3L71J

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l71J00
1PP9J 1P84I 1NTKJ 3CWBJ 3CXHI 3L74J 1SQPJ 1BE3J 3H1KJ 1SQQJ 3BCCJ 3H1LJ 1EZVI 5KLVJ 3L73J 1NTMJ 2FYUJ 3L72J 3H1HJ 1NU1J 1L0NJ 4U3FJ 3H1JJ 4PD4I 3CX5I 1NTZJ 1SQXJ 1BCCJ 1SQVJ 3L70J 2IBZI 4D6TJ 1KB9I 1L0LJ 3L75J 3H1IJ 3TGUJ 1KYOI 3L71J 2BCCJ 1SQBJ 1BGYJ
chains in the Genus database with same CATH superfamily
4D6TG 4Z1MH 1ZR2A 1K8AQ 1N8RQ 3T97A 2ZXXA 1NWQA 1L0NE 2FY8A 3H6PA 1LTSC 2XV5A 5AW0B 5TISE 2PAJA 1JUNA 3CI9A 3SSUA 1LP1A 1IJDB 1SQVJ 2POHA 2HYNA 2OYHA 1VF5C 2ZVOB 1ZP0C 1ZRTE 4CPGA 3B4SA 2YKOA 1FJKA 3AE5C 5CCGA 4WWIA 1BSHA 2W90A 3HD7C 3WMM0 2WSCH 3FGAD 1LT1A 1PV3A 1GL2A 1LTAC 2D2CB 1RH5B 2KK7A 1AVYA 1SQQD 2G8YA 1LTBC 1SFCA 2H88C 2FYNC 4IL6X 3RL0B 1S9KD 1OWAA 3H32A 2P7JA 3B5ND 3E1RA 3HE5B 2IBZG 1L4AC 1MUUA 1BCCJ 3I56P 3KYQA 4GODA 1HGZA 2I1KA 3L35A 1KB9D 2B87B 2W83C 3L72E 1BE3G 3H1JD 1KYOE 5KTBA 1FS0E 3Q2YA 3VOPA 2R44A 1S5LX 1T6AA 3RK2B 1T3JA 1L0ND 3L73J 3U59A 1KMIZ 2H7HA 3BRVB 2QM7A 3MZWB 3HUSB 2AEMA 1ZRTD 3CXHI 2Y9ZA 3O6QA 2CK3H 1NTMJ 1FC2C 1PPJG 1OMIA 2OYIA 1KN7A 3QWOC 4XFJA 1GU4A 4IFDK 3CCJP 4HJGH 3HE4B 1QL1A 2E75C 3AE4C 2ITAA 2E42A 4BRYB 2NPSB 1NO4A 1T2KD 2P10A 2ZYDA 4I7ZB 3CWBG 2FYUE 3LIEA 1OVRA 3AECC 1GD2E 4OGQB 4JYBA 3RL0C 1LTGC 2HR3A 3A0BE 4RESB 1HF9A 5GTHH 1EXIA 3RK3E 2HFED 3MUDC 1AVOA 3OW2O 2GUVA 5KAIH 3CL3D 2UWJE 1M1JA 2Z5HA 3CC4P 3L72D 1KYOD 1CI6A 1OFCX 1UIXA 4L73A 4HB1A 1LGHB 3AEFC 1IFMA 2Y0EA 3V6IA 3BCCJ 3P8CE 4DT0A 3BRTB 2PP6A 1FDIA 3RK2C 3IAOA 4PD4I 2A06E 1N7SA 3ABVC 2QG4A 4K3AA 1H89A 1USDA 1AJYA 2KNCB 1JB0J 1P84I 1RHZB 3HUSC 3P32A 5APWA 1J1EC 1SQPJ 3RBXA 4EDFA 1X0TA 5GTIE 2C0XA 2Q7CA 3AE8C 1LTJB 2J5UA 2AXCA 1JY3P 3WU2E 2O1KA 3TGUG 1JMBA 1IC2A 1SQBG 2FYUD 2R5DA 1QLED 2NPSC 4ZKUA 3HD7A 3C1LA 4I7ZC 3AEAC 2QRXA 1DH3A 3C8VA 3H25A 3FXDA 5CJ4A 4OGQC 4XE5B 5L8RJ 4EI2A 1SQQJ 4H13C 3TF5A 2WPRA 3B71A 3V5BA 4L75A 3H1LG 3IR9A 1SQXK 2Q9IA 1IFJA 1QEXA 2E74D 2BCCE 1YIJP 5APTA 2M3EA 3EQ2A 3Q3DA 1MFZA 2HODA 1JTHB 5APYA 1VQ4P 2A06D 2K9YA 3H1JJ 2WSSH 3KQGA 1SQVD 3GW6A 3FWLA 3A5TA 1EDIA 2WPVB 1NTKE 2OGUA 1GK6A 3B8EB 1ZXGA 1JEKA 1CSBA 1PP9G 1L0NJ 4D6TE 1NTZK 1QL2A 3H1HG 3JSVC 3KZIH 5AW3B 1GZLA 1VQ5P 1GU5A 1H0TB 5AVYB 1LTJC 1Y47A 3O8ZA 1KILB 1ZW0A 2FXMA 2K9JB 1URQB 5M1BA 1FZBA 1Q86Q 5CCHD 3P8MC 4PJ0H 1YTZI 3CX5D 3IFMA 1QVGO 3RBZA 2H43A 1NU1K 1FZCB 2QVAA 2OYOA 3M9BA 1GDTA 1EZVE 2J58A 4U3FG 4H0LB 3AE1C 2BCCD 1DD4A 3MUDA 5AVQB 4B86A 1G1JA 1HVVA 2QIWA 5KLVE 1FZAA 1WMKA 4TT3H 2N1TB 3L72J 5AW4B 1RY3A 3L70J 1NTKD 1SQXG 3HTKB 1ZR4A 2IZ1A 1VQMP 3M0DC 3KHUA 2QJPB 3V2NA 3CCMP 2JWDA 2E75D 1T8ZA 4D6TD 2AXTE 2PGDA 4OVNF 1RE3C 4KT0J 1FBMA 2R3CA 4UB8H 4EOTA 1EC5A 3IF4A 3A7OA 3G9RA 4K35A 2JEEA 5KAIE 2Q3EA 5APXA 2XU6A 1KILC 1R5SA 1URQC 2A45H 5AVRB 4EIJA 3II6A 1NTZG 5GTIH 1RE4C 1DX7A 1VQ6P 1PPJE 3F5HA 3HE4A 2JO1A 1BGYG 2YIUB 4BRYA 2FYUJ 2NPSA 1VQ8P 2IFMA 2ZT9B 1VL2A 3GHGB 1EZVD 1QGKB 1KB9I 4M3LA 3KPEA 4N6JA 1FZCC 1Y9BA 2JR8A 2O01H 2QSIA 5KLVD 4H0LC 4TLFA 1ZOYC 1MV8A 2KS1B 2VRSA 1G2CA 3GF7A 3N7NA 1NU1G 2JDIH 3CCUP 3Q5SA 2M5AA 1NJIQ 1LWUA 1NGMB 2ZXEB 3AE3C 1YJNP 1N86A 3H1KG 4W80A 2J59M 2QJYB 4N3YB 2ZJSE 2H89C 5AVUB 2QJPC 1IFIA 4I2LC 1BDCA 2IDBA 2P2UA 1R5LA 3PJSK 3MD0A 1J2JB 5C39A 3L36A 3H1IG 3FWNA 2V4HA 2WSFH 4JPZB 1IZNB 1IFPA 1KC8Q 1TU3F 1A02F 2N9YB 4MN4C 4H13D 3MGNA 2LR2A 2E5YA 1JY2N 3SWKA 1PPJD 1PGJA 1LTJA 2W27A 3V2QA 1GW4A 4EYYQ 2L5GB 1PGQA 3G3ZA 4IL6H 1VQ9P 2K37A 2YIUC 2ZYGA 3TGUE 1OZHA 2I8DA 5AW6B 4R4MA 3GHGC 4PV1D 1KYOI 1JO5A 1FOSF 1JY2O 3WUUA 3D70A 4H44D 5CHXA 1IO4A 1K9MQ 1N73B 2RKLA 3PH0A 4IOIH 3L74G 5BU8B 4GIFA 1X8YA 5AW1B 1KFMA 3L70E 1SLQA 2E43A 1L0LJ 1WRGA 1LT9B 1FDMA 2GUSA 5APSA 2BCCJ 1S5LH 5CCGD 1YYCA 3H1LE 1KQGB 3KZIE 3MP7B 4WY4B 1OVVA 1GL2D 2WSEH 3EFGA 3CCSP 2WSFJ 2XKMA 1SFCD 1EDJA 1OX3A 1YTZT 3KXDA 2WSCJ 1DEBA 1SQBK 1NTKJ 4PJ0E 5APUA 2M0BA 3PTZA 1HJBA 4D6TJ 3GF3A 1RE3A 1OVUA 2YMYA 1VQOP 2P1JA 1CZQA 1M7LA 1PP9E 5DJTB 3L4FA 2D2CC 3AEGC 2AXTH 3H1HE 4HH2A 1FDOA 3VTPC 2JJLA 2WTYA 1KILA 2KSJA 3TGUD 4RO0A 1LNQA 1AA0A 2K9JA 2BEZF 5TJHA 2OTLP 3I55P 4GOEA 1RE4A 4KHXA 3TYYA 4YXWH 1S3JA 1HH0A 5AW8B 1RF1B 3NXSA 1KV4A 1W2BO 1Q81Q 1N73C 3L70D 3AE9C 3D6ZA 3CC7P 3BVHA 3S4RA 4N78E 1OXZA 1L2PA 3H1LD 1LT9C 2YKQA 2RN0A 4C7NB 5KLVJ 4UB8E 3B5NB 4U3FE 1BDDA 1VQKP 2WVRA 3HRNA 4WY4C 1VQLP 3T97B 2H8PD 2YO3A 2O01N 2B9BA 5AVXB 1H88A 2KLUA 2AEJA 1YJ9P 3HTKA 3A2AA 4GOFA 2OYHB 1SQXE 2WWWA 1MFTA 1FOSE 1KTMA 2XZRA 2YKPA 1YI2P 1PP9D 2WT7A 4ZMDA 4PD4E 3SFEC 5AVVB 3LW5H 3VMYA 3H1HD 2V7QH 3CCEP 1Q7YQ 4L74A 1VQ7P 3CX5I 5AVZB 2FYZA 3VMXA 5CMZA 3RK3D 4YTPC 3H32B 2RH0A 4JQ0D 5BVZA 3L71G 5AVSB 1N7SD 2IYOA 3CMAP 1QVFO 1G1IA 1NTZE 3E7KA 4LLHA 3W68A 1U57A 1L4AA 5KAFH 1BSNA 1L0LE 2W8ZA 1SQVK 5CBNA 3GHGA 4N78D 1BGYE 2OARA 1JY3N 3L75G 1FE6A 3P8CD 3TNUB 1S1CX 4U3FD 4WBAA 1S2EA 4U7JA 1XTGB 1VF5D 1FZGA 3SWFA 1J1DB 3UIAA 2WZ7A 2XDJA 4NPDA 3HD7D 2Y0DA 3VP9A 1NU1E 1YQ3C 2PFXA 3NFQA 1SQXD 1EXJA 1RQVA 1AQTA 4IL6E 2OYHC 2WMMA 1AQ5A 1U7JA 2IZ0A 3H1KE 3Q1MA 3BASA 2OYIB 1L4AD 3AEBC 4OH8B 2KIKA 1NAYA 1OW6A 3G4SP 3H1IE 1SP4A 1YITP 2CPBA 3USSA 4WVZA 1EZVI 1S5LE 5CJ0A 4HYTB 1NTZD 2YNYA 1L0LD 3CCVP 3FX0A 3KDPB 3TGUJ 1BGYD 5AVTB 3HE5A 2XNXA 3AE2C 2G3AA 1HUCA 2IBZE 3CXHH 3M9HA 4Y99B 1WT6A 2OQQA 1NTMK 1T2KC 4O9BA 1HBWA 1N73A 1H8AA 2B87A 1LJ2A 1K04A 4UB6E 1SQVG 1BE3E 1J1DC 1U7MA 2FXPA 3H1LJ 5DJUB 4DJGA 1ZN5A 2LXCB 4WY4A 2D2CD 2OTKE 1X79B 2FBWC 3GMAA 1M56D 2E74B 2GA1A 3NMDA 1ZMEC 3H1KD 1DEEG 4JF7A 3HUSA 4LC1A 1T3UA 2HG5D 3RL0D 1Y8AA 4IFMA 3BATA 3W67A 4QMAA 3G71P 3H1ID 2WPSA 3PHLA 1BCCG 3VMZA 1PP9J 4W7ZA 1N2DC 1IK7A 2Q5UA 2WITA 4Y28J 3H1HJ 3L37A 2W6BA 4PD4H 2R5BA 2Y9YA 3CWBE 2K3RA 5APQA 1DD3A 3TDKA 1P84H 2IBZD 3RK2D 1SQPK 1KQFB 1AFOA 2P67A 5AW2B 3M91A 3K5BA 5AW9B 4NPFX 4BXLA 3L73G 4ASVA 3D71A 2N1TC 3CC2P 1BE3D 2FFDB 3MIWA 1A02J 4ZKPA 4U3FJ 4AUWA 3IN6A 1NTMG 1YBKA 2O1JA 4C7RA 3C9IA 1OIPA 3GLMA 3WUTA 3F89A 2WQYC 2NPSD 2KZIA 1NYHA 2E5TA 2E74C 2KLVA 1M90Q 1SQQK 2KNCA 1OW7A 2P58A 2Z4EA 4JYCA 5B66E 4OGQD 2E76B 1SQXJ 1SVFA 5K5GB 5AVWB 1PFIA 5KAFE 1JNMA 3MHVA 1GW3A 4JBZA 2LKMA 3M06A 1VDFA 2E75B 2O01J 1ZLLA 2JKVA 1EDKA 2B88A 2ZT9C 1SQBE 3CWBD 3OJAB 2Q1KA 1FU1A 2KXPB 1EZVG 2LXBA 5AW5B 3TK1A 3BCCG 5KLVG 3CMEP 1L0NK 1VQPP 1NTZJ 2I1JA 2YXQB 4XA4A 3VP8A 2WPQA 2HLOA 2JP3A 3L71E 4LGDE 1BGYJ 5CCHC 1N7LA 1PGPA 5B5EH 1YQ4C 5EFWB 3P7KA 2FFDC 1VQNP 2HPCB 1SQPG 3LIDA 3TNUA 3L75E 1JTHA 5KLIB 2C9NY 3JCUH 1IFDA 2JWAA 2QJYC 3V4WA 1JCCA 2KI7B 1FZEA 3M0DA 3VYIA 2ZVNB 4A7PA 1KILE 1M1KQ 1NU1J 4I6MC 4C46A 4UB6H 1J1EB 4BWNA 2RMZA 1PGOA 2Z5IA 3U1AA 2E76C 1DIPA 3A0HH 4YXDC 3PRJA 2L91A 4YPCA 3D6YA 3H1KJ 3SWYA 2BASA 1K73Q 3CCLP 3FXEA 2QEXP 2FXOA 1SQQG 2KP8A 4R4LA 1H0TA 3CCQP 3CXHE 1FJPA 1SS1A 3A3YB 3H1IJ 1SQBD 1URQA 5KJ7C 1NH4A 2NZ2A 5BU5A 3EFFK 2B89A 3S9OA 2R32A 2Y0CA 1JM0A 2K1AA 4AYCA 4H13B 3L71D 3G6EP 3H1JG 2KUBA 2WSEJ 4W7YA 5H2FH 1KQLA 1FZCA 5E79H 3R2PA 1G2CB 1HWTC 2XNDH 1Q82Q 1M57D 2BEQD 2CPSA 2M5AB 3L75D 1LWUB 2A45I 2N1TA 1L0NG 3RL0g 4PV1B 1Z56A 1K05A 3L74J 2Q3IA 2KZJA 1BE3J 4H44B 5KLIC 1OW8A 1KILD 1MKMA 1LP1B 3AE6C 2FYUK 1URQD 1SQVE 2ZYAA 1FZFA 1AV1A 1M8OB 3AE7C 1KB9H 1KORA 2KYVA 1RF0C 1GL2B 3OA7A 1P84E 3CXHD 2MJZA 3PLNA 1FAVA 1SFCB 4H0LD 2SPZA 1KZUB 5TISH 3ITKA 1YJWP 5B66H 1D7MA 2N1TD 1CW5A 3R4YA 3PP5A 3Q5PA 1BCCE 3Q5RA 4ZNCA 3L72G 1LTIC 4WB4A 1RF1C 2KSEA 3OAKA 3L70G 3CWBJ 3CX5E 1PIXA 1VPCA 1NVOA 4I1LA 2O3JA 4DCKA 2GM4A 2R3SA 3B5NC 1JMMA 2KS1A 2QJKB 3M0AA 3I5CA 1LWUC 5CCHA 1JY3O 2C0WA 1R8EA 4PV1C 3L73E 1KQSO 3ZDMA 2FKWB 4GKGA 2FFDA 3NTNA 4H44C 2IFNA 3LW5J 2IX7C 2V7QJ 2MKVA 2Q6QA 3O6QB 3V2RA 4PD4D 1KYOH 2OTJP 1X22A 1NTME 3EWKA 4RJTA 2KB7P 5CCGC 2ZT9D 1P84D 1W2EA 1GL2C 2FYUG 3CCRP 4OWFA 5APVA 1L0LK 3QH9A 4KJMA 2IYPA 1KD1Q 1SFCC 1NKZB 1PL5A 2ZAEB 2N9BA 4NPEA 3RGUA 1BCCD 2AEFA 5B5EE 3AEDC 2IPPA 1HTLC 2IBZI 1M1JB 1KFNA 5KJ7A 1SQBJ 1CI6B 1NTKK 1HJ0A 3JCUE 1XTCC 2DW3A 2W6JH 2M8RA 3V2PA 1MZ9A 2QM8A 1PZQA 2YO2A 3RK3B 1USEA 3L71J 2A06G 1Q2NA 3L74E 1GTWA 3BCCE 1LT9A 3L73D 2QJKC 3A0BH 1W5CE 1N7SB 4AQRD 5KKZB 3A0HE 1NU1D 1E5WA 2E76D 2A45G 3AEEC 1UIIA 3V4QA 3N4XA 2HPCA 1GK4A 1NAFA 3L75J 1EQ7A 4GDOA 3JC22 1SQPE 3CLQA 1YHQP 2KOGA 2C9LY 1NTMD 1X9VA 2WT7B 5KJ7D 1JCDA 2QA4P 1VF5B 2OYIC 1GMJA 2QE7H 3E1IA 3S1KA 4L76A 2K88A 3SFDC 1RF0A 3M9QA 5GTHE 2W6AA 1QX8A 3HD7B 5AW7B 1S4XA 2PRRA 5H2FE 3U1CA 5KLVK 3MTUE 5E79E 4ASWA 1RQUA 3CD6P 1LTTC 3CPWO 3VN0A 1IK9A 4HKZH 1NOHA 5CBOA 1S72P 3GG2A 2FYNB 1Q90D 1IFNA 4DOJA 1L0LG 4RKUJ 1SQQE 1M1JC 1L4AB 4WY4D 2BCCG 1S9KE 1HGVA 3WU2H 1RF1A 4Y99C 1JOCA 2NRGA 1E79H 2HODB 2YMKA 3L74D 3BCCD 1EDLA 1NKNA 4IFFA 4GT1A 3RK3C 1KB9E 3VMAA 1NTKG 3H1JE 3WUVA 4C7NA 1N7SC 5KKZC 2YXRB 1NHLA 2M3BA 3CX5H 3B5NA 3TSIA 4DZOA 1ZV8A 1JY2P 2ZFCA 1SQPD
chains in the Genus database with same CATH topology
1PP9J 1P84I 1NTKJ 3CWBJ 3CXHI 3L74J 1SQPJ 1BE3J 3H1KJ 1SQQJ 3BCCJ 3H1LJ 1EZVI 5KLVJ 3L73J 1NTMJ 2FYUJ 3L72J 3H1HJ 1NU1J 1L0NJ 4U3FJ 3H1JJ 4PD4I 3CX5I 1NTZJ 1SQXJ 1BCCJ 1SQVJ 3L70J 2IBZI 4D6TJ 1KB9I 1L0LJ 3L75J 3H1IJ 3TGUJ 1KYOI 3L71J 2BCCJ 1SQBJ 1BGYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 J;  1P84 I;  1NTK J;  3CWB J;  3CXH I;  3L74 J;  1SQP J;  1BE3 J;  3H1K J;  1SQQ J;  3BCC J;  3H1L J;  1EZV I;  5KLV J;  3L73 J;  1NTM J;  2FYU J;  3L72 J;  3H1H J;  1NU1 J;  1L0N J;  4U3F J;  3H1J J;  4PD4 I;  3CX5 I;  1NTZ J;  1SQX J;  1BCC J;  1SQV J;  3L70 J;  2IBZ I;  4D6T J;  1KB9 I;  1L0L J;  3L75 J;  3H1I J;  3TGU J;  1KYO I;  3L71 J;  2BCC J;  1SQB J;  1BGY J; 
#chains in the Genus database with same CATH topology
 4D6T G;  4Z1M H;  1ZR2 A;  1K8A Q;  1N8R Q;  3T97 A;  2ZXX A;  1NWQ A;  1L0N E;  2FY8 A;  3H6P A;  1LTS C;  2XV5 A;  5AW0 B;  5TIS E;  2PAJ A;  1JUN A;  3CI9 A;  3SSU A;  1LP1 A;  1IJD B;  1SQV J;  2POH A;  2HYN A;  2OYH A;  1VF5 C;  2ZVO B;  1ZP0 C;  1ZRT E;  4CPG A;  3B4S A;  2YKO A;  1FJK A;  3AE5 C;  5CCG A;  4WWI A;  1BSH A;  2W90 A;  3HD7 C;  3WMM 0;  2WSC H;  3FGA D;  1LT1 A;  1PV3 A;  1GL2 A;  1LTA C;  2D2C B;  1RH5 B;  2KK7 A;  1AVY A;  1SQQ D;  2G8Y A;  1LTB C;  1SFC A;  2H88 C;  2FYN C;  4IL6 X;  3RL0 B;  1S9K D;  1OWA A;  3H32 A;  2P7J A;  3B5N D;  3E1R A;  3HE5 B;  2IBZ G;  1L4A C;  1MUU A;  1BCC J;  3I56 P;  3KYQ A;  4GOD A;  1HGZ A;  2I1K A;  3L35 A;  1KB9 D;  2B87 B;  2W83 C;  3L72 E;  1BE3 G;  3H1J D;  1KYO E;  5KTB A;  1FS0 E;  3Q2Y A;  3VOP A;  2R44 A;  1S5L X;  1T6A A;  3RK2 B;  1T3J A;  1L0N D;  3L73 J;  3U59 A;  1KMI Z;  2H7H A;  3BRV B;  2QM7 A;  3MZW B;  3HUS B;  2AEM A;  1ZRT D;  3CXH I;  2Y9Z A;  3O6Q A;  2CK3 H;  1NTM J;  1FC2 C;  1PPJ G;  1OMI A;  2OYI A;  1KN7 A;  3QWO C;  4XFJ A;  1GU4 A;  4IFD K;  3CCJ P;  4HJG H;  3HE4 B;  1QL1 A;  2E75 C;  3AE4 C;  2ITA A;  2E42 A;  4BRY B;  2NPS B;  1NO4 A;  1T2K D;  2P10 A;  2ZYD A;  4I7Z B;  3CWB G;  2FYU E;  3LIE A;  1OVR A;  3AEC C;  1GD2 E;  4OGQ B;  4JYB A;  3RL0 C;  1LTG C;  2HR3 A;  3A0B E;  4RES B;  1HF9 A;  5GTH H;  1EXI A;  3RK3 E;  2HFE D;  3MUD C;  1AVO A;  3OW2 O;  2GUV A;  5KAI H;  3CL3 D;  2UWJ E;  1M1J A;  2Z5H A;  3CC4 P;  3L72 D;  1KYO D;  1CI6 A;  1OFC X;  1UIX A;  4L73 A;  4HB1 A;  1LGH B;  3AEF C;  1IFM A;  2Y0E A;  3V6I A;  3BCC J;  3P8C E;  4DT0 A;  3BRT B;  2PP6 A;  1FDI A;  3RK2 C;  3IAO A;  4PD4 I;  2A06 E;  1N7S A;  3ABV C;  2QG4 A;  4K3A A;  1H89 A;  1USD A;  1AJY A;  2KNC B;  1JB0 J;  1P84 I;  1RHZ B;  3HUS C;  3P32 A;  5APW A;  1J1E C;  1SQP J;  3RBX A;  4EDF A;  1X0T A;  5GTI E;  2C0X A;  2Q7C A;  3AE8 C;  1LTJ B;  2J5U A;  2AXC A;  1JY3 P;  3WU2 E;  2O1K A;  3TGU G;  1JMB A;  1IC2 A;  1SQB G;  2FYU D;  2R5D A;  1QLE D;  2NPS C;  4ZKU A;  3HD7 A;  3C1L A;  4I7Z C;  3AEA C;  2QRX A;  1DH3 A;  3C8V A;  3H25 A;  3FXD A;  5CJ4 A;  4OGQ C;  4XE5 B;  5L8R J;  4EI2 A;  1SQQ J;  4H13 C;  3TF5 A;  2WPR A;  3B71 A;  3V5B A;  4L75 A;  3H1L G;  3IR9 A;  1SQX K;  2Q9I A;  1IFJ A;  1QEX A;  2E74 D;  2BCC E;  1YIJ P;  5APT A;  2M3E A;  3EQ2 A;  3Q3D A;  1MFZ A;  2HOD A;  1JTH B;  5APY A;  1VQ4 P;  2A06 D;  2K9Y A;  3H1J J;  2WSS H;  3KQG A;  1SQV D;  3GW6 A;  3FWL A;  3A5T A;  1EDI A;  2WPV B;  1NTK E;  2OGU A;  1GK6 A;  3B8E B;  1ZXG A;  1JEK A;  1CSB A;  1PP9 G;  1L0N J;  4D6T E;  1NTZ K;  1QL2 A;  3H1H G;  3JSV C;  3KZI H;  5AW3 B;  1GZL A;  1VQ5 P;  1GU5 A;  1H0T B;  5AVY B;  1LTJ C;  1Y47 A;  3O8Z A;  1KIL B;  1ZW0 A;  2FXM A;  2K9J B;  1URQ B;  5M1B A;  1FZB A;  1Q86 Q;  5CCH D;  3P8M C;  4PJ0 H;  1YTZ I;  3CX5 D;  3IFM A;  1QVG O;  3RBZ A;  2H43 A;  1NU1 K;  1FZC B;  2QVA A;  2OYO A;  3M9B A;  1GDT A;  1EZV E;  2J58 A;  4U3F G;  4H0L B;  3AE1 C;  2BCC D;  1DD4 A;  3MUD A;  5AVQ B;  4B86 A;  1G1J A;  1HVV A;  2QIW A;  5KLV E;  1FZA A;  1WMK A;  4TT3 H;  2N1T B;  3L72 J;  5AW4 B;  1RY3 A;  3L70 J;  1NTK D;  1SQX G;  3HTK B;  1ZR4 A;  2IZ1 A;  1VQM P;  3M0D C;  3KHU A;  2QJP B;  3V2N A;  3CCM P;  2JWD A;  2E75 D;  1T8Z A;  4D6T D;  2AXT E;  2PGD A;  4OVN F;  1RE3 C;  4KT0 J;  1FBM A;  2R3C A;  4UB8 H;  4EOT A;  1EC5 A;  3IF4 A;  3A7O A;  3G9R A;  4K35 A;  2JEE A;  5KAI E;  2Q3E A;  5APX A;  2XU6 A;  1KIL C;  1R5S A;  1URQ C;  2A45 H;  5AVR B;  4EIJ A;  3II6 A;  1NTZ G;  5GTI H;  1RE4 C;  1DX7 A;  1VQ6 P;  1PPJ E;  3F5H A;  3HE4 A;  2JO1 A;  1BGY G;  2YIU B;  4BRY A;  2FYU J;  2NPS A;  1VQ8 P;  2IFM A;  2ZT9 B;  1VL2 A;  3GHG B;  1EZV D;  1QGK B;  1KB9 I;  4M3L A;  3KPE A;  4N6J A;  1FZC C;  1Y9B A;  2JR8 A;  2O01 H;  2QSI A;  5KLV D;  4H0L C;  4TLF A;  1ZOY C;  1MV8 A;  2KS1 B;  2VRS A;  1G2C A;  3GF7 A;  3N7N A;  1NU1 G;  2JDI H;  3CCU P;  3Q5S A;  2M5A A;  1NJI Q;  1LWU A;  1NGM B;  2ZXE B;  3AE3 C;  1YJN P;  1N86 A;  3H1K G;  4W80 A;  2J59 M;  2QJY B;  4N3Y B;  2ZJS E;  2H89 C;  5AVU B;  2QJP C;  1IFI A;  4I2L C;  1BDC A;  2IDB A;  2P2U A;  1R5L A;  3PJS K;  3MD0 A;  1J2J B;  5C39 A;  3L36 A;  3H1I G;  3FWN A;  2V4H A;  2WSF H;  4JPZ B;  1IZN B;  1IFP A;  1KC8 Q;  1TU3 F;  1A02 F;  2N9Y B;  4MN4 C;  4H13 D;  3MGN A;  2LR2 A;  2E5Y A;  1JY2 N;  3SWK A;  1PPJ D;  1PGJ A;  1LTJ A;  2W27 A;  3V2Q A;  1GW4 A;  4EYY Q;  2L5G B;  1PGQ A;  3G3Z A;  4IL6 H;  1VQ9 P;  2K37 A;  2YIU C;  2ZYG A;  3TGU E;  1OZH A;  2I8D A;  5AW6 B;  4R4M A;  3GHG C;  4PV1 D;  1KYO I;  1JO5 A;  1FOS F;  1JY2 O;  3WUU A;  3D70 A;  4H44 D;  5CHX A;  1IO4 A;  1K9M Q;  1N73 B;  2RKL A;  3PH0 A;  4IOI H;  3L74 G;  5BU8 B;  4GIF A;  1X8Y A;  5AW1 B;  1KFM A;  3L70 E;  1SLQ A;  2E43 A;  1L0L J;  1WRG A;  1LT9 B;  1FDM A;  2GUS A;  5APS A;  2BCC J;  1S5L H;  5CCG D;  1YYC A;  3H1L E;  1KQG B;  3KZI E;  3MP7 B;  4WY4 B;  1OVV A;  1GL2 D;  2WSE H;  3EFG A;  3CCS P;  2WSF J;  2XKM A;  1SFC D;  1EDJ A;  1OX3 A;  1YTZ T;  3KXD A;  2WSC J;  1DEB A;  1SQB K;  1NTK J;  4PJ0 E;  5APU A;  2M0B A;  3PTZ A;  1HJB A;  4D6T J;  3GF3 A;  1RE3 A;  1OVU A;  2YMY A;  1VQO P;  2P1J A;  1CZQ A;  1M7L A;  1PP9 E;  5DJT B;  3L4F A;  2D2C C;  3AEG C;  2AXT H;  3H1H E;  4HH2 A;  1FDO A;  3VTP C;  2JJL A;  2WTY A;  1KIL A;  2KSJ A;  3TGU D;  4RO0 A;  1LNQ A;  1AA0 A;  2K9J A;  2BEZ F;  5TJH A;  2OTL P;  3I55 P;  4GOE A;  1RE4 A;  4KHX A;  3TYY A;  4YXW H;  1S3J A;  1HH0 A;  5AW8 B;  1RF1 B;  3NXS A;  1KV4 A;  1W2B O;  1Q81 Q;  1N73 C;  3L70 D;  3AE9 C;  3D6Z A;  3CC7 P;  3BVH A;  3S4R A;  4N78 E;  1OXZ A;  1L2P A;  3H1L D;  1LT9 C;  2YKQ A;  2RN0 A;  4C7N B;  5KLV J;  4UB8 E;  3B5N B;  4U3F E;  1BDD A;  1VQK P;  2WVR A;  3HRN A;  4WY4 C;  1VQL P;  3T97 B;  2H8P D;  2YO3 A;  2O01 N;  2B9B A;  5AVX B;  1H88 A;  2KLU A;  2AEJ A;  1YJ9 P;  3HTK A;  3A2A A;  4GOF A;  2OYH B;  1SQX E;  2WWW A;  1MFT A;  1FOS E;  1KTM A;  2XZR A;  2YKP A;  1YI2 P;  1PP9 D;  2WT7 A;  4ZMD A;  4PD4 E;  3SFE C;  5AVV B;  3LW5 H;  3VMY A;  3H1H D;  2V7Q H;  3CCE P;  1Q7Y Q;  4L74 A;  1VQ7 P;  3CX5 I;  5AVZ B;  2FYZ A;  3VMX A;  5CMZ A;  3RK3 D;  4YTP C;  3H32 B;  2RH0 A;  4JQ0 D;  5BVZ A;  3L71 G;  5AVS B;  1N7S D;  2IYO A;  3CMA P;  1QVF O;  1G1I A;  1NTZ E;  3E7K A;  4LLH A;  3W68 A;  1U57 A;  1L4A A;  5KAF H;  1BSN A;  1L0L E;  2W8Z A;  1SQV K;  5CBN A;  3GHG A;  4N78 D;  1BGY E;  2OAR A;  1JY3 N;  3L75 G;  1FE6 A;  3P8C D;  3TNU B;  1S1C X;  4U3F D;  4WBA A;  1S2E A;  4U7J A;  1XTG B;  1VF5 D;  1FZG A;  3SWF A;  1J1D B;  3UIA A;  2WZ7 A;  2XDJ A;  4NPD A;  3HD7 D;  2Y0D A;  3VP9 A;  1NU1 E;  1YQ3 C;  2PFX A;  3NFQ A;  1SQX D;  1EXJ A;  1RQV A;  1AQT A;  4IL6 E;  2OYH C;  2WMM A;  1AQ5 A;  1U7J A;  2IZ0 A;  3H1K E;  3Q1M A;  3BAS A;  2OYI B;  1L4A D;  3AEB C;  4OH8 B;  2KIK A;  1NAY A;  1OW6 A;  3G4S P;  3H1I E;  1SP4 A;  1YIT P;  2CPB A;  3USS A;  4WVZ A;  1EZV I;  1S5L E;  5CJ0 A;  4HYT B;  1NTZ D;  2YNY A;  1L0L D;  3CCV P;  3FX0 A;  3KDP B;  3TGU J;  1BGY D;  5AVT B;  3HE5 A;  2XNX A;  3AE2 C;  2G3A A;  1HUC A;  2IBZ E;  3CXH H;  3M9H A;  4Y99 B;  1WT6 A;  2OQQ A;  1NTM K;  1T2K C;  4O9B A;  1HBW A;  1N73 A;  1H8A A;  2B87 A;  1LJ2 A;  1K04 A;  4UB6 E;  1SQV G;  1BE3 E;  1J1D C;  1U7M A;  2FXP A;  3H1L J;  5DJU B;  4DJG A;  1ZN5 A;  2LXC B;  4WY4 A;  2D2C D;  2OTK E;  1X79 B;  2FBW C;  3GMA A;  1M56 D;  2E74 B;  2GA1 A;  3NMD A;  1ZME C;  3H1K D;  1DEE G;  4JF7 A;  3HUS A;  4LC1 A;  1T3U A;  2HG5 D;  3RL0 D;  1Y8A A;  4IFM A;  3BAT A;  3W67 A;  4QMA A;  3G71 P;  3H1I D;  2WPS A;  3PHL A;  1BCC G;  3VMZ A;  1PP9 J;  4W7Z A;  1N2D C;  1IK7 A;  2Q5U A;  2WIT A;  4Y28 J;  3H1H J;  3L37 A;  2W6B A;  4PD4 H;  2R5B A;  2Y9Y A;  3CWB E;  2K3R A;  5APQ A;  1DD3 A;  3TDK A;  1P84 H;  2IBZ D;  3RK2 D;  1SQP K;  1KQF B;  1AFO A;  2P67 A;  5AW2 B;  3M91 A;  3K5B A;  5AW9 B;  4NPF X;  4BXL A;  3L73 G;  4ASV A;  3D71 A;  2N1T C;  3CC2 P;  1BE3 D;  2FFD B;  3MIW A;  1A02 J;  4ZKP A;  4U3F J;  4AUW A;  3IN6 A;  1NTM G;  1YBK A;  2O1J A;  4C7R A;  3C9I A;  1OIP A;  3GLM A;  3WUT A;  3F89 A;  2WQY C;  2NPS D;  2KZI A;  1NYH A;  2E5T A;  2E74 C;  2KLV A;  1M90 Q;  1SQQ K;  2KNC A;  1OW7 A;  2P58 A;  2Z4E A;  4JYC A;  5B66 E;  4OGQ D;  2E76 B;  1SQX J;  1SVF A;  5K5G B;  5AVW B;  1PFI A;  5KAF E;  1JNM A;  3MHV A;  1GW3 A;  4JBZ A;  2LKM A;  3M06 A;  1VDF A;  2E75 B;  2O01 J;  1ZLL A;  2JKV A;  1EDK A;  2B88 A;  2ZT9 C;  1SQB E;  3CWB D;  3OJA B;  2Q1K A;  1FU1 A;  2KXP B;  1EZV G;  2LXB A;  5AW5 B;  3TK1 A;  3BCC G;  5KLV G;  3CME P;  1L0N K;  1VQP P;  1NTZ J;  2I1J A;  2YXQ B;  4XA4 A;  3VP8 A;  2WPQ A;  2HLO A;  2JP3 A;  3L71 E;  4LGD E;  1BGY J;  5CCH C;  1N7L A;  1PGP A;  5B5E H;  1YQ4 C;  5EFW B;  3P7K A;  2FFD C;  1VQN P;  2HPC B;  1SQP G;  3LID A;  3TNU A;  3L75 E;  1JTH A;  5KLI B;  2C9N Y;  3JCU H;  1IFD A;  2JWA A;  2QJY C;  3V4W A;  1JCC A;  2KI7 B;  1FZE A;  3M0D A;  3VYI A;  2ZVN B;  4A7P A;  1KIL E;  1M1K Q;  1NU1 J;  4I6M C;  4C46 A;  4UB6 H;  1J1E B;  4BWN A;  2RMZ A;  1PGO A;  2Z5I A;  3U1A A;  2E76 C;  1DIP A;  3A0H H;  4YXD C;  3PRJ A;  2L91 A;  4YPC A;  3D6Y A;  3H1K J;  3SWY A;  2BAS A;  1K73 Q;  3CCL P;  3FXE A;  2QEX P;  2FXO A;  1SQQ G;  2KP8 A;  4R4L A;  1H0T A;  3CCQ P;  3CXH E;  1FJP A;  1SS1 A;  3A3Y B;  3H1I J;  1SQB D;  1URQ A;  5KJ7 C;  1NH4 A;  2NZ2 A;  5BU5 A;  3EFF K;  2B89 A;  3S9O A;  2R32 A;  2Y0C A;  1JM0 A;  2K1A A;  4AYC A;  4H13 B;  3L71 D;  3G6E P;  3H1J G;  2KUB A;  2WSE J;  4W7Y A;  5H2F H;  1KQL A;  1FZC A;  5E79 H;  3R2P A;  1G2C B;  1HWT C;  2XND H;  1Q82 Q;  1M57 D;  2BEQ D;  2CPS A;  2M5A B;  3L75 D;  1LWU B;  2A45 I;  2N1T A;  1L0N G;  3RL0 g;  4PV1 B;  1Z56 A;  1K05 A;  3L74 J;  2Q3I A;  2KZJ A;  1BE3 J;  4H44 B;  5KLI C;  1OW8 A;  1KIL D;  1MKM A;  1LP1 B;  3AE6 C;  2FYU K;  1URQ D;  1SQV E;  2ZYA A;  1FZF A;  1AV1 A;  1M8O B;  3AE7 C;  1KB9 H;  1KOR A;  2KYV A;  1RF0 C;  1GL2 B;  3OA7 A;  1P84 E;  3CXH D;  2MJZ A;  3PLN A;  1FAV A;  1SFC B;  4H0L D;  2SPZ A;  1KZU B;  5TIS H;  3ITK A;  1YJW P;  5B66 H;  1D7M A;  2N1T D;  1CW5 A;  3R4Y A;  3PP5 A;  3Q5P A;  1BCC E;  3Q5R A;  4ZNC A;  3L72 G;  1LTI C;  4WB4 A;  1RF1 C;  2KSE A;  3OAK A;  3L70 G;  3CWB J;  3CX5 E;  1PIX A;  1VPC A;  1NVO A;  4I1L A;  2O3J A;  4DCK A;  2GM4 A;  2R3S A;  3B5N C;  1JMM A;  2KS1 A;  2QJK B;  3M0A A;  3I5C A;  1LWU C;  5CCH A;  1JY3 O;  2C0W A;  1R8E A;  4PV1 C;  3L73 E;  1KQS O;  3ZDM A;  2FKW B;  4GKG A;  2FFD A;  3NTN A;  4H44 C;  2IFN A;  3LW5 J;  2IX7 C;  2V7Q J;  2MKV A;  2Q6Q A;  3O6Q B;  3V2R A;  4PD4 D;  1KYO H;  2OTJ P;  1X22 A;  1NTM E;  3EWK A;  4RJT A;  2KB7 P;  5CCG C;  2ZT9 D;  1P84 D;  1W2E A;  1GL2 C;  2FYU G;  3CCR P;  4OWF A;  5APV A;  1L0L K;  3QH9 A;  4KJM A;  2IYP A;  1KD1 Q;  1SFC C;  1NKZ B;  1PL5 A;  2ZAE B;  2N9B A;  4NPE A;  3RGU A;  1BCC D;  2AEF A;  5B5E E;  3AED C;  2IPP A;  1HTL C;  2IBZ I;  1M1J B;  1KFN A;  5KJ7 A;  1SQB J;  1CI6 B;  1NTK K;  1HJ0 A;  3JCU E;  1XTC C;  2DW3 A;  2W6J H;  2M8R A;  3V2P A;  1MZ9 A;  2QM8 A;  1PZQ A;  2YO2 A;  3RK3 B;  1USE A;  3L71 J;  2A06 G;  1Q2N A;  3L74 E;  1GTW A;  3BCC E;  1LT9 A;  3L73 D;  2QJK C;  3A0B H;  1W5C E;  1N7S B;  4AQR D;  5KKZ B;  3A0H E;  1NU1 D;  1E5W A;  2E76 D;  2A45 G;  3AEE C;  1UII A;  3V4Q A;  3N4X A;  2HPC A;  1GK4 A;  1NAF A;  3L75 J;  1EQ7 A;  4GDO A;  3JC2 2;  1SQP E;  3CLQ A;  1YHQ P;  2KOG A;  2C9L Y;  1NTM D;  1X9V A;  2WT7 B;  5KJ7 D;  1JCD A;  2QA4 P;  1VF5 B;  2OYI C;  1GMJ A;  2QE7 H;  3E1I A;  3S1K A;  4L76 A;  2K88 A;  3SFD C;  1RF0 A;  3M9Q A;  5GTH E;  2W6A A;  1QX8 A;  3HD7 B;  5AW7 B;  1S4X A;  2PRR A;  5H2F E;  3U1C A;  5KLV K;  3MTU E;  5E79 E;  4ASW A;  1RQU A;  3CD6 P;  1LTT C;  3CPW O;  3VN0 A;  1IK9 A;  4HKZ H;  1NOH A;  5CBO A;  1S72 P;  3GG2 A;  2FYN B;  1Q90 D;  1IFN A;  4DOJ A;  1L0L G;  4RKU J;  1SQQ E;  1M1J C;  1L4A B;  4WY4 D;  2BCC G;  1S9K E;  1HGV A;  3WU2 H;  1RF1 A;  4Y99 C;  1JOC A;  2NRG A;  1E79 H;  2HOD B;  2YMK A;  3L74 D;  3BCC D;  1EDL A;  1NKN A;  4IFF A;  4GT1 A;  3RK3 C;  1KB9 E;  3VMA A;  1NTK G;  3H1J E;  3WUV A;  4C7N A;  1N7S C;  5KKZ C;  2YXR B;  1NHL A;  2M3B A;  3CX5 H;  3B5N A;  3TSI A;  4DZO A;  1ZV8 A;  1JY2 P;  2ZFC A;  1SQP D; 
#chains in the Genus database with same CATH homology
 1PP9 J;  1P84 I;  1NTK J;  3CWB J;  3CXH I;  3L74 J;  1SQP J;  1BE3 J;  3H1K J;  1SQQ J;  3BCC J;  3H1L J;  1EZV I;  5KLV J;  3L73 J;  1NTM J;  2FYU J;  3L72 J;  3H1H J;  1NU1 J;  1L0N J;  4U3F J;  3H1J J;  4PD4 I;  3CX5 I;  1NTZ J;  1SQX J;  1BCC J;  1SQV J;  3L70 J;  2IBZ I;  4D6T J;  1KB9 I;  1L0L J;  3L75 J;  3H1I J;  3TGU J;  1KYO I;  3L71 J;  2BCC J;  1SQB J;  1BGY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...