3L72E

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 36
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l72E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l72E02
2YIUC 3GL0A 1VM9A 3EQQA 4QUPA 1WQLA 4PV1D 1SQXE 2HMOA 4H44D 2QJPC 4AAYB 2YVJB 4QDDA 4PD4E 3CX5E 1Q90C 5BOKA 4NBCD 1EG9A 1PP9E 1EZVE 3L75E 4HJLA 1BE3E 1VF5D 5AEUA 1G8JB 2DE5D 4HM0A 4NBGD 1VCKA 4HM4A 1UUWA 2Q3WA 2GBWA 2HMMA 4H0LD 2I7FA 4HM3A 3VCPA 4NB9D 2E4QA 5AEWA 4NBHD 2FYNC 4HKVA 2BMQA 3L73E 4D6TE 1G8KB 1NDOA 5KKZC 2DE6D 3GL2A 2NUMA 4P1CH 3GZXA 2FYUE 3GTEA 4OGQD 5KLVE 3VMGD 4HM7A 4H13D 1O7NA 1SQBE 2ZT9D 4NBBD 4QDCA 2YFLA 4QUQA 2NUKA 2XR8A 2HMJA 4HM6A 1L0NE 3GTSA 1KB9E 1P84E 4P1BH 2BMOA 2JZAA 3EN1A 2B24A 4NBDD 1FQTA 1UUVA 4QDFB 1SQVE 2A06E 3C0DA 1NTZE 3TGUE 4NBFD 4NBED 2YFIA 1BGYE 2IBZE 3L71E 3GB4A 2HMKA 1SQPE 4AIVA 2DE7D 2BCCE 2QJYC 3DQYA 4U3FE 2XSOA 1O7MA 2NVFA 3GCEA 2BMRA 2HMLA 5KLIC 1NTKE 2YFJA 3H1KE 3D89A 3CWBE 1L0LE 4HM2A 3CXHE 1NTME 2NVEA 4NBAD 2GBXA 1JM1A 1BCCE 2B1XA 2E75D 2E76D 3AZCA 4QDFA 2E4PA 1RFSA 3GKEA 1SQQE 3H1LE 3BCCE 3VCAA 3N0QA 1ZRTE 1O7WA 3H1HE 1O7GA 1NU1E 2XSHA 4HM1A 1PPJE 1RIEA 2CKFA 3VMHD 5HL4A 2HMNA 2QPZA 1ULJA 2NWFA 4HM8A 4HM5A 4QURA 2D2CD 3H1JE 2E74D 1SJGA 3VMID 3GOBA 1ULIA 4QCKA 3L72E 2JO6A 5CXMA 2QJKC 2XRXA 3L70E 1NYKA 3GZYA 3L74E 1O7HA 3FOUA 4NB8D 1O7PA 3H1IE 2NVGA 2ZYLA 1KYOE 4EMJB
chains in the Genus database with same CATH superfamily
2Q5UA 2YIUC 1NJIQ 4ASWA 1P84D 2HMOA 2W6AA 1FOSF 1LT9B 1MUUA 2AEMA 3M0DC 2YO3A 2P58A 1QLED 2J59M 1HJ0A 1NH4A 1VCKA 2I1JA 4NBHD 1Q2NA 1KYOD 1L0LJ 3T97B 4C7NB 2QJKB 3FX0A 4P1CH 1KFMA 1CZQA 1NTMG 1AFOA 1IK7A 3L70J 1M1JC 4HM7A 3EQ2A 2M8RA 2NUKA 3EFGA 2KK7A 3CCQP 2N1TD 1SQPE 4AIVA 4GIFA 2DE7D 2WSSH 3H32B 4DZOA 2Y0DA 1LP1A 4ASVA 1VQ4P 4HM2A 1NVOA 2Q6QA 2Q1KA 1KB9D 1P84I 1KILE 1S9KD 3N0QA 4HM1A 5GTHH 2FFDA 1PGPA 3IN6A 3VMID 4DCKA 2DW3A 3EFFK 1VF5C 5CBNA 1AA0A 3L75J 1PP9J 1BGYG 4OGQB 4I2LC 2C0WA 1N73C 2YO2A 1HVVA 2KP8A 3KQGA 4I7ZC 1SQXD 2WITA 1TU3F 4PD4E 5KLVJ 1SQBD 3I5CA 4IL6X 3HD7D 1ZOYC 3V6IA 3FGAD 2WPQA 1JOCA 4N78E 4JQ0D 1FZCC 1LTIC 1M1JA 1Q81Q 2RKLA 2E5YA 3VMGD 1FC2C 3TSIA 3U1CA 1USDA 3L36A 1HBWA 4ZNCA 4O9BA 4MN4C 2B87A 1NU1D 3VMZA 1UUVA 1BGYE 1JO5A 3L70G 3WMM0 1NTZJ 1XTGB 2HMLA 3L37A 1LWUC 3GHGB 1YTZT 4KT0J 4XA4A 3B5NC 3SWFA 2B1XA 2J5UA 1PGQA 4PD4H 3P8CD 4RKUJ 2HFED 3H1LE 4JPZB 1PL5A 1ZRTE 3M9HA 2XSHA 4U7JA 1BCCG 2Y0CA 2E76C 2HMNA 2C9LY 3SWKA 1S2EA 5CMZA 4IFDK 5CCHA 4L74A 2WWWA 4H13C 1SQPJ 1GL2C 1DD3A 3FOUA 3MP7B 2ZYLA 3RBZA 1RF0A 1LTJA 1IFJA 1OXZA 1MV8A 1SQXJ 1ZMEC 5KJ7C 3M0AA 1D7MA 1OFCX 1GL2D 1MFTA 3PTZA 1FZAA 3A0BH 1QL2A 2KUBA 3F89A 2KIKA 3L72G 4UB8E 1JY3P 3CCLP 1VPCA 4NB9D 3VCPA 2JWDA 3FWNA 1AVYA 3VP8A 4U3FJ 1T2KD 3GTEA 3L35A 1RH5B 2KZIA 4EDFA 1FZCA 3AE4C 1X79B 4QUQA 2P2UA 2K9YA 2OARA 1RE3C 2JP3A 2CPSA 4NPDA 1FBMA 1R5SA 1KQGB 5CHXA 3SWYA 2P67A 3H1JJ 2AEJA 1GK4A 1L0NK 2ZVNB 4CPGA 1VQ7P 4IFFA 2R5DA 3H1KJ 3M06A 4RO0A 3QH9A 3TGUD 3HD7A 2OQQA 4UB8H 3D70A 5APTA 3P8MC 4XFJA 5KLVK 4IL6H 1LT9C 4L73A 2Z4EA 1SFCC 2NWFA 4YTPC 1L0NJ 4QURA 2YMKA 4WY4D 3AE6C 2XRXA 1KORA 3CX5I 1BGYD 3L72D 3OAKA 3O6QB 3JCUE 4HJGH 1EZVD 1SQQD 1YTZI 2HG5D 3ZDMA 4HJLA 3VTPC 3G4SP 1VF5D 3VMYA 2DE5D 1L0LK 2KYVA 5AW8B 1ZR2A 3CCEP 1ZR4A 4RJTA 2BMQA 3E7KA 1NDOA 4WB4A 1RE4A 2WZ7A 3BCCD 2KOGA 1LGHB 2V7QJ 3CLQA 1SQBE 3V2RA 2Q7CA 3AEEC 3RK2C 3RK3E 4QMAA 2A06E 3C0DA 3BATA 1W5CE 2N9BA 3GCEA 1KFNA 3LW5J 3R4YA 2BMRA 2NPSB 3CMAP 2E75C 2WMMA 4TLFA 2GBXA 4PV1B 1JNMA 2QG4A 2WPSA 2HPCA 3N7NA 4WY4A 2BASA 3RL0g 2WSEH 3KZIE 1BE3J 1KILB 1FZBA 5KLVD 1RF1A 1JY2N 2KLVA 1VQ6P 5K5GB 1RIEA 3RK2B 3V2NA 3VMHD 5KLIB 2E5TA 1EZVG 3V4WA 1JB0J 2FYUK 2ZYAA 1RF1C 3D6YA 1DX7A 1ZP0C 5BU8B 4D6TD 2B88A 1S5LE 2CK3H 4R4LA 3H25A 3W67A 4ZKUA 1SQXE 1KN7A 4WWIA 4NBCD 1GW3A 3H1LG 1U57A 1YJWP 5H2FH 1KC8Q 5L8RJ 1NAYA 2NPSA 2Q3WA 2D2CC 5AEWA 2VRSA 3AEBC 1NTKJ 5KKZB 3I56P 5APWA 3LW5H 1XTCC 1G1JA 2IBZD 1BE3D 3MHVA 5KLVE 1SQVG 2YFLA 4EI2A 1LTTC 4LC1A 1L0ND 1UIIA 2P1JA 1NKNA 1P84E 2KNCB 1OVRA 1NTZE 2L5GB 4JBZA 1BGYJ 3FXDA 1SQPD 2XSOA 1O7MA 1VQKP 3AEDC 2B87B 1RF1B 2YFJA 3TYYA 4W7ZA 2QM8A 2KSJA 4Y99B 4JYBA 2E76D 2E76B 2GUVA 1NTZD 5AW4B 3H1HE 1LTJB 3MZWB 2HYNA 4LGDE 2IBZG 4QCKA 2Z5HA 1FDIA 4U3FG 1WT6A 5AW0B 1YI2P 1KQFB 1GD2E 4BRYA 3BVHA 2NVGA 1P84H 1URQA 3IAOA 3L72J 4OWFA 1H89A 1T6AA 2W6BA 1EDIA 2QJPC 5DJTB 3ITKA 1PZQA 4W80A 3HRNA 1SQQG 1PP9E 3G3ZA 4JYCA 3HE4A 4NBGD 4IFMA 2ZJSE 1VQ5P 1KMIZ 2JWAA 3HE5B 3KPEA 2QEXP 3KHUA 1YITP 1EDKA 4A7PA 4GOFA 4I1LA 1HUCA 1RY3A 1USEA 1L4AC 1SP4A 1NWQA 2YKOA 3SSUA 5AVRB 4EOTA 3AE1C 1M57D 2KSEA 4HM6A 1YYCA 2WT7A 1W2EA 4KJMA 1H8AA 1L4AD 1NTKG 1A02J 1K8AQ 1T8ZA 3AE3C 3L71E 3EWKA 1DIPA 4TT3H 2WSCH 2OYIA 3CXHH 1BSHA 3RK3D 1N8RQ 2P10A 1HTLC 1SFCB 5GTHE 1ZRTD 3OJAB 3BCCE 2QJPB 5CCHC 3SFDC 4KHXA 3USSA 1JY3O 1Y47A 2OYHA 2MJZA 1SVFA 2SPZA 1LTSC 3Q5RA 2Y9YA 5AW2B 2ZVOB 2XDJA 4WVZA 2O01N 1QEXA 1FS0E 3NXSA 1SQVD 1K05A 4QUPA 1LJ2A 1VQOP 3A7OA 3JCUH 3H1HG 4K35A 1FDOA 2P7JA 5BOKA 1N7SB 2HODA 1GL2B 4XE5B 3CCRP 4I7ZB 2Y9ZA 2OTLP 5GTIE 1PIXA 3S4RA 2FYUG 2K37A 4RESB 4N78D 5AVQB 2O1JA 3CCMP 1L4AA 1IO4A 4YPCA 1LP1B 3CCVP 2NRGA 1RE3A 1M1KQ 3AE7C 1RQUA 5B66E 1JCDA 3BCCJ 4NBFD 5CJ0A 2YKQA 1IFNA 4H13B 3NTNA 3WUTA 1DH3A 2IBZI 1BCCE 1YIJP 1RFSA 2QA4P 3L71J 2QIWA 2XNDH 3L71G 1FDMA 1LT9A 3ABVC 2FFDC 3CPWO 2ZYGA 3HD7C 1M7LA 2WPVB 1A02F 1O7HA 2OTKE 3V5BA 3II6A 2W8ZA 3T97A 2A45H 4QDDA 2OYHB 1NU1G 2OYOA 4Y28J 2MKVA 1G2CB 2ZXEB 5AVVB 2WSFH 3S1KA 1OIPA 1N7LA 1IC2A 3RL0B 2HMMA 3GHGA 1X8YA 2PAJA 1LTAC 1BE3G 2L91A 3KDPB 1OVVA 2WT7B 2K9JA 3LIEA 3GZXA 3H1LJ 2QJYB 2FXMA 3VOPA 2XR8A 2RN0A 1KB9E 1IJDB 2BCCG 1NHLA 4PV1C 1OVUA 2C9NY 3H1HJ 2K9JB 1L0NG 2IYPA 5APSA 1FE6A 5AW6B 1EXIA 1Q7YQ 2W90A 2FFDB 5AVTB 1GTWA 1KQLA 3CWBE 1OWAA 3TK1A 2H43A 2GA1A 1PPJG 2I1KA 1SQQJ 1WRGA 2FYUJ 3U1AA 1NU1E 2WTYA 2IDBA 4HM8A 3VMAA 2QJKC 3WU2H 1T3JA 4NB8D 4WY4C 3PLNA 4NPFX 1NGMB 2AXTE 2WPRA 1VM9A 4C7RA 1AVOA 1CW5A 2YVJB 3L75D 1U7MA 1NU1J 5TISH 3L75E 1QL1A 2GM4A 2OGUA 5AEUA 5BU5A 1Q90D 1FU1A 1JUNA 3L73G 1QVGO 4H0LD 4ZKPA 1J2JB 4B86A 1PP9G 3CWBJ 2WQYC 3L73E 4LLHA 5AW3B 4D6TE 5E79E 1PGOA 5E79H 1EC5A 4BRYB 1GW4A 1FZEA 3H1IG 2JJLA 5KJ7D 2HMJA 1KB9I 3G71P 3G9RA 2FXOA 1SQPK 1L4AB 3EN1A 4GODA 2K3RA 4NBED 3SFEC 3B5NB 5APUA 3H6PA 2D2CB 1GZLA 3CC4P 3KZIH 2QM7A 2W6JH 1IFPA 1OX3A 2B9BA 2LXBA 2NPSC 2CPBA 2IZ0A 1O7WA 1QX8A 5HL4A 2QRXA 2QPZA 2Q3EA 4HM5A 2KS1B 1SFCA 3CWBD 2PGDA 4PJ0E 1Y8AA 1SQBJ 3HUSA 1NYKA 3H1IE 3GMAA 3H1JG 2GUSA 1DD4A 3A3YB 1EDJA 3EQQA 1MFZA 5CCHD 4H0LC 3TNUA 2XZRA 5C39A 1Q90C 1AV1A 2QE7H 1RE4C 3MIWA 1G8JB 1RQVA 2ITAA 1FZGA 5TJHA 2I7FA 3PP5A 5GTIH 2DE6D 3LIDA 4C46A 2NUMA 4R4MA 1J1DC 3D71A 2PFXA 1U7JA 2M3EA 2ZT9D 1G2CA 1IZNB 1AJYA 4QDCA 1S3JA 1K9MQ 1L0NE 2BMOA 1H0TB 3WUUA 3GB4A 3C9IA 1YHQP 3DQYA 2NVFA 3OW2O 2AEFA 3D89A 2M5AB 1NTME 1KTMA 3PH0A 5AVYB 2E75D 1MKMA 2W83C 2HLOA 2I8DA 1BDDA 1PPJD 2G8YA 3A0HE 3C1LA 1IFIA 5AW1B 1O7GA 4EYYQ 2KXPB 4Y99C 1VF5B 2FYZA 2CKFA 1M56D 1X9VA 1BCCD 2Q9IA 1ULJA 2K1AA 2HPCB 3CXHD 2E74B 1SQXK 2JDIH 5APVA 2JO6A 3B8EB 1HGZA 1SQQK 3NFQA 3FWLA 3E1RA 4EMJB 3BRVB 1Q82Q 3HE5A 3M9QA 1X0TA 1Z56A 2KNCA 2V7QH 1M1JB 3AEFC 1VL2A 4HM0A 1JTHB 1X22A 1Y9BA 3Q5PA 3O6QA 3G6EP 4HM3A 1J1DB 1ZXGA 2ZFCA 3H1KG 2C0XA 3M91A 3CI9A 1N7SC 1S5LX 2A06G 4AUWA 2WSEJ 3GF3A 2O1KA 2IFNA 1SQPG 2M0BA 1SFCD 1SQVE 3P8CE 3TGUE 2H88C 2HMKA 4I6MC 2BCCD 3VMXA 4D6TJ 4K3AA 2ZT9C 3IF4A 3KYQA 2Q3IA 2E4PA 2XKMA 1KYOI 3CD6P 1SQQE 3M9BA 1EZVI 3CC7P 4IL6E 4L76A 3Q1MA 1SQBK 5KAFH 1QGKB 2E74D 1N2DC 1IFDA 3L72E 3F5HA 4YXDC 1ZN5A 1T2KC 5DJUB 3L71D 5APYA 3AE5C 2IYOA 2PP6A 5AVUB 5KKZC 1NKZB 3CX5D 3GL0A 2QSIA 1VQPP 5CCGD 1EXJA 4WY4B 1CI6A 2YIUB 1CSBA 1OW6A 4L75A 1SLQA 5CBOA 4HM4A 4GOEA 2UWJE 1WMKA 2J58A 4N3YB 1NU1K 2NPSD 1E79H 1PP9D 2R3SA 4H13D 1VQ9P 4NBBD 2LXCB 5B66H 2H89C 3RK2D 2YKPA 1SQBG 2AXCA 3VYIA 2BCCJ 2E42A 2NZ2A 1GU5A 1NTZK 3TGUJ 3MUDC 1SQVJ 2JO1A 4DT0A 3CL3D 1LTGC 3PJSK 3RK3C 2R5BA 1LTJC 3H1HD 1YQ4C 3MGNA 1GL2A 1VQMP 2KZJA 1AQ5A 1GMJA 2V4HA 3B4SA 4HH2A 2O01J 4BWNA 4DJGA 5KAIE 4UB6E 3VP9A 2OYHC 1LT1A 2H8PD 1SS1A 4M3LA 2R32A 1MZ9A 3L70E 5CCGA 3L74E 3HE4B 3V2QA 2JR8A 1PGJA 1FZCB 1LNQA 2A45I 3Q2YA 3I55P 4H44B 4H44D 3B71A 2YXQB 3K5BA 5B5EH 1E5WA 5B5EE 4IOIH 2O01H 1UIXA 3L74D 3A0HH 3P7KA 1UUWA 2WVRA 1DEBA 2KI7B 2E4QA 2O3JA 5AW5B 2FYNC 3M0DA 1N73B 3KXDA 1YBKA 1O7NA 1EQ7A 2M5AA 1HH0A 2YMYA 3U59A 3N4XA 1NTMJ 1KB9H 2FYNB 4AQRD 3V2PA 3GW6A 2LKMA 3H1IJ 3CCJP 5TISE 2HODB 3HD7B 5AVSB 2BEZF 3V4QA 5APQA 1W2BO 3L73D 2E43A 3BCCG 3GLMA 3H1KE 3CCUP 1OW7A 1S4XA 4NBAD 1JY2P 3GF7A 3A2AA 1RHZB 2N1TC 1VQLP 2G3AA 2ZYDA 3MUDA 2OTJP 1SJGA 3TGUG 1CI6B 2XNXA 3CMEP 1JEKA 2HR3A 4DOJA 3CC2P 1KYOE 5CCGC 4W7YA 2OYIB 5KLVG 1ZW0A 2PRRA 3CX5E 1S9KE 2JEEA 4GT1A 3HUSB 3Q3DA 1EZVE 3L74J 1HF9A 4OGQC 3B5ND 3L73J 1HJBA 3L70D 3OA7A 1NTMK 2GBWA 1LWUB 3GHGC 1NYHA 1URQB 1GDTA 1J1EC 3CWBG 1ZLLA 1G8KB 2YNYA 2POHA 4OGQD 1JTHA 1PFIA 2R44A 1GU4A 2ZT9B 3A5TA 3H1JD 2IPPA 3RK3B 3R2PA 1EDLA 1NTKK 1IFMA 1JCCA 4P1BH 3W68A 1KV4A 2B24A 1NTKD 2YFIA 2IBZE 1KYOH 1KILC 3MTUE 4GKGA 3UIAA 2BCCE 2QJYC 4U3FE 4OH8B 2KB7P 2QVAA 5KLIC 3CXHE 2NVEA 4EIJA 1N86A 3TNUB 1JY3N 2RMZA 4HKZH 4PD4I 3CX5H 1N7SD 5AVXB 4NPEA 3RBXA 3VCAA 3QWOC 4HYTB 2XU6A 1PPJE 5KAFE 2A45G 1URQD 1M90Q 3GOBA 2N1TB 4AYCA 5CXMA 3TF5A 1BSNA 3AE8C 3VN0A 5KTBA 1SQXG 5APXA 1QVFO 3WU2E 1H88A 1JY2O 2B89A 1BDCA 1PV3A 3C8VA 5M1BA 4AAYB 2IZ1A 1T3UA 2IX7C 3AEGC 1FJKA 4YXWH 5AVZB 1L0LD 1VQ8P 1HWTC 4HKVA 3P32A 4UB6H 4OVNF 1R5LA 2E75B 3GL2A 3RL0C 4HB1A 2FYUE 2ZXXA 2XV5A 1G1IA 3AEAC 3RGUA 1FOSE 1YJ9P 4PJ0H 4H44C 2K88A 2JZAA 1FQTA 3H1LD 4QDFB 1VDFA 1OMIA 2FKWB 4C7NA 3WUVA 3AE2C 3IR9A 3E1IA 2Z5IA 1NTKE 5EFWB 1L2PA 1NOHA 1Q86Q 2FBWC 1JM1A 2N9YB 4JF7A 1N73A 2LR2A 2KS1A 3B5NA 1SQVK 1DEEG 1KQSO 2OYIC 1LWUA 3L75G 1VQNP 5KAIH 1ULIA 1NTZG 3CXHI 1OW8A 1KILA 2WSFJ 1HGVA 1FZFA 1RF0C 2M3BA 2W27A 2YXRB 1L0LG 3RL0D 1JM0A 1LTBC 3BRTB 1YQ3C 1KD1Q 5AW9B 1NO4A 1WQLA 4PV1D 1J1EB 3S9OA 3L74G 4N6JA 2RH0A 4BXLA 4Z1MH 3BASA 3O8ZA 1NAFA 1EG9A 1IK9A 3H1ID 3Q5SA 1BE3E 4GDOA 3A0BE 4ZMDA 2ZAEB 1YJNP 4WBAA 5H2FE 1AQTA 1FJPA 1JMMA 2FY8A 3HTKA 2H7HA 3H32A 1N7SA 3AECC 3JSVC 5AW7B 2KLUA 5CJ4A 2AXTH 2BEQD 1BCCJ 2Y0EA 1ZV8A 3GTSA 3GG2A 1URQC 1OZHA 3TDKA 3PRJA 4H0LB 2JKVA 4NBDD 3H1KD 2FYUD 3HTKB 3HUSC 3AE9C 5KJ7A 1NTMD 4D6TG 1S5LH 1S1CX 1L0LE 3MD0A 1H0TA 5BVZA 1M8OB 3D6ZA 1KZUB 2E74C 2N1TA 1K73Q 4U3FD 3FXEA 3JC22 3L4FA 3IFMA 3AZCA 3PHLA 4QDFA 2IFMA 1S72P 3GKEA 1KILD 4PD4D 5AVWB 2FXPA 1FAVA 1K04A 2WSCJ 2D2CD 3H1JE 1JMBA 1R8EA 1GK6A 3GZYA 3CCSP 1O7PA 2R3CA 3NMDA 2A06D
chains in the Genus database with same CATH topology
2YIUC 3GL0A 1VM9A 3EQQA 4QUPA 1WQLA 4PV1D 1SQXE 2HMOA 4H44D 2QJPC 4AAYB 2YVJB 4QDDA 4PD4E 3CX5E 1Q90C 5BOKA 4NBCD 1EG9A 1PP9E 1EZVE 3L75E 4HJLA 1BE3E 1VF5D 5AEUA 1G8JB 2DE5D 4HM0A 4NBGD 1VCKA 4HM4A 1UUWA 2Q3WA 2GBWA 2HMMA 4H0LD 2I7FA 4HM3A 3VCPA 4NB9D 2E4QA 5AEWA 4NBHD 2FYNC 4HKVA 2BMQA 3L73E 4D6TE 1G8KB 1NDOA 5KKZC 2DE6D 3GL2A 2NUMA 4P1CH 3GZXA 2FYUE 3GTEA 4OGQD 5KLVE 3VMGD 4HM7A 4H13D 1O7NA 1SQBE 2ZT9D 4NBBD 4QDCA 2YFLA 4QUQA 2NUKA 2XR8A 2HMJA 4HM6A 1L0NE 3GTSA 1KB9E 1P84E 4P1BH 2BMOA 2JZAA 3EN1A 2B24A 4NBDD 1FQTA 1UUVA 4QDFB 1SQVE 2A06E 3C0DA 1NTZE 3TGUE 4NBFD 4NBED 2YFIA 1BGYE 2IBZE 3L71E 3GB4A 2HMKA 1SQPE 4AIVA 2DE7D 2BCCE 2QJYC 3DQYA 4U3FE 2XSOA 1O7MA 2NVFA 3GCEA 2BMRA 2HMLA 5KLIC 1NTKE 2YFJA 3H1KE 3D89A 3CWBE 1L0LE 4HM2A 3CXHE 1NTME 2NVEA 4NBAD 2GBXA 1JM1A 1BCCE 2B1XA 2E75D 2E76D 3AZCA 4QDFA 2E4PA 1RFSA 3GKEA 1SQQE 3H1LE 3BCCE 3VCAA 3N0QA 1ZRTE 1O7WA 3H1HE 1O7GA 1NU1E 2XSHA 4HM1A 1PPJE 1RIEA 2CKFA 3VMHD 5HL4A 2HMNA 2QPZA 1ULJA 2NWFA 4HM8A 4HM5A 4QURA 2D2CD 3H1JE 2E74D 1SJGA 3VMID 3GOBA 1ULIA 4QCKA 3L72E 2JO6A 5CXMA 2QJKC 2XRXA 3L70E 1NYKA 3GZYA 3L74E 1O7HA 3FOUA 4NB8D 1O7PA 3H1IE 2NVGA 2ZYLA 1KYOE 4EMJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIU C;  3GL0 A;  1VM9 A;  3EQQ A;  4QUP A;  1WQL A;  4PV1 D;  1SQX E;  2HMO A;  4H44 D;  2QJP C;  4AAY B;  2YVJ B;  4QDD A;  4PD4 E;  3CX5 E;  1Q90 C;  5BOK A;  4NBC D;  1EG9 A;  1PP9 E;  1EZV E;  3L75 E;  4HJL A;  1BE3 E;  1VF5 D;  5AEU A;  1G8J B;  2DE5 D;  4HM0 A;  4NBG D;  1VCK A;  4HM4 A;  1UUW A;  2Q3W A;  2GBW A;  2HMM A;  4H0L D;  2I7F A;  4HM3 A;  3VCP A;  4NB9 D;  2E4Q A;  5AEW A;  4NBH D;  2FYN C;  4HKV A;  2BMQ A;  3L73 E;  4D6T E;  1G8K B;  1NDO A;  5KKZ C;  2DE6 D;  3GL2 A;  2NUM A;  4P1C H;  3GZX A;  2FYU E;  3GTE A;  4OGQ D;  5KLV E;  3VMG D;  4HM7 A;  4H13 D;  1O7N A;  1SQB E;  2ZT9 D;  4NBB D;  4QDC A;  2YFL A;  4QUQ A;  2NUK A;  2XR8 A;  2HMJ A;  4HM6 A;  1L0N E;  3GTS A;  1KB9 E;  1P84 E;  4P1B H;  2BMO A;  2JZA A;  3EN1 A;  2B24 A;  4NBD D;  1FQT A;  1UUV A;  4QDF B;  1SQV E;  2A06 E;  3C0D A;  1NTZ E;  3TGU E;  4NBF D;  4NBE D;  2YFI A;  1BGY E;  2IBZ E;  3L71 E;  3GB4 A;  2HMK A;  1SQP E;  4AIV A;  2DE7 D;  2BCC E;  2QJY C;  3DQY A;  4U3F E;  2XSO A;  1O7M A;  2NVF A;  3GCE A;  2BMR A;  2HML A;  5KLI C;  1NTK E;  2YFJ A;  3H1K E;  3D89 A;  3CWB E;  1L0L E;  4HM2 A;  3CXH E;  1NTM E;  2NVE A;  4NBA D;  2GBX A;  1JM1 A;  1BCC E;  2B1X A;  2E75 D;  2E76 D;  3AZC A;  4QDF A;  2E4P A;  1RFS A;  3GKE A;  1SQQ E;  3H1L E;  3BCC E;  3VCA A;  3N0Q A;  1ZRT E;  1O7W A;  3H1H E;  1O7G A;  1NU1 E;  2XSH A;  4HM1 A;  1PPJ E;  1RIE A;  2CKF A;  3VMH D;  5HL4 A;  2HMN A;  2QPZ A;  1ULJ A;  2NWF A;  4HM8 A;  4HM5 A;  4QUR A;  2D2C D;  3H1J E;  2E74 D;  1SJG A;  3VMI D;  3GOB A;  1ULI A;  4QCK A;  3L72 E;  2JO6 A;  5CXM A;  2QJK C;  2XRX A;  3L70 E;  1NYK A;  3GZY A;  3L74 E;  1O7H A;  3FOU A;  4NB8 D;  1O7P A;  3H1I E;  2NVG A;  2ZYL A;  1KYO E;  4EMJ B; 
#chains in the Genus database with same CATH topology
 2Q5U A;  2YIU C;  1NJI Q;  4ASW A;  1P84 D;  2HMO A;  2W6A A;  1FOS F;  1LT9 B;  1MUU A;  2AEM A;  3M0D C;  2YO3 A;  2P58 A;  1QLE D;  2J59 M;  1HJ0 A;  1NH4 A;  1VCK A;  2I1J A;  4NBH D;  1Q2N A;  1KYO D;  1L0L J;  3T97 B;  4C7N B;  2QJK B;  3FX0 A;  4P1C H;  1KFM A;  1CZQ A;  1NTM G;  1AFO A;  1IK7 A;  3L70 J;  1M1J C;  4HM7 A;  3EQ2 A;  2M8R A;  2NUK A;  3EFG A;  2KK7 A;  3CCQ P;  2N1T D;  1SQP E;  4AIV A;  4GIF A;  2DE7 D;  2WSS H;  3H32 B;  4DZO A;  2Y0D A;  1LP1 A;  4ASV A;  1VQ4 P;  4HM2 A;  1NVO A;  2Q6Q A;  2Q1K A;  1KB9 D;  1P84 I;  1KIL E;  1S9K D;  3N0Q A;  4HM1 A;  5GTH H;  2FFD A;  1PGP A;  3IN6 A;  3VMI D;  4DCK A;  2DW3 A;  3EFF K;  1VF5 C;  5CBN A;  1AA0 A;  3L75 J;  1PP9 J;  1BGY G;  4OGQ B;  4I2L C;  2C0W A;  1N73 C;  2YO2 A;  1HVV A;  2KP8 A;  3KQG A;  4I7Z C;  1SQX D;  2WIT A;  1TU3 F;  4PD4 E;  5KLV J;  1SQB D;  3I5C A;  4IL6 X;  3HD7 D;  1ZOY C;  3V6I A;  3FGA D;  2WPQ A;  1JOC A;  4N78 E;  4JQ0 D;  1FZC C;  1LTI C;  1M1J A;  1Q81 Q;  2RKL A;  2E5Y A;  3VMG D;  1FC2 C;  3TSI A;  3U1C A;  1USD A;  3L36 A;  1HBW A;  4ZNC A;  4O9B A;  4MN4 C;  2B87 A;  1NU1 D;  3VMZ A;  1UUV A;  1BGY E;  1JO5 A;  3L70 G;  3WMM 0;  1NTZ J;  1XTG B;  2HML A;  3L37 A;  1LWU C;  3GHG B;  1YTZ T;  4KT0 J;  4XA4 A;  3B5N C;  3SWF A;  2B1X A;  2J5U A;  1PGQ A;  4PD4 H;  3P8C D;  4RKU J;  2HFE D;  3H1L E;  4JPZ B;  1PL5 A;  1ZRT E;  3M9H A;  2XSH A;  4U7J A;  1BCC G;  2Y0C A;  2E76 C;  2HMN A;  2C9L Y;  3SWK A;  1S2E A;  5CMZ A;  4IFD K;  5CCH A;  4L74 A;  2WWW A;  4H13 C;  1SQP J;  1GL2 C;  1DD3 A;  3FOU A;  3MP7 B;  2ZYL A;  3RBZ A;  1RF0 A;  1LTJ A;  1IFJ A;  1OXZ A;  1MV8 A;  1SQX J;  1ZME C;  5KJ7 C;  3M0A A;  1D7M A;  1OFC X;  1GL2 D;  1MFT A;  3PTZ A;  1FZA A;  3A0B H;  1QL2 A;  2KUB A;  3F89 A;  2KIK A;  3L72 G;  4UB8 E;  1JY3 P;  3CCL P;  1VPC A;  4NB9 D;  3VCP A;  2JWD A;  3FWN A;  1AVY A;  3VP8 A;  4U3F J;  1T2K D;  3GTE A;  3L35 A;  1RH5 B;  2KZI A;  4EDF A;  1FZC A;  3AE4 C;  1X79 B;  4QUQ A;  2P2U A;  2K9Y A;  2OAR A;  1RE3 C;  2JP3 A;  2CPS A;  4NPD A;  1FBM A;  1R5S A;  1KQG B;  5CHX A;  3SWY A;  2P67 A;  3H1J J;  2AEJ A;  1GK4 A;  1L0N K;  2ZVN B;  4CPG A;  1VQ7 P;  4IFF A;  2R5D A;  3H1K J;  3M06 A;  4RO0 A;  3QH9 A;  3TGU D;  3HD7 A;  2OQQ A;  4UB8 H;  3D70 A;  5APT A;  3P8M C;  4XFJ A;  5KLV K;  4IL6 H;  1LT9 C;  4L73 A;  2Z4E A;  1SFC C;  2NWF A;  4YTP C;  1L0N J;  4QUR A;  2YMK A;  4WY4 D;  3AE6 C;  2XRX A;  1KOR A;  3CX5 I;  1BGY D;  3L72 D;  3OAK A;  3O6Q B;  3JCU E;  4HJG H;  1EZV D;  1SQQ D;  1YTZ I;  2HG5 D;  3ZDM A;  4HJL A;  3VTP C;  3G4S P;  1VF5 D;  3VMY A;  2DE5 D;  1L0L K;  2KYV A;  5AW8 B;  1ZR2 A;  3CCE P;  1ZR4 A;  4RJT A;  2BMQ A;  3E7K A;  1NDO A;  4WB4 A;  1RE4 A;  2WZ7 A;  3BCC D;  2KOG A;  1LGH B;  2V7Q J;  3CLQ A;  1SQB E;  3V2R A;  2Q7C A;  3AEE C;  3RK2 C;  3RK3 E;  4QMA A;  2A06 E;  3C0D A;  3BAT A;  1W5C E;  2N9B A;  3GCE A;  1KFN A;  3LW5 J;  3R4Y A;  2BMR A;  2NPS B;  3CMA P;  2E75 C;  2WMM A;  4TLF A;  2GBX A;  4PV1 B;  1JNM A;  2QG4 A;  2WPS A;  2HPC A;  3N7N A;  4WY4 A;  2BAS A;  3RL0 g;  2WSE H;  3KZI E;  1BE3 J;  1KIL B;  1FZB A;  5KLV D;  1RF1 A;  1JY2 N;  2KLV A;  1VQ6 P;  5K5G B;  1RIE A;  3RK2 B;  3V2N A;  3VMH D;  5KLI B;  2E5T A;  1EZV G;  3V4W A;  1JB0 J;  2FYU K;  2ZYA A;  1RF1 C;  3D6Y A;  1DX7 A;  1ZP0 C;  5BU8 B;  4D6T D;  2B88 A;  1S5L E;  2CK3 H;  4R4L A;  3H25 A;  3W67 A;  4ZKU A;  1SQX E;  1KN7 A;  4WWI A;  4NBC D;  1GW3 A;  3H1L G;  1U57 A;  1YJW P;  5H2F H;  1KC8 Q;  5L8R J;  1NAY A;  2NPS A;  2Q3W A;  2D2C C;  5AEW A;  2VRS A;  3AEB C;  1NTK J;  5KKZ B;  3I56 P;  5APW A;  3LW5 H;  1XTC C;  1G1J A;  2IBZ D;  1BE3 D;  3MHV A;  5KLV E;  1SQV G;  2YFL A;  4EI2 A;  1LTT C;  4LC1 A;  1L0N D;  1UII A;  2P1J A;  1NKN A;  1P84 E;  2KNC B;  1OVR A;  1NTZ E;  2L5G B;  4JBZ A;  1BGY J;  3FXD A;  1SQP D;  2XSO A;  1O7M A;  1VQK P;  3AED C;  2B87 B;  1RF1 B;  2YFJ A;  3TYY A;  4W7Z A;  2QM8 A;  2KSJ A;  4Y99 B;  4JYB A;  2E76 D;  2E76 B;  2GUV A;  1NTZ D;  5AW4 B;  3H1H E;  1LTJ B;  3MZW B;  2HYN A;  4LGD E;  2IBZ G;  4QCK A;  2Z5H A;  1FDI A;  4U3F G;  1WT6 A;  5AW0 B;  1YI2 P;  1KQF B;  1GD2 E;  4BRY A;  3BVH A;  2NVG A;  1P84 H;  1URQ A;  3IAO A;  3L72 J;  4OWF A;  1H89 A;  1T6A A;  2W6B A;  1EDI A;  2QJP C;  5DJT B;  3ITK A;  1PZQ A;  4W80 A;  3HRN A;  1SQQ G;  1PP9 E;  3G3Z A;  4JYC A;  3HE4 A;  4NBG D;  4IFM A;  2ZJS E;  1VQ5 P;  1KMI Z;  2JWA A;  3HE5 B;  3KPE A;  2QEX P;  3KHU A;  1YIT P;  1EDK A;  4A7P A;  4GOF A;  4I1L A;  1HUC A;  1RY3 A;  1USE A;  1L4A C;  1SP4 A;  1NWQ A;  2YKO A;  3SSU A;  5AVR B;  4EOT A;  3AE1 C;  1M57 D;  2KSE A;  4HM6 A;  1YYC A;  2WT7 A;  1W2E A;  4KJM A;  1H8A A;  1L4A D;  1NTK G;  1A02 J;  1K8A Q;  1T8Z A;  3AE3 C;  3L71 E;  3EWK A;  1DIP A;  4TT3 H;  2WSC H;  2OYI A;  3CXH H;  1BSH A;  3RK3 D;  1N8R Q;  2P10 A;  1HTL C;  1SFC B;  5GTH E;  1ZRT D;  3OJA B;  3BCC E;  2QJP B;  5CCH C;  3SFD C;  4KHX A;  3USS A;  1JY3 O;  1Y47 A;  2OYH A;  2MJZ A;  1SVF A;  2SPZ A;  1LTS C;  3Q5R A;  2Y9Y A;  5AW2 B;  2ZVO B;  2XDJ A;  4WVZ A;  2O01 N;  1QEX A;  1FS0 E;  3NXS A;  1SQV D;  1K05 A;  4QUP A;  1LJ2 A;  1VQO P;  3A7O A;  3JCU H;  3H1H G;  4K35 A;  1FDO A;  2P7J A;  5BOK A;  1N7S B;  2HOD A;  1GL2 B;  4XE5 B;  3CCR P;  4I7Z B;  2Y9Z A;  2OTL P;  5GTI E;  1PIX A;  3S4R A;  2FYU G;  2K37 A;  4RES B;  4N78 D;  5AVQ B;  2O1J A;  3CCM P;  1L4A A;  1IO4 A;  4YPC A;  1LP1 B;  3CCV P;  2NRG A;  1RE3 A;  1M1K Q;  3AE7 C;  1RQU A;  5B66 E;  1JCD A;  3BCC J;  4NBF D;  5CJ0 A;  2YKQ A;  1IFN A;  4H13 B;  3NTN A;  3WUT A;  1DH3 A;  2IBZ I;  1BCC E;  1YIJ P;  1RFS A;  2QA4 P;  3L71 J;  2QIW A;  2XND H;  3L71 G;  1FDM A;  1LT9 A;  3ABV C;  2FFD C;  3CPW O;  2ZYG A;  3HD7 C;  1M7L A;  2WPV B;  1A02 F;  1O7H A;  2OTK E;  3V5B A;  3II6 A;  2W8Z A;  3T97 A;  2A45 H;  4QDD A;  2OYH B;  1NU1 G;  2OYO A;  4Y28 J;  2MKV A;  1G2C B;  2ZXE B;  5AVV B;  2WSF H;  3S1K A;  1OIP A;  1N7L A;  1IC2 A;  3RL0 B;  2HMM A;  3GHG A;  1X8Y A;  2PAJ A;  1LTA C;  1BE3 G;  2L91 A;  3KDP B;  1OVV A;  2WT7 B;  2K9J A;  3LIE A;  3GZX A;  3H1L J;  2QJY B;  2FXM A;  3VOP A;  2XR8 A;  2RN0 A;  1KB9 E;  1IJD B;  2BCC G;  1NHL A;  4PV1 C;  1OVU A;  2C9N Y;  3H1H J;  2K9J B;  1L0N G;  2IYP A;  5APS A;  1FE6 A;  5AW6 B;  1EXI A;  1Q7Y Q;  2W90 A;  2FFD B;  5AVT B;  1GTW A;  1KQL A;  3CWB E;  1OWA A;  3TK1 A;  2H43 A;  2GA1 A;  1PPJ G;  2I1K A;  1SQQ J;  1WRG A;  2FYU J;  3U1A A;  1NU1 E;  2WTY A;  2IDB A;  4HM8 A;  3VMA A;  2QJK C;  3WU2 H;  1T3J A;  4NB8 D;  4WY4 C;  3PLN A;  4NPF X;  1NGM B;  2AXT E;  2WPR A;  1VM9 A;  4C7R A;  1AVO A;  1CW5 A;  2YVJ B;  3L75 D;  1U7M A;  1NU1 J;  5TIS H;  3L75 E;  1QL1 A;  2GM4 A;  2OGU A;  5AEU A;  5BU5 A;  1Q90 D;  1FU1 A;  1JUN A;  3L73 G;  1QVG O;  4H0L D;  4ZKP A;  1J2J B;  4B86 A;  1PP9 G;  3CWB J;  2WQY C;  3L73 E;  4LLH A;  5AW3 B;  4D6T E;  5E79 E;  1PGO A;  5E79 H;  1EC5 A;  4BRY B;  1GW4 A;  1FZE A;  3H1I G;  2JJL A;  5KJ7 D;  2HMJ A;  1KB9 I;  3G71 P;  3G9R A;  2FXO A;  1SQP K;  1L4A B;  3EN1 A;  4GOD A;  2K3R A;  4NBE D;  3SFE C;  3B5N B;  5APU A;  3H6P A;  2D2C B;  1GZL A;  3CC4 P;  3KZI H;  2QM7 A;  2W6J H;  1IFP A;  1OX3 A;  2B9B A;  2LXB A;  2NPS C;  2CPB A;  2IZ0 A;  1O7W A;  1QX8 A;  5HL4 A;  2QRX A;  2QPZ A;  2Q3E A;  4HM5 A;  2KS1 B;  1SFC A;  3CWB D;  2PGD A;  4PJ0 E;  1Y8A A;  1SQB J;  3HUS A;  1NYK A;  3H1I E;  3GMA A;  3H1J G;  2GUS A;  1DD4 A;  3A3Y B;  1EDJ A;  3EQQ A;  1MFZ A;  5CCH D;  4H0L C;  3TNU A;  2XZR A;  5C39 A;  1Q90 C;  1AV1 A;  2QE7 H;  1RE4 C;  3MIW A;  1G8J B;  1RQV A;  2ITA A;  1FZG A;  5TJH A;  2I7F A;  3PP5 A;  5GTI H;  2DE6 D;  3LID A;  4C46 A;  2NUM A;  4R4M A;  1J1D C;  3D71 A;  2PFX A;  1U7J A;  2M3E A;  2ZT9 D;  1G2C A;  1IZN B;  1AJY A;  4QDC A;  1S3J A;  1K9M Q;  1L0N E;  2BMO A;  1H0T B;  3WUU A;  3GB4 A;  3C9I A;  1YHQ P;  3DQY A;  2NVF A;  3OW2 O;  2AEF A;  3D89 A;  2M5A B;  1NTM E;  1KTM A;  3PH0 A;  5AVY B;  2E75 D;  1MKM A;  2W83 C;  2HLO A;  2I8D A;  1BDD A;  1PPJ D;  2G8Y A;  3A0H E;  3C1L A;  1IFI A;  5AW1 B;  1O7G A;  4EYY Q;  2KXP B;  4Y99 C;  1VF5 B;  2FYZ A;  2CKF A;  1M56 D;  1X9V A;  1BCC D;  2Q9I A;  1ULJ A;  2K1A A;  2HPC B;  3CXH D;  2E74 B;  1SQX K;  2JDI H;  5APV A;  2JO6 A;  3B8E B;  1HGZ A;  1SQQ K;  3NFQ A;  3FWL A;  3E1R A;  4EMJ B;  3BRV B;  1Q82 Q;  3HE5 A;  3M9Q A;  1X0T A;  1Z56 A;  2KNC A;  2V7Q H;  1M1J B;  3AEF C;  1VL2 A;  4HM0 A;  1JTH B;  1X22 A;  1Y9B A;  3Q5P A;  3O6Q A;  3G6E P;  4HM3 A;  1J1D B;  1ZXG A;  2ZFC A;  3H1K G;  2C0X A;  3M91 A;  3CI9 A;  1N7S C;  1S5L X;  2A06 G;  4AUW A;  2WSE J;  3GF3 A;  2O1K A;  2IFN A;  1SQP G;  2M0B A;  1SFC D;  1SQV E;  3P8C E;  3TGU E;  2H88 C;  2HMK A;  4I6M C;  2BCC D;  3VMX A;  4D6T J;  4K3A A;  2ZT9 C;  3IF4 A;  3KYQ A;  2Q3I A;  2E4P A;  2XKM A;  1KYO I;  3CD6 P;  1SQQ E;  3M9B A;  1EZV I;  3CC7 P;  4IL6 E;  4L76 A;  3Q1M A;  1SQB K;  5KAF H;  1QGK B;  2E74 D;  1N2D C;  1IFD A;  3L72 E;  3F5H A;  4YXD C;  1ZN5 A;  1T2K C;  5DJU B;  3L71 D;  5APY A;  3AE5 C;  2IYO A;  2PP6 A;  5AVU B;  5KKZ C;  1NKZ B;  3CX5 D;  3GL0 A;  2QSI A;  1VQP P;  5CCG D;  1EXJ A;  4WY4 B;  1CI6 A;  2YIU B;  1CSB A;  1OW6 A;  4L75 A;  1SLQ A;  5CBO A;  4HM4 A;  4GOE A;  2UWJ E;  1WMK A;  2J58 A;  4N3Y B;  1NU1 K;  2NPS D;  1E79 H;  1PP9 D;  2R3S A;  4H13 D;  1VQ9 P;  4NBB D;  2LXC B;  5B66 H;  2H89 C;  3RK2 D;  2YKP A;  1SQB G;  2AXC A;  3VYI A;  2BCC J;  2E42 A;  2NZ2 A;  1GU5 A;  1NTZ K;  3TGU J;  3MUD C;  1SQV J;  2JO1 A;  4DT0 A;  3CL3 D;  1LTG C;  3PJS K;  3RK3 C;  2R5B A;  1LTJ C;  3H1H D;  1YQ4 C;  3MGN A;  1GL2 A;  1VQM P;  2KZJ A;  1AQ5 A;  1GMJ A;  2V4H A;  3B4S A;  4HH2 A;  2O01 J;  4BWN A;  4DJG A;  5KAI E;  4UB6 E;  3VP9 A;  2OYH C;  1LT1 A;  2H8P D;  1SS1 A;  4M3L A;  2R32 A;  1MZ9 A;  3L70 E;  5CCG A;  3L74 E;  3HE4 B;  3V2Q A;  2JR8 A;  1PGJ A;  1FZC B;  1LNQ A;  2A45 I;  3Q2Y A;  3I55 P;  4H44 B;  4H44 D;  3B71 A;  2YXQ B;  3K5B A;  5B5E H;  1E5W A;  5B5E E;  4IOI H;  2O01 H;  1UIX A;  3L74 D;  3A0H H;  3P7K A;  1UUW A;  2WVR A;  1DEB A;  2KI7 B;  2E4Q A;  2O3J A;  5AW5 B;  2FYN C;  3M0D A;  1N73 B;  3KXD A;  1YBK A;  1O7N A;  1EQ7 A;  2M5A A;  1HH0 A;  2YMY A;  3U59 A;  3N4X A;  1NTM J;  1KB9 H;  2FYN B;  4AQR D;  3V2P A;  3GW6 A;  2LKM A;  3H1I J;  3CCJ P;  5TIS E;  2HOD B;  3HD7 B;  5AVS B;  2BEZ F;  3V4Q A;  5APQ A;  1W2B O;  3L73 D;  2E43 A;  3BCC G;  3GLM A;  3H1K E;  3CCU P;  1OW7 A;  1S4X A;  4NBA D;  1JY2 P;  3GF7 A;  3A2A A;  1RHZ B;  2N1T C;  1VQL P;  2G3A A;  2ZYD A;  3MUD A;  2OTJ P;  1SJG A;  3TGU G;  1CI6 B;  2XNX A;  3CME P;  1JEK A;  2HR3 A;  4DOJ A;  3CC2 P;  1KYO E;  5CCG C;  4W7Y A;  2OYI B;  5KLV G;  1ZW0 A;  2PRR A;  3CX5 E;  1S9K E;  2JEE A;  4GT1 A;  3HUS B;  3Q3D A;  1EZV E;  3L74 J;  1HF9 A;  4OGQ C;  3B5N D;  3L73 J;  1HJB A;  3L70 D;  3OA7 A;  1NTM K;  2GBW A;  1LWU B;  3GHG C;  1NYH A;  1URQ B;  1GDT A;  1J1E C;  3CWB G;  1ZLL A;  1G8K B;  2YNY A;  2POH A;  4OGQ D;  1JTH A;  1PFI A;  2R44 A;  1GU4 A;  2ZT9 B;  3A5T A;  3H1J D;  2IPP A;  3RK3 B;  3R2P A;  1EDL A;  1NTK K;  1IFM A;  1JCC A;  4P1B H;  3W68 A;  1KV4 A;  2B24 A;  1NTK D;  2YFI A;  2IBZ E;  1KYO H;  1KIL C;  3MTU E;  4GKG A;  3UIA A;  2BCC E;  2QJY C;  4U3F E;  4OH8 B;  2KB7 P;  2QVA A;  5KLI C;  3CXH E;  2NVE A;  4EIJ A;  1N86 A;  3TNU B;  1JY3 N;  2RMZ A;  4HKZ H;  4PD4 I;  3CX5 H;  1N7S D;  5AVX B;  4NPE A;  3RBX A;  3VCA A;  3QWO C;  4HYT B;  2XU6 A;  1PPJ E;  5KAF E;  2A45 G;  1URQ D;  1M90 Q;  3GOB A;  2N1T B;  4AYC A;  5CXM A;  3TF5 A;  1BSN A;  3AE8 C;  3VN0 A;  5KTB A;  1SQX G;  5APX A;  1QVF O;  3WU2 E;  1H88 A;  1JY2 O;  2B89 A;  1BDC A;  1PV3 A;  3C8V A;  5M1B A;  4AAY B;  2IZ1 A;  1T3U A;  2IX7 C;  3AEG C;  1FJK A;  4YXW H;  5AVZ B;  1L0L D;  1VQ8 P;  1HWT C;  4HKV A;  3P32 A;  4UB6 H;  4OVN F;  1R5L A;  2E75 B;  3GL2 A;  3RL0 C;  4HB1 A;  2FYU E;  2ZXX A;  2XV5 A;  1G1I A;  3AEA C;  3RGU A;  1FOS E;  1YJ9 P;  4PJ0 H;  4H44 C;  2K88 A;  2JZA A;  1FQT A;  3H1L D;  4QDF B;  1VDF A;  1OMI A;  2FKW B;  4C7N A;  3WUV A;  3AE2 C;  3IR9 A;  3E1I A;  2Z5I A;  1NTK E;  5EFW B;  1L2P A;  1NOH A;  1Q86 Q;  2FBW C;  1JM1 A;  2N9Y B;  4JF7 A;  1N73 A;  2LR2 A;  2KS1 A;  3B5N A;  1SQV K;  1DEE G;  1KQS O;  2OYI C;  1LWU A;  3L75 G;  1VQN P;  5KAI H;  1ULI A;  1NTZ G;  3CXH I;  1OW8 A;  1KIL A;  2WSF J;  1HGV A;  1FZF A;  1RF0 C;  2M3B A;  2W27 A;  2YXR B;  1L0L G;  3RL0 D;  1JM0 A;  1LTB C;  3BRT B;  1YQ3 C;  1KD1 Q;  5AW9 B;  1NO4 A;  1WQL A;  4PV1 D;  1J1E B;  3S9O A;  3L74 G;  4N6J A;  2RH0 A;  4BXL A;  4Z1M H;  3BAS A;  3O8Z A;  1NAF A;  1EG9 A;  1IK9 A;  3H1I D;  3Q5S A;  1BE3 E;  4GDO A;  3A0B E;  4ZMD A;  2ZAE B;  1YJN P;  4WBA A;  5H2F E;  1AQT A;  1FJP A;  1JMM A;  2FY8 A;  3HTK A;  2H7H A;  3H32 A;  1N7S A;  3AEC C;  3JSV C;  5AW7 B;  2KLU A;  5CJ4 A;  2AXT H;  2BEQ D;  1BCC J;  2Y0E A;  1ZV8 A;  3GTS A;  3GG2 A;  1URQ C;  1OZH A;  3TDK A;  3PRJ A;  4H0L B;  2JKV A;  4NBD D;  3H1K D;  2FYU D;  3HTK B;  3HUS C;  3AE9 C;  5KJ7 A;  1NTM D;  4D6T G;  1S5L H;  1S1C X;  1L0L E;  3MD0 A;  1H0T A;  5BVZ A;  1M8O B;  3D6Z A;  1KZU B;  2E74 C;  2N1T A;  1K73 Q;  4U3F D;  3FXE A;  3JC2 2;  3L4F A;  3IFM A;  3AZC A;  3PHL A;  4QDF A;  2IFM A;  1S72 P;  3GKE A;  1KIL D;  4PD4 D;  5AVW B;  2FXP A;  1FAV A;  1K04 A;  2WSC J;  2D2C D;  3H1J E;  1JMB A;  1R8E A;  1GK6 A;  3GZY A;  3CCS P;  1O7P A;  2R3C A;  3NMD A;  2A06 D; 
#chains in the Genus database with same CATH homology
 2YIU C;  3GL0 A;  1VM9 A;  3EQQ A;  4QUP A;  1WQL A;  4PV1 D;  1SQX E;  2HMO A;  4H44 D;  2QJP C;  4AAY B;  2YVJ B;  4QDD A;  4PD4 E;  3CX5 E;  1Q90 C;  5BOK A;  4NBC D;  1EG9 A;  1PP9 E;  1EZV E;  3L75 E;  4HJL A;  1BE3 E;  1VF5 D;  5AEU A;  1G8J B;  2DE5 D;  4HM0 A;  4NBG D;  1VCK A;  4HM4 A;  1UUW A;  2Q3W A;  2GBW A;  2HMM A;  4H0L D;  2I7F A;  4HM3 A;  3VCP A;  4NB9 D;  2E4Q A;  5AEW A;  4NBH D;  2FYN C;  4HKV A;  2BMQ A;  3L73 E;  4D6T E;  1G8K B;  1NDO A;  5KKZ C;  2DE6 D;  3GL2 A;  2NUM A;  4P1C H;  3GZX A;  2FYU E;  3GTE A;  4OGQ D;  5KLV E;  3VMG D;  4HM7 A;  4H13 D;  1O7N A;  1SQB E;  2ZT9 D;  4NBB D;  4QDC A;  2YFL A;  4QUQ A;  2NUK A;  2XR8 A;  2HMJ A;  4HM6 A;  1L0N E;  3GTS A;  1KB9 E;  1P84 E;  4P1B H;  2BMO A;  2JZA A;  3EN1 A;  2B24 A;  4NBD D;  1FQT A;  1UUV A;  4QDF B;  1SQV E;  2A06 E;  3C0D A;  1NTZ E;  3TGU E;  4NBF D;  4NBE D;  2YFI A;  1BGY E;  2IBZ E;  3L71 E;  3GB4 A;  2HMK A;  1SQP E;  4AIV A;  2DE7 D;  2BCC E;  2QJY C;  3DQY A;  4U3F E;  2XSO A;  1O7M A;  2NVF A;  3GCE A;  2BMR A;  2HML A;  5KLI C;  1NTK E;  2YFJ A;  3H1K E;  3D89 A;  3CWB E;  1L0L E;  4HM2 A;  3CXH E;  1NTM E;  2NVE A;  4NBA D;  2GBX A;  1JM1 A;  1BCC E;  2B1X A;  2E75 D;  2E76 D;  3AZC A;  4QDF A;  2E4P A;  1RFS A;  3GKE A;  1SQQ E;  3H1L E;  3BCC E;  3VCA A;  3N0Q A;  1ZRT E;  1O7W A;  3H1H E;  1O7G A;  1NU1 E;  2XSH A;  4HM1 A;  1PPJ E;  1RIE A;  2CKF A;  3VMH D;  5HL4 A;  2HMN A;  2QPZ A;  1ULJ A;  2NWF A;  4HM8 A;  4HM5 A;  4QUR A;  2D2C D;  3H1J E;  2E74 D;  1SJG A;  3VMI D;  3GOB A;  1ULI A;  4QCK A;  3L72 E;  2JO6 A;  5CXM A;  2QJK C;  2XRX A;  3L70 E;  1NYK A;  3GZY A;  3L74 E;  1O7H A;  3FOU A;  4NB8 D;  1O7P A;  3H1I E;  2NVG A;  2ZYL A;  1KYO E;  4EMJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...