3L70J

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l70J00
3H1HJ 3BCCJ 3CX5I 1KB9I 2FYUJ 1SQPJ 1SQQJ 1NTMJ 1BE3J 1PP9J 3H1IJ 3H1KJ 1L0NJ 1EZVI 3L73J 3H1LJ 1SQBJ 3L72J 3L70J 1P84I 1BGYJ 3L71J 1KYOI 4U3FJ 1SQXJ 4PD4I 3TGUJ 3CWBJ 1NU1J 1NTZJ 2BCCJ 2IBZI 3CXHI 1SQVJ 3H1JJ 4D6TJ 5KLVJ 1NTKJ 3L75J 1BCCJ 3L74J 1L0LJ
chains in the Genus database with same CATH superfamily
2QJKC 4BRYB 1XTCC 2ZYDA 3GG2A 2QIWA 2YO3A 1N7SB 4JF7A 2PFXA 1G2CB 1LP1B 1M56D 3HUSC 1URQB 2UWJE 4I7ZC 3D6ZA 2P7JA 3L72E 1KFMA 3M06A 3S9OA 1NJIQ 1MFZA 4R4MA 1MV8A 2FXOA 2W6AA 2WPSA 3PJSK 3JCUE 1Y9BA 5APUA 3RK2C 3B71A 1L4AD 3USSA 1OXZA 5GTIE 2MJZA 1HTLC 2YIUC 4GT1A 1VF5C 1SFCD 1QVFO 1X9VA 3MUDA 3NXSA 3VP8A 1OWAA 2B88A 3AE3C 3P8CD 1SQVE 2BCCD 5BU5A 4K35A 3BASA 3D6YA 1H0TA 3WUUA 1VQOP 1HGVA 3LW5J 5AW2B 1HJBA 1U7JA 1WT6A 1SQVJ 5K5GB 5KLVJ 2HPCB 3H32B 4L75A 5GTIH 1NGMB 2E75C 2OARA 1KFNA 3H1IE 3CXHH 1KD1Q 1JCDA 2D2CD 1L0LJ 1P84D 3IAOA 2FFDC 2ZXEB 3M9QA 1IK9A 2O01J 1ZR4A 1YJWP 4IFMA 3L71E 2BEQD 4OGQD 4WB4A 2FYUJ 4EI2A 2ZT9C 4DCKA 4GOFA 2CPBA 5AVWB 1HWTC 5CCHD 2YXRB 2C9NY 4H44D 5E79E 3WMM0 2BASA 3L72D 1S9KD 1EC5A 3B5ND 3MGNA 1IZNB 2WPRA 3A7OA 1KYOD 3M0AA 1WRGA 1LJ2A 3O6QB 3CCRP 2KK7A 3AEFC 1FZCB 2C9LY 4GOEA 2JR8A 2N1TC 3L70E 5APXA 2Z4EA 1ZRTD 5AVTB 3VMXA 1T2KC 1NTZJ 2OTJP 2KXPB 3OJAB 2IBZI 1EZVD 1SQQE 2KZJA 2W6BA 2WSFH 5KLVG 3Q3DA 1JMBA 4L76A 3PH0A 4I1LA 3P8MC 2KLUA 4GIFA 4Y99B 1QEXA 4ASVA 5KKZC 1ZLLA 1FZEA 2ZVOB 3KZIE 1GU5A 1VQ4P 2N9BA 1P84H 2WZ7A 3AEEC 1SQPK 3II6A 1AFOA 3AE6C 3AEBC 3GMAA 1X22A 3E7KA 2QJYC 4LGDE 2ITAA 2Z5HA 1FS0E 1S5LX 2JDIH 2SPZA 4OWFA 3Q5PA 1NTMJ 2Y0CA 1TU3F 1PP9J 2OYHA 1YTZI 1SQQK 4XA4A 1GD2E 3GW6A 3A0BH 3ABVC 2M0BA 4A7PA 2GUVA 3L74D 3L73D 1RF1A 1KB9H 3CLQA 1FDMA 3HUSA 1W5CE 1RQUA 2G3AA 1M57D 1DD3A 3HRNA 1IK7A 1LT1A 2KZIA 3CCQP 1J1DC 1RE3C 1PZQA 1AVYA 3EFGA 3H1LG 5B66E 3CCUP 2E76C 3H1IG 2ZAEB 5DJTB 3CC7P 1IO4A 3L75J 3TK1A 4BXLA 1NAYA 1HJ0A 3A0BE 2D2CB 5AW0B 3M0DC 1KILA 2OYIA 2QG4A 1FOSE 2O1KA 2RMZA 1SQVD 1L0ND 2BCCE 1X8YA 1GL2D 2FY8A 4DOJA 5TISH 1KC8Q 2IPPA 5KTBA 5B66H 3AEAC 2OYIC 2AXTE 2NPSC 2YKOA 3H1HE 1BCCG 4H44B 2HODA 2JJLA 4H0LB 1VQLP 1SQPG 1JM0A 1NO4A 2K9YA 1NKNA 2QE7H 2YMYA 3CXHE 3FX0A 5AVZB 1AA0A 1KV4A 2ZJSE 3F5HA 1GW3A 1NU1K 1SQVK 1EZVG 2DW3A 3VMZA 1VQPP 3M91A 2Q9IA 1KB9D 2W6JH 1PGPA 4EIJA 4K3AA 2JKVA 2Q3EA 2ZVNB 4HYTB 5APVA 2Q5UA 4IFDK 1L0LE 1NTKJ 2GM4A 2O1JA 1QL2A 4UB8E 1AV1A 1OX3A 3H1HJ 4IL6X 2O01H 1NTKE 2AEMA 1Q86Q 1FJKA 2Y0DA 3L74E 4JPZB 1Y47A 5KJ7C 1NVOA 1KB9I 3H1JD 1NTMD 2L5GB 2KOGA 3LW5H 1FJPA 4HH2A 1L4AA 1JY3O 2XU6A 5B5EH 3L73G 5AW6B 2WT7A 4HB1A 2Z5IA 3H1KG 2KNCB 5H2FE 3SFDC 3PHLA 4UB8H 1EZVI 3SWYA 4JYBA 3B8EB 3V5BA 4N78E 3I55P 3CCVP 2AXCA 4D6TE 3AE9C 4ZMDA 3CD6P 3L72G 1SQPD 3RBZA 4BWNA 1NTZD 1M1JC 4EDFA 2NPSB 1NWQA 1N73B 2HFED 5BVZA 1BGYE 1NU1J 1YBKA 2I8DA 3HE4A 3MD0A 1PIXA 1YTZT 2YKQA 3C1LA 4XE5B 3H1JJ 1K9MQ 2K37A 4EOTA 4W7YA 1BCCJ 2BCCG 4YXWH 2M3EA 2WMMA 4AUWA 1J1EB 4YXDC 3G71P 4W7ZA 1RE3A 1LTGC 5AW3B 2G8YA 2YXQB 2HPCA 3CCJP 4JBZA 2NZ2A 3TNUB 2NPSD 2WSFJ 3H1HG 5EFWB 3KPEA 2QVAA 1A02F 1OW6A 1PFIA 1AQ5A 1T8ZA 2FFDA 2KS1A 4Z1MH 1T3JA 2JWDA 4PV1C 1MUUA 2AEFA 3NTNA 1ZP0C 4AYCA 2E43A 2I1JA 3L71G 3I5CA 1JY3P 1M8OB 1HUCA 3H1JE 1L0NK 4OGQB 2P67A 1P84E 1ZRTE 3VMYA 3MUDC 3GHGC 1NTKD 1Z56A 4KHXA 4U7JA 1CI6A 3CWBJ 3U1AA 5APQA 1YHQP 2OGUA 1FDIA 1N2DC 3FWLA 2ZXXA 3IFMA 2GA1A 3B5NB 4W80A 5KJ7D 3V2RA 1NTKG 4N78D 4WWIA 2JO1A 1G2CA 1IFJA 1LP1A 1PV3A 2K1AA 3B4SA 1NTMK 3IR9A 3M9HA 1GL2B 1EQ7A 1KB9E 1RF0A 3L70G 4IL6E 3R2PA 1VQ9P 2XV5A 3H1KD 4PV1D 5KAFE 1LWUA 3HTKB 5AW7B 2PP6A 3VYIA 2A45H 3CWBE 3TSIA 5KLVE 1W2BO 4U3FE 2CK3H 5M1BA 1LTJC 2B87A 3L35A 1GK4A 1JY2O 2J58A 1LNQA 2R3SA 4PD4D 3ITKA 4ZKUA 1PP9E 2AEJA 4QMAA 3L73J 5AVUB 2I1KA 2PGDA 3HE5A 4M3LA 5CJ0A 1FZBA 2KB7P 2WSCH 4IL6H 2OYHB 4Y99C 1G1IA 1DEEG 5KAFH 1RH5B 3PP5A 3TYYA 5CBOA 1KMIZ 3T97A 1T2KD 3KQGA 1SQBE 2N1TD 1OW7A 1N86A 3NMDA 2H43A 2QJPB 3VN0A 1R8EA 5GTHH 1GL2C 1IFIA 1FZCC 1NTMG 2OYHC 3L74J 4N6JA 2WQYC 1IFDA 4C7RA 5BU8B 1GW4A 3H1LD 1DIPA 3B5NC 2IFNA 2M5AB 4XFJA 1NTZE 2XZRA 3H1LE 3WUTA 3CCLP 2QEXP 2POHA 4C7NA 1FZGA 3HD7A 1RQVA 2OYIB 1PPJE 2CPSA 3CX5D 1FOSF 4HJGH 1YJ9P 1KTMA 2OTLP 5DJUB 2FKWB 3W67A 3TGUD 3GLMA 4OGQC 5AVSB 3H6PA 4L74A 1DH3A 2RN0A 5APSA 1K8AQ 3W68A 1LT9A 3A5TA 1R5SA 2E75D 3WU2E 2A06G 3G6EP 2FYUE 1NKZB 1KYOI 3L71J 4I7ZB 2FYUD 5B5EE 2YNYA 2FYNB 4U3FD 1VQKP 1EZVE 1SFCA 1L0LD 2E5YA 1EDIA 2IBZD 1J1EC 1OVVA 2GUSA 4NPDA 4IOIH 1NHLA 3PLNA 5AVRB 3LIEA 1N7SA 1IFMA 1YQ4C 5KLIB 4I6MC 2FYNC 4U3FG 3QH9A 1URQA 4B86A 1FC2C 1VQNP 1L0LG 2HLOA 5CBNA 3BATA 2E76B 1M1JB 2IFMA 3AE8C 3BCCE 2NRGA 1A02J 2PAJA 2Q6QA 1SQQJ 2W90A 1CW5A 1FDOA 3AE2C 3FXDA 1RE4C 2O01N 4L73A 2WSCJ 1AVOA 4WBAA 1BDCA 1PGQA 5C39A 3H1HD 1MZ9A 5CMZA 3A0HH 3Q1MA 1OW8A 1JMMA 1OMIA 1S4XA 3BRVB 3FWNA 5AVQB 1FE6A 1LTBC 1WMKA 1ZXGA 1HH0A 2P2UA 4JYCA 3TGUG 1SQXK 1SQBG 1N7LA 2YMKA 5CCHA 1QGKB 2E76D 2XDJA 3H1KE 2P1JA 4PD4I 1D7MA 2N1TB 2KSJA 2R3CA 1X79B 1IJDB 1JTHB 2WSEH 3RL0B 2C0WA 4D6TG 4OH8B 1NTZG 2E74B 4N3YB 3KYQA 2KIKA 2KSEA 1PPJG 3H32A 3P8CE 1BGYG 4PD4H 2QJPC 1K04A 4DT0A 3SWFA 3PRJA 5TISE 5CHXA 1VQ8P 3PTZA 1HBWA 1S5LE 1IC2A 2LXCB 4I2LC 3Q5RA 4WY4A 3L70D 3L36A 3H25A 1BE3J 1BGYD 3U1CA 1T6AA 3H1KJ 2A06E 2C0XA 3N7NA 4GKGA 2L91A 2RKLA 1GU4A 1KQLA 2FYUK 3CCMP 1E5WA 1HGZA 5KJ7A 3Q2YA 1QL1A 1DEBA 2JWAA 2PRRA 3L37A 4LLHA 1MKMA 2H88C 4U3FJ 4OVNF 1S5LH 4JQ0D 4KT0J 2K9JA 1ZR2A 1LTSC 2AXTH 1CSBA 2ZT9B 4GDOA 3S1KA 1FZCA 1HF9A 2H7HA 4D6TJ 1H88A 3H1JG 2FXMA 3RL0g 1GMJA 1Q90D 1VL2A 1G1JA 1LGHB 2WT7B 2B89A 4YPCA 3G4SP 2KYVA 1BE3E 1YYCA 3H1ID 3WUVA 3B5NA 2KNCA 3C8VA 2V7QH 3BCCG 4H44C 2J59M 1M90Q 2LKMA 1NTZK 3HD7C 2IZ0A 3GHGB 2KUBA 1SS1A 3TDKA 4H13C 3ZDMA 2A06D 1L0NG 4CPGA 1M7LA 5GTHE 1L2PA 3H1IJ 2WSSH 3TGUE 1EDLA 1N73A 1JUNA 3OW2O 1SQBK 2E5TA 2D2CC 3LIDA 4DZOA 3CL3D 3CWBG 3MTUE 5CCGD 3Q5SA 1K73Q 2WSEJ 4PV1B 3CC4P 1S9KE 3JC22 1W2EA 1KN7A 1U7MA 2ZFCA 3EQ2A 1ZN5A 1JB0J 3L4FA 3HE5B 1RF1B 2Q1KA 3HUSB 4LC1A 5AW9B 3CX5H 3MHVA 1PP9G 3NFQA 4ASWA 3F89A 2M3BA 2IDBA 5E79H 3TNUA 1AJYA 3AE5C 3O6QA 5H2FH 3SFEC 5KKZB 1SFCC 1VF5D 1VQ7P 3CC2P 3KDPB 2VRSA 1LTJA 5KLVK 1Q81Q 3BCCJ 4ZNCA 2IYOA 3A2AA 2IBZG 4RESB 1JEKA 1N73C 1NTME 3CMEP 2QJYB 4RO0A 4H13B 3AE4C 3CX5E 1SP4A 3V4QA 1QVGO 2Y9YA 1E79H 3JSVC 3HD7B 3RK3B 1R5LA 2KP8A 2KLVA 3HE4B 1VDFA 1L0NJ 1USDA 3V4WA 1S72P 1VQ5P 3MP7B 1BDDA 1SQXE 1K05A 1X0TA 3RBXA 1Q7YQ 1OVRA 5CCHC 1LT9B 2IZ1A 1SQXD 1N7SD 4RKUJ 2ZT9D 3O8ZA 1PPJD 2P10A 1GDTA 4PJ0E 1T3UA 5AW8B 1UIIA 1URQD 4Y28J 4BRYA 3E1IA 1S2EA 1QX8A 3CXHD 3S4RA 3G9RA 3GF7A 2FFDB 2KS1B 2E75B 2FYUG 3A0HE 4C46A 3D71A 2B87B 4TT3H 1Q2NA 1L4AB 2H89C 4RJTA 2LXBA 2YKPA 5AW1B 1OFCX 1FZAA 3FXEA 1JY3N 1KILC 2W8ZA 1SQPJ 1SQQD 2N9YB 1KQGB 3CWBD 1VQMP 3QWOC 1U57A 2XNDH 1KILB 1NYHA 1FAVA 5TJHA 3IN6A 1YQ3C 1JNMA 4IFFA 2YIUB 2YO2A 1M1KQ 3L75E 5AVVB 1LWUC 1KYOE 2JP3A 1L4AC 2R5DA 3VTPC 1PP9D 2NPSA 4H0LC 4PD4E 3RK2D 2E42A 1H0TB 1SQBJ 1BE3D 1KQSO 3CI9A 1YITP 3TF5A 1BSNA 3AE1C 2HODB 3CMAP 2Q3IA 3IF4A 1NU1D 1PGOA 1RF0C 2J5UA 1H89A 4C7NB 3VMAA 1NOHA 3CCEP 1NAFA 2QA4P 4WY4C 4WY4D 2A45G 2HR3A 3RK2B 1EXJA 1S1CX 1FBMA 2OTKE 3KHUA 4YTPC 5KAIH 1BSHA 1GTWA 1VPCA 4D6TD 1DD4A 3M9BA 1NTKK 1J1DB 3N4XA 3RGUA 3RL0D 1PGJA 1USEA 3OAKA 1RE4A 1RF1C 3RK3D 2WTYA 2E74D 2KI7B 1L0LK 3UIAA 3V2QA 1MFTA 1JCCA 2OQQA 2QJKB 4TLFA 2A45I 1SQXG 1N8RQ 1SQQG 2V4HA 3AEDC 3H1LJ 5KAIE 1CI6B 3V2PA 1S3JA 5KLVD 1SFCB 3V6IA 5AW5B 3L70J 1Q82Q 2BEZF 3D70A 1VQ6P 1JY2N 1BGYJ 1NU1E 4ZKPA 1FU1A 3M0DA 3EFFK 1QLED 2BCCJ 3P32A 2JEEA 3CXHI 2O3JA 1YIJP 1EDJA 2QRXA 5L8RJ 5CJ4A 1PL5A 2WVRA 1NH4A 2RH0A 3MZWB 1M1JA 3JCUH 4GODA 2K88A 1LWUB 1ZMEC 1FZFA 4KJMA 3WU2H 3VOPA 3P7KA 1H8AA 2FXPA 2OYOA 1HVVA 1AQTA 4O9BA 3L71D 2WPQA 1OIPA 1ZV8A 3G3ZA 4MN4C 4UB6E 3GF3A 4DJGA 5CCGA 3EWKA 3L75G 3HTKA 1BE3G 5AW4B 3BCCD 1IFNA 3U59A 1J2JB 3RK3E 3I56P 1ZOYC 3KXDA 1ZW0A 1KORA 1SVFA 2B9BA 2HYNA 2QSIA 2WPVB 2WWWA 3FGAD 3KZIH 3L75D 3T97B 1SLQA 5AVYB 1CZQA 1UIXA 2W83C 1L0NE 3VP9A 2R5BA 2R44A 5APTA 1LTTC 3AEGC 1LT9C 4UB6H 1LTAC 3BVHA 2K3RA 3V2NA 1RY3A 1SQVG 1EXIA 1OZHA 3C9IA 4WVZA 2FBWC 3AE7C 1YJNP 1YI2P 4H0LD 2FYZA 1KYOH 2HG5D 2W27A 1BCCE 3SWKA 2Y0EA 2XKMA 1BCCD 1SQPE 2Q7CA 3CX5I 4AQRD 4EYYQ 2WITA 1Y8AA 2M8RA 1KZUB 2IX7C 2R32A 5AVXB 2M5AA 1JOCA 3OA7A 1KILD 1LTJB 2XNXA 3CPWO 3MIWA 2ZYAA 4NPFX 4PJ0H 1GL2A 1KILE 1VF5B 3BRTB 2N1TA 3AECC 1JTHA 1KQFB 1JO5A 2IBZE 2K9JB 5CCGC 3K5BA 3CCSP 5APWA 1GK6A 1IFPA 1NU1G 2Y9ZA 2QM7A 2H8PD 2E74C 2MKVA 3L72J 1EDKA 1URQC 2ZYGA 3RK3C 1P84I 3E1RA 1JY2P 3R4YA 4H13D 3A3YB 3TGUJ 1SQXJ 1LTIC 1N7SC 1GZLA 5APYA 1DX7A 1RHZB 3L74G 3HD7D 1OVUA 3RL0C 2P58A 2IYPA 4NPEA 2QM8A 1SQBD 4HKZH 4R4LA 2V7QJ 3SSUA 2LR2A 4WY4B 3L73E 5KLIC 3GHGA 1XTGB
chains in the Genus database with same CATH topology
3H1HJ 3BCCJ 3CX5I 1KB9I 2FYUJ 1SQPJ 1SQQJ 1NTMJ 1BE3J 1PP9J 3H1IJ 3H1KJ 1L0NJ 1EZVI 3L73J 3H1LJ 1SQBJ 3L72J 3L70J 1P84I 1BGYJ 3L71J 1KYOI 4U3FJ 1SQXJ 4PD4I 3TGUJ 3CWBJ 1NU1J 1NTZJ 2BCCJ 2IBZI 3CXHI 1SQVJ 3H1JJ 4D6TJ 5KLVJ 1NTKJ 3L75J 1BCCJ 3L74J 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H J;  3BCC J;  3CX5 I;  1KB9 I;  2FYU J;  1SQP J;  1SQQ J;  1NTM J;  1BE3 J;  1PP9 J;  3H1I J;  3H1K J;  1L0N J;  1EZV I;  3L73 J;  3H1L J;  1SQB J;  3L72 J;  3L70 J;  1P84 I;  1BGY J;  3L71 J;  1KYO I;  4U3F J;  1SQX J;  4PD4 I;  3TGU J;  3CWB J;  1NU1 J;  1NTZ J;  2BCC J;  2IBZ I;  3CXH I;  1SQV J;  3H1J J;  4D6T J;  5KLV J;  1NTK J;  3L75 J;  1BCC J;  3L74 J;  1L0L J; 
#chains in the Genus database with same CATH topology
 2QJK C;  4BRY B;  1XTC C;  2ZYD A;  3GG2 A;  2QIW A;  2YO3 A;  1N7S B;  4JF7 A;  2PFX A;  1G2C B;  1LP1 B;  1M56 D;  3HUS C;  1URQ B;  2UWJ E;  4I7Z C;  3D6Z A;  2P7J A;  3L72 E;  1KFM A;  3M06 A;  3S9O A;  1NJI Q;  1MFZ A;  4R4M A;  1MV8 A;  2FXO A;  2W6A A;  2WPS A;  3PJS K;  3JCU E;  1Y9B A;  5APU A;  3RK2 C;  3B71 A;  1L4A D;  3USS A;  1OXZ A;  5GTI E;  2MJZ A;  1HTL C;  2YIU C;  4GT1 A;  1VF5 C;  1SFC D;  1QVF O;  1X9V A;  3MUD A;  3NXS A;  3VP8 A;  1OWA A;  2B88 A;  3AE3 C;  3P8C D;  1SQV E;  2BCC D;  5BU5 A;  4K35 A;  3BAS A;  3D6Y A;  1H0T A;  3WUU A;  1VQO P;  1HGV A;  3LW5 J;  5AW2 B;  1HJB A;  1U7J A;  1WT6 A;  1SQV J;  5K5G B;  5KLV J;  2HPC B;  3H32 B;  4L75 A;  5GTI H;  1NGM B;  2E75 C;  2OAR A;  1KFN A;  3H1I E;  3CXH H;  1KD1 Q;  1JCD A;  2D2C D;  1L0L J;  1P84 D;  3IAO A;  2FFD C;  2ZXE B;  3M9Q A;  1IK9 A;  2O01 J;  1ZR4 A;  1YJW P;  4IFM A;  3L71 E;  2BEQ D;  4OGQ D;  4WB4 A;  2FYU J;  4EI2 A;  2ZT9 C;  4DCK A;  4GOF A;  2CPB A;  5AVW B;  1HWT C;  5CCH D;  2YXR B;  2C9N Y;  4H44 D;  5E79 E;  3WMM 0;  2BAS A;  3L72 D;  1S9K D;  1EC5 A;  3B5N D;  3MGN A;  1IZN B;  2WPR A;  3A7O A;  1KYO D;  3M0A A;  1WRG A;  1LJ2 A;  3O6Q B;  3CCR P;  2KK7 A;  3AEF C;  1FZC B;  2C9L Y;  4GOE A;  2JR8 A;  2N1T C;  3L70 E;  5APX A;  2Z4E A;  1ZRT D;  5AVT B;  3VMX A;  1T2K C;  1NTZ J;  2OTJ P;  2KXP B;  3OJA B;  2IBZ I;  1EZV D;  1SQQ E;  2KZJ A;  2W6B A;  2WSF H;  5KLV G;  3Q3D A;  1JMB A;  4L76 A;  3PH0 A;  4I1L A;  3P8M C;  2KLU A;  4GIF A;  4Y99 B;  1QEX A;  4ASV A;  5KKZ C;  1ZLL A;  1FZE A;  2ZVO B;  3KZI E;  1GU5 A;  1VQ4 P;  2N9B A;  1P84 H;  2WZ7 A;  3AEE C;  1SQP K;  3II6 A;  1AFO A;  3AE6 C;  3AEB C;  3GMA A;  1X22 A;  3E7K A;  2QJY C;  4LGD E;  2ITA A;  2Z5H A;  1FS0 E;  1S5L X;  2JDI H;  2SPZ A;  4OWF A;  3Q5P A;  1NTM J;  2Y0C A;  1TU3 F;  1PP9 J;  2OYH A;  1YTZ I;  1SQQ K;  4XA4 A;  1GD2 E;  3GW6 A;  3A0B H;  3ABV C;  2M0B A;  4A7P A;  2GUV A;  3L74 D;  3L73 D;  1RF1 A;  1KB9 H;  3CLQ A;  1FDM A;  3HUS A;  1W5C E;  1RQU A;  2G3A A;  1M57 D;  1DD3 A;  3HRN A;  1IK7 A;  1LT1 A;  2KZI A;  3CCQ P;  1J1D C;  1RE3 C;  1PZQ A;  1AVY A;  3EFG A;  3H1L G;  5B66 E;  3CCU P;  2E76 C;  3H1I G;  2ZAE B;  5DJT B;  3CC7 P;  1IO4 A;  3L75 J;  3TK1 A;  4BXL A;  1NAY A;  1HJ0 A;  3A0B E;  2D2C B;  5AW0 B;  3M0D C;  1KIL A;  2OYI A;  2QG4 A;  1FOS E;  2O1K A;  2RMZ A;  1SQV D;  1L0N D;  2BCC E;  1X8Y A;  1GL2 D;  2FY8 A;  4DOJ A;  5TIS H;  1KC8 Q;  2IPP A;  5KTB A;  5B66 H;  3AEA C;  2OYI C;  2AXT E;  2NPS C;  2YKO A;  3H1H E;  1BCC G;  4H44 B;  2HOD A;  2JJL A;  4H0L B;  1VQL P;  1SQP G;  1JM0 A;  1NO4 A;  2K9Y A;  1NKN A;  2QE7 H;  2YMY A;  3CXH E;  3FX0 A;  5AVZ B;  1AA0 A;  1KV4 A;  2ZJS E;  3F5H A;  1GW3 A;  1NU1 K;  1SQV K;  1EZV G;  2DW3 A;  3VMZ A;  1VQP P;  3M91 A;  2Q9I A;  1KB9 D;  2W6J H;  1PGP A;  4EIJ A;  4K3A A;  2JKV A;  2Q3E A;  2ZVN B;  4HYT B;  5APV A;  2Q5U A;  4IFD K;  1L0L E;  1NTK J;  2GM4 A;  2O1J A;  1QL2 A;  4UB8 E;  1AV1 A;  1OX3 A;  3H1H J;  4IL6 X;  2O01 H;  1NTK E;  2AEM A;  1Q86 Q;  1FJK A;  2Y0D A;  3L74 E;  4JPZ B;  1Y47 A;  5KJ7 C;  1NVO A;  1KB9 I;  3H1J D;  1NTM D;  2L5G B;  2KOG A;  3LW5 H;  1FJP A;  4HH2 A;  1L4A A;  1JY3 O;  2XU6 A;  5B5E H;  3L73 G;  5AW6 B;  2WT7 A;  4HB1 A;  2Z5I A;  3H1K G;  2KNC B;  5H2F E;  3SFD C;  3PHL A;  4UB8 H;  1EZV I;  3SWY A;  4JYB A;  3B8E B;  3V5B A;  4N78 E;  3I55 P;  3CCV P;  2AXC A;  4D6T E;  3AE9 C;  4ZMD A;  3CD6 P;  3L72 G;  1SQP D;  3RBZ A;  4BWN A;  1NTZ D;  1M1J C;  4EDF A;  2NPS B;  1NWQ A;  1N73 B;  2HFE D;  5BVZ A;  1BGY E;  1NU1 J;  1YBK A;  2I8D A;  3HE4 A;  3MD0 A;  1PIX A;  1YTZ T;  2YKQ A;  3C1L A;  4XE5 B;  3H1J J;  1K9M Q;  2K37 A;  4EOT A;  4W7Y A;  1BCC J;  2BCC G;  4YXW H;  2M3E A;  2WMM A;  4AUW A;  1J1E B;  4YXD C;  3G71 P;  4W7Z A;  1RE3 A;  1LTG C;  5AW3 B;  2G8Y A;  2YXQ B;  2HPC A;  3CCJ P;  4JBZ A;  2NZ2 A;  3TNU B;  2NPS D;  2WSF J;  3H1H G;  5EFW B;  3KPE A;  2QVA A;  1A02 F;  1OW6 A;  1PFI A;  1AQ5 A;  1T8Z A;  2FFD A;  2KS1 A;  4Z1M H;  1T3J A;  2JWD A;  4PV1 C;  1MUU A;  2AEF A;  3NTN A;  1ZP0 C;  4AYC A;  2E43 A;  2I1J A;  3L71 G;  3I5C A;  1JY3 P;  1M8O B;  1HUC A;  3H1J E;  1L0N K;  4OGQ B;  2P67 A;  1P84 E;  1ZRT E;  3VMY A;  3MUD C;  3GHG C;  1NTK D;  1Z56 A;  4KHX A;  4U7J A;  1CI6 A;  3CWB J;  3U1A A;  5APQ A;  1YHQ P;  2OGU A;  1FDI A;  1N2D C;  3FWL A;  2ZXX A;  3IFM A;  2GA1 A;  3B5N B;  4W80 A;  5KJ7 D;  3V2R A;  1NTK G;  4N78 D;  4WWI A;  2JO1 A;  1G2C A;  1IFJ A;  1LP1 A;  1PV3 A;  2K1A A;  3B4S A;  1NTM K;  3IR9 A;  3M9H A;  1GL2 B;  1EQ7 A;  1KB9 E;  1RF0 A;  3L70 G;  4IL6 E;  3R2P A;  1VQ9 P;  2XV5 A;  3H1K D;  4PV1 D;  5KAF E;  1LWU A;  3HTK B;  5AW7 B;  2PP6 A;  3VYI A;  2A45 H;  3CWB E;  3TSI A;  5KLV E;  1W2B O;  4U3F E;  2CK3 H;  5M1B A;  1LTJ C;  2B87 A;  3L35 A;  1GK4 A;  1JY2 O;  2J58 A;  1LNQ A;  2R3S A;  4PD4 D;  3ITK A;  4ZKU A;  1PP9 E;  2AEJ A;  4QMA A;  3L73 J;  5AVU B;  2I1K A;  2PGD A;  3HE5 A;  4M3L A;  5CJ0 A;  1FZB A;  2KB7 P;  2WSC H;  4IL6 H;  2OYH B;  4Y99 C;  1G1I A;  1DEE G;  5KAF H;  1RH5 B;  3PP5 A;  3TYY A;  5CBO A;  1KMI Z;  3T97 A;  1T2K D;  3KQG A;  1SQB E;  2N1T D;  1OW7 A;  1N86 A;  3NMD A;  2H43 A;  2QJP B;  3VN0 A;  1R8E A;  5GTH H;  1GL2 C;  1IFI A;  1FZC C;  1NTM G;  2OYH C;  3L74 J;  4N6J A;  2WQY C;  1IFD A;  4C7R A;  5BU8 B;  1GW4 A;  3H1L D;  1DIP A;  3B5N C;  2IFN A;  2M5A B;  4XFJ A;  1NTZ E;  2XZR A;  3H1L E;  3WUT A;  3CCL P;  2QEX P;  2POH A;  4C7N A;  1FZG A;  3HD7 A;  1RQV A;  2OYI B;  1PPJ E;  2CPS A;  3CX5 D;  1FOS F;  4HJG H;  1YJ9 P;  1KTM A;  2OTL P;  5DJU B;  2FKW B;  3W67 A;  3TGU D;  3GLM A;  4OGQ C;  5AVS B;  3H6P A;  4L74 A;  1DH3 A;  2RN0 A;  5APS A;  1K8A Q;  3W68 A;  1LT9 A;  3A5T A;  1R5S A;  2E75 D;  3WU2 E;  2A06 G;  3G6E P;  2FYU E;  1NKZ B;  1KYO I;  3L71 J;  4I7Z B;  2FYU D;  5B5E E;  2YNY A;  2FYN B;  4U3F D;  1VQK P;  1EZV E;  1SFC A;  1L0L D;  2E5Y A;  1EDI A;  2IBZ D;  1J1E C;  1OVV A;  2GUS A;  4NPD A;  4IOI H;  1NHL A;  3PLN A;  5AVR B;  3LIE A;  1N7S A;  1IFM A;  1YQ4 C;  5KLI B;  4I6M C;  2FYN C;  4U3F G;  3QH9 A;  1URQ A;  4B86 A;  1FC2 C;  1VQN P;  1L0L G;  2HLO A;  5CBN A;  3BAT A;  2E76 B;  1M1J B;  2IFM A;  3AE8 C;  3BCC E;  2NRG A;  1A02 J;  2PAJ A;  2Q6Q A;  1SQQ J;  2W90 A;  1CW5 A;  1FDO A;  3AE2 C;  3FXD A;  1RE4 C;  2O01 N;  4L73 A;  2WSC J;  1AVO A;  4WBA A;  1BDC A;  1PGQ A;  5C39 A;  3H1H D;  1MZ9 A;  5CMZ A;  3A0H H;  3Q1M A;  1OW8 A;  1JMM A;  1OMI A;  1S4X A;  3BRV B;  3FWN A;  5AVQ B;  1FE6 A;  1LTB C;  1WMK A;  1ZXG A;  1HH0 A;  2P2U A;  4JYC A;  3TGU G;  1SQX K;  1SQB G;  1N7L A;  2YMK A;  5CCH A;  1QGK B;  2E76 D;  2XDJ A;  3H1K E;  2P1J A;  4PD4 I;  1D7M A;  2N1T B;  2KSJ A;  2R3C A;  1X79 B;  1IJD B;  1JTH B;  2WSE H;  3RL0 B;  2C0W A;  4D6T G;  4OH8 B;  1NTZ G;  2E74 B;  4N3Y B;  3KYQ A;  2KIK A;  2KSE A;  1PPJ G;  3H32 A;  3P8C E;  1BGY G;  4PD4 H;  2QJP C;  1K04 A;  4DT0 A;  3SWF A;  3PRJ A;  5TIS E;  5CHX A;  1VQ8 P;  3PTZ A;  1HBW A;  1S5L E;  1IC2 A;  2LXC B;  4I2L C;  3Q5R A;  4WY4 A;  3L70 D;  3L36 A;  3H25 A;  1BE3 J;  1BGY D;  3U1C A;  1T6A A;  3H1K J;  2A06 E;  2C0X A;  3N7N A;  4GKG A;  2L91 A;  2RKL A;  1GU4 A;  1KQL A;  2FYU K;  3CCM P;  1E5W A;  1HGZ A;  5KJ7 A;  3Q2Y A;  1QL1 A;  1DEB A;  2JWA A;  2PRR A;  3L37 A;  4LLH A;  1MKM A;  2H88 C;  4U3F J;  4OVN F;  1S5L H;  4JQ0 D;  4KT0 J;  2K9J A;  1ZR2 A;  1LTS C;  2AXT H;  1CSB A;  2ZT9 B;  4GDO A;  3S1K A;  1FZC A;  1HF9 A;  2H7H A;  4D6T J;  1H88 A;  3H1J G;  2FXM A;  3RL0 g;  1GMJ A;  1Q90 D;  1VL2 A;  1G1J A;  1LGH B;  2WT7 B;  2B89 A;  4YPC A;  3G4S P;  2KYV A;  1BE3 E;  1YYC A;  3H1I D;  3WUV A;  3B5N A;  2KNC A;  3C8V A;  2V7Q H;  3BCC G;  4H44 C;  2J59 M;  1M90 Q;  2LKM A;  1NTZ K;  3HD7 C;  2IZ0 A;  3GHG B;  2KUB A;  1SS1 A;  3TDK A;  4H13 C;  3ZDM A;  2A06 D;  1L0N G;  4CPG A;  1M7L A;  5GTH E;  1L2P A;  3H1I J;  2WSS H;  3TGU E;  1EDL A;  1N73 A;  1JUN A;  3OW2 O;  1SQB K;  2E5T A;  2D2C C;  3LID A;  4DZO A;  3CL3 D;  3CWB G;  3MTU E;  5CCG D;  3Q5S A;  1K73 Q;  2WSE J;  4PV1 B;  3CC4 P;  1S9K E;  3JC2 2;  1W2E A;  1KN7 A;  1U7M A;  2ZFC A;  3EQ2 A;  1ZN5 A;  1JB0 J;  3L4F A;  3HE5 B;  1RF1 B;  2Q1K A;  3HUS B;  4LC1 A;  5AW9 B;  3CX5 H;  3MHV A;  1PP9 G;  3NFQ A;  4ASW A;  3F89 A;  2M3B A;  2IDB A;  5E79 H;  3TNU A;  1AJY A;  3AE5 C;  3O6Q A;  5H2F H;  3SFE C;  5KKZ B;  1SFC C;  1VF5 D;  1VQ7 P;  3CC2 P;  3KDP B;  2VRS A;  1LTJ A;  5KLV K;  1Q81 Q;  3BCC J;  4ZNC A;  2IYO A;  3A2A A;  2IBZ G;  4RES B;  1JEK A;  1N73 C;  1NTM E;  3CME P;  2QJY B;  4RO0 A;  4H13 B;  3AE4 C;  3CX5 E;  1SP4 A;  3V4Q A;  1QVG O;  2Y9Y A;  1E79 H;  3JSV C;  3HD7 B;  3RK3 B;  1R5L A;  2KP8 A;  2KLV A;  3HE4 B;  1VDF A;  1L0N J;  1USD A;  3V4W A;  1S72 P;  1VQ5 P;  3MP7 B;  1BDD A;  1SQX E;  1K05 A;  1X0T A;  3RBX A;  1Q7Y Q;  1OVR A;  5CCH C;  1LT9 B;  2IZ1 A;  1SQX D;  1N7S D;  4RKU J;  2ZT9 D;  3O8Z A;  1PPJ D;  2P10 A;  1GDT A;  4PJ0 E;  1T3U A;  5AW8 B;  1UII A;  1URQ D;  4Y28 J;  4BRY A;  3E1I A;  1S2E A;  1QX8 A;  3CXH D;  3S4R A;  3G9R A;  3GF7 A;  2FFD B;  2KS1 B;  2E75 B;  2FYU G;  3A0H E;  4C46 A;  3D71 A;  2B87 B;  4TT3 H;  1Q2N A;  1L4A B;  2H89 C;  4RJT A;  2LXB A;  2YKP A;  5AW1 B;  1OFC X;  1FZA A;  3FXE A;  1JY3 N;  1KIL C;  2W8Z A;  1SQP J;  1SQQ D;  2N9Y B;  1KQG B;  3CWB D;  1VQM P;  3QWO C;  1U57 A;  2XND H;  1KIL B;  1NYH A;  1FAV A;  5TJH A;  3IN6 A;  1YQ3 C;  1JNM A;  4IFF A;  2YIU B;  2YO2 A;  1M1K Q;  3L75 E;  5AVV B;  1LWU C;  1KYO E;  2JP3 A;  1L4A C;  2R5D A;  3VTP C;  1PP9 D;  2NPS A;  4H0L C;  4PD4 E;  3RK2 D;  2E42 A;  1H0T B;  1SQB J;  1BE3 D;  1KQS O;  3CI9 A;  1YIT P;  3TF5 A;  1BSN A;  3AE1 C;  2HOD B;  3CMA P;  2Q3I A;  3IF4 A;  1NU1 D;  1PGO A;  1RF0 C;  2J5U A;  1H89 A;  4C7N B;  3VMA A;  1NOH A;  3CCE P;  1NAF A;  2QA4 P;  4WY4 C;  4WY4 D;  2A45 G;  2HR3 A;  3RK2 B;  1EXJ A;  1S1C X;  1FBM A;  2OTK E;  3KHU A;  4YTP C;  5KAI H;  1BSH A;  1GTW A;  1VPC A;  4D6T D;  1DD4 A;  3M9B A;  1NTK K;  1J1D B;  3N4X A;  3RGU A;  3RL0 D;  1PGJ A;  1USE A;  3OAK A;  1RE4 A;  1RF1 C;  3RK3 D;  2WTY A;  2E74 D;  2KI7 B;  1L0L K;  3UIA A;  3V2Q A;  1MFT A;  1JCC A;  2OQQ A;  2QJK B;  4TLF A;  2A45 I;  1SQX G;  1N8R Q;  1SQQ G;  2V4H A;  3AED C;  3H1L J;  5KAI E;  1CI6 B;  3V2P A;  1S3J A;  5KLV D;  1SFC B;  3V6I A;  5AW5 B;  3L70 J;  1Q82 Q;  2BEZ F;  3D70 A;  1VQ6 P;  1JY2 N;  1BGY J;  1NU1 E;  4ZKP A;  1FU1 A;  3M0D A;  3EFF K;  1QLE D;  2BCC J;  3P32 A;  2JEE A;  3CXH I;  2O3J A;  1YIJ P;  1EDJ A;  2QRX A;  5L8R J;  5CJ4 A;  1PL5 A;  2WVR A;  1NH4 A;  2RH0 A;  3MZW B;  1M1J A;  3JCU H;  4GOD A;  2K88 A;  1LWU B;  1ZME C;  1FZF A;  4KJM A;  3WU2 H;  3VOP A;  3P7K A;  1H8A A;  2FXP A;  2OYO A;  1HVV A;  1AQT A;  4O9B A;  3L71 D;  2WPQ A;  1OIP A;  1ZV8 A;  3G3Z A;  4MN4 C;  4UB6 E;  3GF3 A;  4DJG A;  5CCG A;  3EWK A;  3L75 G;  3HTK A;  1BE3 G;  5AW4 B;  3BCC D;  1IFN A;  3U59 A;  1J2J B;  3RK3 E;  3I56 P;  1ZOY C;  3KXD A;  1ZW0 A;  1KOR A;  1SVF A;  2B9B A;  2HYN A;  2QSI A;  2WPV B;  2WWW A;  3FGA D;  3KZI H;  3L75 D;  3T97 B;  1SLQ A;  5AVY B;  1CZQ A;  1UIX A;  2W83 C;  1L0N E;  3VP9 A;  2R5B A;  2R44 A;  5APT A;  1LTT C;  3AEG C;  1LT9 C;  4UB6 H;  1LTA C;  3BVH A;  2K3R A;  3V2N A;  1RY3 A;  1SQV G;  1EXI A;  1OZH A;  3C9I A;  4WVZ A;  2FBW C;  3AE7 C;  1YJN P;  1YI2 P;  4H0L D;  2FYZ A;  1KYO H;  2HG5 D;  2W27 A;  1BCC E;  3SWK A;  2Y0E A;  2XKM A;  1BCC D;  1SQP E;  2Q7C A;  3CX5 I;  4AQR D;  4EYY Q;  2WIT A;  1Y8A A;  2M8R A;  1KZU B;  2IX7 C;  2R32 A;  5AVX B;  2M5A A;  1JOC A;  3OA7 A;  1KIL D;  1LTJ B;  2XNX A;  3CPW O;  3MIW A;  2ZYA A;  4NPF X;  4PJ0 H;  1GL2 A;  1KIL E;  1VF5 B;  3BRT B;  2N1T A;  3AEC C;  1JTH A;  1KQF B;  1JO5 A;  2IBZ E;  2K9J B;  5CCG C;  3K5B A;  3CCS P;  5APW A;  1GK6 A;  1IFP A;  1NU1 G;  2Y9Z A;  2QM7 A;  2H8P D;  2E74 C;  2MKV A;  3L72 J;  1EDK A;  1URQ C;  2ZYG A;  3RK3 C;  1P84 I;  3E1R A;  1JY2 P;  3R4Y A;  4H13 D;  3A3Y B;  3TGU J;  1SQX J;  1LTI C;  1N7S C;  1GZL A;  5APY A;  1DX7 A;  1RHZ B;  3L74 G;  3HD7 D;  1OVU A;  3RL0 C;  2P58 A;  2IYP A;  4NPE A;  2QM8 A;  1SQB D;  4HKZ H;  4R4L A;  2V7Q J;  3SSU A;  2LR2 A;  4WY4 B;  3L73 E;  5KLI C;  3GHG A;  1XTG B; 
#chains in the Genus database with same CATH homology
 3H1H J;  3BCC J;  3CX5 I;  1KB9 I;  2FYU J;  1SQP J;  1SQQ J;  1NTM J;  1BE3 J;  1PP9 J;  3H1I J;  3H1K J;  1L0N J;  1EZV I;  3L73 J;  3H1L J;  1SQB J;  3L72 J;  3L70 J;  1P84 I;  1BGY J;  3L71 J;  1KYO I;  4U3F J;  1SQX J;  4PD4 I;  3TGU J;  3CWB J;  1NU1 J;  1NTZ J;  2BCC J;  2IBZ I;  3CXH I;  1SQV J;  3H1J J;  4D6T J;  5KLV J;  1NTK J;  3L75 J;  1BCC J;  3L74 J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...