3L70J

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l70J00
1NTZJ 4PD4I 3H1JJ 1L0NJ 3L71J 1SQXJ 3L73J 1BGYJ 2IBZI 1NTKJ 3BCCJ 5KLVJ 1SQVJ 3H1LJ 1NTMJ 1KB9I 3CX5I 3H1KJ 4U3FJ 3CXHI 3H1HJ 1EZVI 3TGUJ 3L75J 3L74J 3H1IJ 1BCCJ 1KYOI 3CWBJ 2BCCJ 3L72J 1P84I 1BE3J 4D6TJ 1PP9J 1NU1J 1SQBJ 1SQPJ 1SQQJ 3L70J 2FYUJ 1L0LJ
chains in the Genus database with same CATH superfamily
4Y28J 1ZOYC 2YO2A 4JF7A 3CC4P 1DX7A 2NRGA 3PJSK 2YO3A 5KLIB 3L36A 5KAIH 1VQPP 1SQVG 3AE7C 1KV4A 3MHVA 1EZVD 1X22A 1JY3N 2OTKE 4GDOA 1USDA 4H13C 2XZRA 4CPGA 2JDIH 2WSSH 3S9OA 3GHGC 1JY3P 2HODA 2LXBA 1AVYA 1HTLC 3H1KG 1FOSE 3H1IE 1SQPD 1NU1K 1SQXG 2R5BA 1SQQD 3L73G 3JSVC 1LTSC 5KKZC 2BCCG 1KQGB 3AEGC 3CWBJ 3EFGA 3HD7B 2G8YA 1SQVK 3ITKA 4PV1B 1DEEG 1VDFA 2KB7P 2ZYGA 4B86A 1LTGC 1OFCX 3VMZA 1JY3O 2E5YA 1L0LG 1Y8AA 2FYUJ 1PGOA 1AJYA 2BCCD 1NTZJ 2CK3H 3TGUG 2JWDA 1M1JA 3CXHE 1MFTA 3A0BH 2E74B 2XDJA 1BCCG 3HTKB 4RESB 1N7SA 3CWBG 3E1RA 3P8CE 3VN0A 3H32B 5KLVE 1FZCC 1L0LD 1FAVA 1P84E 4L74A 1LTIC 3BCCE 2KLUA 1NTMJ 2HODB 3H32A 4U7JA 1YITP 2H8PD 1EXIA 1M8OB 4EOTA 3H1HJ 1Y47A 2K37A 1IC2A 1SQBD 5DJUB 1EZVI 3RL0D 1PGJA 5KTBA 3M0AA 4Y99C 1WT6A 5KJ7A 1HBWA 4Y99B 1LWUB 3MTUE 3CL3D 1VL2A 1S9KD 2POHA 4C7RA 3L72E 1CI6B 1BCCE 2KSEA 3M9HA 3SSUA 1NTKD 2Y9ZA 5CCGD 2R3SA 1CI6A 2ZT9B 2YMKA 3HUSB 1DIPA 3L75D 4I2LC 2QEXP 4JPZB 2MJZA 1OW6A 1NAYA 1LTJA 2H43A 3Q2YA 2H7HA 3HE5A 3R2PA 4PD4I 1G1JA 1L0NJ 1FOSF 2RH0A 5KAFE 4I7ZC 1LWUC 3KXDA 4H0LD 4RKUJ 4JQ0D 5AVUB 1LJ2A 2AXTE 5AW6B 3VP8A 2AXCA 3MGNA 4H44D 1SQPK 1YIJP 2ZYDA 2O1KA 2K9YA 2JP3A 3H1JG 4N78E 1L4AA 2HFED 2W8ZA 1YYCA 3T97B 2FXPA 1N7SB 3H1KE 3V6IA 2HPCA 1IFNA 1SFCB 4O9BA 1HVVA 3OW2O 2P67A 2C0XA 2ZXXA 3LW5J 3N4XA 1VQLP 1RE3C 3D6YA 3C9IA 1NU1E 1K8AQ 3KYQA 1ZR4A 1Q82Q 1M7LA 3L35A 5CCHC 4N6JA 4D6TJ 4KT0J 1UIIA 1SP4A 1AVOA 2YKOA 1VQ6P 5AW9B 1S72P 1JNMA 4H13B 1BSHA 1W2EA 2YKPA 1T3UA 2IYOA 4IL6X 1BDDA 1Y9BA 3CMAP 3JCUE 3HD7C 2ZVNB 2IZ0A 2P58A 2E74C 2R32A 3RBZA 5KKZB 1K9MQ 2IFNA 2ITAA 2WPQA 1R8EA 2W83C 1FE6A 1KMIZ 1X0TA 3AE6C 1HF9A 3L37A 4D6TG 3RL0g 1FDMA 5KAFH 2DW3A 4UB8E 2O01H 3TDKA 1PL5A 3CX5D 4JBZA 1NTKK 2FYUK 3MIWA 1KQSO 2WQYC 1FC2C 2WSFJ 4WY4C 3PHLA 4UB8H 2QJPB 3CCLP 4PV1C 3EQ2A 3SFEC 1PPJE 1URQD 1H0TB 1GL2A 4M3LA 3Q5SA 3CWBE 2CPBA 3PP5A 4KJMA 5APWA 2BCCE 5AW0B 1L0NE 1NTZK 5GTIH 2J58A 2AEJA 3CX5E 3GHGB 3S1KA 4DZOA 1NTZE 4N3YB 3H1IG 1YTZI 1VQOP 3PLNA 1VQNP 1IK7A 2E74D 2FBWC 1EZVE 3U59A 1SQQE 3P8CD 1Q7YQ 1M90Q 3AE8C 1BGYJ 1SVFA 5AVWB 4EI2A 1KILB 3LW5H 2R3CA 1GL2D 1HJBA 2PP6A 1JEKA 1IK9A 1N2DC 1SQVE 2LXCB 3NTNA 1G2CB 3CXHH 3H1ID 1NU1G 3M06A 5BU5A 2QG4A 3CD6P 3H1LE 1FZCA 2BEZF 1VF5D 3NXSA 4H44B 2P7JA 1MUUA 1S5LX 1H89A 1GDTA 2V4HA 2FFDA 2E43A 2IDBA 1IFJA 2QJKB 1OXZA 3CLQA 1BE3G 1HJ0A 1URQC 3Q1MA 1VQMP 1WRGA 1DD4A 1LT9C 1LTAC 2WPVB 2ZYAA 2XU6A 3L75E 3UIAA 1RQVA 1LT9B 1PV3A 2IBZG 1KC8Q 3G9RA 4BWNA 1OZHA 1YBKA 1K73Q 3BASA 4BXLA 2E75D 2E76D 2IZ1A 2LKMA 2FYNC 1OWAA 2GUSA 3AE2C 1J2JB 2V7QJ 3H1JJ 5B66H 4U3FD 2FYUG 4MN4C 1CW5A 2AEFA 3M9BA 1Q81Q 2IBZD 2J5UA 1JB0J 3F5HA 4ASWA 1W2BO 2W90A 3GF7A 3H1LJ 4IFFA 4K3AA 2E76B 3C1LA 5E79E 1JY2O 1VF5C 1GZLA 2ZVOB 5CCGC 1OX3A 1PGQA 3CXHI 2WSEH 2FYNB 1KORA 2QIWA 5CBOA 4IL6E 5B5EH 1BSNA 3Q5PA 2BEQD 3SFDC 2FYZA 2Z5IA 1SQBE 4H0LC 1AQ5A 1KILE 1KYOI 4PD4E 3ZDMA 2IBZE 3S4RA 3CCQP 3CC2P 4DOJA 3RK2C 5TISE 4I1LA 2H88C 4YTPC 3A0BE 1KILC 1RH5B 2XV5A 3VYIA 4EIJA 2N1TB 3AEFC 5KLVD 2QA4P 1JOCA 1SQQJ 2WITA 4NPDA 1USEA 2QJPC 5M1BA 4L73A 1KD1Q 5AW1B 1LTTC 2A45I 1SLQA 1IFMA 1L0LE 1S4XA 2WPRA 4HB1A 2QJYB 5AVYB 3VP9A 2K1AA 1GL2B 2GM4A 1YQ4C 5H2FE 3KDPB 3TNUB 1QVFO 5AW7B 1FDOA 4L75A 2QE7H 4WY4D 3BATA 3V4QA 4W7ZA 3KHUA 3CMEP 3CI9A 3AE5C 1KB9D 1JMBA 1SQXD 2K88A 1SQQG 2HR3A 2RMZA 2IPPA 3L73D 1UIXA 3G3ZA 1KB9H 4WY4B 5APQA 3V2PA 3GG2A 1U7JA 5CMZA 1FZFA 1A02J 3A0HH 1URQB 3MP7B 1KN7A 2V7QH 2KYVA 1NTMD 1IJDB 3MUDC 4LC1A 3W68A 2NPSD 1L0ND 1P84I 2JEEA 3H1JD 3TNUA 1PP9J 2D2CD 3QH9A 4GOEA 4L76A 2AXTH 3K5BA 3V2RA 1JUNA 1NKZB 1ZRTD 2KLVA 1KB9E 1Q90D 2HG5D 4LLHA 3USSA 3B5NA 2M5AA 5BVZA 4HJGH 2P2UA 1BDCA 1BGYE 2H89C 1L0NG 3H6PA 1JCDA 1N73C 2Q5UA 2IBZI 3B8EB 1OW8A 1RF1B 3IR9A 1SQVJ 1S3JA 3JC22 3TSIA 1JM0A 4DJGA 1EDLA 2OYOA 1SQBG 2OQQA 2Y0EA 4NPEA 4H13D 5L8RJ 3WU2H 3TGUE 3U1CA 1BGYG 1LP1B 1SFCC 3FWNA 5DJTB 5APVA 1GK4A 3EFFK 1L0LK 3M0DA 5APYA 3P32A 3VMAA 4ZKUA 1NO4A 2E76C 1PP9E 2E75B 2GA1A 2QJYC 3FXEA 4HH2A 3L75G 4UB6E 5AVSB 4I6MC 4NPFX 1KQFB 1N7SC 3P8MC 2AEMA 1MKMA 2FYUE 2PFXA 1NOHA 2HLOA 4AUWA 3L74D 5AVTB 1VQ8P 2YKQA 3A7OA 1H0TA 1YJWP 5CCHD 2GUVA 1GW3A 2Q6QA 1DD3A 4PV1D 5AW2B 2QM7A 4H0LB 1GW4A 1MFZA 2WZ7A 4YXDC 1PIXA 1JTHB 2OGUA 2HYNA 2YXRB 3L74G 3W67A 1RF0A 1L0NK 2WVRA 3AE9C 1KB9I 2LR2A 1N8RQ 2ZT9C 2B87B 1M1KQ 2D2CC 3RK2D 5H2FH 4ZMDA 1PP9D 3WUVA 1KILD 4YXWH 2ZJSE 2RN0A 3IN6A 4H44C 3GHGA 5GTIE 5C39A 2WWWA 3CC7P 1XTCC 1FZGA 1A02F 3B5NC 3HUSA 3L74E 1G1IA 1NTZD 1R5LA 3P7KA 4R4MA 1RQUA 3OAKA 4WB4A 4BRYB 4KHXA 3AE4C 1SQPJ 1VQ7P 2Z5HA 4PD4H 2YNYA 2OYHA 2YIUC 3L71G 1L0LJ 3IAOA 1PFIA 1EXJA 3AE1C 2Y9YA 3CCMP 2WMMA 1LGHB 4OGQC 4RJTA 2SPZA 1LP1A 4I7ZB 3V4WA 2FFDB 1FJKA 3RK3E 2N9BA 1SFCA 3BRTB 4JYCA 2UWJE 1KFNA 1RE3A 5KLVK 3T97A 1NGMB 2HPCB 3EWKA 3M0DC 2ZT9D 1E5WA 3H1KJ 1KQLA 1QX8A 1PGPA 1RY3A 2PGDA 4U3FG 3CCVP 3OA7A 3CX5H 3GW6A 1NTME 2D2CB 2IYPA 5GTHH 5B66E 1N86A 1NTMK 1OIPA 2I1JA 3B5ND 4HKZH 1AQTA 3L74J 4OWFA 3O6QB 3SWKA 3TYYA 3U1AA 4D6TE 1PZQA 3GF3A 2O01N 3HTKA 3A5TA 2YXQB 3H1HD 1NAFA 1SQBJ 3OJAB 1WMKA 4GIFA 4PJ0H 1IO4A 2N9YB 1BE3E 2QM8A 2FXOA 5AVRB 1M57D 2KZJA 4N78D 1VQ9P 2KSJA 3L71E 5EFWB 2Q1KA 2WSEJ 4TLFA 1LTJC 1LTBC 1QVGO 1RF1C 2A06E 1EC5A 3H1HG 4WY4A 3H1LG 5APUA 2O3JA 2M0BA 1QL2A 2QSIA 1SFCD 3I56P 1H8AA 2E75C 3FXDA 3BRVB 4C46A 1JTHA 1QGKB 1VF5B 3F89A 3IFMA 5AVVB 1BE3D 2VRSA 1EZVG 2E42A 1YTZT 1M1JC 3A3YB 4R4LA 2B9BA 1T3JA 1J1EB 3TGUJ 1NTZG 2FY8A 2YIUB 3VMXA 3AECC 2OYHC 1FBMA 3RK3B 2FKWB 3G71P 2MKVA 1QEXA 1SQPG 4OGQD 2W27A 4HYTB 1XTGB 4K35A 3G4SP 3H25A 1K05A 2L91A 2JJLA 2OARA 3PTZA 5TJHA 1NKNA 2QRXA 4A7PA 1NJIQ 3HE5B 1X9VA 2FXMA 1ZP0C 3HD7A 1NTMG 2KS1A 1FZBA 2XNXA 3I5CA 1T2KC 1GD2E 1HH0A 1M56D 3AE3C 1MV8A 5K5GB 3WU2E 4C7NB 1KYOE 3AEEC 1GMJA 2KI7B 3KZIH 5AW5B 3RK3C 3WUTA 2WSCH 3L72G 2FFDC 4AYCA 1URQA 1CZQA 2JO1A 2OTJP 2L5GB 1OVUA 2KK7A 4AQRD 2G3AA 1PPJG 2JR8A 3CWBD 2NPSA 3CX5I 3NFQA 4WWIA 3Q3DA 1YJNP 3TK1A 5AVZB 1FJPA 1SS1A 1RF0C 4JYBA 2ZAEB 4PJ0E 2KP8A 2IX7C 2O1JA 3N7NA 4U3FE 2ZFCA 3B5NB 5CJ0A 3RBXA 2WTYA 4DT0A 1VPCA 5AW8B 2BCCJ 1LTJB 4W7YA 5KLVG 5E79H 1IFDA 3VOPA 1RF1A 1KYOH 1L4AC 1RE4A 1BGYD 1SQPE 2M3BA 1ZV8A 1Q2NA 2N1TC 3CCJP 5GTHE 1SQVD 2C0WA 1S2EA 2K9JA 3HUSC 4XFJA 3MZWB 1AA0A 4GOFA 2QVAA 1S5LE 3QWOC 1NTKG 4OGQB 4IOIH 1SQQK 3O6QA 1ZW0A 3CPWO 2KXPB 5KLIC 1FU1A 5CCHA 2KOGA 2ZXEB 4LGDE 4W80A 1N73B 5AW3B 4OVNF 1U7MA 4EYYQ 3RL0C 3L4FA 3CCRP 1TU3F 1R5SA 1OVVA 4IFMA 4DCKA 1NH4A 1EQ7A 1FS0E 1N7SD 2JWAA 3A0HE 4RO0A 4ZKPA 1ZMEC 1KILA 2Q3IA 1YQ3C 3L70G 2OTLP 2M8RA 1EDJA 2B87A 2OYIA 1YJ9P 1JO5A 1LNQA 2R44A 4WVZA 1J1DC 1FZEA 1FZAA 3L75J 3VMYA 2I1KA 1J1DB 2PAJA 2IFMA 4C7NA 3AEDC 3RK2B 1EDKA 2C9NY 5KJ7D 2WSCJ 1NU1J 1PP9G 3FGAD 2A06G 2A45H 3V5BA 3AEBC 1YI2P 3B4SA 2M3EA 3IF4A 1S9KE 3D71A 1FDIA 2B89A 1H88A 1GU4A 5APXA 3E7KA 3L72D 4IL6H 2NPSC 3L71J 1GL2C 2WPSA 2Y0DA 3CCUP 1NTKJ 3BCCJ 1PPJD 4QMAA 1GK6A 1OW7A 4YPCA 4Z1MH 5TISH 3CCSP 3BVHA 2YMYA 1GU5A 1NVOA 1JCCA 2A45G 3MUDA 3WMM0 4IFDK 3M9QA 2Y0CA 4U3FJ 1N7LA 1QLED 3I55P 1IFPA 1RHZB 3HE4B 4D6TD 1Q86Q 2Z4EA 1RE4C 3HE4A 1G2CA 1P84D 3II6A 4XE5B 1U57A 1E79H 1SQBK 3M91A 4XA4A 5BU8B 1P84H 1BCCJ 3LIEA 3G6EP 1N73A 2K3RA 3WUUA 1T2KD 2RKLA 1ZN5A 2NZ2A 1HGVA 3ABVC 3D70A 2XKMA 1ZR2A 2J59M 2Q7CA 2KNCB 4WBAA 2P1JA 2OYIB 1ZXGA 1Z56A 1LT9A 1SQXJ 3H1JE 1LT1A 3L73J 3L70E 5CHXA 1L4AB 1HGZA 2R5DA 4ZNCA 1S1CX 5KLVJ 3TF5A 3CXHD 3PRJA 3L70D 4GT1A 1YHQP 3R4YA 2PRRA 3LIDA 2B88A 5APSA 1T6AA 1IFIA 3GMAA 2CPSA 2Q3EA 3H1HE 4OH8B 5KJ7C 2BASA 2NPSB 2WT7A 1GTWA 1VQKP 1CSBA 3FX0A 1NU1D 1L4AD 1W5CE 2KIKA 2KZIA 3FWLA 5AVQB 1HUCA 1X8YA 1S5LH 4GKGA 1HWTC 1IZNB 1MZ9A 2M5AB 3H1KD 1NWQA 2A06D 3L72J 5APTA 5KAIE 5CCGA 1EDIA 2O01J 3KPEA 3RL0B 3L71D 5AVXB 4ASVA 2KS1B 3E1IA 3KQGA 4TT3H 3AEAC 3BCCD 3SWYA 2P10A 3GLMA 1JMMA 2KNCA 2WSFH 1LWUA 3O8ZA 1ZLLA 3HRNA 3RGUA 5B5EE 1QL1A 3CCEP 1NTKE 2I8DA 2KUBA 2XNDH 3MD0A 2K9JB 3NMDA 1VQ5P 4BRYA 2N1TA 3V2NA 5CBNA 1NHLA 3D6ZA 1AV1A 3VTPC 3PH0A 2Q9IA 3BCCG 4PD4D 2QJKC 4UB6H 3TGUD 1FZCB 2FYUD 2W6JH 2WT7B 1ZRTE 1BCCD 2N1TD 1T8ZA 5AW4B 1D7MA 1L2PA 2W6AA 1DEBA 3A2AA 5CJ4A 3V2QA 1M1JB 3JCUH 2E5TA 1KYOD 4EDFA 1OVRA 3Q5RA 1DH3A 3SWFA 1KZUB 1NYHA 3C8VA 3HD7D 3H1IJ 2OYHB 3RK3D 1K04A 2OYIC 1VQ4P 1BE3J 2JKVA 1AFOA 1X79B 3KZIE 4GODA 2C9LY 1JY2N 3B71A 1OMIA 2W6BA 1KTMA 1KFMA 1J1EC 1SQXE 3L70J 3L73E 3H1LD 1SQXK 1JY2P
chains in the Genus database with same CATH topology
1NTZJ 4PD4I 3H1JJ 1L0NJ 3L71J 1SQXJ 3L73J 1BGYJ 2IBZI 1NTKJ 3BCCJ 5KLVJ 1SQVJ 3H1LJ 1NTMJ 1KB9I 3CX5I 3H1KJ 4U3FJ 3CXHI 3H1HJ 1EZVI 3TGUJ 3L75J 3L74J 3H1IJ 1BCCJ 1KYOI 3CWBJ 2BCCJ 3L72J 1P84I 1BE3J 4D6TJ 1PP9J 1NU1J 1SQBJ 1SQPJ 1SQQJ 3L70J 2FYUJ 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  4PD4 I;  3H1J J;  1L0N J;  3L71 J;  1SQX J;  3L73 J;  1BGY J;  2IBZ I;  1NTK J;  3BCC J;  5KLV J;  1SQV J;  3H1L J;  1NTM J;  1KB9 I;  3CX5 I;  3H1K J;  4U3F J;  3CXH I;  3H1H J;  1EZV I;  3TGU J;  3L75 J;  3L74 J;  3H1I J;  1BCC J;  1KYO I;  3CWB J;  2BCC J;  3L72 J;  1P84 I;  1BE3 J;  4D6T J;  1PP9 J;  1NU1 J;  1SQB J;  1SQP J;  1SQQ J;  3L70 J;  2FYU J;  1L0L J; 
#chains in the Genus database with same CATH topology
 4Y28 J;  1ZOY C;  2YO2 A;  4JF7 A;  3CC4 P;  1DX7 A;  2NRG A;  3PJS K;  2YO3 A;  5KLI B;  3L36 A;  5KAI H;  1VQP P;  1SQV G;  3AE7 C;  1KV4 A;  3MHV A;  1EZV D;  1X22 A;  1JY3 N;  2OTK E;  4GDO A;  1USD A;  4H13 C;  2XZR A;  4CPG A;  2JDI H;  2WSS H;  3S9O A;  3GHG C;  1JY3 P;  2HOD A;  2LXB A;  1AVY A;  1HTL C;  3H1K G;  1FOS E;  3H1I E;  1SQP D;  1NU1 K;  1SQX G;  2R5B A;  1SQQ D;  3L73 G;  3JSV C;  1LTS C;  5KKZ C;  2BCC G;  1KQG B;  3AEG C;  3CWB J;  3EFG A;  3HD7 B;  2G8Y A;  1SQV K;  3ITK A;  4PV1 B;  1DEE G;  1VDF A;  2KB7 P;  2ZYG A;  4B86 A;  1LTG C;  1OFC X;  3VMZ A;  1JY3 O;  2E5Y A;  1L0L G;  1Y8A A;  2FYU J;  1PGO A;  1AJY A;  2BCC D;  1NTZ J;  2CK3 H;  3TGU G;  2JWD A;  1M1J A;  3CXH E;  1MFT A;  3A0B H;  2E74 B;  2XDJ A;  1BCC G;  3HTK B;  4RES B;  1N7S A;  3CWB G;  3E1R A;  3P8C E;  3VN0 A;  3H32 B;  5KLV E;  1FZC C;  1L0L D;  1FAV A;  1P84 E;  4L74 A;  1LTI C;  3BCC E;  2KLU A;  1NTM J;  2HOD B;  3H32 A;  4U7J A;  1YIT P;  2H8P D;  1EXI A;  1M8O B;  4EOT A;  3H1H J;  1Y47 A;  2K37 A;  1IC2 A;  1SQB D;  5DJU B;  1EZV I;  3RL0 D;  1PGJ A;  5KTB A;  3M0A A;  4Y99 C;  1WT6 A;  5KJ7 A;  1HBW A;  4Y99 B;  1LWU B;  3MTU E;  3CL3 D;  1VL2 A;  1S9K D;  2POH A;  4C7R A;  3L72 E;  1CI6 B;  1BCC E;  2KSE A;  3M9H A;  3SSU A;  1NTK D;  2Y9Z A;  5CCG D;  2R3S A;  1CI6 A;  2ZT9 B;  2YMK A;  3HUS B;  1DIP A;  3L75 D;  4I2L C;  2QEX P;  4JPZ B;  2MJZ A;  1OW6 A;  1NAY A;  1LTJ A;  2H43 A;  3Q2Y A;  2H7H A;  3HE5 A;  3R2P A;  4PD4 I;  1G1J A;  1L0N J;  1FOS F;  2RH0 A;  5KAF E;  4I7Z C;  1LWU C;  3KXD A;  4H0L D;  4RKU J;  4JQ0 D;  5AVU B;  1LJ2 A;  2AXT E;  5AW6 B;  3VP8 A;  2AXC A;  3MGN A;  4H44 D;  1SQP K;  1YIJ P;  2ZYD A;  2O1K A;  2K9Y A;  2JP3 A;  3H1J G;  4N78 E;  1L4A A;  2HFE D;  2W8Z A;  1YYC A;  3T97 B;  2FXP A;  1N7S B;  3H1K E;  3V6I A;  2HPC A;  1IFN A;  1SFC B;  4O9B A;  1HVV A;  3OW2 O;  2P67 A;  2C0X A;  2ZXX A;  3LW5 J;  3N4X A;  1VQL P;  1RE3 C;  3D6Y A;  3C9I A;  1NU1 E;  1K8A Q;  3KYQ A;  1ZR4 A;  1Q82 Q;  1M7L A;  3L35 A;  5CCH C;  4N6J A;  4D6T J;  4KT0 J;  1UII A;  1SP4 A;  1AVO A;  2YKO A;  1VQ6 P;  5AW9 B;  1S72 P;  1JNM A;  4H13 B;  1BSH A;  1W2E A;  2YKP A;  1T3U A;  2IYO A;  4IL6 X;  1BDD A;  1Y9B A;  3CMA P;  3JCU E;  3HD7 C;  2ZVN B;  2IZ0 A;  2P58 A;  2E74 C;  2R32 A;  3RBZ A;  5KKZ B;  1K9M Q;  2IFN A;  2ITA A;  2WPQ A;  1R8E A;  2W83 C;  1FE6 A;  1KMI Z;  1X0T A;  3AE6 C;  1HF9 A;  3L37 A;  4D6T G;  3RL0 g;  1FDM A;  5KAF H;  2DW3 A;  4UB8 E;  2O01 H;  3TDK A;  1PL5 A;  3CX5 D;  4JBZ A;  1NTK K;  2FYU K;  3MIW A;  1KQS O;  2WQY C;  1FC2 C;  2WSF J;  4WY4 C;  3PHL A;  4UB8 H;  2QJP B;  3CCL P;  4PV1 C;  3EQ2 A;  3SFE C;  1PPJ E;  1URQ D;  1H0T B;  1GL2 A;  4M3L A;  3Q5S A;  3CWB E;  2CPB A;  3PP5 A;  4KJM A;  5APW A;  2BCC E;  5AW0 B;  1L0N E;  1NTZ K;  5GTI H;  2J58 A;  2AEJ A;  3CX5 E;  3GHG B;  3S1K A;  4DZO A;  1NTZ E;  4N3Y B;  3H1I G;  1YTZ I;  1VQO P;  3PLN A;  1VQN P;  1IK7 A;  2E74 D;  2FBW C;  1EZV E;  3U59 A;  1SQQ E;  3P8C D;  1Q7Y Q;  1M90 Q;  3AE8 C;  1BGY J;  1SVF A;  5AVW B;  4EI2 A;  1KIL B;  3LW5 H;  2R3C A;  1GL2 D;  1HJB A;  2PP6 A;  1JEK A;  1IK9 A;  1N2D C;  1SQV E;  2LXC B;  3NTN A;  1G2C B;  3CXH H;  3H1I D;  1NU1 G;  3M06 A;  5BU5 A;  2QG4 A;  3CD6 P;  3H1L E;  1FZC A;  2BEZ F;  1VF5 D;  3NXS A;  4H44 B;  2P7J A;  1MUU A;  1S5L X;  1H89 A;  1GDT A;  2V4H A;  2FFD A;  2E43 A;  2IDB A;  1IFJ A;  2QJK B;  1OXZ A;  3CLQ A;  1BE3 G;  1HJ0 A;  1URQ C;  3Q1M A;  1VQM P;  1WRG A;  1DD4 A;  1LT9 C;  1LTA C;  2WPV B;  2ZYA A;  2XU6 A;  3L75 E;  3UIA A;  1RQV A;  1LT9 B;  1PV3 A;  2IBZ G;  1KC8 Q;  3G9R A;  4BWN A;  1OZH A;  1YBK A;  1K73 Q;  3BAS A;  4BXL A;  2E75 D;  2E76 D;  2IZ1 A;  2LKM A;  2FYN C;  1OWA A;  2GUS A;  3AE2 C;  1J2J B;  2V7Q J;  3H1J J;  5B66 H;  4U3F D;  2FYU G;  4MN4 C;  1CW5 A;  2AEF A;  3M9B A;  1Q81 Q;  2IBZ D;  2J5U A;  1JB0 J;  3F5H A;  4ASW A;  1W2B O;  2W90 A;  3GF7 A;  3H1L J;  4IFF A;  4K3A A;  2E76 B;  3C1L A;  5E79 E;  1JY2 O;  1VF5 C;  1GZL A;  2ZVO B;  5CCG C;  1OX3 A;  1PGQ A;  3CXH I;  2WSE H;  2FYN B;  1KOR A;  2QIW A;  5CBO A;  4IL6 E;  5B5E H;  1BSN A;  3Q5P A;  2BEQ D;  3SFD C;  2FYZ A;  2Z5I A;  1SQB E;  4H0L C;  1AQ5 A;  1KIL E;  1KYO I;  4PD4 E;  3ZDM A;  2IBZ E;  3S4R A;  3CCQ P;  3CC2 P;  4DOJ A;  3RK2 C;  5TIS E;  4I1L A;  2H88 C;  4YTP C;  3A0B E;  1KIL C;  1RH5 B;  2XV5 A;  3VYI A;  4EIJ A;  2N1T B;  3AEF C;  5KLV D;  2QA4 P;  1JOC A;  1SQQ J;  2WIT A;  4NPD A;  1USE A;  2QJP C;  5M1B A;  4L73 A;  1KD1 Q;  5AW1 B;  1LTT C;  2A45 I;  1SLQ A;  1IFM A;  1L0L E;  1S4X A;  2WPR A;  4HB1 A;  2QJY B;  5AVY B;  3VP9 A;  2K1A A;  1GL2 B;  2GM4 A;  1YQ4 C;  5H2F E;  3KDP B;  3TNU B;  1QVF O;  5AW7 B;  1FDO A;  4L75 A;  2QE7 H;  4WY4 D;  3BAT A;  3V4Q A;  4W7Z A;  3KHU A;  3CME P;  3CI9 A;  3AE5 C;  1KB9 D;  1JMB A;  1SQX D;  2K88 A;  1SQQ G;  2HR3 A;  2RMZ A;  2IPP A;  3L73 D;  1UIX A;  3G3Z A;  1KB9 H;  4WY4 B;  5APQ A;  3V2P A;  3GG2 A;  1U7J A;  5CMZ A;  1FZF A;  1A02 J;  3A0H H;  1URQ B;  3MP7 B;  1KN7 A;  2V7Q H;  2KYV A;  1NTM D;  1IJD B;  3MUD C;  4LC1 A;  3W68 A;  2NPS D;  1L0N D;  1P84 I;  2JEE A;  3H1J D;  3TNU A;  1PP9 J;  2D2C D;  3QH9 A;  4GOE A;  4L76 A;  2AXT H;  3K5B A;  3V2R A;  1JUN A;  1NKZ B;  1ZRT D;  2KLV A;  1KB9 E;  1Q90 D;  2HG5 D;  4LLH A;  3USS A;  3B5N A;  2M5A A;  5BVZ A;  4HJG H;  2P2U A;  1BDC A;  1BGY E;  2H89 C;  1L0N G;  3H6P A;  1JCD A;  1N73 C;  2Q5U A;  2IBZ I;  3B8E B;  1OW8 A;  1RF1 B;  3IR9 A;  1SQV J;  1S3J A;  3JC2 2;  3TSI A;  1JM0 A;  4DJG A;  1EDL A;  2OYO A;  1SQB G;  2OQQ A;  2Y0E A;  4NPE A;  4H13 D;  5L8R J;  3WU2 H;  3TGU E;  3U1C A;  1BGY G;  1LP1 B;  1SFC C;  3FWN A;  5DJT B;  5APV A;  1GK4 A;  3EFF K;  1L0L K;  3M0D A;  5APY A;  3P32 A;  3VMA A;  4ZKU A;  1NO4 A;  2E76 C;  1PP9 E;  2E75 B;  2GA1 A;  2QJY C;  3FXE A;  4HH2 A;  3L75 G;  4UB6 E;  5AVS B;  4I6M C;  4NPF X;  1KQF B;  1N7S C;  3P8M C;  2AEM A;  1MKM A;  2FYU E;  2PFX A;  1NOH A;  2HLO A;  4AUW A;  3L74 D;  5AVT B;  1VQ8 P;  2YKQ A;  3A7O A;  1H0T A;  1YJW P;  5CCH D;  2GUV A;  1GW3 A;  2Q6Q A;  1DD3 A;  4PV1 D;  5AW2 B;  2QM7 A;  4H0L B;  1GW4 A;  1MFZ A;  2WZ7 A;  4YXD C;  1PIX A;  1JTH B;  2OGU A;  2HYN A;  2YXR B;  3L74 G;  3W67 A;  1RF0 A;  1L0N K;  2WVR A;  3AE9 C;  1KB9 I;  2LR2 A;  1N8R Q;  2ZT9 C;  2B87 B;  1M1K Q;  2D2C C;  3RK2 D;  5H2F H;  4ZMD A;  1PP9 D;  3WUV A;  1KIL D;  4YXW H;  2ZJS E;  2RN0 A;  3IN6 A;  4H44 C;  3GHG A;  5GTI E;  5C39 A;  2WWW A;  3CC7 P;  1XTC C;  1FZG A;  1A02 F;  3B5N C;  3HUS A;  3L74 E;  1G1I A;  1NTZ D;  1R5L A;  3P7K A;  4R4M A;  1RQU A;  3OAK A;  4WB4 A;  4BRY B;  4KHX A;  3AE4 C;  1SQP J;  1VQ7 P;  2Z5H A;  4PD4 H;  2YNY A;  2OYH A;  2YIU C;  3L71 G;  1L0L J;  3IAO A;  1PFI A;  1EXJ A;  3AE1 C;  2Y9Y A;  3CCM P;  2WMM A;  1LGH B;  4OGQ C;  4RJT A;  2SPZ A;  1LP1 A;  4I7Z B;  3V4W A;  2FFD B;  1FJK A;  3RK3 E;  2N9B A;  1SFC A;  3BRT B;  4JYC A;  2UWJ E;  1KFN A;  1RE3 A;  5KLV K;  3T97 A;  1NGM B;  2HPC B;  3EWK A;  3M0D C;  2ZT9 D;  1E5W A;  3H1K J;  1KQL A;  1QX8 A;  1PGP A;  1RY3 A;  2PGD A;  4U3F G;  3CCV P;  3OA7 A;  3CX5 H;  3GW6 A;  1NTM E;  2D2C B;  2IYP A;  5GTH H;  5B66 E;  1N86 A;  1NTM K;  1OIP A;  2I1J A;  3B5N D;  4HKZ H;  1AQT A;  3L74 J;  4OWF A;  3O6Q B;  3SWK A;  3TYY A;  3U1A A;  4D6T E;  1PZQ A;  3GF3 A;  2O01 N;  3HTK A;  3A5T A;  2YXQ B;  3H1H D;  1NAF A;  1SQB J;  3OJA B;  1WMK A;  4GIF A;  4PJ0 H;  1IO4 A;  2N9Y B;  1BE3 E;  2QM8 A;  2FXO A;  5AVR B;  1M57 D;  2KZJ A;  4N78 D;  1VQ9 P;  2KSJ A;  3L71 E;  5EFW B;  2Q1K A;  2WSE J;  4TLF A;  1LTJ C;  1LTB C;  1QVG O;  1RF1 C;  2A06 E;  1EC5 A;  3H1H G;  4WY4 A;  3H1L G;  5APU A;  2O3J A;  2M0B A;  1QL2 A;  2QSI A;  1SFC D;  3I56 P;  1H8A A;  2E75 C;  3FXD A;  3BRV B;  4C46 A;  1JTH A;  1QGK B;  1VF5 B;  3F89 A;  3IFM A;  5AVV B;  1BE3 D;  2VRS A;  1EZV G;  2E42 A;  1YTZ T;  1M1J C;  3A3Y B;  4R4L A;  2B9B A;  1T3J A;  1J1E B;  3TGU J;  1NTZ G;  2FY8 A;  2YIU B;  3VMX A;  3AEC C;  2OYH C;  1FBM A;  3RK3 B;  2FKW B;  3G71 P;  2MKV A;  1QEX A;  1SQP G;  4OGQ D;  2W27 A;  4HYT B;  1XTG B;  4K35 A;  3G4S P;  3H25 A;  1K05 A;  2L91 A;  2JJL A;  2OAR A;  3PTZ A;  5TJH A;  1NKN A;  2QRX A;  4A7P A;  1NJI Q;  3HE5 B;  1X9V A;  2FXM A;  1ZP0 C;  3HD7 A;  1NTM G;  2KS1 A;  1FZB A;  2XNX A;  3I5C A;  1T2K C;  1GD2 E;  1HH0 A;  1M56 D;  3AE3 C;  1MV8 A;  5K5G B;  3WU2 E;  4C7N B;  1KYO E;  3AEE C;  1GMJ A;  2KI7 B;  3KZI H;  5AW5 B;  3RK3 C;  3WUT A;  2WSC H;  3L72 G;  2FFD C;  4AYC A;  1URQ A;  1CZQ A;  2JO1 A;  2OTJ P;  2L5G B;  1OVU A;  2KK7 A;  4AQR D;  2G3A A;  1PPJ G;  2JR8 A;  3CWB D;  2NPS A;  3CX5 I;  3NFQ A;  4WWI A;  3Q3D A;  1YJN P;  3TK1 A;  5AVZ B;  1FJP A;  1SS1 A;  1RF0 C;  4JYB A;  2ZAE B;  4PJ0 E;  2KP8 A;  2IX7 C;  2O1J A;  3N7N A;  4U3F E;  2ZFC A;  3B5N B;  5CJ0 A;  3RBX A;  2WTY A;  4DT0 A;  1VPC A;  5AW8 B;  2BCC J;  1LTJ B;  4W7Y A;  5KLV G;  5E79 H;  1IFD A;  3VOP A;  1RF1 A;  1KYO H;  1L4A C;  1RE4 A;  1BGY D;  1SQP E;  2M3B A;  1ZV8 A;  1Q2N A;  2N1T C;  3CCJ P;  5GTH E;  1SQV D;  2C0W A;  1S2E A;  2K9J A;  3HUS C;  4XFJ A;  3MZW B;  1AA0 A;  4GOF A;  2QVA A;  1S5L E;  3QWO C;  1NTK G;  4OGQ B;  4IOI H;  1SQQ K;  3O6Q A;  1ZW0 A;  3CPW O;  2KXP B;  5KLI C;  1FU1 A;  5CCH A;  2KOG A;  2ZXE B;  4LGD E;  4W80 A;  1N73 B;  5AW3 B;  4OVN F;  1U7M A;  4EYY Q;  3RL0 C;  3L4F A;  3CCR P;  1TU3 F;  1R5S A;  1OVV A;  4IFM A;  4DCK A;  1NH4 A;  1EQ7 A;  1FS0 E;  1N7S D;  2JWA A;  3A0H E;  4RO0 A;  4ZKP A;  1ZME C;  1KIL A;  2Q3I A;  1YQ3 C;  3L70 G;  2OTL P;  2M8R A;  1EDJ A;  2B87 A;  2OYI A;  1YJ9 P;  1JO5 A;  1LNQ A;  2R44 A;  4WVZ A;  1J1D C;  1FZE A;  1FZA A;  3L75 J;  3VMY A;  2I1K A;  1J1D B;  2PAJ A;  2IFM A;  4C7N A;  3AED C;  3RK2 B;  1EDK A;  2C9N Y;  5KJ7 D;  2WSC J;  1NU1 J;  1PP9 G;  3FGA D;  2A06 G;  2A45 H;  3V5B A;  3AEB C;  1YI2 P;  3B4S A;  2M3E A;  3IF4 A;  1S9K E;  3D71 A;  1FDI A;  2B89 A;  1H88 A;  1GU4 A;  5APX A;  3E7K A;  3L72 D;  4IL6 H;  2NPS C;  3L71 J;  1GL2 C;  2WPS A;  2Y0D A;  3CCU P;  1NTK J;  3BCC J;  1PPJ D;  4QMA A;  1GK6 A;  1OW7 A;  4YPC A;  4Z1M H;  5TIS H;  3CCS P;  3BVH A;  2YMY A;  1GU5 A;  1NVO A;  1JCC A;  2A45 G;  3MUD A;  3WMM 0;  4IFD K;  3M9Q A;  2Y0C A;  4U3F J;  1N7L A;  1QLE D;  3I55 P;  1IFP A;  1RHZ B;  3HE4 B;  4D6T D;  1Q86 Q;  2Z4E A;  1RE4 C;  3HE4 A;  1G2C A;  1P84 D;  3II6 A;  4XE5 B;  1U57 A;  1E79 H;  1SQB K;  3M91 A;  4XA4 A;  5BU8 B;  1P84 H;  1BCC J;  3LIE A;  3G6E P;  1N73 A;  2K3R A;  3WUU A;  1T2K D;  2RKL A;  1ZN5 A;  2NZ2 A;  1HGV A;  3ABV C;  3D70 A;  2XKM A;  1ZR2 A;  2J59 M;  2Q7C A;  2KNC B;  4WBA A;  2P1J A;  2OYI B;  1ZXG A;  1Z56 A;  1LT9 A;  1SQX J;  3H1J E;  1LT1 A;  3L73 J;  3L70 E;  5CHX A;  1L4A B;  1HGZ A;  2R5D A;  4ZNC A;  1S1C X;  5KLV J;  3TF5 A;  3CXH D;  3PRJ A;  3L70 D;  4GT1 A;  1YHQ P;  3R4Y A;  2PRR A;  3LID A;  2B88 A;  5APS A;  1T6A A;  1IFI A;  3GMA A;  2CPS A;  2Q3E A;  3H1H E;  4OH8 B;  5KJ7 C;  2BAS A;  2NPS B;  2WT7 A;  1GTW A;  1VQK P;  1CSB A;  3FX0 A;  1NU1 D;  1L4A D;  1W5C E;  2KIK A;  2KZI A;  3FWL A;  5AVQ B;  1HUC A;  1X8Y A;  1S5L H;  4GKG A;  1HWT C;  1IZN B;  1MZ9 A;  2M5A B;  3H1K D;  1NWQ A;  2A06 D;  3L72 J;  5APT A;  5KAI E;  5CCG A;  1EDI A;  2O01 J;  3KPE A;  3RL0 B;  3L71 D;  5AVX B;  4ASV A;  2KS1 B;  3E1I A;  3KQG A;  4TT3 H;  3AEA C;  3BCC D;  3SWY A;  2P10 A;  3GLM A;  1JMM A;  2KNC A;  2WSF H;  1LWU A;  3O8Z A;  1ZLL A;  3HRN A;  3RGU A;  5B5E E;  1QL1 A;  3CCE P;  1NTK E;  2I8D A;  2KUB A;  2XND H;  3MD0 A;  2K9J B;  3NMD A;  1VQ5 P;  4BRY A;  2N1T A;  3V2N A;  5CBN A;  1NHL A;  3D6Z A;  1AV1 A;  3VTP C;  3PH0 A;  2Q9I A;  3BCC G;  4PD4 D;  2QJK C;  4UB6 H;  3TGU D;  1FZC B;  2FYU D;  2W6J H;  2WT7 B;  1ZRT E;  1BCC D;  2N1T D;  1T8Z A;  5AW4 B;  1D7M A;  1L2P A;  2W6A A;  1DEB A;  3A2A A;  5CJ4 A;  3V2Q A;  1M1J B;  3JCU H;  2E5T A;  1KYO D;  4EDF A;  1OVR A;  3Q5R A;  1DH3 A;  3SWF A;  1KZU B;  1NYH A;  3C8V A;  3HD7 D;  3H1I J;  2OYH B;  3RK3 D;  1K04 A;  2OYI C;  1VQ4 P;  1BE3 J;  2JKV A;  1AFO A;  1X79 B;  3KZI E;  4GOD A;  2C9L Y;  1JY2 N;  3B71 A;  1OMI A;  2W6B A;  1KTM A;  1KFM A;  1J1E C;  1SQX E;  3L70 J;  3L73 E;  3H1L D;  1SQX K;  1JY2 P; 
#chains in the Genus database with same CATH homology
 1NTZ J;  4PD4 I;  3H1J J;  1L0N J;  3L71 J;  1SQX J;  3L73 J;  1BGY J;  2IBZ I;  1NTK J;  3BCC J;  5KLV J;  1SQV J;  3H1L J;  1NTM J;  1KB9 I;  3CX5 I;  3H1K J;  4U3F J;  3CXH I;  3H1H J;  1EZV I;  3TGU J;  3L75 J;  3L74 J;  3H1I J;  1BCC J;  1KYO I;  3CWB J;  2BCC J;  3L72 J;  1P84 I;  1BE3 J;  4D6T J;  1PP9 J;  1NU1 J;  1SQB J;  1SQP J;  1SQQ J;  3L70 J;  2FYU J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...