3L70J

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l70J00
1SQQJ 3H1IJ 1NTMJ 1SQVJ 4U3FJ 5KLVJ 2FYUJ 1L0LJ 4PD4I 1SQXJ 3L70J 3CWBJ 1NTKJ 1BGYJ 3H1KJ 1SQPJ 3L71J 1SQBJ 3H1HJ 4D6TJ 1KYOI 1BE3J 3CXHI 3H1LJ 1NU1J 1BCCJ 1EZVI 3H1JJ 3L74J 3CX5I 1PP9J 2BCCJ 3L75J 2IBZI 1P84I 3L73J 1KB9I 1NTZJ 1L0NJ 3L72J 3TGUJ 3BCCJ
chains in the Genus database with same CATH superfamily
2OGUA 2A45G 5GTHE 1SQPJ 1FC2C 3KYQA 2BASA 1BCCE 1G2CB 3GF3A 3O6QB 1U57A 3TNUB 1Z56A 3CCLP 3NFQA 1K9MQ 1YHQP 1KN7A 1PGOA 1FOSE 1CZQA 1JY3N 2YKPA 1SQQD 2E75D 1EDKA 4U3FD 2BCCE 4EYYQ 4C7NA 2WSEH 2I8DA 1AQTA 1JY2N 2QA4P 1NU1D 1KB9E 2YMKA 1BGYE 1NTKJ 1GMJA 1FU1A 1IFIA 5K5GB 1OX3A 5B5EH 3CCSP 2R5BA 4HH2A 3M91A 2H88C 4YXDC 2WPSA 3H1JG 2L91A 2RN0A 2YKOA 4EOTA 2C0XA 4HYTB 5KAIE 2YNYA 5B66H 2IBZD 2NRGA 4IFMA 4I7ZC 3A0HH 2C9NY 3M0DA 1X0TA 1BCCD 1M1KQ 5CJ0A 1RY3A 3CX5H 1BE3J 1QVGO 1JNMA 1OXZA 2WPRA 1SQXD 1N86A 2HODB 2KK7A 1S4XA 1RF1A 3L73J 1L2PA 1LTJB 1KFNA 1LTTC 1JUNA 1OVRA 3VMYA 4DJGA 2BCCD 5APTA 2W27A 1VL2A 1YITP 2NPSA 1X8YA 2N9BA 1KB9D 3GW6A 1BGYD 4HJGH 1IK9A 2D2CB 1KQGB 4BWNA 3RK2B 1QX8A 1S9KD 1LNQA 1KYOH 1HGVA 5TJHA 3M0DC 1LTJC 2FYUD 5C39A 1AVYA 2NPSB 2Q3EA 4Y99B 3TK1A 2P7JA 3L37A 2A06G 2FKWB 3AEAC 1KV4A 2N1TA 1EDIA 1LT1A 4B86A 2D2CC 3H1KE 1ZLLA 1Q90D 3RK2C 1LTAC 1SQVD 4NPEA 1JEKA 3MP7B 2M3EA 3E1IA 3RBXA 2LKMA 3G6EP 1PL5A 2NPSC 3Q2YA 5APYA 2POHA 2H7HA 4PD4E 3L36A 4LC1A 1P84H 2D2CD 4N6JA 1U7MA 2SPZA 1IC2A 1L4AB 4JF7A 3RK2D 1NKZB 3I5CA 1W2EA 1N7LA 2FY8A 1AV1A 4ZMDA 4QMAA 2OTJP 2NPSD 3E7KA 2H43A 5AVXB 3V4WA 2N1TC 5GTIH 3P8CE 1ZXGA 1S1CX 1DX7A 4YXWH 1L0NE 3H1IE 4U7JA 3B4SA 2E74D 1YBKA 1SLQA 1JY2P 1CI6B 3PTZA 1MFTA 3HRNA 1IFMA 1YTZI 5CJ4A 1M90Q 3BVHA 3H1LD 3H1HG 2WSCJ 2N1TD 2LR2A 5AVZB 2DW3A 4ASVA 4OH8B 3D70A 1DH3A 3N7NA 1NAFA 5AVSB 1SQPG 2KOGA 2HFED 3Q5SA 1G1IA 5AVWB 4RESB 3CWBE 5B5EE 3H1KJ 3S1KA 2M8RA 5APXA 2ZAEB 3L74E 4IOIH 1R8EA 3D6ZA 1VQLP 5B66E 1KB9I 3AE3C 1RE3A 2IZ0A 3AEFC 1EZVG 3P8CD 1XTCC 4ASWA 3H1ID 5KLVD 4RKUJ 1NTKG 3CX5E 3LW5H 2Y0CA 1NHLA 1M7LA 3VN0A 4N78E 2M0BA 2KNCA 4DOJA 1T6AA 1N73A 2E5YA 3L35A 2QM7A 3L72D 1ZP0C 3MTUE 4DCKA 3A7OA 4L75A 1NTZK 1L0NJ 1LWUA 1KTMA 4WY4A 5AW3B 3L70J 2Q6QA 1PPJG 1JMBA 4KT0J 1WMKA 2YKQA 1AQ5A 3C1LA 4PJ0E 3H32A 4XFJA 3BCCJ 3L74D 1HF9A 1GK6A 2YMYA 3CMEP 1L0LE 3M0AA 2FYNB 3MGNA 2FYZA 1UIIA 2FBWC 2QIWA 3L73G 1IFJA 1PP9E 1LP1A 1FZBA 3L75E 3MUDA 3NMDA 1N73C 1SFCB 1DD3A 2ZYGA 2OQQA 5AVQB 1E79H 4Y28J 1NTMK 2HG5D 1RH5B 2A45H 4EDFA 1Y47A 3SFDC 3CWBJ 3CX5D 4D6TE 5AVVB 5AVRB 2CPSA 1T3UA 1AFOA 1K8AQ 1EQ7A 4WY4C 3CD6P 2Q1KA 1LP1B 2FFDB 1L0LK 3L71E 1JM0A 1SQPK 1CSBA 2I1KA 1MV8A 3NXSA 2WZ7A 2QM8A 1QL2A 4JPZB 3RK3E 1LTSC 4WY4D 1KYOD 1VQ5P 4PD4I 3CCEP 3MUDC 5GTIE 3V4QA 1H0TA 1K04A 3TF5A 2WWWA 1FZCA 2AEFA 2JEEA 2K1AA 4GODA 5CBOA 1KD1Q 3RK3B 1OFCX 3HD7A 1G1JA 2E75B 3W67A 2IX7C 3PJSK 4OVNF 1KILA 1PP9D 5CHXA 1J1DC 4N3YB 3L75D 1H8AA 1AA0A 3WUTA 2GA1A 2VRSA 3IF4A 3HE4B 1H0TB 1RF0A 4M3LA 3CCJP 3HD7B 1SQQK 1EDJA 1RQUA 3TGUE 3Q5PA 1YQ4C 3RK3C 3CXHH 5KLIC 1L0LJ 4GIFA 2E75C 1NH4A 4ZKPA 1YTZT 1SQBE 2IFNA 1NU1K 2AXTH 1FE6A 3AE7C 1P84D 2I1JA 2KB7P 3L71D 1VQ4P 1FZCC 4O9BA 2K9JA 1DIPA 2QVAA 1SQXE 1FDIA 3OW2O 2V4HA 3HD7C 3RK3D 3AE2C 4D6TJ 5APUA 4WVZA 3EFGA 2ZJSE 3G71P 3HUSA 3WU2H 3PLNA 2E5TA 2BEZF 3MD0A 4HKZH 3G4SP 5TISH 3CCMP 1RF0C 4I7ZB 3II6A 2K9JB 2CK3H 4UB8H 1HBWA 1K05A 2V7QH 5BU8B 1X22A 1VQNP 1Y8AA 3GF7A 3HD7D 1S9KE 3FWLA 2RKLA 3PH0A 2G3AA 3H1KG 4C7NB 2Z4EA 2KSJA 1SQQJ 4U3FJ 2FYUE 2O01J 1EXJA 2KI7B 1PFIA 1KFMA 1NOHA 2XDJA 1NU1J 3TGUD 3MIWA 1N8RQ 3CX5I 1EC5A 2IZ1A 1VQOP 2ZXXA 2KP8A 1SQBD 2XNDH 4GKGA 1SQVE 1JB0J 1KORA 2ZVOB 3U59A 2WPVB 1GD2E 2IDBA 4JBZA 1S5LX 3HUSC 4I2LC 3S4RA 1ZV8A 2Q3IA 2E76D 1GTWA 3I56P 3CCVP 2M3BA 3A0BH 4L74A 3TGUJ 1XTGB 1IK7A 2FYUK 1AVOA 2J58A 4IL6X 1T2KD 1SQBJ 4AYCA 2WSFH 4L73A 2ZYDA 1BCCJ 4GT1A 1JTHA 1SVFA 3MHVA 1KQSO 2QJPB 3L70G 3T97A 2WTYA 3FXEA 1GU4A 3NTNA 1RF1B 1SQVK 4CPGA 1TU3F 3GLMA 1FZEA 1SQXJ 5CCHA 5CCGA 4DZOA 3BCCG 1KZUB 2WITA 3MZWB 2BCCJ 1HH0A 1HUCA 1YI2P 3B5NA 3V6IA 1YQ3C 1GW3A 2FXPA 2QJPC 2OYIA 3SFEC 1BGYJ 2P2UA 4IFFA 1RF1C 2E74B 3H1LE 3P7KA 3USSA 5E79H 3CWBG 3R4YA 5BU5A 3B5NB 1M57D 4ZKUA 4WB4A 2W83C 4C46A 5KAFH 2FYUJ 1GZLA 2OYIB 2HLOA 1U7JA 2N1TB 2R5DA 2JWAA 1NTZG 3H1JE 2P58A 2WMMA 5CCHC 2E74C 1YYCA 5CCGC 1MKMA 2OTKE 1OW7A 1SQVJ 5AW9B 3O8ZA 1LT9A 2C9LY 2P10A 3V2QA 1FDOA 3B5NC 3PP5A 4BRYA 1JCDA 3CXHE 2YO3A 2LXBA 3CCQP 1HVVA 1DEBA 2OYIC 2JDIH 3S9OA 2AXTE 1VF5B 2XZRA 5KLVE 5CCHD 5CCGD 4R4LA 5DJUB 2O01N 2YXRB 2ZXEB 3FWNA 2KLVA 3B5ND 1OVVA 4BRYB 1NTMG 5AVTB 2IBZI 3L72E 2Z5IA 1MUUA 2B87A 1RQVA 3EFFK 3PHLA 3AE4C 2J59M 3LIEA 2YO2A 1VF5C 3IN6A 1S5LH 1FBMA 1KC8Q 1IO4A 1L0LG 4UB8E 3EQ2A 1Q86Q 1L0NK 2R3CA 5KLVK 3WMM0 1VQ8P 3H1JD 1UIXA 1ZRTE 2KYVA 2B87B 1E5WA 4RO0A 4IL6H 3SWFA 2A06E 3H1LJ 3Q3DA 3AEEC 1VF5D 1Q82Q 1SP4A 2PGDA 2WSSH 1OZHA 1FZGA 4D6TG 5APSA 4MN4C 2W6AA 4W80A 5AW0B 3CXHD 3CCRP 3A0HE 3AEGC 2KLUA 3CC2P 1IFNA 5M1BA 1PV3A 4R4MA 2HPCA 4XA4A 3V5BA 5AW2B 4JYBA 5APVA 2QEXP 3AEDC 2R32A 3UIAA 1LTBC 5AW7B 3AE6C 1GL2A 2HPCB 1GU5A 1SQQG 4U3FG 2C0WA 2IPPA 1USEA 5H2FH 1NU1G 1M8OB 3H1IJ 5KLVJ 2OYHA 3A2AA 3GG2A 2ZT9C 3JSVC 2KNCB 3AECC 3RL0C 1N73B 2J5UA 2W6JH 1GDTA 2AEMA 5EFWB 1RE3C 1KYOE 1KQLA 1ZRTD 4KHXA 5KJ7A 5KAIH 2A06D 2MKVA 1BE3G 3L72J 2KSEA 3QWOC 2B88A 2KUBA 1LWUB 5AW4B 4WY4B 2WSEJ 2H8PD 2ZT9D 3M9BA 2IBZG 1CW5A 1N7SA 4HB1A 4K35A 3RL0D 1GL2C 3H32B 1BCCG 4UB6H 1NWQA 4TLFA 2HYNA 2ZYAA 2ITAA 2N9YB 2YXQB 2WT7A 4C7RA 3OAKA 3PRJA 1A02J 1S72P 3F89A 1PIXA 5KAFE 1LWUC 2OYHC 3L74J 1JO5A 3RGUA 1SQXG 3G3ZA 4GOEA 2K37A 1EXIA 3D6YA 3VMAA 1P84E 5APQA 1GL2D 2L5GB 2QJYB 2BCCG 1S3JA 5KJ7C 2WSCH 1KQFB 2UWJE 1OW6A 4GOFA 1RE4A 1FZFA 1EZVE 1J1DB 1BGYG 4H44C 1J1EB 5CBNA 1URQA 1FAVA 1N7SC 1LGHB 1WT6A 2M5AA 2JP3A 1ZN5A 1HJ0A 5KJ7D 1MZ9A 2QJYC 1W2BO 1YJ9P 2FYUG 4L76A 5KLIB 2OYOA 3H1HD 4A7PA 1X9VA 2Y0DA 1BDDA 4H44D 2JKVA 1IFPA 2Y9YA 1YJNP 1J1EC 3VTPC 1IZNB 4XE5B 1N7SD 1KILE 2WQYC 1SQVG 1FZCB 2KS1A 1PPJE 1SQPD 4PD4H 4TT3H 3TSIA 3VMXA 4W7ZA 1RE4C 1KILB 1OWAA 2XU6A 2QG4A 1URQC 3TNUA 3VP9A 1PP9J 4GDOA 2K3RA 3L75J 3CPWO 3L73E 1QGKB 3B8EB 1BSHA 1S2EA 1EZVD 3Q5RA 1H88A 3HE5A 4OWFA 1KILC 1URQD 1NTKD 1HTLC 1ZOYC 4K3AA 1HWTC 2E76B 3KHUA 3P8MC 2XNXA 3KZIH 3L71J 3VOPA 2XV5A 1SQBK 1QLED 3HE5B 4EIJA 2RMZA 1QVFO 3N4XA 2Q7CA 1KILD 3H1LG 3HUSB 5AVYB 3M06A 3U1AA 1SQXK 3BATA 1PPJD 3F5HA 2G8YA 4EI2A 3KDPB 5H2FE 2Q5UA 2E76C 2GM4A 3I55P 3ABVC 1BE3D 1AJYA 4BXLA 5AW1B 1DEEG 1T2KC 3IAOA 3L73D 1ZMEC 2JJLA 1M1JA 2BEQD 2HODA 4Z1MH 3GMAA 4I1LA 1ZW0A 3TYYA 3B71A 1LTJA 2Z5HA 3V2PA 2P1JA 4YTPC 2E43A 1T3JA 2YIUB 1NAYA 1KYOI 1W5CE 1L0NG 1LTIC 4UB6E 2IYPA 3H1IG 5KLVG 1M1JB 2QE7H 2O1JA 3IFMA 1FDMA 3L4FA 3KQGA 1HGZA 1YJWP 1PGQA 2WVRA 5BVZA 1ZR2A 3L72G 1FOSF 2B89A 2YIUC 2B9BA 1JTHB 4KJMA 2KZIA 3T97B 4NPDA 3P32A 4JQ0D 1M1JC 2QJKB 1OW8A 4PJ0H 1BSNA 4H0LB 2MJZA 2W90A 3LW5J 1R5SA 1OVUA 3V2NA 2JR8A 5L8RJ 4NPFX 3OA7A 1EDLA 2ZFCA 1P84I 1NGMB 3D71A 1JMMA 1OIPA 3WUUA 1JCCA 3L74G 1NKNA 3CC4P 1L4AA 2QJKC 1EZVI 2Y9ZA 4H0LC 1PGPA 1VQ9P 3H6PA 3VMZA 3IR9A 3CI9A 1JY3O 1FJPA 2KXPB 1NO4A 3WUVA 4Y99C 2O3JA 1NYHA 2K88A 2PAJA 1Q7YQ 3AE1C 3FX0A 3SWKA 1MFZA 4OGQB 1IFDA 2K9YA 1FS0E 1N2DC 1JY2O 1GW4A 4W7YA 1OMIA 4H0LD 3A3YB 1WRGA 2Q9IA 2GUSA 3FGAD 3AEBC 5APWA 2ZVNB 3JC22 1CI6A 3CLQA 1NJIQ 3W68A 3BRVB 2W6BA 3AE5C 1LT9B 5AW8B 1JY3P 2O01H 1QEXA 3TDKA 1DD4A 2RH0A 1KMIZ 1RHZB 3CL3D 1L4AC 1VPCA 4OGQC 3ZDMA 3L70E 3WU2E 5TISE 3BRTB 3ITKA 1LT9C 3H1KD 3JCUH 1LJ2A 3KZIE 2FXMA 2KIKA 3BCCE 3OJAB 4AQRD 4H13B 1PP9G 1D7MA 1L4AD 3L75G 4OGQD 4PV1B 3BASA 3LIDA 5KKZB 5GTHH 1JOCA 4PD4D 1J2JB 1Q81Q 2W8ZA 5AW5B 3M9HA 2PP6A 4RJTA 3G9RA 3EWKA 3AE9C 3FXDA 3Q1MA 4H13C 3H1JJ 1FJKA 2ZT9B 4JYCA 3L71G 3VP8A 4PV1C 1NTZE 3RL0B 1PZQA 3HTKA 5KKZC 3C9IA 3SSUA 3C8VA 1L0ND 3A0BE 2NZ2A 3E1RA 1KB9H 3L70D 1GK4A 3AE8C 4H13D 5CMZA 3H25A 4IFDK 2XKMA 4PV1D 3HTKB 2KZJA 4WBAA 3M9QA 1VQ6P 1Q2NA 3BCCD 1GL2B 3CC7P 2R3SA 3CCUP 2AXCA 2CPBA 5KTBA 3R2PA 1NTME 2WPQA 4I6MC 2OYHB 3GHGA 3H1HE 2A45I 3TGUG 1SFCA 3CWBD 1Y9BA 1HJBA 2QRXA 1VQ7P 2V7QJ 1SQBG 1VQPP 3SWYA 2R44A 3RL0g 2IYOA 5E79E 1SQPE 1USDA 3GHGB 4H44B 1NTZD 5AVUB 3V2RA 2P67A 2GUVA 2FFDA 1N7SB 2IFMA 2JO1A 4DT0A 4LGDE 1A02F 1IJDB 1ZR4A 4WWIA 1H89A 1SS1A 1X79B 1K73Q 2AEJA 3VYIA 1VQKP 1QL1A 2WT7B 2OTLP 1VQMP 4N78D 2FYNC 2QSIA 3GHGC 1NTZJ 4ZNCA 2FXOA 1R5LA 1SFCC 3RBZA 1NTKE 2H89C 5AW6B 2JWDA 2PRRA 1NTMD 1PGJA 2Y0EA 2WSFJ 1SQQE 4U3FE 5DJTB 3U1CA 1URQB 2FFDC 3K5BA 3HE4A 3A5TA 2M5AB 1LTGC 3KXDA 1NVOA 1M56D 1NU1E 1SFCD 3CXHI 1YIJP 1L0LD 3KPEA 1BDCA 3CMAP 1T8ZA 1FZAA 1S5LE 2HR3A 4AUWA 4LLHA 1NTMJ 1VDFA 2LXCB 1NTKK 3JCUE 2OARA 1G2CA 3H1HJ 1BE3E 3O6QA 2PFXA 3QH9A 2E42A 2KS1B 4IL6E 4D6TD 2IBZE 2O1KA 4YPCA
chains in the Genus database with same CATH topology
1SQQJ 3H1IJ 1NTMJ 1SQVJ 4U3FJ 5KLVJ 2FYUJ 1L0LJ 4PD4I 1SQXJ 3L70J 3CWBJ 1NTKJ 1BGYJ 3H1KJ 1SQPJ 3L71J 1SQBJ 3H1HJ 4D6TJ 1KYOI 1BE3J 3CXHI 3H1LJ 1NU1J 1BCCJ 1EZVI 3H1JJ 3L74J 3CX5I 1PP9J 2BCCJ 3L75J 2IBZI 1P84I 3L73J 1KB9I 1NTZJ 1L0NJ 3L72J 3TGUJ 3BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ J;  3H1I J;  1NTM J;  1SQV J;  4U3F J;  5KLV J;  2FYU J;  1L0L J;  4PD4 I;  1SQX J;  3L70 J;  3CWB J;  1NTK J;  1BGY J;  3H1K J;  1SQP J;  3L71 J;  1SQB J;  3H1H J;  4D6T J;  1KYO I;  1BE3 J;  3CXH I;  3H1L J;  1NU1 J;  1BCC J;  1EZV I;  3H1J J;  3L74 J;  3CX5 I;  1PP9 J;  2BCC J;  3L75 J;  2IBZ I;  1P84 I;  3L73 J;  1KB9 I;  1NTZ J;  1L0N J;  3L72 J;  3TGU J;  3BCC J; 
#chains in the Genus database with same CATH topology
 2OGU A;  2A45 G;  5GTH E;  1SQP J;  1FC2 C;  3KYQ A;  2BAS A;  1BCC E;  1G2C B;  3GF3 A;  3O6Q B;  1U57 A;  3TNU B;  1Z56 A;  3CCL P;  3NFQ A;  1K9M Q;  1YHQ P;  1KN7 A;  1PGO A;  1FOS E;  1CZQ A;  1JY3 N;  2YKP A;  1SQQ D;  2E75 D;  1EDK A;  4U3F D;  2BCC E;  4EYY Q;  4C7N A;  2WSE H;  2I8D A;  1AQT A;  1JY2 N;  2QA4 P;  1NU1 D;  1KB9 E;  2YMK A;  1BGY E;  1NTK J;  1GMJ A;  1FU1 A;  1IFI A;  5K5G B;  1OX3 A;  5B5E H;  3CCS P;  2R5B A;  4HH2 A;  3M91 A;  2H88 C;  4YXD C;  2WPS A;  3H1J G;  2L91 A;  2RN0 A;  2YKO A;  4EOT A;  2C0X A;  4HYT B;  5KAI E;  2YNY A;  5B66 H;  2IBZ D;  2NRG A;  4IFM A;  4I7Z C;  3A0H H;  2C9N Y;  3M0D A;  1X0T A;  1BCC D;  1M1K Q;  5CJ0 A;  1RY3 A;  3CX5 H;  1BE3 J;  1QVG O;  1JNM A;  1OXZ A;  2WPR A;  1SQX D;  1N86 A;  2HOD B;  2KK7 A;  1S4X A;  1RF1 A;  3L73 J;  1L2P A;  1LTJ B;  1KFN A;  1LTT C;  1JUN A;  1OVR A;  3VMY A;  4DJG A;  2BCC D;  5APT A;  2W27 A;  1VL2 A;  1YIT P;  2NPS A;  1X8Y A;  2N9B A;  1KB9 D;  3GW6 A;  1BGY D;  4HJG H;  1IK9 A;  2D2C B;  1KQG B;  4BWN A;  3RK2 B;  1QX8 A;  1S9K D;  1LNQ A;  1KYO H;  1HGV A;  5TJH A;  3M0D C;  1LTJ C;  2FYU D;  5C39 A;  1AVY A;  2NPS B;  2Q3E A;  4Y99 B;  3TK1 A;  2P7J A;  3L37 A;  2A06 G;  2FKW B;  3AEA C;  1KV4 A;  2N1T A;  1EDI A;  1LT1 A;  4B86 A;  2D2C C;  3H1K E;  1ZLL A;  1Q90 D;  3RK2 C;  1LTA C;  1SQV D;  4NPE A;  1JEK A;  3MP7 B;  2M3E A;  3E1I A;  3RBX A;  2LKM A;  3G6E P;  1PL5 A;  2NPS C;  3Q2Y A;  5APY A;  2POH A;  2H7H A;  4PD4 E;  3L36 A;  4LC1 A;  1P84 H;  2D2C D;  4N6J A;  1U7M A;  2SPZ A;  1IC2 A;  1L4A B;  4JF7 A;  3RK2 D;  1NKZ B;  3I5C A;  1W2E A;  1N7L A;  2FY8 A;  1AV1 A;  4ZMD A;  4QMA A;  2OTJ P;  2NPS D;  3E7K A;  2H43 A;  5AVX B;  3V4W A;  2N1T C;  5GTI H;  3P8C E;  1ZXG A;  1S1C X;  1DX7 A;  4YXW H;  1L0N E;  3H1I E;  4U7J A;  3B4S A;  2E74 D;  1YBK A;  1SLQ A;  1JY2 P;  1CI6 B;  3PTZ A;  1MFT A;  3HRN A;  1IFM A;  1YTZ I;  5CJ4 A;  1M90 Q;  3BVH A;  3H1L D;  3H1H G;  2WSC J;  2N1T D;  2LR2 A;  5AVZ B;  2DW3 A;  4ASV A;  4OH8 B;  3D70 A;  1DH3 A;  3N7N A;  1NAF A;  5AVS B;  1SQP G;  2KOG A;  2HFE D;  3Q5S A;  1G1I A;  5AVW B;  4RES B;  3CWB E;  5B5E E;  3H1K J;  3S1K A;  2M8R A;  5APX A;  2ZAE B;  3L74 E;  4IOI H;  1R8E A;  3D6Z A;  1VQL P;  5B66 E;  1KB9 I;  3AE3 C;  1RE3 A;  2IZ0 A;  3AEF C;  1EZV G;  3P8C D;  1XTC C;  4ASW A;  3H1I D;  5KLV D;  4RKU J;  1NTK G;  3CX5 E;  3LW5 H;  2Y0C A;  1NHL A;  1M7L A;  3VN0 A;  4N78 E;  2M0B A;  2KNC A;  4DOJ A;  1T6A A;  1N73 A;  2E5Y A;  3L35 A;  2QM7 A;  3L72 D;  1ZP0 C;  3MTU E;  4DCK A;  3A7O A;  4L75 A;  1NTZ K;  1L0N J;  1LWU A;  1KTM A;  4WY4 A;  5AW3 B;  3L70 J;  2Q6Q A;  1PPJ G;  1JMB A;  4KT0 J;  1WMK A;  2YKQ A;  1AQ5 A;  3C1L A;  4PJ0 E;  3H32 A;  4XFJ A;  3BCC J;  3L74 D;  1HF9 A;  1GK6 A;  2YMY A;  3CME P;  1L0L E;  3M0A A;  2FYN B;  3MGN A;  2FYZ A;  1UII A;  2FBW C;  2QIW A;  3L73 G;  1IFJ A;  1PP9 E;  1LP1 A;  1FZB A;  3L75 E;  3MUD A;  3NMD A;  1N73 C;  1SFC B;  1DD3 A;  2ZYG A;  2OQQ A;  5AVQ B;  1E79 H;  4Y28 J;  1NTM K;  2HG5 D;  1RH5 B;  2A45 H;  4EDF A;  1Y47 A;  3SFD C;  3CWB J;  3CX5 D;  4D6T E;  5AVV B;  5AVR B;  2CPS A;  1T3U A;  1AFO A;  1K8A Q;  1EQ7 A;  4WY4 C;  3CD6 P;  2Q1K A;  1LP1 B;  2FFD B;  1L0L K;  3L71 E;  1JM0 A;  1SQP K;  1CSB A;  2I1K A;  1MV8 A;  3NXS A;  2WZ7 A;  2QM8 A;  1QL2 A;  4JPZ B;  3RK3 E;  1LTS C;  4WY4 D;  1KYO D;  1VQ5 P;  4PD4 I;  3CCE P;  3MUD C;  5GTI E;  3V4Q A;  1H0T A;  1K04 A;  3TF5 A;  2WWW A;  1FZC A;  2AEF A;  2JEE A;  2K1A A;  4GOD A;  5CBO A;  1KD1 Q;  3RK3 B;  1OFC X;  3HD7 A;  1G1J A;  2E75 B;  3W67 A;  2IX7 C;  3PJS K;  4OVN F;  1KIL A;  1PP9 D;  5CHX A;  1J1D C;  4N3Y B;  3L75 D;  1H8A A;  1AA0 A;  3WUT A;  2GA1 A;  2VRS A;  3IF4 A;  3HE4 B;  1H0T B;  1RF0 A;  4M3L A;  3CCJ P;  3HD7 B;  1SQQ K;  1EDJ A;  1RQU A;  3TGU E;  3Q5P A;  1YQ4 C;  3RK3 C;  3CXH H;  5KLI C;  1L0L J;  4GIF A;  2E75 C;  1NH4 A;  4ZKP A;  1YTZ T;  1SQB E;  2IFN A;  1NU1 K;  2AXT H;  1FE6 A;  3AE7 C;  1P84 D;  2I1J A;  2KB7 P;  3L71 D;  1VQ4 P;  1FZC C;  4O9B A;  2K9J A;  1DIP A;  2QVA A;  1SQX E;  1FDI A;  3OW2 O;  2V4H A;  3HD7 C;  3RK3 D;  3AE2 C;  4D6T J;  5APU A;  4WVZ A;  3EFG A;  2ZJS E;  3G71 P;  3HUS A;  3WU2 H;  3PLN A;  2E5T A;  2BEZ F;  3MD0 A;  4HKZ H;  3G4S P;  5TIS H;  3CCM P;  1RF0 C;  4I7Z B;  3II6 A;  2K9J B;  2CK3 H;  4UB8 H;  1HBW A;  1K05 A;  2V7Q H;  5BU8 B;  1X22 A;  1VQN P;  1Y8A A;  3GF7 A;  3HD7 D;  1S9K E;  3FWL A;  2RKL A;  3PH0 A;  2G3A A;  3H1K G;  4C7N B;  2Z4E A;  2KSJ A;  1SQQ J;  4U3F J;  2FYU E;  2O01 J;  1EXJ A;  2KI7 B;  1PFI A;  1KFM A;  1NOH A;  2XDJ A;  1NU1 J;  3TGU D;  3MIW A;  1N8R Q;  3CX5 I;  1EC5 A;  2IZ1 A;  1VQO P;  2ZXX A;  2KP8 A;  1SQB D;  2XND H;  4GKG A;  1SQV E;  1JB0 J;  1KOR A;  2ZVO B;  3U59 A;  2WPV B;  1GD2 E;  2IDB A;  4JBZ A;  1S5L X;  3HUS C;  4I2L C;  3S4R A;  1ZV8 A;  2Q3I A;  2E76 D;  1GTW A;  3I56 P;  3CCV P;  2M3B A;  3A0B H;  4L74 A;  3TGU J;  1XTG B;  1IK7 A;  2FYU K;  1AVO A;  2J58 A;  4IL6 X;  1T2K D;  1SQB J;  4AYC A;  2WSF H;  4L73 A;  2ZYD A;  1BCC J;  4GT1 A;  1JTH A;  1SVF A;  3MHV A;  1KQS O;  2QJP B;  3L70 G;  3T97 A;  2WTY A;  3FXE A;  1GU4 A;  3NTN A;  1RF1 B;  1SQV K;  4CPG A;  1TU3 F;  3GLM A;  1FZE A;  1SQX J;  5CCH A;  5CCG A;  4DZO A;  3BCC G;  1KZU B;  2WIT A;  3MZW B;  2BCC J;  1HH0 A;  1HUC A;  1YI2 P;  3B5N A;  3V6I A;  1YQ3 C;  1GW3 A;  2FXP A;  2QJP C;  2OYI A;  3SFE C;  1BGY J;  2P2U A;  4IFF A;  1RF1 C;  2E74 B;  3H1L E;  3P7K A;  3USS A;  5E79 H;  3CWB G;  3R4Y A;  5BU5 A;  3B5N B;  1M57 D;  4ZKU A;  4WB4 A;  2W83 C;  4C46 A;  5KAF H;  2FYU J;  1GZL A;  2OYI B;  2HLO A;  1U7J A;  2N1T B;  2R5D A;  2JWA A;  1NTZ G;  3H1J E;  2P58 A;  2WMM A;  5CCH C;  2E74 C;  1YYC A;  5CCG C;  1MKM A;  2OTK E;  1OW7 A;  1SQV J;  5AW9 B;  3O8Z A;  1LT9 A;  2C9L Y;  2P10 A;  3V2Q A;  1FDO A;  3B5N C;  3PP5 A;  4BRY A;  1JCD A;  3CXH E;  2YO3 A;  2LXB A;  3CCQ P;  1HVV A;  1DEB A;  2OYI C;  2JDI H;  3S9O A;  2AXT E;  1VF5 B;  2XZR A;  5KLV E;  5CCH D;  5CCG D;  4R4L A;  5DJU B;  2O01 N;  2YXR B;  2ZXE B;  3FWN A;  2KLV A;  3B5N D;  1OVV A;  4BRY B;  1NTM G;  5AVT B;  2IBZ I;  3L72 E;  2Z5I A;  1MUU A;  2B87 A;  1RQV A;  3EFF K;  3PHL A;  3AE4 C;  2J59 M;  3LIE A;  2YO2 A;  1VF5 C;  3IN6 A;  1S5L H;  1FBM A;  1KC8 Q;  1IO4 A;  1L0L G;  4UB8 E;  3EQ2 A;  1Q86 Q;  1L0N K;  2R3C A;  5KLV K;  3WMM 0;  1VQ8 P;  3H1J D;  1UIX A;  1ZRT E;  2KYV A;  2B87 B;  1E5W A;  4RO0 A;  4IL6 H;  3SWF A;  2A06 E;  3H1L J;  3Q3D A;  3AEE C;  1VF5 D;  1Q82 Q;  1SP4 A;  2PGD A;  2WSS H;  1OZH A;  1FZG A;  4D6T G;  5APS A;  4MN4 C;  2W6A A;  4W80 A;  5AW0 B;  3CXH D;  3CCR P;  3A0H E;  3AEG C;  2KLU A;  3CC2 P;  1IFN A;  5M1B A;  1PV3 A;  4R4M A;  2HPC A;  4XA4 A;  3V5B A;  5AW2 B;  4JYB A;  5APV A;  2QEX P;  3AED C;  2R32 A;  3UIA A;  1LTB C;  5AW7 B;  3AE6 C;  1GL2 A;  2HPC B;  1GU5 A;  1SQQ G;  4U3F G;  2C0W A;  2IPP A;  1USE A;  5H2F H;  1NU1 G;  1M8O B;  3H1I J;  5KLV J;  2OYH A;  3A2A A;  3GG2 A;  2ZT9 C;  3JSV C;  2KNC B;  3AEC C;  3RL0 C;  1N73 B;  2J5U A;  2W6J H;  1GDT A;  2AEM A;  5EFW B;  1RE3 C;  1KYO E;  1KQL A;  1ZRT D;  4KHX A;  5KJ7 A;  5KAI H;  2A06 D;  2MKV A;  1BE3 G;  3L72 J;  2KSE A;  3QWO C;  2B88 A;  2KUB A;  1LWU B;  5AW4 B;  4WY4 B;  2WSE J;  2H8P D;  2ZT9 D;  3M9B A;  2IBZ G;  1CW5 A;  1N7S A;  4HB1 A;  4K35 A;  3RL0 D;  1GL2 C;  3H32 B;  1BCC G;  4UB6 H;  1NWQ A;  4TLF A;  2HYN A;  2ZYA A;  2ITA A;  2N9Y B;  2YXQ B;  2WT7 A;  4C7R A;  3OAK A;  3PRJ A;  1A02 J;  1S72 P;  3F89 A;  1PIX A;  5KAF E;  1LWU C;  2OYH C;  3L74 J;  1JO5 A;  3RGU A;  1SQX G;  3G3Z A;  4GOE A;  2K37 A;  1EXI A;  3D6Y A;  3VMA A;  1P84 E;  5APQ A;  1GL2 D;  2L5G B;  2QJY B;  2BCC G;  1S3J A;  5KJ7 C;  2WSC H;  1KQF B;  2UWJ E;  1OW6 A;  4GOF A;  1RE4 A;  1FZF A;  1EZV E;  1J1D B;  1BGY G;  4H44 C;  1J1E B;  5CBN A;  1URQ A;  1FAV A;  1N7S C;  1LGH B;  1WT6 A;  2M5A A;  2JP3 A;  1ZN5 A;  1HJ0 A;  5KJ7 D;  1MZ9 A;  2QJY C;  1W2B O;  1YJ9 P;  2FYU G;  4L76 A;  5KLI B;  2OYO A;  3H1H D;  4A7P A;  1X9V A;  2Y0D A;  1BDD A;  4H44 D;  2JKV A;  1IFP A;  2Y9Y A;  1YJN P;  1J1E C;  3VTP C;  1IZN B;  4XE5 B;  1N7S D;  1KIL E;  2WQY C;  1SQV G;  1FZC B;  2KS1 A;  1PPJ E;  1SQP D;  4PD4 H;  4TT3 H;  3TSI A;  3VMX A;  4W7Z A;  1RE4 C;  1KIL B;  1OWA A;  2XU6 A;  2QG4 A;  1URQ C;  3TNU A;  3VP9 A;  1PP9 J;  4GDO A;  2K3R A;  3L75 J;  3CPW O;  3L73 E;  1QGK B;  3B8E B;  1BSH A;  1S2E A;  1EZV D;  3Q5R A;  1H88 A;  3HE5 A;  4OWF A;  1KIL C;  1URQ D;  1NTK D;  1HTL C;  1ZOY C;  4K3A A;  1HWT C;  2E76 B;  3KHU A;  3P8M C;  2XNX A;  3KZI H;  3L71 J;  3VOP A;  2XV5 A;  1SQB K;  1QLE D;  3HE5 B;  4EIJ A;  2RMZ A;  1QVF O;  3N4X A;  2Q7C A;  1KIL D;  3H1L G;  3HUS B;  5AVY B;  3M06 A;  3U1A A;  1SQX K;  3BAT A;  1PPJ D;  3F5H A;  2G8Y A;  4EI2 A;  3KDP B;  5H2F E;  2Q5U A;  2E76 C;  2GM4 A;  3I55 P;  3ABV C;  1BE3 D;  1AJY A;  4BXL A;  5AW1 B;  1DEE G;  1T2K C;  3IAO A;  3L73 D;  1ZME C;  2JJL A;  1M1J A;  2BEQ D;  2HOD A;  4Z1M H;  3GMA A;  4I1L A;  1ZW0 A;  3TYY A;  3B71 A;  1LTJ A;  2Z5H A;  3V2P A;  2P1J A;  4YTP C;  2E43 A;  1T3J A;  2YIU B;  1NAY A;  1KYO I;  1W5C E;  1L0N G;  1LTI C;  4UB6 E;  2IYP A;  3H1I G;  5KLV G;  1M1J B;  2QE7 H;  2O1J A;  3IFM A;  1FDM A;  3L4F A;  3KQG A;  1HGZ A;  1YJW P;  1PGQ A;  2WVR A;  5BVZ A;  1ZR2 A;  3L72 G;  1FOS F;  2B89 A;  2YIU C;  2B9B A;  1JTH B;  4KJM A;  2KZI A;  3T97 B;  4NPD A;  3P32 A;  4JQ0 D;  1M1J C;  2QJK B;  1OW8 A;  4PJ0 H;  1BSN A;  4H0L B;  2MJZ A;  2W90 A;  3LW5 J;  1R5S A;  1OVU A;  3V2N A;  2JR8 A;  5L8R J;  4NPF X;  3OA7 A;  1EDL A;  2ZFC A;  1P84 I;  1NGM B;  3D71 A;  1JMM A;  1OIP A;  3WUU A;  1JCC A;  3L74 G;  1NKN A;  3CC4 P;  1L4A A;  2QJK C;  1EZV I;  2Y9Z A;  4H0L C;  1PGP A;  1VQ9 P;  3H6P A;  3VMZ A;  3IR9 A;  3CI9 A;  1JY3 O;  1FJP A;  2KXP B;  1NO4 A;  3WUV A;  4Y99 C;  2O3J A;  1NYH A;  2K88 A;  2PAJ A;  1Q7Y Q;  3AE1 C;  3FX0 A;  3SWK A;  1MFZ A;  4OGQ B;  1IFD A;  2K9Y A;  1FS0 E;  1N2D C;  1JY2 O;  1GW4 A;  4W7Y A;  1OMI A;  4H0L D;  3A3Y B;  1WRG A;  2Q9I A;  2GUS A;  3FGA D;  3AEB C;  5APW A;  2ZVN B;  3JC2 2;  1CI6 A;  3CLQ A;  1NJI Q;  3W68 A;  3BRV B;  2W6B A;  3AE5 C;  1LT9 B;  5AW8 B;  1JY3 P;  2O01 H;  1QEX A;  3TDK A;  1DD4 A;  2RH0 A;  1KMI Z;  1RHZ B;  3CL3 D;  1L4A C;  1VPC A;  4OGQ C;  3ZDM A;  3L70 E;  3WU2 E;  5TIS E;  3BRT B;  3ITK A;  1LT9 C;  3H1K D;  3JCU H;  1LJ2 A;  3KZI E;  2FXM A;  2KIK A;  3BCC E;  3OJA B;  4AQR D;  4H13 B;  1PP9 G;  1D7M A;  1L4A D;  3L75 G;  4OGQ D;  4PV1 B;  3BAS A;  3LID A;  5KKZ B;  5GTH H;  1JOC A;  4PD4 D;  1J2J B;  1Q81 Q;  2W8Z A;  5AW5 B;  3M9H A;  2PP6 A;  4RJT A;  3G9R A;  3EWK A;  3AE9 C;  3FXD A;  3Q1M A;  4H13 C;  3H1J J;  1FJK A;  2ZT9 B;  4JYC A;  3L71 G;  3VP8 A;  4PV1 C;  1NTZ E;  3RL0 B;  1PZQ A;  3HTK A;  5KKZ C;  3C9I A;  3SSU A;  3C8V A;  1L0N D;  3A0B E;  2NZ2 A;  3E1R A;  1KB9 H;  3L70 D;  1GK4 A;  3AE8 C;  4H13 D;  5CMZ A;  3H25 A;  4IFD K;  2XKM A;  4PV1 D;  3HTK B;  2KZJ A;  4WBA A;  3M9Q A;  1VQ6 P;  1Q2N A;  3BCC D;  1GL2 B;  3CC7 P;  2R3S A;  3CCU P;  2AXC A;  2CPB A;  5KTB A;  3R2P A;  1NTM E;  2WPQ A;  4I6M C;  2OYH B;  3GHG A;  3H1H E;  2A45 I;  3TGU G;  1SFC A;  3CWB D;  1Y9B A;  1HJB A;  2QRX A;  1VQ7 P;  2V7Q J;  1SQB G;  1VQP P;  3SWY A;  2R44 A;  3RL0 g;  2IYO A;  5E79 E;  1SQP E;  1USD A;  3GHG B;  4H44 B;  1NTZ D;  5AVU B;  3V2R A;  2P67 A;  2GUV A;  2FFD A;  1N7S B;  2IFM A;  2JO1 A;  4DT0 A;  4LGD E;  1A02 F;  1IJD B;  1ZR4 A;  4WWI A;  1H89 A;  1SS1 A;  1X79 B;  1K73 Q;  2AEJ A;  3VYI A;  1VQK P;  1QL1 A;  2WT7 B;  2OTL P;  1VQM P;  4N78 D;  2FYN C;  2QSI A;  3GHG C;  1NTZ J;  4ZNC A;  2FXO A;  1R5L A;  1SFC C;  3RBZ A;  1NTK E;  2H89 C;  5AW6 B;  2JWD A;  2PRR A;  1NTM D;  1PGJ A;  2Y0E A;  2WSF J;  1SQQ E;  4U3F E;  5DJT B;  3U1C A;  1URQ B;  2FFD C;  3K5B A;  3HE4 A;  3A5T A;  2M5A B;  1LTG C;  3KXD A;  1NVO A;  1M56 D;  1NU1 E;  1SFC D;  3CXH I;  1YIJ P;  1L0L D;  3KPE A;  1BDC A;  3CMA P;  1T8Z A;  1FZA A;  1S5L E;  2HR3 A;  4AUW A;  4LLH A;  1NTM J;  1VDF A;  2LXC B;  1NTK K;  3JCU E;  2OAR A;  1G2C A;  3H1H J;  1BE3 E;  3O6Q A;  2PFX A;  3QH9 A;  2E42 A;  2KS1 B;  4IL6 E;  4D6T D;  2IBZ E;  2O1K A;  4YPC A; 
#chains in the Genus database with same CATH homology
 1SQQ J;  3H1I J;  1NTM J;  1SQV J;  4U3F J;  5KLV J;  2FYU J;  1L0L J;  4PD4 I;  1SQX J;  3L70 J;  3CWB J;  1NTK J;  1BGY J;  3H1K J;  1SQP J;  3L71 J;  1SQB J;  3H1H J;  4D6T J;  1KYO I;  1BE3 J;  3CXH I;  3H1L J;  1NU1 J;  1BCC J;  1EZV I;  3H1J J;  3L74 J;  3CX5 I;  1PP9 J;  2BCC J;  3L75 J;  2IBZ I;  1P84 I;  3L73 J;  1KB9 I;  1NTZ J;  1L0N J;  3L72 J;  3TGU J;  3BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...