3L72E

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
total genus 36
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l72E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l72E02
2QJPC 2DE5D 2ZYLA 2NVGA 2Q3WA 4HM4A 1SQXE 2BMQA 1NDOA 3DQYA 1ZRTE 3VCPA 3N0QA 3GL2A 2B24A 2NVFA 1BE3E 3GZXA 3GZYA 4PV1D 3H1IE 3CWBE 3GB4A 3D89A 1L0LE 1G8KB 2BMOA 1UUVA 2CKFA 2ZT9D 3VMGD 4H0LD 1G8JB 4HM2A 4NBGD 1UUWA 4QDCA 4HM7A 3VCAA 4QCKA 4NBAD 1KB9E 1O7PA 4U3FE 1L0NE 1SQPE 4NBFD 4OGQD 4QDFB 1PPJE 2JZAA 3H1JE 4HM5A 2GBWA 1EG9A 2E74D 1RFSA 3L75E 2XR8A 3H1LE 1ULJA 1O7GA 1O7HA 2YFJA 1SQQE 5KLVE 3GOBA 2YVJB 1VM9A 4QUQA 1O7WA 4HM3A 4QDDA 2YFIA 4NBDD 4QURA 4H13D 1JM1A 1PP9E 4QUPA 3C0DA 2E4QA 4NB9D 1Q90C 3L74E 2QPZA 3VMHD 3AZCA 2BCCE 2E76D 3GCEA 3GTEA 3CXHE 4NBHD 5AEUA 4EMJB 3GKEA 3H1KE 2NVEA 1NTZE 4PD4E 1VF5D 2HMJA 4HM6A 2NWFA 4P1BH 1VCKA 1BGYE 2HMLA 3L73E 4HM1A 5BOKA 2I7FA 3L70E 3L71E 2FYNC 4HJLA 1SQBE 2HMNA 4NB8D 3BCCE 3L72E 2E75D 2JO6A 2GBXA 5AEWA 1SQVE 3TGUE 1P84E 3H1HE 2YIUC 4NBED 1NTKE 5KLIC 1O7NA 4H44D 4D6TE 2IBZE 3FOUA 4NBCD 3EQQA 2DE7D 1NYKA 2HMOA 2YFLA 2DE6D 4P1CH 5CXMA 2QJKC 2B1XA 2XSOA 3GL0A 3CX5E 2NUKA 2QJYC 3GTSA 3EN1A 1NTME 5KKZC 4AAYB 1NU1E 5HL4A 3VMID 1RIEA 2NUMA 4HM0A 2HMKA 2BMRA 1SJGA 1FQTA 2E4PA 4QDFA 4NBBD 4HKVA 1O7MA 1BCCE 2D2CD 1WQLA 1KYOE 2A06E 1ULIA 2XSHA 2FYUE 1EZVE 2HMMA 2XRXA 4AIVA 4HM8A
chains in the Genus database with same CATH superfamily
5CCGD 1CW5A 2Y9ZA 1KFNA 3H1JJ 2BMQA 2WSSH 2YNYA 3GL2A 1BE3E 1NOHA 3K5BA 3UIAA 3P32A 4HKZH 1VQLP 4L74A 4K35A 3CX5I 2O01J 4W80A 2AXCA 2H8PD 3CWBG 4OGQB 4PV1C 2FYZA 2YO3A 3KHUA 1VQ9P 3ZDMA 3OW2O 2WT7A 2QM8A 2QPZA 3GTEA 4NBHD 1AQTA 3HRNA 2K3RA 2QSIA 4WB4A 4PJ0E 1S72P 1SQBD 1RE4C 1ZW0A 2I1JA 1W2BO 2IFNA 3A7OA 1KMIZ 2W6BA 2Z4EA 3CMAP 1FAVA 3A0HE 4L73A 3RL0D 1VQ4P 1M90Q 3CCEP 1GU4A 3PTZA 3D6YA 3BRTB 3KQGA 5KLIB 5KLVK 1YTZT 3CCJP 2FXMA 3OAKA 3VMID 3JSVC 2E4PA 2R44A 4HKVA 2QJYB 2R3SA 2FYUE 3NFQA 3WU2H 2KK7A 2ZXXA 1OXZA 3GZYA 4PV1D 3GG2A 5GTHH 5KLVJ 3VMAA 1M57D 3BVHA 2LXBA 1FZGA 2RN0A 4LLHA 1PPJD 4ASVA 4WY4A 1SQXG 2FBWC 4EDFA 4R4LA 1URQC 5APTA 4TT3H 2CPBA 3AEGC 2ZT9C 3P7KA 2WVRA 1RH5B 5CBNA 5CCHC 3CMEP 5B5EH 1RE4A 1IK9A 2B87B 2I8DA 3IR9A 2WSEJ 4ZMDA 2FFDA 3E7KA 4OGQC 3H1JG 3Q5PA 1H8AA 2ZXEB 2E74C 5L8RJ 5CJ0A 2NRGA 4PD4E 1GL2B 1R5LA 3PRJA 5AVYB 3F89A 3TGUD 2HMLA 3L70E 1JY3N 1OZHA 2GBXA 4DCKA 1DD4A 1VL2A 1NTKE 3V5BA 4BXLA 3CX5D 3EFGA 3A0BH 1NU1D 1KV4A 3N7NA 3WUUA 5AW3B 2SPZA 4WBAA 4HM0A 2K37A 4UB6E 1PGPA 2E42A 4HM8A 1X79B 3TNUB 2ZYLA 1LTTC 1HBWA 3MD0A 1JY2P 1G1JA 3S9OA 1URQA 1S3JA 1URQD 3MGNA 2QJPB 2ZT9D 5CCHA 5CHXA 5CCHD 1UUWA 1J1EB 1T2KC 1O7PA 4DZOA 2IYOA 4OGQD 4I1LA 2JKVA 3CCUP 1EG9A 3CPWO 2E74D 3RK2B 1EDLA 3RGUA 4QUQA 1AQ5A 4QDDA 1L0ND 3BCCJ 1FZBA 1IFMA 3L74E 2M8RA 2XV5A 1ZOYC 4N3YB 4BRYB 3HTKA 5KLVG 3B8EB 3PJSK 1Q7YQ 4UB8E 1KYOH 1R5SA 3L73D 1PFIA 1EXJA 2OTJP 3KZIH 3SSUA 2KNCB 2W27A 1CSBA 1N8RQ 3AEDC 1AV1A 4RESB 1NJIQ 3O8ZA 1GL2C 1GD2E 3EQQA 1L4AB 2OTKE 3O6QA 1NHLA 1EQ7A 5KJ7C 1N73A 1BCCD 2IDBA 3L4FA 3H1HD 3L36A 1EDJA 4U3FJ 2N9YB 1HGVA 2P1JA 1X8YA 3GF7A 1T2KD 3IAOA 1ZR2A 1L0LD 1NTZK 4B86A 1EXIA 3RBXA 3AECC 5BU8B 1SS1A 2KP8A 3NXSA 2JWAA 4HJGH 1AVOA 5C39A 1L0NE 1OVVA 4NBFD 4W7ZA 2FXPA 2UWJE 3H1ID 1SQQD 2Q9IA 1SFCC 3L75E 2WSCH 1ZLLA 1OWAA 1NO4A 1NTZJ 1LT9C 2BASA 2YVJB 5AVSB 4I6MC 2YFIA 2OTLP 2HPCB 5AVUB 3D6ZA 1BDDA 1AJYA 4GODA 5APWA 1T6AA 3VMHD 2JWDA 1GZLA 3PH0A 3CCMP 2VRSA 1GL2D 4EMJB 1KYOI 1FC2C 3H1KJ 2KSEA 1VCKA 2Y0EA 4H13C 5KJ7A 5KJ7D 1EDKA 3L71E 1PIXA 1H0TA 1PL5A 1JY3O 1LP1A 3H1HE 1Q82Q 2WT7B 3OA7A 5AW5B 1S1CX 4P1CH 1LTJC 2PRRA 2DW3A 1BE3J 1OW8A 3BCCG 2HLOA 5HL4A 1VQ5P 1RIEA 3VYIA 1KQFB 2XKMA 2WSFH 5KKZB 1ZP0C 3IFMA 1ZRTD 4Y28J 4KHXA 3VP9A 1UIIA 3TK1A 2WTYA 2ZYAA 1SFCA 2NVFA 5DJTB 3H1IE 3RL0B 1SFCD 2AXTH 1YIJP 3VMGD 5GTIH 2M3EA 5AVVB 1FZFA 1RY3A 3FXDA 2FY8A 1SLQA 3GHGA 1JY2N 3M0DC 1FJKA 1XTGB 3OJAB 1YYCA 2YMKA 4U3FG 3WU2E 3BASA 4H13D 1PP9E 5DJUB 4EOTA 2R3CA 1KD1Q 3GCEA 3VP8A 2MKVA 3G3ZA 2YKQA 1SP4A 5GTHE 1FOSF 5AW2B 2NPSC 4P1BH 1KZUB 1SQVD 4XE5B 4HM1A 2IBZD 3EQ2A 1A02F 2FYUJ 4D6TE 1NTZG 4NBCD 3G4SP 1IFNA 2DE6D 2W6JH 1HF9A 3EN1A 1JEKA 2OARA 4GKGA 4IFMA 1YITP 2C9NY 2KLVA 2Z5HA 2IZ0A 4W7YA 3AE3C 3AE9C 1OW7A 2WSEH 3H1KG 1KFMA 3CWBD 2Q3WA 2KS1B 4JBZA 1HJBA 1VPCA 1T8ZA 3CXHH 3AE2C 1KYOD 4NBGD 3VMYA 3H32A 3V4QA 1SQPE 3KDPB 3GF3A 3Q2YA 1BE3G 4O9BA 4GOEA 2K9YA 2WMMA 1Y47A 4Z1MH 2Y0CA 4A7PA 2NPSA 1WT6A 2NPSD 2W8ZA 3LW5J 3HE4A 1URQB 1HVVA 4NBDD 3L70J 2ZT9B 1M56D 4I2LC 1NTKJ 2BCCE 2QA4P 3AZCA 1U7MA 2E5YA 1DH3A 1KB9H 3CCRP 1CZQA 2QM7A 2HG5D 3SWKA 2NVEA 5AVRB 2E74B 2KSJA 1LTIC 2QG4A 3II6A 1BGYJ 2HFED 2M5AA 1YHQP 1NAFA 4WY4C 2JO6A 2JEEA 1E5WA 5AW0B 1NKZB 1N7SA 2R5DA 1DIPA 3HUSA 2HMOA 2YFLA 2WPQA 2OGUA 3CD6P 1DX7A 3GL0A 1JB0J 4HH2A 3VMXA 4L75A 3L72D 4JYBA 3USSA 2E75C 2FFDC 1N7LA 4OWFA 3Q1MA 1SQXD 1KYOE 2A06E 2HMMA 3KZIE 3MP7B 3S4RA 1FS0E 3CCLP 3N0QA 2B24A 4KJMA 3CXHI 3D89A 3TDKA 2FYUG 3U1AA 5AVQB 4KT0J 1MKMA 3FWLA 1N73B 3H1JD 3L74J 2IYPA 1KQSO 2A45G 2GBWA 3KYQA 1JY2O 2XR8A 1K73Q 3M91A 2WPRA 2YFJA 1YJ9P 2AEMA 3I56P 2W6AA 1EZVG 1KORA 4AYCA 3FXEA 1FE6A 3SWYA 3M0AA 2B88A 4WY4D 2E76B 1KB9I 2GA1A 1FU1A 1IFJA 1OFCX 1QVGO 2V4HA 3IN6A 2OYHC 1SQBE 3L72E 2E75D 1L0NK 2QRXA 1JM0A 4AUWA 3BRVB 3AE4C 4XFJA 4NBED 4C7NA 3MIWA 1GTWA 3FOUA 2B89A 1LTBC 2NZ2A 3L70G 4WVZA 3A5TA 2KUBA 3AE7C 1NTKG 1GMJA 1GW3A 1SJGA 1JNMA 3U1CA 1VQPP 1KC8Q 5BU5A 2XRXA 1H0TB 3I5CA 3SFDC 1LP1B 1GW4A 3L75J 1XTCC 1BGYG 2K88A 3JCUH 1PGJA 2XNDH 3Q5RA 3CCVP 1K04A 2W83C 3B4SA 4I7ZB 2RH0A 2YXQB 1PPJE 5KLVD 3SFEC 3E1IA 4RKUJ 1P84H 1L0LK 1QGKB 1G2CA 1O7GA 1N73C 1LWUA 4ZKPA 1YQ3C 4YXWH 1SFCB 1GDTA 3C1LA 3L71J 2K9JA 2CPSA 1JTHA 2OYHA 1LT9B 2P2UA 1ZXGA 5AW8B 4ASWA 2AXTE 1Q86Q 3AEAC 5GTIE 3HD7C 5APYA 1S5LH 1FDOA 3GHGB 3L74G 4C7RA 5TJHA 3TSIA 1M8OB 2AEJA 2OQQA 1LGHB 2E76C 3CXHD 5APVA 3TGUE 3HE5A 4H13B 1O7NA 1KILC 1D7MA 2H88C 1QL2A 2B1XA 3CX5E 3WMM0 2ZVOB 3N4XA 1NU1E 2J59M 1LTJB 2HMKA 2PP6A 3V2PA 1Y9BA 1JOCA 1ULIA 3P8CD 3U59A 4HM4A 1GU5A 5KAIH 1NTMD 1PV3A 1NWQA 1RF1C 1KB9D 1G8JB 1PP9J 1DEEG 1UIXA 1BSNA 4DT0A 3NTNA 1KTMA 1Z56A 3AEFC 3FGAD 1P84I 1J1DC 2V7QJ 4I7ZC 3HD7A 2IBZI 4H0LC 3HD7D 2A45H 1JM1A 1S4XA 3L75G 2E76D 1QLED 4D6TJ 3CXHE 1KILA 2YMYA 3H1LD 1KILD 1IFIA 2GM4A 3R2PA 1X22A 2IZ1A 3BCCD 2P10A 3H6PA 5B66H 1Y8AA 3L73E 1H89A 2I7FA 3W67A 2JDIH 2NPSB 2K1AA 5AEWA 1SQPK 3HE4B 1AVYA 2KB7P 2G3AA 1TU3F 3GHGC 5CXMA 1VQ8P 1VF5C 2QIWA 2B87A 3P8CE 2OYIC 3CCSP 1RE3A 2QVAA 3L71G 1N86A 1NTME 5APUA 3Q5SA 1RF1A 5BVZA 1U57A 4PD4H 3FX0A 3PLNA 1O7MA 3AE5C 1BCCE 2R5BA 3V2RA 1WQLA 2XSHA 1SQPJ 2M5AB 2PFXA 2O01H 3WUVA 3VCPA 1N7SB 1NVOA 1M1JC 3GB4A 3CLQA 1L0LE 4AQRD 3I55P 3R4YA 4H0LD 4HM2A 2PGDA 3MHVA 4NBAD 4OH8B 2BCCJ 4BWNA 1R8EA 1JO5A 4UB6H 1VDFA 4CPGA 4ZKUA 1VQNP 3P8MC 3H1LE 2POHA 1SQQE 1VQOP 5KAFH 1BDCA 1FDIA 2A45I 1Q90C 1JCDA 1NTZD 2R32A 2IX7C 1M7LA 1EZVI 1VF5D 2O01N 2OYIA 2YXRB 2NWFA 1PP9G 2AEFA 1KQGB 2JP3A 3V2QA 1RF0C 1H88A 2WITA 2YIUC 2KLUA 1T3UA 3H1KD 2QJKC 4WY4B 1YBKA 1M1JA 4UB8H 2NUMA 2BMRA 1P84D 1MUUA 4D6TG 2Q3IA 4PD4I 4QDFA 3M9QA 3PP5A 2KZJA 2I1KA 2E75B 4NPDA 1BE3D 2FFDB 2NVGA 1FOSE 5B5EE 2KOGA 1ZRTE 4C7NB 1MFTA 3C8VA 3L35A 2CKFA 2D2CC 1SQBK 1FZAA 1JY3P 2FKWB 3ITKA 1N7SC 3HUSC 1Q90D 1IFPA 1SQXK 3KXDA 5TISH 1K05A 3CC2P 1ULJA 3GOBA 1VM9A 5E79H 1O7WA 1J2JB 1SQPG 1JCCA 3W68A 1SQBJ 4QURA 3A0BE 2ZYGA 3L72J 2LKMA 1RF0A 1OVRA 2WSCJ 1ZN5A 4Y99C 3H25A 3V2NA 4JF7A 3M06A 4TLFA 1LT1A 2KYVA 3H1KE 2OYOA 3VTPC 2BCCG 1FZCA 1HH0A 1G2CB 1QL1A 1LWUB 1SQVE 1P84E 5H2FH 3GLMA 2IBZE 2K9JB 1JTHB 2OYHB 2Q7CA 2P67A 1NKNA 3M9HA 3NMDA 4GOFA 4JPZB 5AVWB 4IL6X 2HPCA 4DOJA 4IOIH 2G8YA 1EC5A 2FYUD 3WUTA 4NBBD 3RL0g 2D2CD 1QEXA 5EFWB 3AE6C 1S5LE 2HODA 1N7SD 3HE5B 1HTLC 4M3LA 2WZ7A 3CWBE 2WSFJ 3HTKB 4GDOA 1G8KB 2BMOA 2A06G 4LGDE 1EZVD 4QDCA 1GK4A 5AW6B 2ITAA 2JZAA 1CI6A 2WQYC 2ZJSE 2E43A 3BATA 1HUCA 2Q6QA 1NU1K 4K3AA 3O6QB 2L91A 3IF4A 2C0WA 4QUPA 5KAIE 3TGUJ 2BEQD 3RBZA 4PD4D 5AW1B 3T97A 2GUVA 2XDJA 1OIPA 2B9BA 4HB1A 1QX8A 1S5LX 2M3BA 3L70D 2KIKA 1USEA 1NU1J 1FDMA 1NTKD 2BEZF 2HMNA 3HD7B 1IZNB 3SWFA 1ZR4A 2N1TC 1NYKA 2ZYDA 3B5NC 3AE8C 1KN7A 4OVNF 1BGYD 2NUKA 1KILB 1LWUC 1SQBG 3RK3B 3L72G 4N78D 1JMBA 1ZV8A 2M0BA 2V7QH 1JUNA 2XZRA 2CK3H 4QMAA 1RQUA 1EZVE 3Q3DA 1LTAC 1WMKA 2C9LY 5B66E 1QVFO 1SQXE 3EFFK 3DQYA 4ZNCA 3S1KA 4LC1A 2E5TA 4IL6H 1IK7A 4U7JA 3A3YB 1GK6A 2ZAEB 2P58A 4HM7A 1RF1B 1LJ2A 1L0NJ 2ZFCA 3H1JE 1W2EA 2LR2A 1S9KD 3MUDC 1NH4A 1NTMK 1O7HA 1Q2NA 3QWOC 3L74D 4HM3A 2QE7H 3L73J 1VQKP 2O1KA 1PPJG 1HWTC 2KS1A 1J1DB 1G1IA 1LTSC 2E4QA 4NB9D 4H0LB 5APSA 1HJ0A 4YPCA 2N1TA 2N1TD 3B5NA 1IO4A 3B5ND 1NGMB 1NTMJ 1BGYE 5BOKA 1VQ6P 4N78E 1BCCJ 5KLIC 3H1HJ 2ZVNB 1OX3A 1M1KQ 2WPSA 2WWWA 1YQ4C 5KAFE 2QJYC 3GTSA 1SQQK 1L0LJ 2MJZA 4AAYB 5APQA 3TGUG 1PGQA 1VF5B 1MV8A 5AW4B 2OYIB 1OVUA 2XNXA 2YO2A 1YJWP 3CCQP 4YTPC 1MFZA 3RK3C 1IFDA 1NU1G 1LNQA 2IFMA 1Q81Q 5AW7B 1RHZB 3MUDA 3GZXA 3H1LJ 5K5GB 3H1IJ 1SQQJ 3C9IA 1S9KE 3TYYA 4PJ0H 2QEXP 1KQLA 1VQ7P 3D71A 2O3JA 1M1JB 4JYCA 4QCKA 4DJGA 3CC7P 3L75D 4QDFB 4WWIA 1RE3C 3AEBC 5KLVE 3A0HH 5M1BA 5CJ4A 5AVZB 1DEBA 3FWNA 3B71A 1WRGA 2RKLA 2P7JA 1NAYA 3V6IA 1PZQA 2W90A 1T3JA 2HMJA 3L71D 2FXOA 3MTUE 1L0NG 5AW9B 4JQ0D 5TISE 1AFOA 4XA4A 4L76A 1PGOA 3VOPA 2DE7D 3H32B 4H44B 5E79E 2XSOA 3RK3D 3L73G 2H7HA 3CI9A 2YIUB 4R4MA 3GMAA 2QJKB 3LIDA 2Q5UA 3AE1C 3JC22 3TF5A 1FZCB 1A02J 4AIVA 2QJPC 2DE5D 1NTMG 1EDIA 1YTZI 1MZ9A 3ABVC 1J1EC 1VQMP 1BCCG 3AEEC 5H2FE 2KXPB 1IJDB 2KZIA 3H1HG 1AA0A 4IFFA 1SQVK 2L5GB 2XU6A 1KB9E 2WPVB 3LW5H 5KTBA 1OMIA 3RK2C 2D2CB 1GL2A 1L0LG 5APXA 4MN4C 1SVFA 2HODB 3V4WA 3HUSB 1YI2P 1USDA 1PP9D 3VMZA 2Z5IA 2JJLA 4U3FD 1JMMA 1OW6A 2HR3A 3QH9A 3L37A 1SQVJ 1BSHA 3H1LG 2FYNB 3H1IG 1SQQG 3G6EP 3CC4P 4Y99B 1CI6B 1KILE 4RO0A 3RK3E 2H89C 2Q3EA 4NPFX 4D6TD 1L4AC 3VN0A 3MZWB 4HJLA 4NB8D 3BCCE 3TNUA 1N2DC 1FJPA 5CMZA 3M9BA 3EWKA 1IC2A 2Y9YA 4GT1A 3LIEA 3T97B 1RQVA 1LT9A 3CWBJ 1X0TA 1NYHA 1W5CE 5AVTB 1K8AQ 1HGZA 2J58A 4RJTA 3G9RA 4H44C 4IFDK 1FBMA 3D70A 3RK2D 1NDOA 4GIFA 1K9MQ 4PV1B 1UUVA 2C0XA 1FZCC 3CX5H 3A2AA 1SQPD 1DD3A 4BRYA 2FYUK 3VCAA 2J5UA 5CCGC 4U3FE 4C46A 2JR8A 4EYYQ 3PHLA 2Q1KA 3E1RA 2N9BA 4HM5A 2KNCA 3GW6A 1LTJA 1RFSA 2LXCB 2KI7B 4EIJA 2HYNA 2BCCD 4HYTB 3C0DA 1L4AA 1L4AD 2IPPA 2RMZA 1E79H 4EI2A 4IL6E 3CL3D 5AEUA 1ZMEC 1YJNP 3GKEA 2JO1A 1X9VA 1NTZE 4HM6A 2GUSA 4N6JA 2YKOA 3KPEA 4YXDC 2FYNC 5AVXB 2H43A 1FZEA 4H44D 3JCUE 2O1JA 1S2EA 4NPEA 2Y0DA 1SQXJ 3M0DA 1U7JA 2N1TB 2PAJA 2YKPA 5KKZC 1LTGC 1SQVG 1L2PA 2A06D 3B5NB 1FQTA 2IBZG 1NTKK 3F5HA 5CBOA 3G71P 5CCGA 3RL0C
chains in the Genus database with same CATH topology
2QJPC 2DE5D 2ZYLA 2NVGA 2Q3WA 4HM4A 1SQXE 2BMQA 1NDOA 3DQYA 1ZRTE 3VCPA 3N0QA 3GL2A 2B24A 2NVFA 1BE3E 3GZXA 3GZYA 4PV1D 3H1IE 3CWBE 3GB4A 3D89A 1L0LE 1G8KB 2BMOA 1UUVA 2CKFA 2ZT9D 3VMGD 4H0LD 1G8JB 4HM2A 4NBGD 1UUWA 4QDCA 4HM7A 3VCAA 4QCKA 4NBAD 1KB9E 1O7PA 4U3FE 1L0NE 1SQPE 4NBFD 4OGQD 4QDFB 1PPJE 2JZAA 3H1JE 4HM5A 2GBWA 1EG9A 2E74D 1RFSA 3L75E 2XR8A 3H1LE 1ULJA 1O7GA 1O7HA 2YFJA 1SQQE 5KLVE 3GOBA 2YVJB 1VM9A 4QUQA 1O7WA 4HM3A 4QDDA 2YFIA 4NBDD 4QURA 4H13D 1JM1A 1PP9E 4QUPA 3C0DA 2E4QA 4NB9D 1Q90C 3L74E 2QPZA 3VMHD 3AZCA 2BCCE 2E76D 3GCEA 3GTEA 3CXHE 4NBHD 5AEUA 4EMJB 3GKEA 3H1KE 2NVEA 1NTZE 4PD4E 1VF5D 2HMJA 4HM6A 2NWFA 4P1BH 1VCKA 1BGYE 2HMLA 3L73E 4HM1A 5BOKA 2I7FA 3L70E 3L71E 2FYNC 4HJLA 1SQBE 2HMNA 4NB8D 3BCCE 3L72E 2E75D 2JO6A 2GBXA 5AEWA 1SQVE 3TGUE 1P84E 3H1HE 2YIUC 4NBED 1NTKE 5KLIC 1O7NA 4H44D 4D6TE 2IBZE 3FOUA 4NBCD 3EQQA 2DE7D 1NYKA 2HMOA 2YFLA 2DE6D 4P1CH 5CXMA 2QJKC 2B1XA 2XSOA 3GL0A 3CX5E 2NUKA 2QJYC 3GTSA 3EN1A 1NTME 5KKZC 4AAYB 1NU1E 5HL4A 3VMID 1RIEA 2NUMA 4HM0A 2HMKA 2BMRA 1SJGA 1FQTA 2E4PA 4QDFA 4NBBD 4HKVA 1O7MA 1BCCE 2D2CD 1WQLA 1KYOE 2A06E 1ULIA 2XSHA 2FYUE 1EZVE 2HMMA 2XRXA 4AIVA 4HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJP C;  2DE5 D;  2ZYL A;  2NVG A;  2Q3W A;  4HM4 A;  1SQX E;  2BMQ A;  1NDO A;  3DQY A;  1ZRT E;  3VCP A;  3N0Q A;  3GL2 A;  2B24 A;  2NVF A;  1BE3 E;  3GZX A;  3GZY A;  4PV1 D;  3H1I E;  3CWB E;  3GB4 A;  3D89 A;  1L0L E;  1G8K B;  2BMO A;  1UUV A;  2CKF A;  2ZT9 D;  3VMG D;  4H0L D;  1G8J B;  4HM2 A;  4NBG D;  1UUW A;  4QDC A;  4HM7 A;  3VCA A;  4QCK A;  4NBA D;  1KB9 E;  1O7P A;  4U3F E;  1L0N E;  1SQP E;  4NBF D;  4OGQ D;  4QDF B;  1PPJ E;  2JZA A;  3H1J E;  4HM5 A;  2GBW A;  1EG9 A;  2E74 D;  1RFS A;  3L75 E;  2XR8 A;  3H1L E;  1ULJ A;  1O7G A;  1O7H A;  2YFJ A;  1SQQ E;  5KLV E;  3GOB A;  2YVJ B;  1VM9 A;  4QUQ A;  1O7W A;  4HM3 A;  4QDD A;  2YFI A;  4NBD D;  4QUR A;  4H13 D;  1JM1 A;  1PP9 E;  4QUP A;  3C0D A;  2E4Q A;  4NB9 D;  1Q90 C;  3L74 E;  2QPZ A;  3VMH D;  3AZC A;  2BCC E;  2E76 D;  3GCE A;  3GTE A;  3CXH E;  4NBH D;  5AEU A;  4EMJ B;  3GKE A;  3H1K E;  2NVE A;  1NTZ E;  4PD4 E;  1VF5 D;  2HMJ A;  4HM6 A;  2NWF A;  4P1B H;  1VCK A;  1BGY E;  2HML A;  3L73 E;  4HM1 A;  5BOK A;  2I7F A;  3L70 E;  3L71 E;  2FYN C;  4HJL A;  1SQB E;  2HMN A;  4NB8 D;  3BCC E;  3L72 E;  2E75 D;  2JO6 A;  2GBX A;  5AEW A;  1SQV E;  3TGU E;  1P84 E;  3H1H E;  2YIU C;  4NBE D;  1NTK E;  5KLI C;  1O7N A;  4H44 D;  4D6T E;  2IBZ E;  3FOU A;  4NBC D;  3EQQ A;  2DE7 D;  1NYK A;  2HMO A;  2YFL A;  2DE6 D;  4P1C H;  5CXM A;  2QJK C;  2B1X A;  2XSO A;  3GL0 A;  3CX5 E;  2NUK A;  2QJY C;  3GTS A;  3EN1 A;  1NTM E;  5KKZ C;  4AAY B;  1NU1 E;  5HL4 A;  3VMI D;  1RIE A;  2NUM A;  4HM0 A;  2HMK A;  2BMR A;  1SJG A;  1FQT A;  2E4P A;  4QDF A;  4NBB D;  4HKV A;  1O7M A;  1BCC E;  2D2C D;  1WQL A;  1KYO E;  2A06 E;  1ULI A;  2XSH A;  2FYU E;  1EZV E;  2HMM A;  2XRX A;  4AIV A;  4HM8 A; 
#chains in the Genus database with same CATH topology
 5CCG D;  1CW5 A;  2Y9Z A;  1KFN A;  3H1J J;  2BMQ A;  2WSS H;  2YNY A;  3GL2 A;  1BE3 E;  1NOH A;  3K5B A;  3UIA A;  3P32 A;  4HKZ H;  1VQL P;  4L74 A;  4K35 A;  3CX5 I;  2O01 J;  4W80 A;  2AXC A;  2H8P D;  3CWB G;  4OGQ B;  4PV1 C;  2FYZ A;  2YO3 A;  3KHU A;  1VQ9 P;  3ZDM A;  3OW2 O;  2WT7 A;  2QM8 A;  2QPZ A;  3GTE A;  4NBH D;  1AQT A;  3HRN A;  2K3R A;  2QSI A;  4WB4 A;  4PJ0 E;  1S72 P;  1SQB D;  1RE4 C;  1ZW0 A;  2I1J A;  1W2B O;  2IFN A;  3A7O A;  1KMI Z;  2W6B A;  2Z4E A;  3CMA P;  1FAV A;  3A0H E;  4L73 A;  3RL0 D;  1VQ4 P;  1M90 Q;  3CCE P;  1GU4 A;  3PTZ A;  3D6Y A;  3BRT B;  3KQG A;  5KLI B;  5KLV K;  1YTZ T;  3CCJ P;  2FXM A;  3OAK A;  3VMI D;  3JSV C;  2E4P A;  2R44 A;  4HKV A;  2QJY B;  2R3S A;  2FYU E;  3NFQ A;  3WU2 H;  2KK7 A;  2ZXX A;  1OXZ A;  3GZY A;  4PV1 D;  3GG2 A;  5GTH H;  5KLV J;  3VMA A;  1M57 D;  3BVH A;  2LXB A;  1FZG A;  2RN0 A;  4LLH A;  1PPJ D;  4ASV A;  4WY4 A;  1SQX G;  2FBW C;  4EDF A;  4R4L A;  1URQ C;  5APT A;  4TT3 H;  2CPB A;  3AEG C;  2ZT9 C;  3P7K A;  2WVR A;  1RH5 B;  5CBN A;  5CCH C;  3CME P;  5B5E H;  1RE4 A;  1IK9 A;  2B87 B;  2I8D A;  3IR9 A;  2WSE J;  4ZMD A;  2FFD A;  3E7K A;  4OGQ C;  3H1J G;  3Q5P A;  1H8A A;  2ZXE B;  2E74 C;  5L8R J;  5CJ0 A;  2NRG A;  4PD4 E;  1GL2 B;  1R5L A;  3PRJ A;  5AVY B;  3F89 A;  3TGU D;  2HML A;  3L70 E;  1JY3 N;  1OZH A;  2GBX A;  4DCK A;  1DD4 A;  1VL2 A;  1NTK E;  3V5B A;  4BXL A;  3CX5 D;  3EFG A;  3A0B H;  1NU1 D;  1KV4 A;  3N7N A;  3WUU A;  5AW3 B;  2SPZ A;  4WBA A;  4HM0 A;  2K37 A;  4UB6 E;  1PGP A;  2E42 A;  4HM8 A;  1X79 B;  3TNU B;  2ZYL A;  1LTT C;  1HBW A;  3MD0 A;  1JY2 P;  1G1J A;  3S9O A;  1URQ A;  1S3J A;  1URQ D;  3MGN A;  2QJP B;  2ZT9 D;  5CCH A;  5CHX A;  5CCH D;  1UUW A;  1J1E B;  1T2K C;  1O7P A;  4DZO A;  2IYO A;  4OGQ D;  4I1L A;  2JKV A;  3CCU P;  1EG9 A;  3CPW O;  2E74 D;  3RK2 B;  1EDL A;  3RGU A;  4QUQ A;  1AQ5 A;  4QDD A;  1L0N D;  3BCC J;  1FZB A;  1IFM A;  3L74 E;  2M8R A;  2XV5 A;  1ZOY C;  4N3Y B;  4BRY B;  3HTK A;  5KLV G;  3B8E B;  3PJS K;  1Q7Y Q;  4UB8 E;  1KYO H;  1R5S A;  3L73 D;  1PFI A;  1EXJ A;  2OTJ P;  3KZI H;  3SSU A;  2KNC B;  2W27 A;  1CSB A;  1N8R Q;  3AED C;  1AV1 A;  4RES B;  1NJI Q;  3O8Z A;  1GL2 C;  1GD2 E;  3EQQ A;  1L4A B;  2OTK E;  3O6Q A;  1NHL A;  1EQ7 A;  5KJ7 C;  1N73 A;  1BCC D;  2IDB A;  3L4F A;  3H1H D;  3L36 A;  1EDJ A;  4U3F J;  2N9Y B;  1HGV A;  2P1J A;  1X8Y A;  3GF7 A;  1T2K D;  3IAO A;  1ZR2 A;  1L0L D;  1NTZ K;  4B86 A;  1EXI A;  3RBX A;  3AEC C;  5BU8 B;  1SS1 A;  2KP8 A;  3NXS A;  2JWA A;  4HJG H;  1AVO A;  5C39 A;  1L0N E;  1OVV A;  4NBF D;  4W7Z A;  2FXP A;  2UWJ E;  3H1I D;  1SQQ D;  2Q9I A;  1SFC C;  3L75 E;  2WSC H;  1ZLL A;  1OWA A;  1NO4 A;  1NTZ J;  1LT9 C;  2BAS A;  2YVJ B;  5AVS B;  4I6M C;  2YFI A;  2OTL P;  2HPC B;  5AVU B;  3D6Z A;  1BDD A;  1AJY A;  4GOD A;  5APW A;  1T6A A;  3VMH D;  2JWD A;  1GZL A;  3PH0 A;  3CCM P;  2VRS A;  1GL2 D;  4EMJ B;  1KYO I;  1FC2 C;  3H1K J;  2KSE A;  1VCK A;  2Y0E A;  4H13 C;  5KJ7 A;  5KJ7 D;  1EDK A;  3L71 E;  1PIX A;  1H0T A;  1PL5 A;  1JY3 O;  1LP1 A;  3H1H E;  1Q82 Q;  2WT7 B;  3OA7 A;  5AW5 B;  1S1C X;  4P1C H;  1LTJ C;  2PRR A;  2DW3 A;  1BE3 J;  1OW8 A;  3BCC G;  2HLO A;  5HL4 A;  1VQ5 P;  1RIE A;  3VYI A;  1KQF B;  2XKM A;  2WSF H;  5KKZ B;  1ZP0 C;  3IFM A;  1ZRT D;  4Y28 J;  4KHX A;  3VP9 A;  1UII A;  3TK1 A;  2WTY A;  2ZYA A;  1SFC A;  2NVF A;  5DJT B;  3H1I E;  3RL0 B;  1SFC D;  2AXT H;  1YIJ P;  3VMG D;  5GTI H;  2M3E A;  5AVV B;  1FZF A;  1RY3 A;  3FXD A;  2FY8 A;  1SLQ A;  3GHG A;  1JY2 N;  3M0D C;  1FJK A;  1XTG B;  3OJA B;  1YYC A;  2YMK A;  4U3F G;  3WU2 E;  3BAS A;  4H13 D;  1PP9 E;  5DJU B;  4EOT A;  2R3C A;  1KD1 Q;  3GCE A;  3VP8 A;  2MKV A;  3G3Z A;  2YKQ A;  1SP4 A;  5GTH E;  1FOS F;  5AW2 B;  2NPS C;  4P1B H;  1KZU B;  1SQV D;  4XE5 B;  4HM1 A;  2IBZ D;  3EQ2 A;  1A02 F;  2FYU J;  4D6T E;  1NTZ G;  4NBC D;  3G4S P;  1IFN A;  2DE6 D;  2W6J H;  1HF9 A;  3EN1 A;  1JEK A;  2OAR A;  4GKG A;  4IFM A;  1YIT P;  2C9N Y;  2KLV A;  2Z5H A;  2IZ0 A;  4W7Y A;  3AE3 C;  3AE9 C;  1OW7 A;  2WSE H;  3H1K G;  1KFM A;  3CWB D;  2Q3W A;  2KS1 B;  4JBZ A;  1HJB A;  1VPC A;  1T8Z A;  3CXH H;  3AE2 C;  1KYO D;  4NBG D;  3VMY A;  3H32 A;  3V4Q A;  1SQP E;  3KDP B;  3GF3 A;  3Q2Y A;  1BE3 G;  4O9B A;  4GOE A;  2K9Y A;  2WMM A;  1Y47 A;  4Z1M H;  2Y0C A;  4A7P A;  2NPS A;  1WT6 A;  2NPS D;  2W8Z A;  3LW5 J;  3HE4 A;  1URQ B;  1HVV A;  4NBD D;  3L70 J;  2ZT9 B;  1M56 D;  4I2L C;  1NTK J;  2BCC E;  2QA4 P;  3AZC A;  1U7M A;  2E5Y A;  1DH3 A;  1KB9 H;  3CCR P;  1CZQ A;  2QM7 A;  2HG5 D;  3SWK A;  2NVE A;  5AVR B;  2E74 B;  2KSJ A;  1LTI C;  2QG4 A;  3II6 A;  1BGY J;  2HFE D;  2M5A A;  1YHQ P;  1NAF A;  4WY4 C;  2JO6 A;  2JEE A;  1E5W A;  5AW0 B;  1NKZ B;  1N7S A;  2R5D A;  1DIP A;  3HUS A;  2HMO A;  2YFL A;  2WPQ A;  2OGU A;  3CD6 P;  1DX7 A;  3GL0 A;  1JB0 J;  4HH2 A;  3VMX A;  4L75 A;  3L72 D;  4JYB A;  3USS A;  2E75 C;  2FFD C;  1N7L A;  4OWF A;  3Q1M A;  1SQX D;  1KYO E;  2A06 E;  2HMM A;  3KZI E;  3MP7 B;  3S4R A;  1FS0 E;  3CCL P;  3N0Q A;  2B24 A;  4KJM A;  3CXH I;  3D89 A;  3TDK A;  2FYU G;  3U1A A;  5AVQ B;  4KT0 J;  1MKM A;  3FWL A;  1N73 B;  3H1J D;  3L74 J;  2IYP A;  1KQS O;  2A45 G;  2GBW A;  3KYQ A;  1JY2 O;  2XR8 A;  1K73 Q;  3M91 A;  2WPR A;  2YFJ A;  1YJ9 P;  2AEM A;  3I56 P;  2W6A A;  1EZV G;  1KOR A;  4AYC A;  3FXE A;  1FE6 A;  3SWY A;  3M0A A;  2B88 A;  4WY4 D;  2E76 B;  1KB9 I;  2GA1 A;  1FU1 A;  1IFJ A;  1OFC X;  1QVG O;  2V4H A;  3IN6 A;  2OYH C;  1SQB E;  3L72 E;  2E75 D;  1L0N K;  2QRX A;  1JM0 A;  4AUW A;  3BRV B;  3AE4 C;  4XFJ A;  4NBE D;  4C7N A;  3MIW A;  1GTW A;  3FOU A;  2B89 A;  1LTB C;  2NZ2 A;  3L70 G;  4WVZ A;  3A5T A;  2KUB A;  3AE7 C;  1NTK G;  1GMJ A;  1GW3 A;  1SJG A;  1JNM A;  3U1C A;  1VQP P;  1KC8 Q;  5BU5 A;  2XRX A;  1H0T B;  3I5C A;  3SFD C;  1LP1 B;  1GW4 A;  3L75 J;  1XTC C;  1BGY G;  2K88 A;  3JCU H;  1PGJ A;  2XND H;  3Q5R A;  3CCV P;  1K04 A;  2W83 C;  3B4S A;  4I7Z B;  2RH0 A;  2YXQ B;  1PPJ E;  5KLV D;  3SFE C;  3E1I A;  4RKU J;  1P84 H;  1L0L K;  1QGK B;  1G2C A;  1O7G A;  1N73 C;  1LWU A;  4ZKP A;  1YQ3 C;  4YXW H;  1SFC B;  1GDT A;  3C1L A;  3L71 J;  2K9J A;  2CPS A;  1JTH A;  2OYH A;  1LT9 B;  2P2U A;  1ZXG A;  5AW8 B;  4ASW A;  2AXT E;  1Q86 Q;  3AEA C;  5GTI E;  3HD7 C;  5APY A;  1S5L H;  1FDO A;  3GHG B;  3L74 G;  4C7R A;  5TJH A;  3TSI A;  1M8O B;  2AEJ A;  2OQQ A;  1LGH B;  2E76 C;  3CXH D;  5APV A;  3TGU E;  3HE5 A;  4H13 B;  1O7N A;  1KIL C;  1D7M A;  2H88 C;  1QL2 A;  2B1X A;  3CX5 E;  3WMM 0;  2ZVO B;  3N4X A;  1NU1 E;  2J59 M;  1LTJ B;  2HMK A;  2PP6 A;  3V2P A;  1Y9B A;  1JOC A;  1ULI A;  3P8C D;  3U59 A;  4HM4 A;  1GU5 A;  5KAI H;  1NTM D;  1PV3 A;  1NWQ A;  1RF1 C;  1KB9 D;  1G8J B;  1PP9 J;  1DEE G;  1UIX A;  1BSN A;  4DT0 A;  3NTN A;  1KTM A;  1Z56 A;  3AEF C;  3FGA D;  1P84 I;  1J1D C;  2V7Q J;  4I7Z C;  3HD7 A;  2IBZ I;  4H0L C;  3HD7 D;  2A45 H;  1JM1 A;  1S4X A;  3L75 G;  2E76 D;  1QLE D;  4D6T J;  3CXH E;  1KIL A;  2YMY A;  3H1L D;  1KIL D;  1IFI A;  2GM4 A;  3R2P A;  1X22 A;  2IZ1 A;  3BCC D;  2P10 A;  3H6P A;  5B66 H;  1Y8A A;  3L73 E;  1H89 A;  2I7F A;  3W67 A;  2JDI H;  2NPS B;  2K1A A;  5AEW A;  1SQP K;  3HE4 B;  1AVY A;  2KB7 P;  2G3A A;  1TU3 F;  3GHG C;  5CXM A;  1VQ8 P;  1VF5 C;  2QIW A;  2B87 A;  3P8C E;  2OYI C;  3CCS P;  1RE3 A;  2QVA A;  3L71 G;  1N86 A;  1NTM E;  5APU A;  3Q5S A;  1RF1 A;  5BVZ A;  1U57 A;  4PD4 H;  3FX0 A;  3PLN A;  1O7M A;  3AE5 C;  1BCC E;  2R5B A;  3V2R A;  1WQL A;  2XSH A;  1SQP J;  2M5A B;  2PFX A;  2O01 H;  3WUV A;  3VCP A;  1N7S B;  1NVO A;  1M1J C;  3GB4 A;  3CLQ A;  1L0L E;  4AQR D;  3I55 P;  3R4Y A;  4H0L D;  4HM2 A;  2PGD A;  3MHV A;  4NBA D;  4OH8 B;  2BCC J;  4BWN A;  1R8E A;  1JO5 A;  4UB6 H;  1VDF A;  4CPG A;  4ZKU A;  1VQN P;  3P8M C;  3H1L E;  2POH A;  1SQQ E;  1VQO P;  5KAF H;  1BDC A;  1FDI A;  2A45 I;  1Q90 C;  1JCD A;  1NTZ D;  2R32 A;  2IX7 C;  1M7L A;  1EZV I;  1VF5 D;  2O01 N;  2OYI A;  2YXR B;  2NWF A;  1PP9 G;  2AEF A;  1KQG B;  2JP3 A;  3V2Q A;  1RF0 C;  1H88 A;  2WIT A;  2YIU C;  2KLU A;  1T3U A;  3H1K D;  2QJK C;  4WY4 B;  1YBK A;  1M1J A;  4UB8 H;  2NUM A;  2BMR A;  1P84 D;  1MUU A;  4D6T G;  2Q3I A;  4PD4 I;  4QDF A;  3M9Q A;  3PP5 A;  2KZJ A;  2I1K A;  2E75 B;  4NPD A;  1BE3 D;  2FFD B;  2NVG A;  1FOS E;  5B5E E;  2KOG A;  1ZRT E;  4C7N B;  1MFT A;  3C8V A;  3L35 A;  2CKF A;  2D2C C;  1SQB K;  1FZA A;  1JY3 P;  2FKW B;  3ITK A;  1N7S C;  3HUS C;  1Q90 D;  1IFP A;  1SQX K;  3KXD A;  5TIS H;  1K05 A;  3CC2 P;  1ULJ A;  3GOB A;  1VM9 A;  5E79 H;  1O7W A;  1J2J B;  1SQP G;  1JCC A;  3W68 A;  1SQB J;  4QUR A;  3A0B E;  2ZYG A;  3L72 J;  2LKM A;  1RF0 A;  1OVR A;  2WSC J;  1ZN5 A;  4Y99 C;  3H25 A;  3V2N A;  4JF7 A;  3M06 A;  4TLF A;  1LT1 A;  2KYV A;  3H1K E;  2OYO A;  3VTP C;  2BCC G;  1FZC A;  1HH0 A;  1G2C B;  1QL1 A;  1LWU B;  1SQV E;  1P84 E;  5H2F H;  3GLM A;  2IBZ E;  2K9J B;  1JTH B;  2OYH B;  2Q7C A;  2P67 A;  1NKN A;  3M9H A;  3NMD A;  4GOF A;  4JPZ B;  5AVW B;  4IL6 X;  2HPC A;  4DOJ A;  4IOI H;  2G8Y A;  1EC5 A;  2FYU D;  3WUT A;  4NBB D;  3RL0 g;  2D2C D;  1QEX A;  5EFW B;  3AE6 C;  1S5L E;  2HOD A;  1N7S D;  3HE5 B;  1HTL C;  4M3L A;  2WZ7 A;  3CWB E;  2WSF J;  3HTK B;  4GDO A;  1G8K B;  2BMO A;  2A06 G;  4LGD E;  1EZV D;  4QDC A;  1GK4 A;  5AW6 B;  2ITA A;  2JZA A;  1CI6 A;  2WQY C;  2ZJS E;  2E43 A;  3BAT A;  1HUC A;  2Q6Q A;  1NU1 K;  4K3A A;  3O6Q B;  2L91 A;  3IF4 A;  2C0W A;  4QUP A;  5KAI E;  3TGU J;  2BEQ D;  3RBZ A;  4PD4 D;  5AW1 B;  3T97 A;  2GUV A;  2XDJ A;  1OIP A;  2B9B A;  4HB1 A;  1QX8 A;  1S5L X;  2M3B A;  3L70 D;  2KIK A;  1USE A;  1NU1 J;  1FDM A;  1NTK D;  2BEZ F;  2HMN A;  3HD7 B;  1IZN B;  3SWF A;  1ZR4 A;  2N1T C;  1NYK A;  2ZYD A;  3B5N C;  3AE8 C;  1KN7 A;  4OVN F;  1BGY D;  2NUK A;  1KIL B;  1LWU C;  1SQB G;  3RK3 B;  3L72 G;  4N78 D;  1JMB A;  1ZV8 A;  2M0B A;  2V7Q H;  1JUN A;  2XZR A;  2CK3 H;  4QMA A;  1RQU A;  1EZV E;  3Q3D A;  1LTA C;  1WMK A;  2C9L Y;  5B66 E;  1QVF O;  1SQX E;  3EFF K;  3DQY A;  4ZNC A;  3S1K A;  4LC1 A;  2E5T A;  4IL6 H;  1IK7 A;  4U7J A;  3A3Y B;  1GK6 A;  2ZAE B;  2P58 A;  4HM7 A;  1RF1 B;  1LJ2 A;  1L0N J;  2ZFC A;  3H1J E;  1W2E A;  2LR2 A;  1S9K D;  3MUD C;  1NH4 A;  1NTM K;  1O7H A;  1Q2N A;  3QWO C;  3L74 D;  4HM3 A;  2QE7 H;  3L73 J;  1VQK P;  2O1K A;  1PPJ G;  1HWT C;  2KS1 A;  1J1D B;  1G1I A;  1LTS C;  2E4Q A;  4NB9 D;  4H0L B;  5APS A;  1HJ0 A;  4YPC A;  2N1T A;  2N1T D;  3B5N A;  1IO4 A;  3B5N D;  1NGM B;  1NTM J;  1BGY E;  5BOK A;  1VQ6 P;  4N78 E;  1BCC J;  5KLI C;  3H1H J;  2ZVN B;  1OX3 A;  1M1K Q;  2WPS A;  2WWW A;  1YQ4 C;  5KAF E;  2QJY C;  3GTS A;  1SQQ K;  1L0L J;  2MJZ A;  4AAY B;  5APQ A;  3TGU G;  1PGQ A;  1VF5 B;  1MV8 A;  5AW4 B;  2OYI B;  1OVU A;  2XNX A;  2YO2 A;  1YJW P;  3CCQ P;  4YTP C;  1MFZ A;  3RK3 C;  1IFD A;  1NU1 G;  1LNQ A;  2IFM A;  1Q81 Q;  5AW7 B;  1RHZ B;  3MUD A;  3GZX A;  3H1L J;  5K5G B;  3H1I J;  1SQQ J;  3C9I A;  1S9K E;  3TYY A;  4PJ0 H;  2QEX P;  1KQL A;  1VQ7 P;  3D71 A;  2O3J A;  1M1J B;  4JYC A;  4QCK A;  4DJG A;  3CC7 P;  3L75 D;  4QDF B;  4WWI A;  1RE3 C;  3AEB C;  5KLV E;  3A0H H;  5M1B A;  5CJ4 A;  5AVZ B;  1DEB A;  3FWN A;  3B71 A;  1WRG A;  2RKL A;  2P7J A;  1NAY A;  3V6I A;  1PZQ A;  2W90 A;  1T3J A;  2HMJ A;  3L71 D;  2FXO A;  3MTU E;  1L0N G;  5AW9 B;  4JQ0 D;  5TIS E;  1AFO A;  4XA4 A;  4L76 A;  1PGO A;  3VOP A;  2DE7 D;  3H32 B;  4H44 B;  5E79 E;  2XSO A;  3RK3 D;  3L73 G;  2H7H A;  3CI9 A;  2YIU B;  4R4M A;  3GMA A;  2QJK B;  3LID A;  2Q5U A;  3AE1 C;  3JC2 2;  3TF5 A;  1FZC B;  1A02 J;  4AIV A;  2QJP C;  2DE5 D;  1NTM G;  1EDI A;  1YTZ I;  1MZ9 A;  3ABV C;  1J1E C;  1VQM P;  1BCC G;  3AEE C;  5H2F E;  2KXP B;  1IJD B;  2KZI A;  3H1H G;  1AA0 A;  4IFF A;  1SQV K;  2L5G B;  2XU6 A;  1KB9 E;  2WPV B;  3LW5 H;  5KTB A;  1OMI A;  3RK2 C;  2D2C B;  1GL2 A;  1L0L G;  5APX A;  4MN4 C;  1SVF A;  2HOD B;  3V4W A;  3HUS B;  1YI2 P;  1USD A;  1PP9 D;  3VMZ A;  2Z5I A;  2JJL A;  4U3F D;  1JMM A;  1OW6 A;  2HR3 A;  3QH9 A;  3L37 A;  1SQV J;  1BSH A;  3H1L G;  2FYN B;  3H1I G;  1SQQ G;  3G6E P;  3CC4 P;  4Y99 B;  1CI6 B;  1KIL E;  4RO0 A;  3RK3 E;  2H89 C;  2Q3E A;  4NPF X;  4D6T D;  1L4A C;  3VN0 A;  3MZW B;  4HJL A;  4NB8 D;  3BCC E;  3TNU A;  1N2D C;  1FJP A;  5CMZ A;  3M9B A;  3EWK A;  1IC2 A;  2Y9Y A;  4GT1 A;  3LIE A;  3T97 B;  1RQV A;  1LT9 A;  3CWB J;  1X0T A;  1NYH A;  1W5C E;  5AVT B;  1K8A Q;  1HGZ A;  2J58 A;  4RJT A;  3G9R A;  4H44 C;  4IFD K;  1FBM A;  3D70 A;  3RK2 D;  1NDO A;  4GIF A;  1K9M Q;  4PV1 B;  1UUV A;  2C0X A;  1FZC C;  3CX5 H;  3A2A A;  1SQP D;  1DD3 A;  4BRY A;  2FYU K;  3VCA A;  2J5U A;  5CCG C;  4U3F E;  4C46 A;  2JR8 A;  4EYY Q;  3PHL A;  2Q1K A;  3E1R A;  2N9B A;  4HM5 A;  2KNC A;  3GW6 A;  1LTJ A;  1RFS A;  2LXC B;  2KI7 B;  4EIJ A;  2HYN A;  2BCC D;  4HYT B;  3C0D A;  1L4A A;  1L4A D;  2IPP A;  2RMZ A;  1E79 H;  4EI2 A;  4IL6 E;  3CL3 D;  5AEU A;  1ZME C;  1YJN P;  3GKE A;  2JO1 A;  1X9V A;  1NTZ E;  4HM6 A;  2GUS A;  4N6J A;  2YKO A;  3KPE A;  4YXD C;  2FYN C;  5AVX B;  2H43 A;  1FZE A;  4H44 D;  3JCU E;  2O1J A;  1S2E A;  4NPE A;  2Y0D A;  1SQX J;  3M0D A;  1U7J A;  2N1T B;  2PAJ A;  2YKP A;  5KKZ C;  1LTG C;  1SQV G;  1L2P A;  2A06 D;  3B5N B;  1FQT A;  2IBZ G;  1NTK K;  3F5H A;  5CBO A;  3G71 P;  5CCG A;  3RL0 C; 
#chains in the Genus database with same CATH homology
 2QJP C;  2DE5 D;  2ZYL A;  2NVG A;  2Q3W A;  4HM4 A;  1SQX E;  2BMQ A;  1NDO A;  3DQY A;  1ZRT E;  3VCP A;  3N0Q A;  3GL2 A;  2B24 A;  2NVF A;  1BE3 E;  3GZX A;  3GZY A;  4PV1 D;  3H1I E;  3CWB E;  3GB4 A;  3D89 A;  1L0L E;  1G8K B;  2BMO A;  1UUV A;  2CKF A;  2ZT9 D;  3VMG D;  4H0L D;  1G8J B;  4HM2 A;  4NBG D;  1UUW A;  4QDC A;  4HM7 A;  3VCA A;  4QCK A;  4NBA D;  1KB9 E;  1O7P A;  4U3F E;  1L0N E;  1SQP E;  4NBF D;  4OGQ D;  4QDF B;  1PPJ E;  2JZA A;  3H1J E;  4HM5 A;  2GBW A;  1EG9 A;  2E74 D;  1RFS A;  3L75 E;  2XR8 A;  3H1L E;  1ULJ A;  1O7G A;  1O7H A;  2YFJ A;  1SQQ E;  5KLV E;  3GOB A;  2YVJ B;  1VM9 A;  4QUQ A;  1O7W A;  4HM3 A;  4QDD A;  2YFI A;  4NBD D;  4QUR A;  4H13 D;  1JM1 A;  1PP9 E;  4QUP A;  3C0D A;  2E4Q A;  4NB9 D;  1Q90 C;  3L74 E;  2QPZ A;  3VMH D;  3AZC A;  2BCC E;  2E76 D;  3GCE A;  3GTE A;  3CXH E;  4NBH D;  5AEU A;  4EMJ B;  3GKE A;  3H1K E;  2NVE A;  1NTZ E;  4PD4 E;  1VF5 D;  2HMJ A;  4HM6 A;  2NWF A;  4P1B H;  1VCK A;  1BGY E;  2HML A;  3L73 E;  4HM1 A;  5BOK A;  2I7F A;  3L70 E;  3L71 E;  2FYN C;  4HJL A;  1SQB E;  2HMN A;  4NB8 D;  3BCC E;  3L72 E;  2E75 D;  2JO6 A;  2GBX A;  5AEW A;  1SQV E;  3TGU E;  1P84 E;  3H1H E;  2YIU C;  4NBE D;  1NTK E;  5KLI C;  1O7N A;  4H44 D;  4D6T E;  2IBZ E;  3FOU A;  4NBC D;  3EQQ A;  2DE7 D;  1NYK A;  2HMO A;  2YFL A;  2DE6 D;  4P1C H;  5CXM A;  2QJK C;  2B1X A;  2XSO A;  3GL0 A;  3CX5 E;  2NUK A;  2QJY C;  3GTS A;  3EN1 A;  1NTM E;  5KKZ C;  4AAY B;  1NU1 E;  5HL4 A;  3VMI D;  1RIE A;  2NUM A;  4HM0 A;  2HMK A;  2BMR A;  1SJG A;  1FQT A;  2E4P A;  4QDF A;  4NBB D;  4HKV A;  1O7M A;  1BCC E;  2D2C D;  1WQL A;  1KYO E;  2A06 E;  1ULI A;  2XSH A;  2FYU E;  1EZV E;  2HMM A;  2XRX A;  4AIV A;  4HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...