3L71J

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l71J00
3CXHI 1NTZJ 1NU1J 3H1IJ 3H1JJ 1SQXJ 1SQVJ 1BE3J 1SQQJ 3L70J 2IBZI 5KLVJ 1SQPJ 3BCCJ 1L0LJ 4D6TJ 2FYUJ 3H1KJ 1KB9I 3H1LJ 1P84I 3H1HJ 4PD4I 3L71J 2BCCJ 3L73J 1EZVI 3L75J 1BCCJ 1PP9J 3CX5I 1NTKJ 1KYOI 1SQBJ 3CWBJ 1L0NJ 3L72J 4U3FJ 3TGUJ 1NTMJ 3L74J 1BGYJ
chains in the Genus database with same CATH superfamily
3OAKA 3AE4C 2JO1A 1IFPA 5GTIE 1NAYA 3GW6A 1HH0A 3KQGA 1M8OB 2Y9ZA 2P67A 5L8RJ 3AE2C 3KYQA 4DT0A 3U1CA 2IBZG 2A45I 3AEFC 5BU5A 1IFIA 1SQVJ 3KZIH 1SQQJ 5KKZB 1OW6A 2KSEA 1QVFO 3B4SA 3B5NC 4L76A 5KLVD 2OYIA 2KK7A 1Q90D 1SQXD 3BATA 3PRJA 1GU5A 3W67A 3H1KD 1CZQA 3VOPA 4ASWA 4N6JA 3A7OA 2WT7A 1NO4A 3CWBG 2AEFA 2R32A 1L0LK 5KLVG 4I1LA 2ZYDA 5KTBA 3AE3C 1VPCA 1HF9A 1USDA 1LTJC 3AEDC 2E42A 4UB8E 4XFJA 1QGKB 1GL2B 3H1JJ 2BCCG 1PZQA 5AW6B 3V4QA 2AXCA 3GG2A 3CXHH 5BU8B 4TLFA 3IF4A 1JMBA 4WY4C 4D6TE 2J59M 2I1KA 1L0LJ 3TGUD 5AVZB 3E7KA 1NJIQ 1BGYD 3HE4B 3P7KA 1NTKE 3D6YA 2D2CC 3GHGA 1YHQP 3BRTB 3CC2P 3IN6A 3OW2O 1IK7A 3HD7D 2A06E 3TGUG 1KMIZ 4TT3H 1BGYG 2HFED 2AEJA 2NRGA 3D6ZA 4N3YB 1BE3D 2Z5IA 3WU2H 2FYNB 3M06A 3ZDMA 2HODA 4ZKPA 5KAIH 1GK4A 1IFJA 3WUUA 3CC4P 3II6A 2WSFJ 3R2PA 1KQFB 3C1LA 1FAVA 1BE3G 1NH4A 1T6AA 1PGOA 2KOGA 2ZYGA 1IFMA 2K37A 2ZJSE 1N86A 3L35A 3L70J 3L75D 3G71P 1BDDA 1KYOH 3AEEC 4U3FD 1NTMD 1IO4A 3CCMP 3JCUE 3L72J 5H2FH 3USSA 2G3AA 1Q81Q 2P7JA 3FXEA 3H1HG 1SS1A 3RL0D 2WZ7A 2P1JA 2KNCA 1OVVA 3ABVC 4MN4C 1Q82Q 1XTGB 2PFXA 4U3FG 1NTMG 1NAFA 4NPFX 1L0NE 5CHXA 1J1DC 3D71A 1N7SB 1KN7A 3MZWB 3FX0A 2E75B 1NU1J 4BRYA 3O6QB 2B87A 3HTKA 1LP1A 1M90Q 2KS1B 1OZHA 4M3LA 3JSVC 2OTJP 4GOFA 3VN0A 2NPSB 2BEZF 3U1AA 2ZVNB 1PP9D 1SQPJ 1EZVG 1T2KC 2VRSA 2W27A 3EWKA 3A0BH 1ZRTE 1LT9C 2FYUK 2FY8A 1AQTA 2W6AA 3H1IE 2KIKA 3Q5PA 3I5CA 3CCQP 1K73Q 2FFDC 2XU6A 1X22A 1NTZK 3AECC 1PP9G 1L0ND 3NMDA 2A45H 3SWFA 5E79H 3FWLA 2OYHB 2HLOA 2J5UA 3FXDA 1PIXA 3AEBC 1VL2A 5AW1B 5GTHE 1DD3A 2WPRA 1KFNA 1URQB 5KLIC 3D70A 2WSCJ 4OGQB 3L73G 1NOHA 1FZAA 3M0AA 4WVZA 1FZCB 2RN0A 1SQBE 1ZV8A 2AXTH 1NWQA 2YO2A 1HVVA 1TU3F 1NTZJ 3HD7C 1BCCG 4IFFA 2W8ZA 3CMAP 3G6EP 1SVFA 1FOSE 1YTZT 1LTGC 3Q2YA 3S9OA 2NZ2A 5CCGA 4C7NB 3H1LD 5KLVK 3IAOA 2R5BA 2WSEJ 1SQXK 5AW0B 3G4SP 1VQ7P 1OVUA 1DIPA 4PD4E 5CBNA 5B66E 3H6PA 4PD4I 2N1TB 3F5HA 4GIFA 3L70G 2W6JH 5AVXB 1H0TA 3MUDC 1SQPE 2XV5A 1KILB 3N7NA 1LGHB 2R3SA 4EI2A 1HJ0A 1M57D 3TDKA 2Q9IA 3OJAB 1L4AA 3CWBJ 5KLVJ 2QSIA 3RL0C 1SFCA 1SQXJ 2V7QJ 1JY2P 2H43A 1LTAC 2QIWA 1P84E 3T97A 2MJZA 1P84I 1G1IA 2OYIB 1J1EB 2BCCJ 1RF0A 3L74E 1QL1A 1PFIA 2QM8A 3QH9A 1MZ9A 4PV1D 1LNQA 4A7PA 4H0LB 2FXPA 2WT7B 1YI2P 3L37A 3RBZA 3SSUA 4GKGA 4W80A 1X79B 4ZKUA 1S1CX 4K35A 1VF5B 1W2EA 2W90A 4H13B 5KKZC 2QJYB 3N4XA 2B9BA 3JCUH 2ZXEB 2QM7A 5KJ7D 2ZAEB 1M1JA 3TGUJ 1BGYJ 1VQLP 4AYCA 1H89A 2IBZE 2NPSD 3AE8C 2IBZI 1YJWP 1GU4A 1LTTC 2IPPA 3V6IA 4GT1A 2OARA 3GHGB 2PRRA 1KD1Q 5AVVB 1R8EA 1ZP0C 2FYUG 1MFTA 1BE3J 2GUVA 3A0HE 2JJLA 1MV8A 3HE5A 1OMIA 1VQ4P 5APUA 3G9RA 1IC2A 1G2CA 3RK2B 1YQ3C 4IL6E 3F89A 3PTZA 3AE6C 4LC1A 3EFFK 2KZIA 2HODB 3CPWO 1KILA 2KXPB 2OQQA 5DJTB 1FJKA 2QVAA 4W7ZA 4KJMA 4YXWH 1KILE 2BCCE 4N78D 3KHUA 3RK3B 3CCUP 1OX3A 3H1HJ 5AW2B 2JKVA 4H44B 3TYYA 3PP5A 4U3FJ 1HWTC 1NTMJ 2HPCA 1IFNA 5K5GB 1IK9A 3BCCE 4BWNA 3KDPB 4Y99B 2I1JA 2YXQB 3QWOC 5AVWB 3VP9A 4C46A 1NGMB 5CCHA 5APYA 2WSSH 3CX5E 1FU1A 2FYNC 3CX5I 4XA4A 2AEMA 1JMMA 1VQKP 1WMKA 1JCDA 1X8YA 1JM0A 4JF7A 2O01N 3WUTA 1FBMA 1LTSC 4RO0A 2KNCB 3JC22 1JY3P 1T2KD 2M3EA 3TNUA 4JBZA 1SQXG 1L0NK 3H1KG 1UIIA 1QLED 1S72P 2O1KA 2N9BA 4UB6E 3MHVA 3LW5J 4BRYB 5AVTB 2B87B 2Q3IA 4PJ0E 2KZJA 1VDFA 3A3YB 3HTKB 1LP1B 3AEAC 1DH3A 1PP9J 1DX7A 1FS0E 3RGUA 3C8VA 2OTLP 4PV1C 3CCLP 2R3CA 1G1JA 1QL2A 2FXOA 4WB4A 1ZOYC 3L71E 4EYYQ 2M5AB 2A45G 1S2EA 2K1AA 2Z4EA 3L73J 1RQUA 5AVYB 2E75C 1JTHA 2UWJE 1FC2C 1GZLA 3FWNA 3H1HE 1GD2E 2KI7B 2RKLA 3GF7A 5KJ7C 2KYVA 4HKZH 3C9IA 4I7ZB 3R4YA 1BCCJ 3M0DA 3CCSP 1VF5D 3B71A 1SQVE 1SQQE 4H13D 2NPSC 1JO5A 2C9NY 1KQSO 4DCKA 2ZT9D 4K3AA 1GW3A 1BSHA 1N73A 3RK3E 5CJ4A 4D6TD 5AW3B 3L71D 2Y0DA 3A2AA 1OWAA 1NTKD 2FBWC 3H1LJ 1EZVE 4I6MC 1EZVI 2QJPC 2R5DA 3AE9C 2QA4P 3H1JE 2POHA 1VQMP 2A06D 1OW7A 4W7YA 3V2RA 5BVZA 1S5LE 3B8EB 1AFOA 3L75G 2KUBA 1GDTA 2C0WA 1CI6B 2ZYAA 1DEBA 2IYOA 5AW9B 4Z1MH 2A06G 1H0TB 3TK1A 1L0LE 2Q6QA 1KB9E 3Q3DA 3L73E 4JPZB 1KB9I 1RF1C 2YMKA 3BASA 2D2CB 3IFMA 3Q5RA 3AE5C 1L4AB 3WUVA 2H7HA 2YO3A 1W2BO 3V4WA 1ZLLA 1SFCB 1NKNA 1QEXA 2M5AA 4IL6H 3CI9A 3T97B 1BCCE 4BXLA 2N1TC 5DJUB 3PLNA 1Y9BA 3KXDA 1KQGB 1N7LA 3MIWA 5GTIH 2CPSA 1Z56A 1Q86Q 2IX7C 2HYNA 1RQVA 2Y0CA 3CL3D 5AW4B 2LXCB 1VQ8P 4HJGH 2H88C 1KB9D 3L70E 1GL2D 2BASA 2ZXXA 3P8MC 1S4XA 1L0NG 2FYUJ 3B5NA 3KZIE 5APTA 3CD6P 1J1EC 3L72E 3M9HA 3HUSC 1J2JB 1N8RQ 1Y47A 1M1JB 1X0TA 4H0LC 2IZ0A 1ZRTD 1H88A 3H32A 2IDBA 1FE6A 2H89C 4UB8H 3VP8A 2DW3A 3H1ID 1LTJA 1VF5C 1NU1E 4ZMDA 4H13C 2QJYC 1MFZA 3WMM0 2IFNA 3IR9A 2Q5UA 1IFDA 2MKVA 1QVGO 1DD4A 5APVA 1ZR4A 1EXIA 3HE5B 2ZT9C 1YJ9P 5AW8B 1CI6A 1PPJE 4RJTA 1JY2N 1G2CB 3CXHE 3CCJP 3CXHI 2JWDA 2WVRA 4WY4A 2IYPA 3M9QA 3H1LG 2YIUC 1LT1A 3SWKA 1FZBA 3L72D 4HB1A 2GM4A 1SQBD 3L4FA 2XKMA 2FYZA 2SPZA 2E76B 2XNXA 3GHGC 1T8ZA 5CBOA 3V2PA 5APQA 2WPQA 1LWUC 4OH8B 1YQ4C 2HPCB 2QE7H 3V2NA 1IZNB 4DZOA 3H1KJ 2YKPA 1NU1D 2XZRA 2JEEA 1HTLC 2I8DA 3E1RA 3V5BA 3TSIA 1KTMA 3H25A 1ZR2A 3PJSK 1GTWA 5KLIB 3WU2E 4CPGA 4PD4D 1H8AA 2KSJA 3M9BA 4IL6X 4L75A 5KAIE 4LGDE 3CC7P 2K9JA 1T3UA 4JYCA 1PGQA 4HYTB 3TNUB 1SQPD 2YMYA 1NTZE 1N7SD 1FJPA 3UIAA 3AEGC 1YJNP 4O9BA 2E75D 3PHLA 2N9YB 1KYOE 3SFDC 3W68A 3ITKA 1S5LH 1S9KE 1A02F 1KYOI 4KHXA 3MP7B 4OWFA 1RE3C 5B5EE 3GF3A 2E74B 4IFDK 1P84D 5H2FE 3L74D 1MUUA 5CMZA 2G8YA 5AVUB 2W6BA 1ZW0A 4LLHA 1OVRA 1NTKK 2FKWB 3VYIA 1KB9H 1GL2C 1U7JA 3EFGA 4NPEA 1GK6A 1X9VA 1JTHB 3L74G 1RF1A 5M1BA 3CWBE 4R4MA 2M0BA 5KLVE 3OA7A 1JUNA 1SQXE 2WITA 1URQD 3RL0B 1NKZB 3H1KE 2QJKB 4OGQD 3LIDA 1M1KQ 2BEQD 1SQQK 1LT9A 2B88A 5TJHA 1WRGA 1R5SA 3MGNA 1PGPA 1K9MQ 1N73B 3L75J 2L5GB 3A0BE 2IBZD 2WSFH 1JY3N 4C7RA 2FFDA 1NYHA 5KAFE 5GTHH 5AVRB 4EDFA 1SLQA 4I7ZC 4NPDA 4YTPC 3CCEP 5E79E 4JQ0D 1EDLA 1FDMA 2HG5D 1XTCC 2CK3H 5APWA 5TISE 3CWBD 3E1IA 1JCCA 2E43A 2HR3A 2H8PD 2KP8A 3HUSA 1RHZB 3TGUE 2YNYA 2N1TD 4DOJA 3VMYA 1BGYE 1FDIA 4WWIA 2K88A 2AXTE 1KILD 1KQLA 1QX8A 2BCCD 3HD7A 2PP6A 2Z5HA 1LJ2A 3A5TA 5C39A 1HBWA 1VQ5P 1K04A 3VMXA 2E76D 3O8ZA 1OXZA 2O01H 1JOCA 3BCCD 1BE3E 5CCGC 4PD4H 2RMZA 5B66H 1W5CE 3CX5D 1ZN5A 2LKMA 5CCHD 4IOIH 2JDIH 1S5LX 1L2PA 1EC5A 1PV3A 3CCRP 1AQ5A 3KPEA 2W83C 1L0NJ 3BCCG 1N7SC 1PGJA 2PGDA 3BRVB 3MUDA 2K3RA 4H0LD 1EDJA 2CPBA 4IFMA 1K05A 2J58A 2PAJA 4GDOA 3L75E 1L4AC 4U3FE 1NTME 4U7JA 1LWUA 1P84H 1SFCC 1RE4C 3G3ZA 1NVOA 1HUCA 3VMAA 3NXSA 2WTYA 2WSCH 3B5NB 2Q1KA 1Q2NA 1RF0C 2RH0A 1EQ7A 1SQBK 3CCVP 1FZGA 1R5LA 2E74D 3H1IJ 2YKQA 1DEEG 2ITAA 1M7LA 3H32B 3GLMA 4JYBA 2OYHC 1CSBA 1VQ6P 2KB7P 1USEA 1LTJB 4D6TG 3H1HD 1URQC 1JY2O 3I56P 3L71G 1E5WA 1NU1K 4OGQC 4RESB 1AVOA 1NTKG 2E5YA 1PP9E 1FZCC 5B5EH 2WSEH 4AUWA 3S1KA 1SQVD 1M1JC 1SQQD 3RK2D 1SQBJ 1KV4A 1RE3A 4PV1B 4WY4B 2Y0EA 4I2LC 3P32A 2OGUA 1SQPK 2P2UA 3RK3D 1RY3A 4H44D 1VQ9P 3M91A 2JP3A 2Y9YA 1SQVG 1SQQG 1YIJP 3A0HH 3FGAD 1GL2A 1FOSF 3Q5SA 3EQ2A 1BSNA 1EZVD 2O01J 4WBAA 1PL5A 1NHLA 2V7QH 3H1JD 3U59A 1D7MA 2ZVOB 1AJYA 3CLQA 1RH5B 1FZFA 4ASVA 3I55P 1KILC 4L74A 1AA0A 1M56D 3HE4A 1FZEA 1Q7YQ 2B89A 2E76C 2K9JB 4HH2A 3H1JG 2V4HA 1L0LD 4RKUJ 1EDKA 5KAFH 4XE5B 2WPSA 1LTBC 3L73D 3CX5H 4R4LA 3H1LE 1KORA 5CCHC 2OYIC 2QJPB 3MD0A 3L74J 1L0LG 3VTPC 5TISH 3GMAA 3MTUE 2P58A 1HGVA 1OIPA 1S3JA 2QEXP 1BCCD 2ZFCA 4Y28J 2YKOA 4UB6H 1J1DB 1U7MA 1VQPP 3HRNA 4OVNF 3V2QA 2LR2A 2O1JA 4PJ0H 2M3BA 2OYOA 2FXMA 3P8CE 1GW4A 1RF1B 4GOEA 2E5TA 3VMZA 1ZXGA 3H1IG 1U57A 3L70D 3NFQA 2E74C 2IZ1A 1JY3O 2YXRB 2C0XA 2JR8A 1LT9B 3B5ND 5AVSB 3SFEC 1HGZA 1LTIC 1WT6A 2C9LY 1VQOP 1K8AQ 4L73A 1N7SA 1SP4A 1GMJA 4ZNCA 1T3JA 3PH0A 2QRXA 2FFDB 1Y8AA 4QMAA 3O6QA 1FDOA 1EXJA 3L72G 2XDJA 1SQBG 3AE7C 5KJ7A 1YITP 3BVHA 2KS1A 2P10A 3RL0g 3RK2C 3NTNA 2K9YA 3M0DC 4AQRD 3LIEA 4YXDC 2NPSA 3P8CD 3TF5A 1RE4A 5CCGD 1YBKA 2QJKC 2FYUE 2LXBA 3CMEP 3RK3C 1PPJD 3SWYA 1OFCX 5AW5B 2QG4A 3CXHD 1OW8A 4H44C 1NU1G 1N73C 3HUSB 1IJDB 4YPCA 1ZMEC 1KC8Q 1JEKA 2O3JA 4WY4D 4Y99C 5CJ0A 3HD7B 1E79H 3BCCJ 1CW5A 3RBXA 1PPJG 2OYHA 1A02J 2D2CD 1L4AD 3LW5H 1SQPG 2JWAA 1URQA 5APSA 2GUSA 5APXA 1JNMA 2KLUA 1SFCD 2GA1A 2WPVB 1FZCA 2ZT9B 1KZUB 5EFWB 1KFMA 4N78E 1UIXA 1VQNP 4B86A 1HJBA 3Q1MA 2FYUD 3AE1C 1YTZI 1MKMA 2OTKE 1AVYA 1EDIA 4EOTA 2YIUB 1YYCA 1JB0J 5AW7B 2Q3EA 2KLVA 1NTZD 3K5BA 5AVQB 3L36A 4C7NA 4DJGA 1NTMK 1LWUB 2IFMA 2WQYC 4GODA 2R44A 2WMMA 2WWWA 1SQVK 2M8RA 2XNDH 1KYOD 4D6TJ 1BDCA 4EIJA 1S9KD 2N1TA 3L71J 4KT0J 1AV1A 1NTZG 1N2DC 2Q7CA 2L91A 1NTKJ 3S4RA
chains in the Genus database with same CATH topology
3CXHI 1NTZJ 1NU1J 3H1IJ 3H1JJ 1SQXJ 1SQVJ 1BE3J 1SQQJ 3L70J 2IBZI 5KLVJ 1SQPJ 3BCCJ 1L0LJ 4D6TJ 2FYUJ 3H1KJ 1KB9I 3H1LJ 1P84I 3H1HJ 4PD4I 3L71J 2BCCJ 3L73J 1EZVI 3L75J 1BCCJ 1PP9J 3CX5I 1NTKJ 1KYOI 1SQBJ 3CWBJ 1L0NJ 3L72J 4U3FJ 3TGUJ 1NTMJ 3L74J 1BGYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH I;  1NTZ J;  1NU1 J;  3H1I J;  3H1J J;  1SQX J;  1SQV J;  1BE3 J;  1SQQ J;  3L70 J;  2IBZ I;  5KLV J;  1SQP J;  3BCC J;  1L0L J;  4D6T J;  2FYU J;  3H1K J;  1KB9 I;  3H1L J;  1P84 I;  3H1H J;  4PD4 I;  3L71 J;  2BCC J;  3L73 J;  1EZV I;  3L75 J;  1BCC J;  1PP9 J;  3CX5 I;  1NTK J;  1KYO I;  1SQB J;  3CWB J;  1L0N J;  3L72 J;  4U3F J;  3TGU J;  1NTM J;  3L74 J;  1BGY J; 
#chains in the Genus database with same CATH topology
 3OAK A;  3AE4 C;  2JO1 A;  1IFP A;  5GTI E;  1NAY A;  3GW6 A;  1HH0 A;  3KQG A;  1M8O B;  2Y9Z A;  2P67 A;  5L8R J;  3AE2 C;  3KYQ A;  4DT0 A;  3U1C A;  2IBZ G;  2A45 I;  3AEF C;  5BU5 A;  1IFI A;  1SQV J;  3KZI H;  1SQQ J;  5KKZ B;  1OW6 A;  2KSE A;  1QVF O;  3B4S A;  3B5N C;  4L76 A;  5KLV D;  2OYI A;  2KK7 A;  1Q90 D;  1SQX D;  3BAT A;  3PRJ A;  1GU5 A;  3W67 A;  3H1K D;  1CZQ A;  3VOP A;  4ASW A;  4N6J A;  3A7O A;  2WT7 A;  1NO4 A;  3CWB G;  2AEF A;  2R32 A;  1L0L K;  5KLV G;  4I1L A;  2ZYD A;  5KTB A;  3AE3 C;  1VPC A;  1HF9 A;  1USD A;  1LTJ C;  3AED C;  2E42 A;  4UB8 E;  4XFJ A;  1QGK B;  1GL2 B;  3H1J J;  2BCC G;  1PZQ A;  5AW6 B;  3V4Q A;  2AXC A;  3GG2 A;  3CXH H;  5BU8 B;  4TLF A;  3IF4 A;  1JMB A;  4WY4 C;  4D6T E;  2J59 M;  2I1K A;  1L0L J;  3TGU D;  5AVZ B;  3E7K A;  1NJI Q;  1BGY D;  3HE4 B;  3P7K A;  1NTK E;  3D6Y A;  2D2C C;  3GHG A;  1YHQ P;  3BRT B;  3CC2 P;  3IN6 A;  3OW2 O;  1IK7 A;  3HD7 D;  2A06 E;  3TGU G;  1KMI Z;  4TT3 H;  1BGY G;  2HFE D;  2AEJ A;  2NRG A;  3D6Z A;  4N3Y B;  1BE3 D;  2Z5I A;  3WU2 H;  2FYN B;  3M06 A;  3ZDM A;  2HOD A;  4ZKP A;  5KAI H;  1GK4 A;  1IFJ A;  3WUU A;  3CC4 P;  3II6 A;  2WSF J;  3R2P A;  1KQF B;  3C1L A;  1FAV A;  1BE3 G;  1NH4 A;  1T6A A;  1PGO A;  2KOG A;  2ZYG A;  1IFM A;  2K37 A;  2ZJS E;  1N86 A;  3L35 A;  3L70 J;  3L75 D;  3G71 P;  1BDD A;  1KYO H;  3AEE C;  4U3F D;  1NTM D;  1IO4 A;  3CCM P;  3JCU E;  3L72 J;  5H2F H;  3USS A;  2G3A A;  1Q81 Q;  2P7J A;  3FXE A;  3H1H G;  1SS1 A;  3RL0 D;  2WZ7 A;  2P1J A;  2KNC A;  1OVV A;  3ABV C;  4MN4 C;  1Q82 Q;  1XTG B;  2PFX A;  4U3F G;  1NTM G;  1NAF A;  4NPF X;  1L0N E;  5CHX A;  1J1D C;  3D71 A;  1N7S B;  1KN7 A;  3MZW B;  3FX0 A;  2E75 B;  1NU1 J;  4BRY A;  3O6Q B;  2B87 A;  3HTK A;  1LP1 A;  1M90 Q;  2KS1 B;  1OZH A;  4M3L A;  3JSV C;  2OTJ P;  4GOF A;  3VN0 A;  2NPS B;  2BEZ F;  3U1A A;  2ZVN B;  1PP9 D;  1SQP J;  1EZV G;  1T2K C;  2VRS A;  2W27 A;  3EWK A;  3A0B H;  1ZRT E;  1LT9 C;  2FYU K;  2FY8 A;  1AQT A;  2W6A A;  3H1I E;  2KIK A;  3Q5P A;  3I5C A;  3CCQ P;  1K73 Q;  2FFD C;  2XU6 A;  1X22 A;  1NTZ K;  3AEC C;  1PP9 G;  1L0N D;  3NMD A;  2A45 H;  3SWF A;  5E79 H;  3FWL A;  2OYH B;  2HLO A;  2J5U A;  3FXD A;  1PIX A;  3AEB C;  1VL2 A;  5AW1 B;  5GTH E;  1DD3 A;  2WPR A;  1KFN A;  1URQ B;  5KLI C;  3D70 A;  2WSC J;  4OGQ B;  3L73 G;  1NOH A;  1FZA A;  3M0A A;  4WVZ A;  1FZC B;  2RN0 A;  1SQB E;  1ZV8 A;  2AXT H;  1NWQ A;  2YO2 A;  1HVV A;  1TU3 F;  1NTZ J;  3HD7 C;  1BCC G;  4IFF A;  2W8Z A;  3CMA P;  3G6E P;  1SVF A;  1FOS E;  1YTZ T;  1LTG C;  3Q2Y A;  3S9O A;  2NZ2 A;  5CCG A;  4C7N B;  3H1L D;  5KLV K;  3IAO A;  2R5B A;  2WSE J;  1SQX K;  5AW0 B;  3G4S P;  1VQ7 P;  1OVU A;  1DIP A;  4PD4 E;  5CBN A;  5B66 E;  3H6P A;  4PD4 I;  2N1T B;  3F5H A;  4GIF A;  3L70 G;  2W6J H;  5AVX B;  1H0T A;  3MUD C;  1SQP E;  2XV5 A;  1KIL B;  3N7N A;  1LGH B;  2R3S A;  4EI2 A;  1HJ0 A;  1M57 D;  3TDK A;  2Q9I A;  3OJA B;  1L4A A;  3CWB J;  5KLV J;  2QSI A;  3RL0 C;  1SFC A;  1SQX J;  2V7Q J;  1JY2 P;  2H43 A;  1LTA C;  2QIW A;  1P84 E;  3T97 A;  2MJZ A;  1P84 I;  1G1I A;  2OYI B;  1J1E B;  2BCC J;  1RF0 A;  3L74 E;  1QL1 A;  1PFI A;  2QM8 A;  3QH9 A;  1MZ9 A;  4PV1 D;  1LNQ A;  4A7P A;  4H0L B;  2FXP A;  2WT7 B;  1YI2 P;  3L37 A;  3RBZ A;  3SSU A;  4GKG A;  4W80 A;  1X79 B;  4ZKU A;  1S1C X;  4K35 A;  1VF5 B;  1W2E A;  2W90 A;  4H13 B;  5KKZ C;  2QJY B;  3N4X A;  2B9B A;  3JCU H;  2ZXE B;  2QM7 A;  5KJ7 D;  2ZAE B;  1M1J A;  3TGU J;  1BGY J;  1VQL P;  4AYC A;  1H89 A;  2IBZ E;  2NPS D;  3AE8 C;  2IBZ I;  1YJW P;  1GU4 A;  1LTT C;  2IPP A;  3V6I A;  4GT1 A;  2OAR A;  3GHG B;  2PRR A;  1KD1 Q;  5AVV B;  1R8E A;  1ZP0 C;  2FYU G;  1MFT A;  1BE3 J;  2GUV A;  3A0H E;  2JJL A;  1MV8 A;  3HE5 A;  1OMI A;  1VQ4 P;  5APU A;  3G9R A;  1IC2 A;  1G2C A;  3RK2 B;  1YQ3 C;  4IL6 E;  3F89 A;  3PTZ A;  3AE6 C;  4LC1 A;  3EFF K;  2KZI A;  2HOD B;  3CPW O;  1KIL A;  2KXP B;  2OQQ A;  5DJT B;  1FJK A;  2QVA A;  4W7Z A;  4KJM A;  4YXW H;  1KIL E;  2BCC E;  4N78 D;  3KHU A;  3RK3 B;  3CCU P;  1OX3 A;  3H1H J;  5AW2 B;  2JKV A;  4H44 B;  3TYY A;  3PP5 A;  4U3F J;  1HWT C;  1NTM J;  2HPC A;  1IFN A;  5K5G B;  1IK9 A;  3BCC E;  4BWN A;  3KDP B;  4Y99 B;  2I1J A;  2YXQ B;  3QWO C;  5AVW B;  3VP9 A;  4C46 A;  1NGM B;  5CCH A;  5APY A;  2WSS H;  3CX5 E;  1FU1 A;  2FYN C;  3CX5 I;  4XA4 A;  2AEM A;  1JMM A;  1VQK P;  1WMK A;  1JCD A;  1X8Y A;  1JM0 A;  4JF7 A;  2O01 N;  3WUT A;  1FBM A;  1LTS C;  4RO0 A;  2KNC B;  3JC2 2;  1JY3 P;  1T2K D;  2M3E A;  3TNU A;  4JBZ A;  1SQX G;  1L0N K;  3H1K G;  1UII A;  1QLE D;  1S72 P;  2O1K A;  2N9B A;  4UB6 E;  3MHV A;  3LW5 J;  4BRY B;  5AVT B;  2B87 B;  2Q3I A;  4PJ0 E;  2KZJ A;  1VDF A;  3A3Y B;  3HTK B;  1LP1 B;  3AEA C;  1DH3 A;  1PP9 J;  1DX7 A;  1FS0 E;  3RGU A;  3C8V A;  2OTL P;  4PV1 C;  3CCL P;  2R3C A;  1G1J A;  1QL2 A;  2FXO A;  4WB4 A;  1ZOY C;  3L71 E;  4EYY Q;  2M5A B;  2A45 G;  1S2E A;  2K1A A;  2Z4E A;  3L73 J;  1RQU A;  5AVY B;  2E75 C;  1JTH A;  2UWJ E;  1FC2 C;  1GZL A;  3FWN A;  3H1H E;  1GD2 E;  2KI7 B;  2RKL A;  3GF7 A;  5KJ7 C;  2KYV A;  4HKZ H;  3C9I A;  4I7Z B;  3R4Y A;  1BCC J;  3M0D A;  3CCS P;  1VF5 D;  3B71 A;  1SQV E;  1SQQ E;  4H13 D;  2NPS C;  1JO5 A;  2C9N Y;  1KQS O;  4DCK A;  2ZT9 D;  4K3A A;  1GW3 A;  1BSH A;  1N73 A;  3RK3 E;  5CJ4 A;  4D6T D;  5AW3 B;  3L71 D;  2Y0D A;  3A2A A;  1OWA A;  1NTK D;  2FBW C;  3H1L J;  1EZV E;  4I6M C;  1EZV I;  2QJP C;  2R5D A;  3AE9 C;  2QA4 P;  3H1J E;  2POH A;  1VQM P;  2A06 D;  1OW7 A;  4W7Y A;  3V2R A;  5BVZ A;  1S5L E;  3B8E B;  1AFO A;  3L75 G;  2KUB A;  1GDT A;  2C0W A;  1CI6 B;  2ZYA A;  1DEB A;  2IYO A;  5AW9 B;  4Z1M H;  2A06 G;  1H0T B;  3TK1 A;  1L0L E;  2Q6Q A;  1KB9 E;  3Q3D A;  3L73 E;  4JPZ B;  1KB9 I;  1RF1 C;  2YMK A;  3BAS A;  2D2C B;  3IFM A;  3Q5R A;  3AE5 C;  1L4A B;  3WUV A;  2H7H A;  2YO3 A;  1W2B O;  3V4W A;  1ZLL A;  1SFC B;  1NKN A;  1QEX A;  2M5A A;  4IL6 H;  3CI9 A;  3T97 B;  1BCC E;  4BXL A;  2N1T C;  5DJU B;  3PLN A;  1Y9B A;  3KXD A;  1KQG B;  1N7L A;  3MIW A;  5GTI H;  2CPS A;  1Z56 A;  1Q86 Q;  2IX7 C;  2HYN A;  1RQV A;  2Y0C A;  3CL3 D;  5AW4 B;  2LXC B;  1VQ8 P;  4HJG H;  2H88 C;  1KB9 D;  3L70 E;  1GL2 D;  2BAS A;  2ZXX A;  3P8M C;  1S4X A;  1L0N G;  2FYU J;  3B5N A;  3KZI E;  5APT A;  3CD6 P;  1J1E C;  3L72 E;  3M9H A;  3HUS C;  1J2J B;  1N8R Q;  1Y47 A;  1M1J B;  1X0T A;  4H0L C;  2IZ0 A;  1ZRT D;  1H88 A;  3H32 A;  2IDB A;  1FE6 A;  2H89 C;  4UB8 H;  3VP8 A;  2DW3 A;  3H1I D;  1LTJ A;  1VF5 C;  1NU1 E;  4ZMD A;  4H13 C;  2QJY C;  1MFZ A;  3WMM 0;  2IFN A;  3IR9 A;  2Q5U A;  1IFD A;  2MKV A;  1QVG O;  1DD4 A;  5APV A;  1ZR4 A;  1EXI A;  3HE5 B;  2ZT9 C;  1YJ9 P;  5AW8 B;  1CI6 A;  1PPJ E;  4RJT A;  1JY2 N;  1G2C B;  3CXH E;  3CCJ P;  3CXH I;  2JWD A;  2WVR A;  4WY4 A;  2IYP A;  3M9Q A;  3H1L G;  2YIU C;  1LT1 A;  3SWK A;  1FZB A;  3L72 D;  4HB1 A;  2GM4 A;  1SQB D;  3L4F A;  2XKM A;  2FYZ A;  2SPZ A;  2E76 B;  2XNX A;  3GHG C;  1T8Z A;  5CBO A;  3V2P A;  5APQ A;  2WPQ A;  1LWU C;  4OH8 B;  1YQ4 C;  2HPC B;  2QE7 H;  3V2N A;  1IZN B;  4DZO A;  3H1K J;  2YKP A;  1NU1 D;  2XZR A;  2JEE A;  1HTL C;  2I8D A;  3E1R A;  3V5B A;  3TSI A;  1KTM A;  3H25 A;  1ZR2 A;  3PJS K;  1GTW A;  5KLI B;  3WU2 E;  4CPG A;  4PD4 D;  1H8A A;  2KSJ A;  3M9B A;  4IL6 X;  4L75 A;  5KAI E;  4LGD E;  3CC7 P;  2K9J A;  1T3U A;  4JYC A;  1PGQ A;  4HYT B;  3TNU B;  1SQP D;  2YMY A;  1NTZ E;  1N7S D;  1FJP A;  3UIA A;  3AEG C;  1YJN P;  4O9B A;  2E75 D;  3PHL A;  2N9Y B;  1KYO E;  3SFD C;  3W68 A;  3ITK A;  1S5L H;  1S9K E;  1A02 F;  1KYO I;  4KHX A;  3MP7 B;  4OWF A;  1RE3 C;  5B5E E;  3GF3 A;  2E74 B;  4IFD K;  1P84 D;  5H2F E;  3L74 D;  1MUU A;  5CMZ A;  2G8Y A;  5AVU B;  2W6B A;  1ZW0 A;  4LLH A;  1OVR A;  1NTK K;  2FKW B;  3VYI A;  1KB9 H;  1GL2 C;  1U7J A;  3EFG A;  4NPE A;  1GK6 A;  1X9V A;  1JTH B;  3L74 G;  1RF1 A;  5M1B A;  3CWB E;  4R4M A;  2M0B A;  5KLV E;  3OA7 A;  1JUN A;  1SQX E;  2WIT A;  1URQ D;  3RL0 B;  1NKZ B;  3H1K E;  2QJK B;  4OGQ D;  3LID A;  1M1K Q;  2BEQ D;  1SQQ K;  1LT9 A;  2B88 A;  5TJH A;  1WRG A;  1R5S A;  3MGN A;  1PGP A;  1K9M Q;  1N73 B;  3L75 J;  2L5G B;  3A0B E;  2IBZ D;  2WSF H;  1JY3 N;  4C7R A;  2FFD A;  1NYH A;  5KAF E;  5GTH H;  5AVR B;  4EDF A;  1SLQ A;  4I7Z C;  4NPD A;  4YTP C;  3CCE P;  5E79 E;  4JQ0 D;  1EDL A;  1FDM A;  2HG5 D;  1XTC C;  2CK3 H;  5APW A;  5TIS E;  3CWB D;  3E1I A;  1JCC A;  2E43 A;  2HR3 A;  2H8P D;  2KP8 A;  3HUS A;  1RHZ B;  3TGU E;  2YNY A;  2N1T D;  4DOJ A;  3VMY A;  1BGY E;  1FDI A;  4WWI A;  2K88 A;  2AXT E;  1KIL D;  1KQL A;  1QX8 A;  2BCC D;  3HD7 A;  2PP6 A;  2Z5H A;  1LJ2 A;  3A5T A;  5C39 A;  1HBW A;  1VQ5 P;  1K04 A;  3VMX A;  2E76 D;  3O8Z A;  1OXZ A;  2O01 H;  1JOC A;  3BCC D;  1BE3 E;  5CCG C;  4PD4 H;  2RMZ A;  5B66 H;  1W5C E;  3CX5 D;  1ZN5 A;  2LKM A;  5CCH D;  4IOI H;  2JDI H;  1S5L X;  1L2P A;  1EC5 A;  1PV3 A;  3CCR P;  1AQ5 A;  3KPE A;  2W83 C;  1L0N J;  3BCC G;  1N7S C;  1PGJ A;  2PGD A;  3BRV B;  3MUD A;  2K3R A;  4H0L D;  1EDJ A;  2CPB A;  4IFM A;  1K05 A;  2J58 A;  2PAJ A;  4GDO A;  3L75 E;  1L4A C;  4U3F E;  1NTM E;  4U7J A;  1LWU A;  1P84 H;  1SFC C;  1RE4 C;  3G3Z A;  1NVO A;  1HUC A;  3VMA A;  3NXS A;  2WTY A;  2WSC H;  3B5N B;  2Q1K A;  1Q2N A;  1RF0 C;  2RH0 A;  1EQ7 A;  1SQB K;  3CCV P;  1FZG A;  1R5L A;  2E74 D;  3H1I J;  2YKQ A;  1DEE G;  2ITA A;  1M7L A;  3H32 B;  3GLM A;  4JYB A;  2OYH C;  1CSB A;  1VQ6 P;  2KB7 P;  1USE A;  1LTJ B;  4D6T G;  3H1H D;  1URQ C;  1JY2 O;  3I56 P;  3L71 G;  1E5W A;  1NU1 K;  4OGQ C;  4RES B;  1AVO A;  1NTK G;  2E5Y A;  1PP9 E;  1FZC C;  5B5E H;  2WSE H;  4AUW A;  3S1K A;  1SQV D;  1M1J C;  1SQQ D;  3RK2 D;  1SQB J;  1KV4 A;  1RE3 A;  4PV1 B;  4WY4 B;  2Y0E A;  4I2L C;  3P32 A;  2OGU A;  1SQP K;  2P2U A;  3RK3 D;  1RY3 A;  4H44 D;  1VQ9 P;  3M91 A;  2JP3 A;  2Y9Y A;  1SQV G;  1SQQ G;  1YIJ P;  3A0H H;  3FGA D;  1GL2 A;  1FOS F;  3Q5S A;  3EQ2 A;  1BSN A;  1EZV D;  2O01 J;  4WBA A;  1PL5 A;  1NHL A;  2V7Q H;  3H1J D;  3U59 A;  1D7M A;  2ZVO B;  1AJY A;  3CLQ A;  1RH5 B;  1FZF A;  4ASV A;  3I55 P;  1KIL C;  4L74 A;  1AA0 A;  1M56 D;  3HE4 A;  1FZE A;  1Q7Y Q;  2B89 A;  2E76 C;  2K9J B;  4HH2 A;  3H1J G;  2V4H A;  1L0L D;  4RKU J;  1EDK A;  5KAF H;  4XE5 B;  2WPS A;  1LTB C;  3L73 D;  3CX5 H;  4R4L A;  3H1L E;  1KOR A;  5CCH C;  2OYI C;  2QJP B;  3MD0 A;  3L74 J;  1L0L G;  3VTP C;  5TIS H;  3GMA A;  3MTU E;  2P58 A;  1HGV A;  1OIP A;  1S3J A;  2QEX P;  1BCC D;  2ZFC A;  4Y28 J;  2YKO A;  4UB6 H;  1J1D B;  1U7M A;  1VQP P;  3HRN A;  4OVN F;  3V2Q A;  2LR2 A;  2O1J A;  4PJ0 H;  2M3B A;  2OYO A;  2FXM A;  3P8C E;  1GW4 A;  1RF1 B;  4GOE A;  2E5T A;  3VMZ A;  1ZXG A;  3H1I G;  1U57 A;  3L70 D;  3NFQ A;  2E74 C;  2IZ1 A;  1JY3 O;  2YXR B;  2C0X A;  2JR8 A;  1LT9 B;  3B5N D;  5AVS B;  3SFE C;  1HGZ A;  1LTI C;  1WT6 A;  2C9L Y;  1VQO P;  1K8A Q;  4L73 A;  1N7S A;  1SP4 A;  1GMJ A;  4ZNC A;  1T3J A;  3PH0 A;  2QRX A;  2FFD B;  1Y8A A;  4QMA A;  3O6Q A;  1FDO A;  1EXJ A;  3L72 G;  2XDJ A;  1SQB G;  3AE7 C;  5KJ7 A;  1YIT P;  3BVH A;  2KS1 A;  2P10 A;  3RL0 g;  3RK2 C;  3NTN A;  2K9Y A;  3M0D C;  4AQR D;  3LIE A;  4YXD C;  2NPS A;  3P8C D;  3TF5 A;  1RE4 A;  5CCG D;  1YBK A;  2QJK C;  2FYU E;  2LXB A;  3CME P;  3RK3 C;  1PPJ D;  3SWY A;  1OFC X;  5AW5 B;  2QG4 A;  3CXH D;  1OW8 A;  4H44 C;  1NU1 G;  1N73 C;  3HUS B;  1IJD B;  4YPC A;  1ZME C;  1KC8 Q;  1JEK A;  2O3J A;  4WY4 D;  4Y99 C;  5CJ0 A;  3HD7 B;  1E79 H;  3BCC J;  1CW5 A;  3RBX A;  1PPJ G;  2OYH A;  1A02 J;  2D2C D;  1L4A D;  3LW5 H;  1SQP G;  2JWA A;  1URQ A;  5APS A;  2GUS A;  5APX A;  1JNM A;  2KLU A;  1SFC D;  2GA1 A;  2WPV B;  1FZC A;  2ZT9 B;  1KZU B;  5EFW B;  1KFM A;  4N78 E;  1UIX A;  1VQN P;  4B86 A;  1HJB A;  3Q1M A;  2FYU D;  3AE1 C;  1YTZ I;  1MKM A;  2OTK E;  1AVY A;  1EDI A;  4EOT A;  2YIU B;  1YYC A;  1JB0 J;  5AW7 B;  2Q3E A;  2KLV A;  1NTZ D;  3K5B A;  5AVQ B;  3L36 A;  4C7N A;  4DJG A;  1NTM K;  1LWU B;  2IFM A;  2WQY C;  4GOD A;  2R44 A;  2WMM A;  2WWW A;  1SQV K;  2M8R A;  2XND H;  1KYO D;  4D6T J;  1BDC A;  4EIJ A;  1S9K D;  2N1T A;  3L71 J;  4KT0 J;  1AV1 A;  1NTZ G;  1N2D C;  2Q7C A;  2L91 A;  1NTK J;  3S4R A; 
#chains in the Genus database with same CATH homology
 3CXH I;  1NTZ J;  1NU1 J;  3H1I J;  3H1J J;  1SQX J;  1SQV J;  1BE3 J;  1SQQ J;  3L70 J;  2IBZ I;  5KLV J;  1SQP J;  3BCC J;  1L0L J;  4D6T J;  2FYU J;  3H1K J;  1KB9 I;  3H1L J;  1P84 I;  3H1H J;  4PD4 I;  3L71 J;  2BCC J;  3L73 J;  1EZV I;  3L75 J;  1BCC J;  1PP9 J;  3CX5 I;  1NTK J;  1KYO I;  1SQB J;  3CWB J;  1L0N J;  3L72 J;  4U3F J;  3TGU J;  1NTM J;  3L74 J;  1BGY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...