 1SFCB 2W6BA 1KYOH 1M1KQ 3L37A 1SQVJ 5BVZA 1SLQA 2V7QJ 1S1CX 1NYKA 1FDIA 1LP1A 1WQLA 1LT9B 2VRSA 3G3ZA 1X79B 4D6TD 1BGYJ 1SQQG 4PD4H 2QIWA 1NTKK 3JSVC 3D71A 4YXDC 3H6PA 5CBOA 2IZ1A 4H13B 1CW5A 3V6IA 3OJAB 2IFNA 1Q90C 1YJ9P 1YIJP 3CC4P 3GW6A 3OA7A 1O7GA 1K05A 1S9KE 2I1JA 2E75B 5KAFH 1R5LA 1A02F 3Q3DA 1SFCC 2NPSB 4IL6X 3AE3C 1T2KD 3PH0A 4JYCA 5B5EH 5CCGC 2K1AA 2AXTE 2YKOA 2Y0DA 1JY2O 3L4FA 3V2PA 5H2FE 2WPQA 1CSBA 4GKGA 4QDCA 1LTBC 2OYHA 2XNDH 1X9VA 3H1HG 1L0LJ 3L71E 4QUQA 2A45H 2IFMA 2HG5D 1JM0A 3I55P 1PV3A 3I5CA 1Z56A 2M3EA 1MFTA 2ZAEB 3PP5A 4MN4C 2E75C 3UIAA 2BCCJ 1N86A 1JCDA 4YXWH 4D6TG 3FWNA 1BCCJ 2NPSC 1JO5A 2W83C 2KI7B 3G9RA 3PHLA 2PGDA 1N73B 5E79E 3HD7D 5L8RJ 3WU2H 1SS1A 1OW8A 1NTZE 5AW4B 3WMM0 2E4QA 2HMJA 3B71A 3GTEA 1AQ5A 3PTZA 1QVGO 2QG4A 2QVAA 1NVOA 1IFDA 2CPBA 2E76B 2NVEA 2M5AB 2UWJE 2WITA 1RHZB 3EQQA 5KJ7A 3S1KA 4XFJA 4HYTB 3G4SP 4H44B 5DJTB 2PP6A 1FZEA 5AVTB 2N1TB 2Q1KA 3H1JJ 2XV5A 2J59M 2MJZA 3GMAA 2KIKA 1GL2C 2KSEA 2K9JB 4WWIA 4ASVA 3P32A 2HMKA 2DW3A 2NWFA 2P7JA 3AE6C 2SPZA 3HRNA 3BATA 1M1JC 1ULJA 2WPVB 4PD4D 1PP9G 3HTKA 1PL5A 1PGQA 1T8ZA 4JQ0D 2IBZD 4HB1A 1O7WA 3H1LJ 3L73D 1FOSF 1SQBD 5APUA 3VMGD 1YITP 4U7JA 2E76C 3AEBC 1PIXA 4ASWA 1RF1B 2XR8A 1RE4A 4H44C 5TJHA 2N1TC 2BMQA 1KTMA 1AVYA 2PRRA 1KV4A 1RFSA 3V2QA 2KOGA 3QH9A 1E79H 1NTZK 4NBHD 3CCRP 3M06A 3CCUP 3CWBD 3SFDC 3VN0A 5BOKA 1BCCG 4AAYB 1GK4A 5CCHD 3M0DA 1K73Q 1LWUA 1OMIA 1NKZB 2WZ7A 3TGUE 1IO4A 2FFDB 4YPCA 1JTHB 2ZVNB 1FZCB 1PZQA 2C9NY 4M3LA 2WMMA 3RK3D 2M8RA 1NKNA 2IX7C 2ITAA 4DCKA 2W6AA 3V4QA 4NPFX 1IC2A 5CHXA 1LTJC 1NTMG 1RF1C 3GHGB 4RESB 2B9BA 2J5UA 3H25A 2Z5IA 4HM4A 5AVXB 3OAKA 2WSEJ 5AW1B 3MP7B 1JY3P 1KD1Q 2IBZG 2XDJA 2KNCA 4GIFA 3RK2B 4PD4E 1KFMA 2OQQA 1T6AA 2B24A 1J1EB 3L72E 1XTCC 3CXHE 2R3CA 4A7PA 3GL0A 3L73E 4C7NA 1SQBE 2QRXA 3EFGA 1M57D 1T3JA 4WVZA 3HE4B 1FZCC 4H0LB 1NGMB 1ZR2A 1YQ3C 3AEEC 4PD4I 3L70E 3AEFC 2YXRB 1JEKA 3L74E 3CWBG 2AXTH 5AW7B 1KFNA 2ZFCA 2IBZI 1JM1A 2YNYA 5H2FH 5APQA 1N7SD 2R5DA 1UUVA 4ZNCA 2OTKE 2I8DA 1NTKD 1QL1A 4Y99C 3RK2C 5CMZA 3IFMA 4JBZA 5CBNA 2A45G 2QE7H 3V2NA 2R32A 4OWFA 4HM1A 5TISH 4WY4A 1DEBA 3RK3E 3H32A 1S2EA 4H0LC 3TK1A 2W27A 3B5ND 3BASA 2HODA 1VQ5P 1SQXJ 1DD3A 1L4AB 1RE3C 1UIIA 5E79H 3RGUA 1OX3A 3AE4C 4HM8A 3VMID 1KILD 2HFED 1FS0E 1YTZT 1L0ND 1L4AD 3SSUA 2A45I 2B89A 1KQFB 1USDA 2ZT9D 2Q3WA 1SQBK 2QM8A 3JCUE 2IYOA 1JY2P 2BASA 2JEEA 3O6QA 5KKZB 4K35A 3H1KE 3LIDA 1SQQJ 3BCCE 5KLVE 2XKMA 3U59A 3EN1A 1S3JA 3IAOA 4RJTA 1NTKG 4U3FD 5B66H 1NTKE 1E5WA 4AYCA 2OTJP 1ULIA 3L75D 2NUMA 4WBAA 2E74C 4I7ZC 4EYYQ 2D2CC 1S9KD 3F89A 1NU1E 1JUNA 3GF3A 2GUSA 2FYUK 3AE8C 3Q5PA 2HMNA 3GF7A 1G1IA 3A7OA 1VPCA 5DJUB 5AW3B 4EOTA 1IFMA 3CCQP 3M91A 2FYNC 4HM2A 1JB0J 4K3AA 1KILE 2OYHC 3H1HJ 3T97A 1ZRTD 5AVWB 1L0NE 1SQPD 5AW0B 2Q3IA 3RL0B 1FAVA 2NVFA 1BE3G 2P67A 2RN0A 2H43A 1NYHA 1OZHA 5KAIE 4NBGD 3A0HE 2C0XA 4D6TJ 1VQMP 4I2LC 1YJWP 1Q90D 2WSFJ 3Q2YA 3TDKA 2AEJA 5KLVK 1RQUA 1N2DC 4EI2A 1HJ0A 1NO4A 4NBED 1JMMA 3ZDMA 1BDCA 1G8KB 3HTKB 1LTTC 3SWYA 3W68A 1SFCD 3P8CD 3LW5H 4RO0A 1RF0C 1FC2C 5AVQB 3L75G 4KT0J 2JKVA 1NTZD 5AW2B 3AE2C 4U3FE 4Z1MH 1H88A 5CCGD 1GD2E 1X8YA 3CXHH 3MUDA 5KJ7C 2N9YB 3B5NA 4XE5B 3L75E 3RL0C 1FDMA 1IFPA 1WRGA 1NU1K 3H1ID 3A0BE 2ZYAA 2QEXP 3GCEA 4H13D 3VMZA 2JP3A 2K88A 1NJIQ 4HH2A 3CLQA 3ITKA 1M7LA 1OIPA 1NH4A
chains in the Genus database with same CATH topology
4HM8A 4QDCA 3VMID 2XRXA 1EZVE 1O7MA 2FYNC 2BMOA 3D89A 1SQXE 4QDFB 5AEUA 1SQVE 4HM2A 2E76D 4QCKA 2QPZA 2E75D 4NB9D 3VCPA 4PD4E 1BE3E 4NBFD 3L71E 4QUQA 1O7WA 2B1XA 1L0NE 5HL4A 2B24A 4NBBD 3CX5E 1PPJE 4D6TE 3L72E 2ZT9D 3CXHE 2FYUE 3GZYA 4H44D 4P1BH 3VMGD 1ZRTE 2Q3WA 3GL0A 2XSOA 3L73E 1SQPE 1SQBE 1SQQE 4HJLA 2JO6A 5KLIC 1O7PA 2NVFA 4HM0A 2GBXA 4HM3A 1NYKA 4AIVA 2XR8A 1WQLA 2ZYLA 3C0DA 3CWBE 4NBGD 4QDFA 1EG9A 4HM5A 2CKFA 2JZAA 2BCCE 3GL2A 2HMMA 5CXMA 2NVGA 1VF5D 3H1KE 3L70E 2BMQA 2YIUC 4NBAD 4QDDA 1BCCE 3N0QA 2HMOA 3FOUA 1RFSA 3L74E 3BCCE 5KLVE 3GB4A 4NBDD 4NB8D 1BGYE 4NBED 1JM1A 4NBHD 1NTZE 2DE5D 3EN1A 1NDOA 1G8KB 1G8JB 2E4QA 1P84E 2HMLA 2HMJA 4P1CH 5BOKA 1Q90C 1KB9E 3GTEA 4AAYB 4EMJB 2QJPC 3AZCA 2GBWA 1UUVA 2A06E 2I7FA 1UUWA 2NUKA 3GZXA 2E74D 1KYOE 1O7GA 4OGQD 2BMRA 5KKZC 1SJGA 3TGUE 3VCAA 2NVEA 2D2CD 3H1JE 1FQTA 2YFJA 1NTKE 3GKEA 2DE6D 1NTME 4U3FE 3EQQA 2YFIA 1ULIA 4NBCD 1VCKA 2NUMA 4H0LD 2XSHA 2YFLA 3GTSA 4HM1A 3GOBA 4HM6A 3L75E 2QJKC 2DE7D 2QJYC 3VMHD 2E4PA 4QUPA 1NU1E 1RIEA 5AEWA 3GCEA 4H13D 1O7HA 1PP9E 4PV1D 2HMKA 2NWFA 4QURA 2IBZE 3H1IE 1L0LE 3H1HE 2HMNA 4HM4A 1VM9A 4HM7A 3H1LE 2YVJB 3DQYA 1O7NA 4HKVA 1ULJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM8 A;  4QDC A;  3VMI D;  2XRX A;  1EZV E;  1O7M A;  2FYN C;  2BMO A;  3D89 A;  1SQX E;  4QDF B;  5AEU A;  1SQV E;  4HM2 A;  2E76 D;  4QCK A;  2QPZ A;  2E75 D;  4NB9 D;  3VCP A;  4PD4 E;  1BE3 E;  4NBF D;  3L71 E;  4QUQ A;  1O7W A;  2B1X A;  1L0N E;  5HL4 A;  2B24 A;  4NBB D;  3CX5 E;  1PPJ E;  4D6T E;  3L72 E;  2ZT9 D;  3CXH E;  2FYU E;  3GZY A;  4H44 D;  4P1B H;  3VMG D;  1ZRT E;  2Q3W A;  3GL0 A;  2XSO A;  3L73 E;  1SQP E;  1SQB E;  1SQQ E;  4HJL A;  2JO6 A;  5KLI C;  1O7P A;  2NVF A;  4HM0 A;  2GBX A;  4HM3 A;  1NYK A;  4AIV A;  2XR8 A;  1WQL A;  2ZYL A;  3C0D A;  3CWB E;  4NBG D;  4QDF A;  1EG9 A;  4HM5 A;  2CKF A;  2JZA A;  2BCC E;  3GL2 A;  2HMM A;  5CXM A;  2NVG A;  1VF5 D;  3H1K E;  3L70 E;  2BMQ A;  2YIU C;  4NBA D;  4QDD A;  1BCC E;  3N0Q A;  2HMO A;  3FOU A;  1RFS A;  3L74 E;  3BCC E;  5KLV E;  3GB4 A;  4NBD D;  4NB8 D;  1BGY E;  4NBE D;  1JM1 A;  4NBH D;  1NTZ E;  2DE5 D;  3EN1 A;  1NDO A;  1G8K B;  1G8J B;  2E4Q A;  1P84 E;  2HML A;  2HMJ A;  4P1C H;  5BOK A;  1Q90 C;  1KB9 E;  3GTE A;  4AAY B;  4EMJ B;  2QJP C;  3AZC A;  2GBW A;  1UUV A;  2A06 E;  2I7F A;  1UUW A;  2NUK A;  3GZX A;  2E74 D;  1KYO E;  1O7G A;  4OGQ D;  2BMR A;  5KKZ C;  1SJG A;  3TGU E;  3VCA A;  2NVE A;  2D2C D;  3H1J E;  1FQT A;  2YFJ A;  1NTK E;  3GKE A;  2DE6 D;  1NTM E;  4U3F E;  3EQQ A;  2YFI A;  1ULI A;  4NBC D;  1VCK A;  2NUM A;  4H0L D;  2XSH A;  2YFL A;  3GTS A;  4HM1 A;  3GOB A;  4HM6 A;  3L75 E;  2QJK C;  2DE7 D;  2QJY C;  3VMH D;  2E4P A;  4QUP A;  1NU1 E;  1RIE A;  5AEW A;  3GCE A;  4H13 D;  1O7H A;  1PP9 E;  4PV1 D;  2HMK A;  2NWF A;  4QUR A;  2IBZ E;  3H1I E;  1L0L E;  3H1H E;  2HMN A;  4HM4 A;  1VM9 A;  4HM7 A;  3H1L E;  2YVJ B;  3DQY A;  1O7N A;  4HKV A;  1ULJ A; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  4ZMD A;  1KZU B;  2E75 D;  1PP9 J;  1GZL A;  1LWU B;  1SQP G;  4W7Z A;  1PPJ D;  1L0N K;  2NPS D;  4L74 A;  2JJL A;  1YTZ I;  1ZRT E;  3KDP B;  3CCM P;  1SQP E;  3CMA P;  4W7Y A;  1KQS O;  3L71 G;  4AIV A;  3VP9 A;  3TNU A;  1T3U A;  2IYP A;  4QDF A;  4HM5 A;  2K37 A;  1RE4 C;  1EDJ A;  3EQ2 A;  1DIP A;  2KS1 A;  3IF4 A;  1K9M Q;  4NB8 D;  2KZJ A;  4HJG H;  4PV1 B;  1G8J B;  5TIS E;  5AVY B;  1U7M A;  4C46 A;  1NHL A;  2KNC B;  2O01 N;  1GL2 B;  3GZX A;  5APX A;  1NTZ G;  3P8C E;  3M0D C;  1W2E A;  1LWU C;  3AED C;  1M1J B;  1T2K C;  2ZJS E;  4C7N B;  1PGP A;  3R4Y A;  1GL2 D;  1EXJ A;  2JWD A;  3K5B A;  1NAY A;  1OW6 A;  2XZR A;  2QJK C;  2OTL P;  3JCU H;  4N3Y B;  2QJY C;  2Q5U A;  3TGU D;  1RF0 A;  1N7L A;  1URQ A;  1L0L D;  3A3Y B;  2AEF A;  1NTM J;  1ZW0 A;  1HTL C;  1SP4 A;  3S4R A;  3NXS A;  3H1I E;  1GDT A;  1BSN A;  3BRV B;  3DQY A;  1O7N A;  2HML A;  2CPS A;  1LNQ A;  4TT3 H;  1ZR4 A;  5AEU A;  1SQV E;  2E76 D;  4NPE A;  2QPZ A;  4PV1 C;  3B4S A;  2LKM A;  2OYI A;  3MTU E;  1OWA A;  3KXD A;  2B1X A;  1SQB J;  2GM4 A;  1PPJ E;  4H44 D;  1SQP K;  2XSO A;  1VQ7 P;  2N1T D;  3NTN A;  2GBX A;  2Q6Q A;  4WY4 B;  2RKL A;  3M9B A;  3H32 B;  2AXC A;  4EDF A;  2PAJ A;  5CXM A;  5B66 E;  3L72 D;  4R4M A;  3CXH D;  3E1I A;  4L76 A;  4NBA D;  2KK7 A;  2HOD B;  3V4W A;  1HGZ A;  3AE7 C;  1GTW A;  3OW2 O;  1FE6 A;  4NBD D;  3Q5R A;  3C9I A;  3CWB J;  1AFO A;  1LTJ B;  1HUC A;  1KB9 E;  3KPE A;  4AUW A;  3KZI H;  4N6J A;  4DJG A;  2E43 A;  3L70 D;  2LXC B;  3P7K A;  3EWK A;  4BRY A;  3L74 D;  1XTG B;  2GUV A;  1EDI A;  2FXO A;  1KC8 Q;  2MKV A;  2YKP A;  1WMK A;  2WQY C;  3O6Q B;  3TGU G;  5CJ4 A;  1CZQ A;  2L91 A;  5KAI H;  1EDL A;  4WY4 C;  3A0H H;  3PLN A;  3H1L D;  1L0L E;  1VM9 A;  2YVJ B;  1BDD A;  3A5T A;  3V2R A;  3MD0 A;  1H0T A;  1SQV K;  3CCS P;  1MUU A;  2M0B A;  2FYU D;  1D7M A;  1G2C A;  1HJB A;  4NBB D;  1G1J A;  1FOS E;  2ZYG A;  3CCE P;  4KHX A;  1VQL P;  5AW8 B;  1K04 A;  2O01 H;  2RMZ A;  4GOE A;  2P2U A;  1LTG C;  3L72 G;  2XNX A;  3HE5 B;  4Y99 B;  3L73 G;  2HMM A;  1SQB G;  1IJD B;  3C8V A;  3A0B H;  2V4H A;  2WSC H;  1RY3 A;  4AQR D;  3I56 P;  1KOR A;  3RK2 D;  1GMJ A;  2A06 D;  3L70 G;  4UB6 E;  3HUS A;  3HD7 A;  3ABV C;  3F5H A;  1M56 D;  3L74 G;  3H1K D;  1ZN5 A;  1NTK J;  3T97 B;  3NMD A;  4JYB A;  3BCC D;  5KLV D;  3VCA A;  2BEZ F;  3H1J E;  1S5L E;  2KB7 P;  1N73 A;  1LTS C;  3CXH I;  3O8Z A;  3V5B A;  4H0L D;  4N78 E;  2XU6 A;  2YFL A;  4Y28 J;  4EIJ A;  2OGU A;  3GOB A;  4HM6 A;  1DEE G;  1KMI Z;  1NAF A;  2WTY A;  4QMA A;  1L0L K;  3USS A;  1J2J B;  5BU5 A;  2HPC A;  2IPP A;  3H1L E;  3RBX A;  1PGO A;  2KP8 A;  3B8E B;  1LP1 B;  2FYU G;  4QCK A;  1NU1 D;  2QM7 A;  3AEG C;  1U7J A;  4UB8 E;  3CX5 E;  2K9J A;  2FYU E;  3VTP C;  4OGQ B;  3S9O A;  1VDF A;  3RL0 g;  4C7R A;  5AW6 B;  1BE3 J;  1KQG B;  3CC7 P;  3GLM A;  3FXE A;  5AVZ B;  5GTI H;  2N9B A;  2G3A A;  2NVG A;  1OVR A;  1Q7Y Q;  3AE1 C;  1YI2 P;  1R8E A;  2E74 B;  2K9Y A;  4I7Z B;  5AVS B;  1Q82 Q;  2D2C B;  3BRT B;  3H1K G;  4P1C H;  1DX7 A;  1HBW A;  1K8A Q;  2GBW A;  3BCC G;  5KLV G;  2A06 E;  1UUW A;  4IOI H;  2E74 D;  5AW9 B;  2H8P D;  2P58 A;  2D2C D;  3L75 J;  5CCH A;  2FYN B;  1AV1 A;  4NPD A;  2OYH B;  1VQ4 P;  3TNU B;  3MUD C;  4OGQ C;  3CME P;  3R2P A;  3B5N C;  3FWL A;  3VMH D;  2Q9I A;  1BSH A;  2FYZ A;  2Y0C A;  1O7H A;  2B87 A;  1ZXG A;  3C1L A;  1PGJ A;  1ZLL A;  4JPZ B;  2FFD A;  1Y47 A;  1EZV D;  1LJ2 A;  1JMB A;  1NU1 G;  1O7M A;  4NB9 D;  2B88 A;  4R4L A;  1KB9 H;  3LIE A;  4KJM A;  3GHG A;  1SQP J;  2KLV A;  1X22 A;  2HLO A;  2JO1 A;  2WT7 A;  1UIX A;  3E7K A;  4P1B H;  3U1C A;  1FZG A;  2E5T A;  3SWK A;  1OXZ A;  4HJL A;  1ZME C;  2POH A;  3P8M C;  3KZI E;  1L0N G;  3E1R A;  3L71 J;  3C0D A;  3IR9 A;  1URQ B;  2CKF A;  4W80 A;  1Y9B A;  2J58 A;  2KYV A;  1S72 P;  3QWO C;  3A2A A;  1VF5 C;  1LTA C;  2OYI B;  3HE4 A;  4PJ0 E;  2QJP C;  2I7F A;  5AW5 B;  2FXM A;  5K5G B;  4B86 A;  4GDO A;  3RL0 D;  1N7S A;  3IN6 A;  4TLF A;  3II6 A;  4RKU J;  1NTZ J;  1IFI A;  1GU5 A;  2JDI H;  1VCK A;  2FXP A;  3N7N A;  4I1L A;  1MV8 A;  2RH0 A;  2H88 C;  1S5L X;  1MFZ A;  2LXB A;  1YHQ P;  4WB4 A;  4U3F G;  1VQO P;  3M9Q A;  3VOP A;  1RIE A;  1EZV G;  1URQ C;  1OW7 A;  2IDB A;  4QUR A;  2O1K A;  1M8O B;  1EZV E;  1VQ6 P;  2CK3 H;  4UB6 H;  4BRY B;  1GK6 A;  3CCJ P;  4NBF D;  1KIL A;  2OYI C;  4BXL A;  1FBM A;  3TF5 A;  2W90 A;  4BWN A;  1YYC A;  1S5L H;  1L4A A;  2K3R A;  1SQQ E;  2JO6 A;  1SQV D;  4CPG A;  2M3B A;  2ZYL A;  1EZV I;  1U57 A;  2R3S A;  1Q81 Q;  1PFI A;  3FGA D;  3FXD A;  1M90 Q;  1BGY D;  2YO2 A;  3N0Q A;  2HMO A;  1NOH A;  3L36 A;  1AA0 A;  2QJK B;  2DE5 D;  1H0T B;  2QJY B;  3CL3 D;  5KTB A;  3VMY A;  1ZV8 A;  2PFX A;  2QSI A;  4GT1 A;  2NUK A;  1G2C B;  1FZB A;  1JCC A;  1LT9 C;  1SJG A;  3G6E P;  2QA4 P;  1YBK A;  3GKE A;  4UB8 H;  3CX5 H;  1VL2 A;  1IZN B;  1GU4 A;  4IFM A;  1KB9 D;  1SQX K;  2W8Z A;  3FX0 A;  4H13 C;  2NZ2 A;  4OH8 B;  3TGU J;  2YIU B;  1FZA A;  1PP9 D;  1GW4 A;  4QUP A;  4PV1 D;  4IL6 H;  2WPR A;  1CI6 A;  3H1H E;  1S4X A;  1VQP P;  3CPW O;  1EC5 A;  1WT6 A;  3HUS B;  1IFJ A;  1FDO A;  3HD7 B;  2KLU A;  5GTI E;  3D89 A;  3Q5S A;  3H1I G;  1LGH B;  3AEC C;  4JF7 A;  3WUT A;  1KQL A;  4D6T E;  3GZY A;  3AE5 C;  1SQV G;  3LW5 J;  1SQQ K;  2OAR A;  5GTH E;  3CD6 P;  1IK7 A;  2BCC D;  1AVO A;  2IZ0 A;  1KN7 A;  1VQ9 P;  1PPJ G;  4YTP C;  1HVV A;  4IFD K;  2HYN A;  2YO3 A;  2WSE H;  1BGY G;  3L72 J;  1BCC D;  3L73 J;  2HR3 A;  2FY8 A;  2YIU C;  1OVU A;  2HPC B;  2O3J A;  1BGY E;  4GOD A;  1TU3 F;  2NRG A;  1DH3 A;  1NDO A;  1FJK A;  2Y9Y A;  1MKM A;  5APW A;  1QX8 A;  2YKQ A;  2JR8 A;  2YMK A;  2Y9Z A;  1KYO D;  4LGD E;  3L70 J;  3N4X A;  1HF9 A;  3HUS C;  1OFC X;  1EQ7 A;  3HD7 C;  3L74 J;  1NTM D;  2YFJ A;  4WY4 D;  3WUV A;  1SFC A;  3TYY A;  2XSH A;  1N73 C;  2JWA A;  1P84 H;  3BVH A;  2DE7 D;  3EFF K;  5CCG A;  1LT9 A;  1VQN P;  2OYO A;  3H1J D;  1HGV A;  1PP9 E;  2ZXX A;  3PRJ A;  1JOC A;  1FU1 A;  2WSS H;  2WWW A;  4XA4 A;  4N78 D;  2BEQ D;  3KHU A;  5APS A;  1L0L G;  2ZYD A;  2E5Y A;  1KB9 I;  2FYU J;  3VYI A;  4PJ0 H;  2Q3E A;  2L5G B;  3PJS K;  2BCC G;  4ZKP A;  4OVN F;  4HM0 A;  4LC1 A;  4L73 A;  2KZI A;  2NPS A;  1JNM A;  2Y0E A;  3MGN A;  3G71 P;  4HKZ H;  2JZA A;  2BCC E;  3RK3 B;  3CX5 D;  2B87 B;  1BCC E;  3W67 A;  1YQ4 C;  3D70 A;  3M9H A;  4LLH A;  1W5C E;  4IFF A;  3RBZ A;  5EFW B;  3H1K J;  3AE9 C;  1VQ8 P;  1KYO E;  3BCC J;  5KLV J;  2WT7 B;  5KLI B;  1HWT C;  1NTM E;  4NBC D;  1DD4 A;  1AJY A;  3MHV A;  1IK9 A;  3NFQ A;  1L2P A;  5AVU B;  5CCH C;  1AQT A;  3GTS A;  2AEM A;  3H1J G;  3VMX A;  1GL2 A;  1R5S A;  2E4P A;  1QEX A;  5AEW A;  1KYO I;  3KYQ A;  2KSJ A;  2IBZ E;  3RK3 C;  1QL2 A;  1M1J A;  2KUB A;  1ZOY C;  4HM7 A;  4HKV A;  2FFD C;  1H89 A;  1NU1 J;  2BMO A;  2H89 C;  1JY3 N;  3GG2 A;  1Q86 Q;  3CCV P;  1N7S B;  3H1L G;  5KAF E;  3GHG C;  1Q2N A;  2YXQ B;  2M5A A;  1EDK A;  1ZP0 C;  1IFN A;  4I6M C;  5KLI C;  5C39 A;  1HH0 A;  2KXP B;  3CWB E;  3VMA A;  1FJP A;  1L0N J;  1YJN P;  5B5E E;  2ZXE B;  2N1T A;  5APT A;  1OVV A;  2ZVO B;  3FOU A;  1P84 D;  1NWQ A;  2E42 A;  2Q7C A;  1J1E C;  3CCL P;  2R44 A;  3B5N B;  1FZF A;  3U1A A;  4L75 A;  4EMJ B;  1RQV A;  3Q1M A;  1KIL B;  4IL6 E;  4OGQ D;  2BMR A;  1GW3 A;  1NTM K;  1N7S C;  5APY A;  3CX5 I;  2DE6 D;  2YFI A;  2A06 G;  1EXI A;  3MZW B;  2WSF H;  2ZT9 B;  1LTJ A;  5GTH H;  2C9L Y;  1RF1 A;  3VP8 A;  2WVR A;  4ZKU A;  4U3F J;  1N8R Q;  2O01 J;  1SVF A;  3SFE C;  2V7Q H;  3WU2 E;  2LR2 A;  2Z4E A;  1J1D B;  1SQX D;  2XRX A;  1BE3 D;  4QDF B;  2Z5H A;  2WSC J;  3VCP A;  5M1B A;  1LTI C;  2O1J A;  5AVV B;  1KIL C;  2KS1 B;  1RH5 B;  2FBW C;  3M0A A;  1QVF O;  1VF5 B;  2GA1 A;  1JTH A;  1FZC A;  1O7P A;  4DT0 A;  2QJP B;  4HM3 A;  3L35 A;  1JY2 N;  1L4A C;  1EG9 A;  3MIW A;  2ZT9 C;  3GL2 A;  1VF5 D;  3D6Z A;  1CI6 B;  4QDD A;  2W6J H;  1SQQ D;  2P1J A;  3GB4 A;  1H8A A;  1P84 E;  1J1D C;  3AEA C;  4GOF A;  3SWF A;  4O9B A;  2R5B A;  3AZC A;  2H7H A;  2P10 A;  3HE5 A;  5KKZ C;  1FQT A;  1JY3 O;  2I1K A;  5AVR B;  1Y8A A;  4DZO A;  2C0W A;  1URQ D;  5BU8 B;  3WUU A;  1P84 I;  1USE A;  1VQK P;  3D6Y A;  3KQG A;  4DOJ A;  5KJ7 D;  1SQX G;  1RE3 A;  1A02 J;  3CI9 A;  5APV A;  1LT1 A;  1X0T A;  3CC2 P;  3TSI A;  2G8Y A;  5CJ0 A;  1SQX E;  2YMY A;  1QGK B;  3L71 D;  1W2B O;  3JC2 2;  1QLE D;  3H1I J;  2WPS A;  1BE3 E;  2FKW B;  3H1H D;  5HL4 A;  1SFC B;  2W6B A;  1KYO H;  1M1K Q;  3L37 A;  1SQV J;  5BVZ A;  1SLQ A;  2V7Q J;  1S1C X;  1NYK A;  1FDI A;  1LP1 A;  1WQL A;  1LT9 B;  2VRS A;  3G3Z A;  1X79 B;  4D6T D;  1BGY J;  1SQQ G;  4PD4 H;  2QIW A;  1NTK K;  3JSV C;  3D71 A;  4YXD C;  3H6P A;  5CBO A;  2IZ1 A;  4H13 B;  1CW5 A;  3V6I A;  3OJA B;  2IFN A;  1Q90 C;  1YJ9 P;  1YIJ P;  3CC4 P;  3GW6 A;  3OA7 A;  1O7G A;  1K05 A;  1S9K E;  2I1J A;  2E75 B;  5KAF H;  1R5L A;  1A02 F;  3Q3D A;  1SFC C;  2NPS B;  4IL6 X;  3AE3 C;  1T2K D;  3PH0 A;  4JYC A;  5B5E H;  5CCG C;  2K1A A;  2AXT E;  2YKO A;  2Y0D A;  1JY2 O;  3L4F A;  3V2P A;  5H2F E;  2WPQ A;  1CSB A;  4GKG A;  4QDC A;  1LTB C;  2OYH A;  2XND H;  1X9V A;  3H1H G;  1L0L J;  3L71 E;  4QUQ A;  2A45 H;  2IFM A;  2HG5 D;  1JM0 A;  3I55 P;  1PV3 A;  3I5C A;  1Z56 A;  2M3E A;  1MFT A;  2ZAE B;  3PP5 A;  4MN4 C;  2E75 C;  3UIA A;  2BCC J;  1N86 A;  1JCD A;  4YXW H;  4D6T G;  3FWN A;  1BCC J;  2NPS C;  1JO5 A;  2W83 C;  2KI7 B;  3G9R A;  3PHL A;  2PGD A;  1N73 B;  5E79 E;  3HD7 D;  5L8R J;  3WU2 H;  1SS1 A;  1OW8 A;  1NTZ E;  5AW4 B;  3WMM 0;  2E4Q A;  2HMJ A;  3B71 A;  3GTE A;  1AQ5 A;  3PTZ A;  1QVG O;  2QG4 A;  2QVA A;  1NVO A;  1IFD A;  2CPB A;  2E76 B;  2NVE A;  2M5A B;  2UWJ E;  2WIT A;  1RHZ B;  3EQQ A;  5KJ7 A;  3S1K A;  4XFJ A;  4HYT B;  3G4S P;  4H44 B;  5DJT B;  2PP6 A;  1FZE A;  5AVT B;  2N1T B;  2Q1K A;  3H1J J;  2XV5 A;  2J59 M;  2MJZ A;  3GMA A;  2KIK A;  1GL2 C;  2KSE A;  2K9J B;  4WWI A;  4ASV A;  3P32 A;  2HMK A;  2DW3 A;  2NWF A;  2P7J A;  3AE6 C;  2SPZ A;  3HRN A;  3BAT A;  1M1J C;  1ULJ A;  2WPV B;  4PD4 D;  1PP9 G;  3HTK A;  1PL5 A;  1PGQ A;  1T8Z A;  4JQ0 D;  2IBZ D;  4HB1 A;  1O7W A;  3H1L J;  3L73 D;  1FOS F;  1SQB D;  5APU A;  3VMG D;  1YIT P;  4U7J A;  2E76 C;  3AEB C;  1PIX A;  4ASW A;  1RF1 B;  2XR8 A;  1RE4 A;  4H44 C;  5TJH A;  2N1T C;  2BMQ A;  1KTM A;  1AVY A;  2PRR A;  1KV4 A;  1RFS A;  3V2Q A;  2KOG A;  3QH9 A;  1E79 H;  1NTZ K;  4NBH D;  3CCR P;  3M06 A;  3CCU P;  3CWB D;  3SFD C;  3VN0 A;  5BOK A;  1BCC G;  4AAY B;  1GK4 A;  5CCH D;  3M0D A;  1K73 Q;  1LWU A;  1OMI A;  1NKZ B;  2WZ7 A;  3TGU E;  1IO4 A;  2FFD B;  4YPC A;  1JTH B;  2ZVN B;  1FZC B;  1PZQ A;  2C9N Y;  4M3L A;  2WMM A;  3RK3 D;  2M8R A;  1NKN A;  2IX7 C;  2ITA A;  4DCK A;  2W6A A;  3V4Q A;  4NPF X;  1IC2 A;  5CHX A;  1LTJ C;  1NTM G;  1RF1 C;  3GHG B;  4RES B;  2B9B A;  2J5U A;  3H25 A;  2Z5I A;  4HM4 A;  5AVX B;  3OAK A;  2WSE J;  5AW1 B;  3MP7 B;  1JY3 P;  1KD1 Q;  2IBZ G;  2XDJ A;  2KNC A;  4GIF A;  3RK2 B;  4PD4 E;  1KFM A;  2OQQ A;  1T6A A;  2B24 A;  1J1E B;  3L72 E;  1XTC C;  3CXH E;  2R3C A;  4A7P A;  3GL0 A;  3L73 E;  4C7N A;  1SQB E;  2QRX A;  3EFG A;  1M57 D;  1T3J A;  4WVZ A;  3HE4 B;  1FZC C;  4H0L B;  1NGM B;  1ZR2 A;  1YQ3 C;  3AEE C;  4PD4 I;  3L70 E;  3AEF C;  2YXR B;  1JEK A;  3L74 E;  3CWB G;  2AXT H;  5AW7 B;  1KFN A;  2ZFC A;  2IBZ I;  1JM1 A;  2YNY A;  5H2F H;  5APQ A;  1N7S D;  2R5D A;  1UUV A;  4ZNC A;  2OTK E;  2I8D A;  1NTK D;  1QL1 A;  4Y99 C;  3RK2 C;  5CMZ A;  3IFM A;  4JBZ A;  5CBN A;  2A45 G;  2QE7 H;  3V2N A;  2R32 A;  4OWF A;  4HM1 A;  5TIS H;  4WY4 A;  1DEB A;  3RK3 E;  3H32 A;  1S2E A;  4H0L C;  3TK1 A;  2W27 A;  3B5N D;  3BAS A;  2HOD A;  1VQ5 P;  1SQX J;  1DD3 A;  1L4A B;  1RE3 C;  1UII A;  5E79 H;  3RGU A;  1OX3 A;  3AE4 C;  4HM8 A;  3VMI D;  1KIL D;  2HFE D;  1FS0 E;  1YTZ T;  1L0N D;  1L4A D;  3SSU A;  2A45 I;  2B89 A;  1KQF B;  1USD A;  2ZT9 D;  2Q3W A;  1SQB K;  2QM8 A;  3JCU E;  2IYO A;  1JY2 P;  2BAS A;  2JEE A;  3O6Q A;  5KKZ B;  4K35 A;  3H1K E;  3LID A;  1SQQ J;  3BCC E;  5KLV E;  2XKM A;  3U59 A;  3EN1 A;  1S3J A;  3IAO A;  4RJT A;  1NTK G;  4U3F D;  5B66 H;  1NTK E;  1E5W A;  4AYC A;  2OTJ P;  1ULI A;  3L75 D;  2NUM A;  4WBA A;  2E74 C;  4I7Z C;  4EYY Q;  2D2C C;  1S9K D;  3F89 A;  1NU1 E;  1JUN A;  3GF3 A;  2GUS A;  2FYU K;  3AE8 C;  3Q5P A;  2HMN A;  3GF7 A;  1G1I A;  3A7O A;  1VPC A;  5DJU B;  5AW3 B;  4EOT A;  1IFM A;  3CCQ P;  3M91 A;  2FYN C;  4HM2 A;  1JB0 J;  4K3A A;  1KIL E;  2OYH C;  3H1H J;  3T97 A;  1ZRT D;  5AVW B;  1L0N E;  1SQP D;  5AW0 B;  2Q3I A;  3RL0 B;  1FAV A;  2NVF A;  1BE3 G;  2P67 A;  2RN0 A;  2H43 A;  1NYH A;  1OZH A;  5KAI E;  4NBG D;  3A0H E;  2C0X A;  4D6T J;  1VQM P;  4I2L C;  1YJW P;  1Q90 D;  2WSF J;  3Q2Y A;  3TDK A;  2AEJ A;  5KLV K;  1RQU A;  1N2D C;  4EI2 A;  1HJ0 A;  1NO4 A;  4NBE D;  1JMM A;  3ZDM A;  1BDC A;  1G8K B;  3HTK B;  1LTT C;  3SWY A;  3W68 A;  1SFC D;  3P8C D;  3LW5 H;  4RO0 A;  1RF0 C;  1FC2 C;  5AVQ B;  3L75 G;  4KT0 J;  2JKV A;  1NTZ D;  5AW2 B;  3AE2 C;  4U3F E;  4Z1M H;  1H88 A;  5CCG D;  1GD2 E;  1X8Y A;  3CXH H;  3MUD A;  5KJ7 C;  2N9Y B;  3B5N A;  4XE5 B;  3L75 E;  3RL0 C;  1FDM A;  1IFP A;  1WRG A;  1NU1 K;  3H1I D;  3A0B E;  2ZYA A;  2QEX P;  3GCE A;  4H13 D;  3VMZ A;  2JP3 A;  2K88 A;  1NJI Q;  4HH2 A;  3CLQ A;  3ITK A;  1M7L A;  1OIP A;  1NH4 A; 
#chains in the Genus database with same CATH homology
 4HM8 A;  4QDC A;  3VMI D;  2XRX A;  1EZV E;  1O7M A;  2FYN C;  2BMO A;  3D89 A;  1SQX E;  4QDF B;  5AEU A;  1SQV E;  4HM2 A;  2E76 D;  4QCK A;  2QPZ A;  2E75 D;  4NB9 D;  3VCP A;  4PD4 E;  1BE3 E;  4NBF D;  3L71 E;  4QUQ A;  1O7W A;  2B1X A;  1L0N E;  5HL4 A;  2B24 A;  4NBB D;  3CX5 E;  1PPJ E;  4D6T E;  3L72 E;  2ZT9 D;  3CXH E;  2FYU E;  3GZY A;  4H44 D;  4P1B H;  3VMG D;  1ZRT E;  2Q3W A;  3GL0 A;  2XSO A;  3L73 E;  1SQP E;  1SQB E;  1SQQ E;  4HJL A;  2JO6 A;  5KLI C;  1O7P A;  2NVF A;  4HM0 A;  2GBX A;  4HM3 A;  1NYK A;  4AIV A;  2XR8 A;  1WQL A;  2ZYL A;  3C0D A;  3CWB E;  4NBG D;  4QDF A;  1EG9 A;  4HM5 A;  2CKF A;  2JZA A;  2BCC E;  3GL2 A;  2HMM A;  5CXM A;  2NVG A;  1VF5 D;  3H1K E;  3L70 E;  2BMQ A;  2YIU C;  4NBA D;  4QDD A;  1BCC E;  3N0Q A;  2HMO A;  3FOU A;  1RFS A;  3L74 E;  3BCC E;  5KLV E;  3GB4 A;  4NBD D;  4NB8 D;  1BGY E;  4NBE D;  1JM1 A;  4NBH D;  1NTZ E;  2DE5 D;  3EN1 A;  1NDO A;  1G8K B;  1G8J B;  2E4Q A;  1P84 E;  2HML A;  2HMJ A;  4P1C H;  5BOK A;  1Q90 C;  1KB9 E;  3GTE A;  4AAY B;  4EMJ B;  2QJP C;  3AZC A;  2GBW A;  1UUV A;  2A06 E;  2I7F A;  1UUW A;  2NUK A;  3GZX A;  2E74 D;  1KYO E;  1O7G A;  4OGQ D;  2BMR A;  5KKZ C;  1SJG A;  3TGU E;  3VCA A;  2NVE A;  2D2C D;  3H1J E;  1FQT A;  2YFJ A;  1NTK E;  3GKE A;  2DE6 D;  1NTM E;  4U3F E;  3EQQ A;  2YFI A;  1ULI A;  4NBC D;  1VCK A;  2NUM A;  4H0L D;  2XSH A;  2YFL A;  3GTS A;  4HM1 A;  3GOB A;  4HM6 A;  3L75 E;  2QJK C;  2DE7 D;  2QJY C;  3VMH D;  2E4P A;  4QUP A;  1NU1 E;  1RIE A;  5AEW A;  3GCE A;  4H13 D;  1O7H A;  1PP9 E;  4PV1 D;  2HMK A;  2NWF A;  4QUR A;  2IBZ E;  3H1I E;  1L0L E;  3H1H E;  2HMN A;  4HM4 A;  1VM9 A;  4HM7 A;  3H1L E;  2YVJ B;  3DQY A;  1O7N A;  4HKV A;  1ULJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...