3L72E

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 36
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l72E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l72E02
1O7MA 2XSOA 2HMMA 4H44D 1PPJE 4HM3A 3VCAA 2B24A 1O7PA 3GOBA 3H1JE 4P1BH 3GL2A 2B1XA 1SQVE 4QCKA 5HL4A 1P84E 3L70E 3H1IE 1O7HA 1VCKA 2GBWA 5KLVE 2DE5D 2A06E 1VM9A 1SQQE 1SJGA 2E4QA 2JO6A 3AZCA 4NB8D 2XR8A 1G8KB 4NBHD 2ZT9D 2XSHA 2YIUC 2NUKA 3D89A 1ZRTE 4H0LD 4HM0A 3GZXA 3GKEA 3L75E 2JZAA 4PV1D 4U3FE 2DE7D 3VMHD 1KYOE 5BOKA 2BMRA 4OGQD 3GL0A 3FOUA 1BGYE 4NBBD 2YFIA 3GZYA 1KB9E 1UUWA 4NBFD 4EMJB 4P1CH 2HMOA 2YVJB 1Q90C 4HM5A 1NU1E 4PD4E 2Q3WA 1G8JB 4HM2A 4AAYB 3CWBE 4NBDD 4AIVA 2I7FA 2QJKC 2HMJA 1NTME 5KLIC 1BCCE 2FYNC 1L0LE 3H1KE 2HMKA 4HM6A 5KKZC 4NBAD 1VF5D 1WQLA 3GTSA 3CX5E 2D2CD 4NB9D 2NUMA 3VCPA 3L74E 3GB4A 2QJPC 2QPZA 4HM7A 2FYUE 1SQPE 2NVFA 3VMGD 3VMID 2E75D 3TGUE 1UUVA 1O7GA 2YFLA 1NYKA 3CXHE 2QJYC 2E4PA 4QDCA 1ULJA 4HM4A 2E76D 1RFSA 1NDOA 5AEUA 3GTEA 2BCCE 1O7NA 1SQXE 2NWFA 1JM1A 4H13D 1EG9A 4NBGD 1NTZE 3H1LE 3BCCE 4HKVA 1RIEA 2XRXA 4QDFA 3GCEA 2NVGA 2CKFA 3EQQA 4QURA 1PP9E 3L71E 1ULIA 1SQBE 4HJLA 1NTKE 2IBZE 3N0QA 4QDDA 2YFJA 3DQYA 4QUQA 5CXMA 2BMOA 3H1HE 3C0DA 2HMNA 3L72E 1L0NE 1BE3E 1FQTA 2E74D 4QDFB 2GBXA 2DE6D 4NBCD 5AEWA 2HMLA 4HM8A 2NVEA 1EZVE 1O7WA 4QUPA 3EN1A 2ZYLA 4D6TE 2BMQA 3L73E 4HM1A 4NBED
chains in the Genus database with same CATH superfamily
3N4XA 1SLQA 2E43A 1S5LH 2H88C 3A5TA 3M06A 2K9YA 5GTHH 4MN4C 1S72P 3II6A 1KTMA 5BOKA 1BDCA 4ZMDA 2J5UA 3C1LA 1UUWA 1SQXG 2R3CA 4AYCA 1YQ3C 3HE4B 1EXIA 1URQB 2QJYB 1RF1B 1HUCA 3HE5B 5KLIC 1M57D 1IFNA 3RL0B 4NB9D 1U7MA 1CI6B 3L72J 3F5HA 4GOFA 5APTA 1X79B 3PTZA 1SQXK 3TGUE 1UUVA 3L36A 1GU4A 3H1KG 2A06D 5TISH 3B5NA 3F89A 5CCGA 3FX0A 3TK1A 3A2AA 2QM7A 2XRXA 2LXBA 1JMBA 1VDFA 3TGUD 3AE3C 3OJAB 3GLMA 1FU1A 5M1BA 4QDFB 2GUVA 1FAVA 2P67A 1K04A 1IO4A 2HPCA 2ZYLA 3O6QA 4NPDA 3M9HA 3GTSA 2XNDH 4HKZH 1J1EB 1YJ9P 1PPJE 2YKQA 1HWTC 3A3YB 2K9JB 1A02F 1IZNB 2CPBA 1GU5A 4RJTA 3CXHD 5KLIB 2KS1A 2O01J 3L75E 2M0BA 1ZXGA 1HJ0A 1T3JA 1PPJD 3GZYA 1GZLA 1NGMB 1JY2N 2WPSA 1DD3A 5L8RJ 2ZVOB 2IFNA 1PP9J 4NBAD 1VF5D 1WQLA 2RN0A 1RE4A 3L73D 3GB4A 2N9YB 3VYIA 1PGPA 1VF5C 3MHVA 3TDKA 3AE4C 3L35A 3KHUA 3CLQA 2E5TA 1W2BO 2PP6A 2YKOA 1JY2O 4R4LA 5AW1B 3G71P 5APYA 2BCCE 5AVYB 1R5LA 4RO0A 1U7JA 1S5LX 2WSSH 3GCEA 2NVGA 1YITP 1BGYD 1SQBE 3L75G 4KT0J 4N3YB 3N0QA 1HBWA 5CXMA 3VMAA 2KP8A 3MUDA 2JEEA 2NVEA 1N73C 5H2FE 4NPEA 2W6AA 1SQBD 3KDPB 3OAKA 2Y9ZA 2C0XA 5KLVE 3E1RA 3PRJA 3EQ2A 3HUSA 3AEFC 1FOSE 2DE7D 1G2CB 2B87A 3P8MC 2N1TD 2ZFCA 3EFFK 4LGDE 4NBFD 2BCCG 4AAYB 1VF5B 4N78E 3LIEA 1NO4A 3H1LJ 2N1TC 2ITAA 5APQA 1NTME 1SQBG 5KKZC 1JY2P 5DJUB 5C39A 2OYOA 2JP3A 5AVSB 2L5GB 2IFMA 3GF3A 3VMID 5KAFE 1N7SC 2KYVA 2NPSA 1DIPA 1NTMD 3M0DA 1VPCA 1ZP0C 3L4FA 5KJ7A 5KLVG 1N73B 1MKMA 5K5GB 2CKFA 4OWFA 2J59M 1KB9D 4GOEA 1QVGO 1CW5A 1FQTA 1LP1B 2GBXA 3Q5PA 4NBCD 1IJDB 3EN1A 5KLVK 1O7MA 3GOBA 1GK6A 2B1XA 1SQVE 1VCKA 1GL2D 4NB8D 3IAOA 1JO5A 2KNCB 2N1TB 1DX7A 2IBZG 2KLUA 2JJLA 3BASA 5KKZB 1GL2C 1JY3N 1PZQA 1KYOE 3VMYA 1RQVA 1SQVD 3A0BE 3RGUA 4NBDD 2OTKE 1N7SB 3B8EB 4DCKA 2HMJA 1LT1A 3E1IA 1GMJA 4YXDC 4JYBA 3I55P 2QVAA 3MZWB 1S1CX 1JY3O 3Q3DA 2OGUA 1UIIA 3A7OA 1H0TB 1QL1A 1KFNA 1Q7YQ 5AVQB 3KXDA 4H13D 4C7NA 1RF0C 3BCCE 4XFJA 1FZCC 2M3EA 3M9BA 1LJ2A 1EXJA 3L71E 3NMDA 4H13C 3CC7P 1GTWA 2AXCA 4QUQA 4IFDK 2HMNA 1RHZB 3CMAP 1L0LD 1S2EA 1GL2B 1XTGB 3BCCD 2WSFJ 4OVNF 1JMMA 2XDJA 3AE8C 2IYPA 5CBOA 4HM3A 1YJWP 1G1JA 3H1JE 4QCKA 3H6PA 2GBWA 4WVZA 2XR8A 2B89A 3SWKA 4LC1A 2FBWC 3HE4A 2QRXA 1URQA 2Y0CA 1RF1A 4K3AA 3FOUA 3TSIA 1K05A 2HMOA 4WY4D 3EWKA 3H1JD 1ZN5A 2YVJB 3TNUB 4HJGH 1JY3P 3CCUP 5KAFH 4DJGA 1CI6A 1ZV8A 1K73Q 3M9QA 3L71G 4WY4C 2PRRA 5AW8B 3HD7D 1SQQG 3CX5E 1PGJA 2YO3A 4D6TD 1HH0A 3B4SA 3CCQP 1FZCB 1L0NJ 5CBNA 1KQFB 3HD7C 4H13B 2E75D 2QG4A 3P32A 1N8RQ 1FZFA 2HYNA 2E75C 2QM8A 1EDIA 1SQQK 3H1IJ 1KILE 4QDFA 4Y99C 3AEGC 1NH4A 1RQUA 4QDDA 1N7LA 3PLNA 2JO1A 3CWBD 1AA0A 3RK3E 2FXOA 2W27A 1M1JB 1FJPA 5AEWA 4R4MA 2FFDC 1YYCA 2LXCB 3RL0g 3Q5SA 1KILD 1KYOH 5CMZA 3CCLP 4W7YA 4RKUJ 4P1BH 4JPZB 1KQGB 2AXTE 3LW5J 1Q81Q 3AE1C 1KILC 4EIJA 5BU8B 4IL6X 1WRGA 4WY4B 3GZXA 1SQXD 3UIAA 1OW7A 3RK3C 3C8VA 3VP8A 4XE5B 3HD7B 1AJYA 2H89C 2WPRA 2KLVA 1HVVA 5CJ0A 4WWIA 4DOJA 3BVHA 1DD4A 3P8CE 2BASA 3M91A 2E75B 2POHA 2WSEJ 3H1HJ 3H1KD 2QJPC 4Y99B 1VQ7P 1X0TA 3AE9C 2AEMA 2YMYA 1M1KQ 1O7GA 2YFLA 2KB7P 4BXLA 1OFCX 1KC8Q 3L73J 2IYOA 5EFWB 3SSUA 3P7KA 5KAIE 1MV8A 2FFDB 4RESB 4KHXA 1IC2A 3A0HE 2H7HA 3U1CA 1KILB 1E79H 1BE3E 1JCCA 2XNXA 1BGYJ 1LTJC 3RBXA 5DJTB 5AW9B 1L4AA 3JSVC 3RK3B 2IBZI 1ZR2A 3VCAA 1BCCJ 1LWUC 1G2CA 1O7PA 3L70E 3JCUE 1NAFA 2ZT9D 2B88A 5AW2B 1ZLLA 3FXDA 1FDIA 2FYUJ 1SQPJ 2FXMA 1L0NG 5AW6B 2ZT9C 3CX5H 1X8YA 4NBBD 2YKPA 2V7QJ 2YFIA 2QJPB 4EOTA 1EZVG 4PD4E 4DT0A 1IFMA 1HGVA 2M5AA 1T6AA 3CI9A 1T2KC 2YMKA 1U57A 4JYCA 1BE3G 1L0NK 1M90Q 1RE3A 3N7NA 2OYHC 1NKNA 5AVVB 2WT7B 2WITA 4KJMA 1RH5B 1N73A 5AVTB 3AE7C 3R4YA 3G4SP 2Q1KA 1QEXA 4C7RA 2E76D 1KYOI 3SFDC 3L75D 3L70G 3SWFA 4GIFA 5AVUB 2E76C 4CPGA 3MGNA 1NTMJ 5CCGC 3BRTB 1NAYA 2WQYC 1LWUB 3GG2A 1JTHB 2WSFH 2AXTH 2HG5D 1VQ9P 3L72E 2I8DA 3CCRP 3H32A 1ZR4A 3AEDC 4I2LC 1J2JB 3GW6A 1FBMA 4IL6E 2BMQA 2KNCA 2ZT9B 2N1TA 3AEBC 4H44D 2IZ1A 1OWAA 4JF7A 4N6JA 5CCHA 1BSHA 5AW4B 1SJGA 3AZCA 4NBHD 3L74J 4H44C 2Q5UA 2NUKA 1HF9A 2OTLP 2BCCD 1ZMEC 3H1HG 1YBKA 1JOCA 3PJSK 3OW2O 3V2NA 2OYHB 2JWDA 4I1LA 2YXRB 2OYIC 2W90A 1W5CE 2FYNC 5AW3B 3TYYA 1FZGA 2IDBA 1KMIZ 2KUBA 1NTKJ 5KAIH 2R5BA 3L72G 2WMMA 5AVWB 4I6MC 1JCDA 1VQ5P 2E76B 3D6YA 3A0HH 3ITKA 2Q6QA 1RE4C 5KLVD 1LT9C 3WUVA 4IFFA 4NBGD 4HKVA 4PJ0E 1N7SD 5AVXB 1PP9E 2AEFA 5APWA 2IBZE 2YFJA 1GL2A 2P2UA 4U3FJ 3O6QB 2YO2A 4N78D 4H44B 3JCUH 2DE6D 3CX5I 3V5BA 1S4XA 2QIWA 1OW8A 3M0AA 3VMZA 2B9BA 1GW3A 4W7ZA 2KS1B 2YXQB 3MUDC 2IBZD 1L0LJ 2M8RA 4PD4H 2QEXP 3H25A 3BCCJ 3CCVP 2OYIB 2XSHA 4JBZA 3D89A 1ZRTE 1ZOYC 3MIWA 2FYUK 1SQPK 5TJHA 2FYNB 3TNUA 4IFMA 1Q90D 2C0WA 1E5WA 4HH2A 3S1KA 1P84I 1FE6A 1Q90C 1KFMA 1G8JB 2VRSA 1VQPP 4HB1A 2QJKC 1NTZJ 1FZCA 3SFEC 2BEZF 1LT9B 1PP9G 1K9MQ 3IFMA 1CZQA 2D2CD 3MTUE 1JNMA 5GTIE 1JEKA 1SFCD 2R32A 1KV4A 4BRYA 3VMGD 2D2CC 2RH0A 1GW4A 1OVVA 3V4WA 4D6TJ 1EC5A 2W83C 2OQQA 1RFSA 2HLOA 1SFCC 5AEUA 2HFED 3GTEA 3Q1MA 4JQ0D 3H1LE 4L74A 1KYOD 2NPSC 1M7LA 3JC22 1M1JA 4IL6H 2KZJA 3EQQA 1Y47A 1Q86Q 2HODB 4A7PA 3M0DC 2QE7H 3B71A 3L74G 4TLFA 1VQKP 1USEA 4W80A 1IK7A 2HR3A 4GT1A 3ZDMA 1NU1J 1OVRA 2W6BA 3CWBJ 2BEQD 4WY4A 2WPVB 2K3RA 2O1KA 2A45I 3V6IA 2B87B 3CMEP 4WB4A 1SQQE 3CC2P 1G8KB 2QJKB 2R3SA 2IPPA 3V2QA 1EZVI 1FS0E 5APVA 3GKEA 3HD7A 1DEBA 1PGQA 2MKVA 1WMKA 3GF7A 1UIXA 3FWNA 1AVYA 1TU3F 2O01H 2OTJP 3L71D 2NRGA 1MZ9A 2YNYA 3WUUA 2RMZA 2D2CB 3H1LG 1SQXJ 2I7FA 1SQQD 1M56D 2KIKA 2XU6A 3D71A 4HYTB 1YTZI 1NTKK 2HMKA 1SFCB 4HM6A 1FJKA 1T8ZA 3GMAA 1NVOA 2XKMA 3VCPA 2ZJSE 2NPSB 1JUNA 3HE5A 4PJ0H 2NVFA 2FFDA 2XV5A 2E4PA 2H8PD 2WTYA 1MFZA 3H1KJ 2Q3EA 2WPQA 2C9LY 5KTBA 4AQRD 1VQLP 2Y0EA 1PFIA 1HTLC 2FY8A 1KILA 2CK3H 1OXZA 1RIEA 3WUTA 3AE2C 4PD4I 4QURA 1LTBC 4Z1MH 3CXHI 3L37A 3W68A 3PH0A 3WMM0 1MFTA 4QMAA 3CX5D 1H8AA 2BMRA 4GDOA 1JB0J 5AVZB 4H0LC 4U7JA 2ZYAA 2B24A 3GL2A 2IX7C 1NTZG 1P84E 2JO6A 2I1JA 4OH8B 2JWAA 1X9VA 2K9JA 3CCSP 3TGUJ 2QSIA 1SP4A 2M3BA 3AE5C 3C9IA 3IN6A 2WWWA 1QLED 1SVFA 4HM2A 5GTIH 1NTZK 2R44A 3RK3D 4EDFA 2WT7A 1IK9A 3V4QA 2ZVNB 2JR8A 3IF4A 1SS1A 2CPSA 2PGDA 4DZOA 2FYZA 3GHGC 2AEJA 1NYKA 1PIXA 1YJNP 1OVUA 2Y9YA 2C9NY 1NU1G 5APSA 1LWUA 2ZXEB 1JTHA 1JM1A 4BWNA 1AQ5A 4H0LB 1ULIA 1NKZB 2OARA 3L75J 1EDLA 3I5CA 1YHQP 1L0NE 3MD0A 3QH9A 4XA4A 1NU1K 3D6ZA 1NOHA 1T3UA 1IFDA 3P8CD 1EZVE 1O7WA 2W6JH 1J1EC 2KOGA 4NBED 1EQ7A 1N86A 2DW3A 2RKLA 4LLHA 3H1IE 3S4RA 3HTKB 2A06E 4L75A 1L0ND 2YIUC 3KYQA 2OYHA 3MP7B 2JZAA 1GD2E 2Y0DA 4Y28J 1EZVD 4B86A 1N2DC 2V4HA 1HJBA 4IOIH 4EMJB 1J1DC 1H89A 4K35A 1QL2A 2BCCJ 2KXPB 3H1ID 3GHGB 3OA7A 4WBAA 3T97B 2KSEA 1BE3D 3VN0A 1SQBJ 2XZRA 4L73A 3S9OA 1KB9I 2A45G 3K5BA 5CHXA 4UB8H 5B5EH 2O01N 4HM7A 3PHLA 3AEEC 1LGHB 2Z4EA 3L70D 3CXHE 1T2KD 1DEEG 4GKGA 5E79E 3H1IG 1EG9A 2A06G 4NPFX 5KLVJ 3CC4P 5APXA 4PD4D 3H1HE 1P84H 3C0DA 2GA1A 1G1IA 2WSCJ 2YIUB 3B5ND 3IR9A 3TGUG 1LTJB 5CCGD 2W8ZA 4YPCA 2OYIA 3L73E 1L4AD 1EDKA 3FGAD 5BU5A 3B5NC 4C46A 1LP1A 1J1DB 2KI7B 1O7HA 2FXPA 1L4AC 3H1HD 1NWQA 2LR2A 3NXSA 4TT3H 1AQTA 1VQ8P 1VQ4P 2E5YA 2P7JA 3GL0A 1LT9A 1BGYE 1DH3A 4P1CH 2N9BA 4HM5A 2Q3WA 4AIVA 3WU2E 1S3JA 1PPJG 3L72D 1BCCE 1IFIA 1YQ4C 3RK2D 1N7SA 3FWLA 3G3ZA 2Q3IA 2H43A 2FYUE 1SQPE 3G6EP 1K8AQ 2G8YA 4AUWA 1OMIA 3RK2C 3USSA 3L73G 3HRNA 1RE3C 2HODA 2A45H 1ULJA 1BCCD 2NWFA 2G3AA 1H0TA 3NFQA 1SQVJ 3FXEA 3B5NB 1MUUA 2WVRA 2FYUD 1SQPD 3DQYA 1BDDA 1M8OB 1L4AB 2PFXA 1BGYG 1Q82Q 4L76A 2HMLA 1QGKB 4HM8A 1R8EA 3CPWO 2NZ2A 2XSOA 1BCCG 2Q7CA 1FDOA 1KZUB 1CSBA 5CCHD 2DE5D 2HPCB 2E4QA 2FYUG 1SQPG 2SPZA 5CCHC 3LW5H 1YI2P 1ZW0A 1H88A 1OIPA 4OGQD 1AV1A 2M5AB 2I1KA 1KB9E 1SFCA 1PP9D 2UWJE 3Q2YA 4UB6E 1JM0A 4OGQC 3U1AA 3RK2B 5AW0B 3CXHH 1FZEA 2L91A 3PP5A 1SQBK 3CCEP 5AVRB 1KD1Q 3L71J 2NUMA 1GK4A 3L74E 5E79H 2KK7A 1SQQJ 3NTNA 2ZXXA 2QPZA 3KQGA 3HUSC 3AE6C 2FKWB 2WSEH 1RF0A 1FZAA 4QDCA 1ZRTD 3CL3D 1EDJA 1PGOA 3H1JJ 3V2PA 1VQOP 2GM4A 3L74D 3KZIE 2ZYGA 1NTMG 3V2RA 4O9BA 3H32B 5AW7B 4HJLA 1NTKE 1NYHA 2K88A 2BMOA 3AECC 3BATA 3VOPA 2E74D 2NPSD 1NJIQ 1A02J 1W2EA 3O8ZA 1FC2C 3W67A 3SWYA 3I56P 1LTAC 5KJ7D 4EYYQ 1VQMP 2E74C 1NTMK 1KORA 1NTKD 5KJ7C 2K1AA 3AEAC 1VQNP 3WU2H 4OGQB 5B66E 3BRVB 4HM0A 2O3JA 4PV1D 3TF5A 4U3FE 3VMHD 1X22A 2K37A 2ZAEB 3QWOC 3H1LD 3VTPC 4YXWH 3D70A 2PAJA 2R5DA 4ASWA 1S5LE 4PV1C 3CD6P 3HUSB 1GDTA 1OW6A 2KZIA 2ZYDA 1NHLA 1AFOA 5GTHE 2V7QH 1L0LE 1SQVG 1NTKG 4U3FD 5AW5B 4M3LA 5H2FH 2E42A 1IFPA 3VMXA 2O1JA 2GUSA 2KSJA 4HM4A 4I7ZC 1OZHA 1USDA 1IFJA 4YTPC 1LTIC 1L2PA 3Q5RA 1SQVK 1O7NA 1D7MA 1NTZE 3R2PA 4GODA 2JDIH 3EFGA 2Z5IA 2E74B 2WSCH 1YTZT 4U3FG 3KPEA 1KN7A 5BVZA 3CCMP 1PV3A 5TISE 4EI2A 1M1JC 3CCJP 1LTSC 1R5SA 2LKMA 3HTKA 1PL5A 2P1JA 3RBZA 1VQ6P 1BSNA 1NTZD 4QUPA 4D6TE 4UB8E 1FOSF 1AVOA 4HM1A 2HMMA 5B5EE 1L0LG 1RY3A 1KB9H 4PV1B 5HL4A 2J58A 3BCCG 1VM9A 4UB6H 1HGZA 1LTTC 2WZ7A 4H0LD 5APUA 1Y9BA 5CJ4A 3ABVC 3GHGA 1S9KE 3VP9A 3T97A 4ZNCA 1L0LK 1NU1E 2MJZA 3CWBE 1QVFO 2JKVA 2P58A 1KQLA 3E7KA 3H1JG 4I7ZB 1Z56A 4BRYB 1VL2A 1FZBA 1S9KD 2QA4P 1URQD 3KZIH 1BE3J 1FDMA 1YIJP 1NU1D 3RL0D 1WT6A 3LIDA 4D6TG 1P84D 2Q9IA 1URQC 2QJYC 1RF1C 2Z5HA 1NDOA 1LNQA 3RL0C 1SQXE 2IZ0A 1Q2NA 3L70J 1XTCC 3G9RA 3U59A 1LTJA 4ASVA 3A0BH 2P10A 1KQSO 1LTGC 4C7NB 4ZKPA 1QX8A 4ZKUA 1Y8AA 1OX3A 5B66H 3CWBG 3H1KE
chains in the Genus database with same CATH topology
1O7MA 2XSOA 2HMMA 4H44D 1PPJE 4HM3A 3VCAA 2B24A 1O7PA 3GOBA 3H1JE 4P1BH 3GL2A 2B1XA 1SQVE 4QCKA 5HL4A 1P84E 3L70E 3H1IE 1O7HA 1VCKA 2GBWA 5KLVE 2DE5D 2A06E 1VM9A 1SQQE 1SJGA 2E4QA 2JO6A 3AZCA 4NB8D 2XR8A 1G8KB 4NBHD 2ZT9D 2XSHA 2YIUC 2NUKA 3D89A 1ZRTE 4H0LD 4HM0A 3GZXA 3GKEA 3L75E 2JZAA 4PV1D 4U3FE 2DE7D 3VMHD 1KYOE 5BOKA 2BMRA 4OGQD 3GL0A 3FOUA 1BGYE 4NBBD 2YFIA 3GZYA 1KB9E 1UUWA 4NBFD 4EMJB 4P1CH 2HMOA 2YVJB 1Q90C 4HM5A 1NU1E 4PD4E 2Q3WA 1G8JB 4HM2A 4AAYB 3CWBE 4NBDD 4AIVA 2I7FA 2QJKC 2HMJA 1NTME 5KLIC 1BCCE 2FYNC 1L0LE 3H1KE 2HMKA 4HM6A 5KKZC 4NBAD 1VF5D 1WQLA 3GTSA 3CX5E 2D2CD 4NB9D 2NUMA 3VCPA 3L74E 3GB4A 2QJPC 2QPZA 4HM7A 2FYUE 1SQPE 2NVFA 3VMGD 3VMID 2E75D 3TGUE 1UUVA 1O7GA 2YFLA 1NYKA 3CXHE 2QJYC 2E4PA 4QDCA 1ULJA 4HM4A 2E76D 1RFSA 1NDOA 5AEUA 3GTEA 2BCCE 1O7NA 1SQXE 2NWFA 1JM1A 4H13D 1EG9A 4NBGD 1NTZE 3H1LE 3BCCE 4HKVA 1RIEA 2XRXA 4QDFA 3GCEA 2NVGA 2CKFA 3EQQA 4QURA 1PP9E 3L71E 1ULIA 1SQBE 4HJLA 1NTKE 2IBZE 3N0QA 4QDDA 2YFJA 3DQYA 4QUQA 5CXMA 2BMOA 3H1HE 3C0DA 2HMNA 3L72E 1L0NE 1BE3E 1FQTA 2E74D 4QDFB 2GBXA 2DE6D 4NBCD 5AEWA 2HMLA 4HM8A 2NVEA 1EZVE 1O7WA 4QUPA 3EN1A 2ZYLA 4D6TE 2BMQA 3L73E 4HM1A 4NBED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7M A;  2XSO A;  2HMM A;  4H44 D;  1PPJ E;  4HM3 A;  3VCA A;  2B24 A;  1O7P A;  3GOB A;  3H1J E;  4P1B H;  3GL2 A;  2B1X A;  1SQV E;  4QCK A;  5HL4 A;  1P84 E;  3L70 E;  3H1I E;  1O7H A;  1VCK A;  2GBW A;  5KLV E;  2DE5 D;  2A06 E;  1VM9 A;  1SQQ E;  1SJG A;  2E4Q A;  2JO6 A;  3AZC A;  4NB8 D;  2XR8 A;  1G8K B;  4NBH D;  2ZT9 D;  2XSH A;  2YIU C;  2NUK A;  3D89 A;  1ZRT E;  4H0L D;  4HM0 A;  3GZX A;  3GKE A;  3L75 E;  2JZA A;  4PV1 D;  4U3F E;  2DE7 D;  3VMH D;  1KYO E;  5BOK A;  2BMR A;  4OGQ D;  3GL0 A;  3FOU A;  1BGY E;  4NBB D;  2YFI A;  3GZY A;  1KB9 E;  1UUW A;  4NBF D;  4EMJ B;  4P1C H;  2HMO A;  2YVJ B;  1Q90 C;  4HM5 A;  1NU1 E;  4PD4 E;  2Q3W A;  1G8J B;  4HM2 A;  4AAY B;  3CWB E;  4NBD D;  4AIV A;  2I7F A;  2QJK C;  2HMJ A;  1NTM E;  5KLI C;  1BCC E;  2FYN C;  1L0L E;  3H1K E;  2HMK A;  4HM6 A;  5KKZ C;  4NBA D;  1VF5 D;  1WQL A;  3GTS A;  3CX5 E;  2D2C D;  4NB9 D;  2NUM A;  3VCP A;  3L74 E;  3GB4 A;  2QJP C;  2QPZ A;  4HM7 A;  2FYU E;  1SQP E;  2NVF A;  3VMG D;  3VMI D;  2E75 D;  3TGU E;  1UUV A;  1O7G A;  2YFL A;  1NYK A;  3CXH E;  2QJY C;  2E4P A;  4QDC A;  1ULJ A;  4HM4 A;  2E76 D;  1RFS A;  1NDO A;  5AEU A;  3GTE A;  2BCC E;  1O7N A;  1SQX E;  2NWF A;  1JM1 A;  4H13 D;  1EG9 A;  4NBG D;  1NTZ E;  3H1L E;  3BCC E;  4HKV A;  1RIE A;  2XRX A;  4QDF A;  3GCE A;  2NVG A;  2CKF A;  3EQQ A;  4QUR A;  1PP9 E;  3L71 E;  1ULI A;  1SQB E;  4HJL A;  1NTK E;  2IBZ E;  3N0Q A;  4QDD A;  2YFJ A;  3DQY A;  4QUQ A;  5CXM A;  2BMO A;  3H1H E;  3C0D A;  2HMN A;  3L72 E;  1L0N E;  1BE3 E;  1FQT A;  2E74 D;  4QDF B;  2GBX A;  2DE6 D;  4NBC D;  5AEW A;  2HML A;  4HM8 A;  2NVE A;  1EZV E;  1O7W A;  4QUP A;  3EN1 A;  2ZYL A;  4D6T E;  2BMQ A;  3L73 E;  4HM1 A;  4NBE D; 
#chains in the Genus database with same CATH topology
 3N4X A;  1SLQ A;  2E43 A;  1S5L H;  2H88 C;  3A5T A;  3M06 A;  2K9Y A;  5GTH H;  4MN4 C;  1S72 P;  3II6 A;  1KTM A;  5BOK A;  1BDC A;  4ZMD A;  2J5U A;  3C1L A;  1UUW A;  1SQX G;  2R3C A;  4AYC A;  1YQ3 C;  3HE4 B;  1EXI A;  1URQ B;  2QJY B;  1RF1 B;  1HUC A;  3HE5 B;  5KLI C;  1M57 D;  1IFN A;  3RL0 B;  4NB9 D;  1U7M A;  1CI6 B;  3L72 J;  3F5H A;  4GOF A;  5APT A;  1X79 B;  3PTZ A;  1SQX K;  3TGU E;  1UUV A;  3L36 A;  1GU4 A;  3H1K G;  2A06 D;  5TIS H;  3B5N A;  3F89 A;  5CCG A;  3FX0 A;  3TK1 A;  3A2A A;  2QM7 A;  2XRX A;  2LXB A;  1JMB A;  1VDF A;  3TGU D;  3AE3 C;  3OJA B;  3GLM A;  1FU1 A;  5M1B A;  4QDF B;  2GUV A;  1FAV A;  2P67 A;  1K04 A;  1IO4 A;  2HPC A;  2ZYL A;  3O6Q A;  4NPD A;  3M9H A;  3GTS A;  2XND H;  4HKZ H;  1J1E B;  1YJ9 P;  1PPJ E;  2YKQ A;  1HWT C;  3A3Y B;  2K9J B;  1A02 F;  1IZN B;  2CPB A;  1GU5 A;  4RJT A;  3CXH D;  5KLI B;  2KS1 A;  2O01 J;  3L75 E;  2M0B A;  1ZXG A;  1HJ0 A;  1T3J A;  1PPJ D;  3GZY A;  1GZL A;  1NGM B;  1JY2 N;  2WPS A;  1DD3 A;  5L8R J;  2ZVO B;  2IFN A;  1PP9 J;  4NBA D;  1VF5 D;  1WQL A;  2RN0 A;  1RE4 A;  3L73 D;  3GB4 A;  2N9Y B;  3VYI A;  1PGP A;  1VF5 C;  3MHV A;  3TDK A;  3AE4 C;  3L35 A;  3KHU A;  3CLQ A;  2E5T A;  1W2B O;  2PP6 A;  2YKO A;  1JY2 O;  4R4L A;  5AW1 B;  3G71 P;  5APY A;  2BCC E;  5AVY B;  1R5L A;  4RO0 A;  1U7J A;  1S5L X;  2WSS H;  3GCE A;  2NVG A;  1YIT P;  1BGY D;  1SQB E;  3L75 G;  4KT0 J;  4N3Y B;  3N0Q A;  1HBW A;  5CXM A;  3VMA A;  2KP8 A;  3MUD A;  2JEE A;  2NVE A;  1N73 C;  5H2F E;  4NPE A;  2W6A A;  1SQB D;  3KDP B;  3OAK A;  2Y9Z A;  2C0X A;  5KLV E;  3E1R A;  3PRJ A;  3EQ2 A;  3HUS A;  3AEF C;  1FOS E;  2DE7 D;  1G2C B;  2B87 A;  3P8M C;  2N1T D;  2ZFC A;  3EFF K;  4LGD E;  4NBF D;  2BCC G;  4AAY B;  1VF5 B;  4N78 E;  3LIE A;  1NO4 A;  3H1L J;  2N1T C;  2ITA A;  5APQ A;  1NTM E;  1SQB G;  5KKZ C;  1JY2 P;  5DJU B;  5C39 A;  2OYO A;  2JP3 A;  5AVS B;  2L5G B;  2IFM A;  3GF3 A;  3VMI D;  5KAF E;  1N7S C;  2KYV A;  2NPS A;  1DIP A;  1NTM D;  3M0D A;  1VPC A;  1ZP0 C;  3L4F A;  5KJ7 A;  5KLV G;  1N73 B;  1MKM A;  5K5G B;  2CKF A;  4OWF A;  2J59 M;  1KB9 D;  4GOE A;  1QVG O;  1CW5 A;  1FQT A;  1LP1 B;  2GBX A;  3Q5P A;  4NBC D;  1IJD B;  3EN1 A;  5KLV K;  1O7M A;  3GOB A;  1GK6 A;  2B1X A;  1SQV E;  1VCK A;  1GL2 D;  4NB8 D;  3IAO A;  1JO5 A;  2KNC B;  2N1T B;  1DX7 A;  2IBZ G;  2KLU A;  2JJL A;  3BAS A;  5KKZ B;  1GL2 C;  1JY3 N;  1PZQ A;  1KYO E;  3VMY A;  1RQV A;  1SQV D;  3A0B E;  3RGU A;  4NBD D;  2OTK E;  1N7S B;  3B8E B;  4DCK A;  2HMJ A;  1LT1 A;  3E1I A;  1GMJ A;  4YXD C;  4JYB A;  3I55 P;  2QVA A;  3MZW B;  1S1C X;  1JY3 O;  3Q3D A;  2OGU A;  1UII A;  3A7O A;  1H0T B;  1QL1 A;  1KFN A;  1Q7Y Q;  5AVQ B;  3KXD A;  4H13 D;  4C7N A;  1RF0 C;  3BCC E;  4XFJ A;  1FZC C;  2M3E A;  3M9B A;  1LJ2 A;  1EXJ A;  3L71 E;  3NMD A;  4H13 C;  3CC7 P;  1GTW A;  2AXC A;  4QUQ A;  4IFD K;  2HMN A;  1RHZ B;  3CMA P;  1L0L D;  1S2E A;  1GL2 B;  1XTG B;  3BCC D;  2WSF J;  4OVN F;  1JMM A;  2XDJ A;  3AE8 C;  2IYP A;  5CBO A;  4HM3 A;  1YJW P;  1G1J A;  3H1J E;  4QCK A;  3H6P A;  2GBW A;  4WVZ A;  2XR8 A;  2B89 A;  3SWK A;  4LC1 A;  2FBW C;  3HE4 A;  2QRX A;  1URQ A;  2Y0C A;  1RF1 A;  4K3A A;  3FOU A;  3TSI A;  1K05 A;  2HMO A;  4WY4 D;  3EWK A;  3H1J D;  1ZN5 A;  2YVJ B;  3TNU B;  4HJG H;  1JY3 P;  3CCU P;  5KAF H;  4DJG A;  1CI6 A;  1ZV8 A;  1K73 Q;  3M9Q A;  3L71 G;  4WY4 C;  2PRR A;  5AW8 B;  3HD7 D;  1SQQ G;  3CX5 E;  1PGJ A;  2YO3 A;  4D6T D;  1HH0 A;  3B4S A;  3CCQ P;  1FZC B;  1L0N J;  5CBN A;  1KQF B;  3HD7 C;  4H13 B;  2E75 D;  2QG4 A;  3P32 A;  1N8R Q;  1FZF A;  2HYN A;  2E75 C;  2QM8 A;  1EDI A;  1SQQ K;  3H1I J;  1KIL E;  4QDF A;  4Y99 C;  3AEG C;  1NH4 A;  1RQU A;  4QDD A;  1N7L A;  3PLN A;  2JO1 A;  3CWB D;  1AA0 A;  3RK3 E;  2FXO A;  2W27 A;  1M1J B;  1FJP A;  5AEW A;  4R4M A;  2FFD C;  1YYC A;  2LXC B;  3RL0 g;  3Q5S A;  1KIL D;  1KYO H;  5CMZ A;  3CCL P;  4W7Y A;  4RKU J;  4P1B H;  4JPZ B;  1KQG B;  2AXT E;  3LW5 J;  1Q81 Q;  3AE1 C;  1KIL C;  4EIJ A;  5BU8 B;  4IL6 X;  1WRG A;  4WY4 B;  3GZX A;  1SQX D;  3UIA A;  1OW7 A;  3RK3 C;  3C8V A;  3VP8 A;  4XE5 B;  3HD7 B;  1AJY A;  2H89 C;  2WPR A;  2KLV A;  1HVV A;  5CJ0 A;  4WWI A;  4DOJ A;  3BVH A;  1DD4 A;  3P8C E;  2BAS A;  3M91 A;  2E75 B;  2POH A;  2WSE J;  3H1H J;  3H1K D;  2QJP C;  4Y99 B;  1VQ7 P;  1X0T A;  3AE9 C;  2AEM A;  2YMY A;  1M1K Q;  1O7G A;  2YFL A;  2KB7 P;  4BXL A;  1OFC X;  1KC8 Q;  3L73 J;  2IYO A;  5EFW B;  3SSU A;  3P7K A;  5KAI E;  1MV8 A;  2FFD B;  4RES B;  4KHX A;  1IC2 A;  3A0H E;  2H7H A;  3U1C A;  1KIL B;  1E79 H;  1BE3 E;  1JCC A;  2XNX A;  1BGY J;  1LTJ C;  3RBX A;  5DJT B;  5AW9 B;  1L4A A;  3JSV C;  3RK3 B;  2IBZ I;  1ZR2 A;  3VCA A;  1BCC J;  1LWU C;  1G2C A;  1O7P A;  3L70 E;  3JCU E;  1NAF A;  2ZT9 D;  2B88 A;  5AW2 B;  1ZLL A;  3FXD A;  1FDI A;  2FYU J;  1SQP J;  2FXM A;  1L0N G;  5AW6 B;  2ZT9 C;  3CX5 H;  1X8Y A;  4NBB D;  2YKP A;  2V7Q J;  2YFI A;  2QJP B;  4EOT A;  1EZV G;  4PD4 E;  4DT0 A;  1IFM A;  1HGV A;  2M5A A;  1T6A A;  3CI9 A;  1T2K C;  2YMK A;  1U57 A;  4JYC A;  1BE3 G;  1L0N K;  1M90 Q;  1RE3 A;  3N7N A;  2OYH C;  1NKN A;  5AVV B;  2WT7 B;  2WIT A;  4KJM A;  1RH5 B;  1N73 A;  5AVT B;  3AE7 C;  3R4Y A;  3G4S P;  2Q1K A;  1QEX A;  4C7R A;  2E76 D;  1KYO I;  3SFD C;  3L75 D;  3L70 G;  3SWF A;  4GIF A;  5AVU B;  2E76 C;  4CPG A;  3MGN A;  1NTM J;  5CCG C;  3BRT B;  1NAY A;  2WQY C;  1LWU B;  3GG2 A;  1JTH B;  2WSF H;  2AXT H;  2HG5 D;  1VQ9 P;  3L72 E;  2I8D A;  3CCR P;  3H32 A;  1ZR4 A;  3AED C;  4I2L C;  1J2J B;  3GW6 A;  1FBM A;  4IL6 E;  2BMQ A;  2KNC A;  2ZT9 B;  2N1T A;  3AEB C;  4H44 D;  2IZ1 A;  1OWA A;  4JF7 A;  4N6J A;  5CCH A;  1BSH A;  5AW4 B;  1SJG A;  3AZC A;  4NBH D;  3L74 J;  4H44 C;  2Q5U A;  2NUK A;  1HF9 A;  2OTL P;  2BCC D;  1ZME C;  3H1H G;  1YBK A;  1JOC A;  3PJS K;  3OW2 O;  3V2N A;  2OYH B;  2JWD A;  4I1L A;  2YXR B;  2OYI C;  2W90 A;  1W5C E;  2FYN C;  5AW3 B;  3TYY A;  1FZG A;  2IDB A;  1KMI Z;  2KUB A;  1NTK J;  5KAI H;  2R5B A;  3L72 G;  2WMM A;  5AVW B;  4I6M C;  1JCD A;  1VQ5 P;  2E76 B;  3D6Y A;  3A0H H;  3ITK A;  2Q6Q A;  1RE4 C;  5KLV D;  1LT9 C;  3WUV A;  4IFF A;  4NBG D;  4HKV A;  4PJ0 E;  1N7S D;  5AVX B;  1PP9 E;  2AEF A;  5APW A;  2IBZ E;  2YFJ A;  1GL2 A;  2P2U A;  4U3F J;  3O6Q B;  2YO2 A;  4N78 D;  4H44 B;  3JCU H;  2DE6 D;  3CX5 I;  3V5B A;  1S4X A;  2QIW A;  1OW8 A;  3M0A A;  3VMZ A;  2B9B A;  1GW3 A;  4W7Z A;  2KS1 B;  2YXQ B;  3MUD C;  2IBZ D;  1L0L J;  2M8R A;  4PD4 H;  2QEX P;  3H25 A;  3BCC J;  3CCV P;  2OYI B;  2XSH A;  4JBZ A;  3D89 A;  1ZRT E;  1ZOY C;  3MIW A;  2FYU K;  1SQP K;  5TJH A;  2FYN B;  3TNU A;  4IFM A;  1Q90 D;  2C0W A;  1E5W A;  4HH2 A;  3S1K A;  1P84 I;  1FE6 A;  1Q90 C;  1KFM A;  1G8J B;  2VRS A;  1VQP P;  4HB1 A;  2QJK C;  1NTZ J;  1FZC A;  3SFE C;  2BEZ F;  1LT9 B;  1PP9 G;  1K9M Q;  3IFM A;  1CZQ A;  2D2C D;  3MTU E;  1JNM A;  5GTI E;  1JEK A;  1SFC D;  2R32 A;  1KV4 A;  4BRY A;  3VMG D;  2D2C C;  2RH0 A;  1GW4 A;  1OVV A;  3V4W A;  4D6T J;  1EC5 A;  2W83 C;  2OQQ A;  1RFS A;  2HLO A;  1SFC C;  5AEU A;  2HFE D;  3GTE A;  3Q1M A;  4JQ0 D;  3H1L E;  4L74 A;  1KYO D;  2NPS C;  1M7L A;  3JC2 2;  1M1J A;  4IL6 H;  2KZJ A;  3EQQ A;  1Y47 A;  1Q86 Q;  2HOD B;  4A7P A;  3M0D C;  2QE7 H;  3B71 A;  3L74 G;  4TLF A;  1VQK P;  1USE A;  4W80 A;  1IK7 A;  2HR3 A;  4GT1 A;  3ZDM A;  1NU1 J;  1OVR A;  2W6B A;  3CWB J;  2BEQ D;  4WY4 A;  2WPV B;  2K3R A;  2O1K A;  2A45 I;  3V6I A;  2B87 B;  3CME P;  4WB4 A;  1SQQ E;  3CC2 P;  1G8K B;  2QJK B;  2R3S A;  2IPP A;  3V2Q A;  1EZV I;  1FS0 E;  5APV A;  3GKE A;  3HD7 A;  1DEB A;  1PGQ A;  2MKV A;  1WMK A;  3GF7 A;  1UIX A;  3FWN A;  1AVY A;  1TU3 F;  2O01 H;  2OTJ P;  3L71 D;  2NRG A;  1MZ9 A;  2YNY A;  3WUU A;  2RMZ A;  2D2C B;  3H1L G;  1SQX J;  2I7F A;  1SQQ D;  1M56 D;  2KIK A;  2XU6 A;  3D71 A;  4HYT B;  1YTZ I;  1NTK K;  2HMK A;  1SFC B;  4HM6 A;  1FJK A;  1T8Z A;  3GMA A;  1NVO A;  2XKM A;  3VCP A;  2ZJS E;  2NPS B;  1JUN A;  3HE5 A;  4PJ0 H;  2NVF A;  2FFD A;  2XV5 A;  2E4P A;  2H8P D;  2WTY A;  1MFZ A;  3H1K J;  2Q3E A;  2WPQ A;  2C9L Y;  5KTB A;  4AQR D;  1VQL P;  2Y0E A;  1PFI A;  1HTL C;  2FY8 A;  1KIL A;  2CK3 H;  1OXZ A;  1RIE A;  3WUT A;  3AE2 C;  4PD4 I;  4QUR A;  1LTB C;  4Z1M H;  3CXH I;  3L37 A;  3W68 A;  3PH0 A;  3WMM 0;  1MFT A;  4QMA A;  3CX5 D;  1H8A A;  2BMR A;  4GDO A;  1JB0 J;  5AVZ B;  4H0L C;  4U7J A;  2ZYA A;  2B24 A;  3GL2 A;  2IX7 C;  1NTZ G;  1P84 E;  2JO6 A;  2I1J A;  4OH8 B;  2JWA A;  1X9V A;  2K9J A;  3CCS P;  3TGU J;  2QSI A;  1SP4 A;  2M3B A;  3AE5 C;  3C9I A;  3IN6 A;  2WWW A;  1QLE D;  1SVF A;  4HM2 A;  5GTI H;  1NTZ K;  2R44 A;  3RK3 D;  4EDF A;  2WT7 A;  1IK9 A;  3V4Q A;  2ZVN B;  2JR8 A;  3IF4 A;  1SS1 A;  2CPS A;  2PGD A;  4DZO A;  2FYZ A;  3GHG C;  2AEJ A;  1NYK A;  1PIX A;  1YJN P;  1OVU A;  2Y9Y A;  2C9N Y;  1NU1 G;  5APS A;  1LWU A;  2ZXE B;  1JTH A;  1JM1 A;  4BWN A;  1AQ5 A;  4H0L B;  1ULI A;  1NKZ B;  2OAR A;  3L75 J;  1EDL A;  3I5C A;  1YHQ P;  1L0N E;  3MD0 A;  3QH9 A;  4XA4 A;  1NU1 K;  3D6Z A;  1NOH A;  1T3U A;  1IFD A;  3P8C D;  1EZV E;  1O7W A;  2W6J H;  1J1E C;  2KOG A;  4NBE D;  1EQ7 A;  1N86 A;  2DW3 A;  2RKL A;  4LLH A;  3H1I E;  3S4R A;  3HTK B;  2A06 E;  4L75 A;  1L0N D;  2YIU C;  3KYQ A;  2OYH A;  3MP7 B;  2JZA A;  1GD2 E;  2Y0D A;  4Y28 J;  1EZV D;  4B86 A;  1N2D C;  2V4H A;  1HJB A;  4IOI H;  4EMJ B;  1J1D C;  1H89 A;  4K35 A;  1QL2 A;  2BCC J;  2KXP B;  3H1I D;  3GHG B;  3OA7 A;  4WBA A;  3T97 B;  2KSE A;  1BE3 D;  3VN0 A;  1SQB J;  2XZR A;  4L73 A;  3S9O A;  1KB9 I;  2A45 G;  3K5B A;  5CHX A;  4UB8 H;  5B5E H;  2O01 N;  4HM7 A;  3PHL A;  3AEE C;  1LGH B;  2Z4E A;  3L70 D;  3CXH E;  1T2K D;  1DEE G;  4GKG A;  5E79 E;  3H1I G;  1EG9 A;  2A06 G;  4NPF X;  5KLV J;  3CC4 P;  5APX A;  4PD4 D;  3H1H E;  1P84 H;  3C0D A;  2GA1 A;  1G1I A;  2WSC J;  2YIU B;  3B5N D;  3IR9 A;  3TGU G;  1LTJ B;  5CCG D;  2W8Z A;  4YPC A;  2OYI A;  3L73 E;  1L4A D;  1EDK A;  3FGA D;  5BU5 A;  3B5N C;  4C46 A;  1LP1 A;  1J1D B;  2KI7 B;  1O7H A;  2FXP A;  1L4A C;  3H1H D;  1NWQ A;  2LR2 A;  3NXS A;  4TT3 H;  1AQT A;  1VQ8 P;  1VQ4 P;  2E5Y A;  2P7J A;  3GL0 A;  1LT9 A;  1BGY E;  1DH3 A;  4P1C H;  2N9B A;  4HM5 A;  2Q3W A;  4AIV A;  3WU2 E;  1S3J A;  1PPJ G;  3L72 D;  1BCC E;  1IFI A;  1YQ4 C;  3RK2 D;  1N7S A;  3FWL A;  3G3Z A;  2Q3I A;  2H43 A;  2FYU E;  1SQP E;  3G6E P;  1K8A Q;  2G8Y A;  4AUW A;  1OMI A;  3RK2 C;  3USS A;  3L73 G;  3HRN A;  1RE3 C;  2HOD A;  2A45 H;  1ULJ A;  1BCC D;  2NWF A;  2G3A A;  1H0T A;  3NFQ A;  1SQV J;  3FXE A;  3B5N B;  1MUU A;  2WVR A;  2FYU D;  1SQP D;  3DQY A;  1BDD A;  1M8O B;  1L4A B;  2PFX A;  1BGY G;  1Q82 Q;  4L76 A;  2HML A;  1QGK B;  4HM8 A;  1R8E A;  3CPW O;  2NZ2 A;  2XSO A;  1BCC G;  2Q7C A;  1FDO A;  1KZU B;  1CSB A;  5CCH D;  2DE5 D;  2HPC B;  2E4Q A;  2FYU G;  1SQP G;  2SPZ A;  5CCH C;  3LW5 H;  1YI2 P;  1ZW0 A;  1H88 A;  1OIP A;  4OGQ D;  1AV1 A;  2M5A B;  2I1K A;  1KB9 E;  1SFC A;  1PP9 D;  2UWJ E;  3Q2Y A;  4UB6 E;  1JM0 A;  4OGQ C;  3U1A A;  3RK2 B;  5AW0 B;  3CXH H;  1FZE A;  2L91 A;  3PP5 A;  1SQB K;  3CCE P;  5AVR B;  1KD1 Q;  3L71 J;  2NUM A;  1GK4 A;  3L74 E;  5E79 H;  2KK7 A;  1SQQ J;  3NTN A;  2ZXX A;  2QPZ A;  3KQG A;  3HUS C;  3AE6 C;  2FKW B;  2WSE H;  1RF0 A;  1FZA A;  4QDC A;  1ZRT D;  3CL3 D;  1EDJ A;  1PGO A;  3H1J J;  3V2P A;  1VQO P;  2GM4 A;  3L74 D;  3KZI E;  2ZYG A;  1NTM G;  3V2R A;  4O9B A;  3H32 B;  5AW7 B;  4HJL A;  1NTK E;  1NYH A;  2K88 A;  2BMO A;  3AEC C;  3BAT A;  3VOP A;  2E74 D;  2NPS D;  1NJI Q;  1A02 J;  1W2E A;  3O8Z A;  1FC2 C;  3W67 A;  3SWY A;  3I56 P;  1LTA C;  5KJ7 D;  4EYY Q;  1VQM P;  2E74 C;  1NTM K;  1KOR A;  1NTK D;  5KJ7 C;  2K1A A;  3AEA C;  1VQN P;  3WU2 H;  4OGQ B;  5B66 E;  3BRV B;  4HM0 A;  2O3J A;  4PV1 D;  3TF5 A;  4U3F E;  3VMH D;  1X22 A;  2K37 A;  2ZAE B;  3QWO C;  3H1L D;  3VTP C;  4YXW H;  3D70 A;  2PAJ A;  2R5D A;  4ASW A;  1S5L E;  4PV1 C;  3CD6 P;  3HUS B;  1GDT A;  1OW6 A;  2KZI A;  2ZYD A;  1NHL A;  1AFO A;  5GTH E;  2V7Q H;  1L0L E;  1SQV G;  1NTK G;  4U3F D;  5AW5 B;  4M3L A;  5H2F H;  2E42 A;  1IFP A;  3VMX A;  2O1J A;  2GUS A;  2KSJ A;  4HM4 A;  4I7Z C;  1OZH A;  1USD A;  1IFJ A;  4YTP C;  1LTI C;  1L2P A;  3Q5R A;  1SQV K;  1O7N A;  1D7M A;  1NTZ E;  3R2P A;  4GOD A;  2JDI H;  3EFG A;  2Z5I A;  2E74 B;  2WSC H;  1YTZ T;  4U3F G;  3KPE A;  1KN7 A;  5BVZ A;  3CCM P;  1PV3 A;  5TIS E;  4EI2 A;  1M1J C;  3CCJ P;  1LTS C;  1R5S A;  2LKM A;  3HTK A;  1PL5 A;  2P1J A;  3RBZ A;  1VQ6 P;  1BSN A;  1NTZ D;  4QUP A;  4D6T E;  4UB8 E;  1FOS F;  1AVO A;  4HM1 A;  2HMM A;  5B5E E;  1L0L G;  1RY3 A;  1KB9 H;  4PV1 B;  5HL4 A;  2J58 A;  3BCC G;  1VM9 A;  4UB6 H;  1HGZ A;  1LTT C;  2WZ7 A;  4H0L D;  5APU A;  1Y9B A;  5CJ4 A;  3ABV C;  3GHG A;  1S9K E;  3VP9 A;  3T97 A;  4ZNC A;  1L0L K;  1NU1 E;  2MJZ A;  3CWB E;  1QVF O;  2JKV A;  2P58 A;  1KQL A;  3E7K A;  3H1J G;  4I7Z B;  1Z56 A;  4BRY B;  1VL2 A;  1FZB A;  1S9K D;  2QA4 P;  1URQ D;  3KZI H;  1BE3 J;  1FDM A;  1YIJ P;  1NU1 D;  3RL0 D;  1WT6 A;  3LID A;  4D6T G;  1P84 D;  2Q9I A;  1URQ C;  2QJY C;  1RF1 C;  2Z5H A;  1NDO A;  1LNQ A;  3RL0 C;  1SQX E;  2IZ0 A;  1Q2N A;  3L70 J;  1XTC C;  3G9R A;  3U59 A;  1LTJ A;  4ASV A;  3A0B H;  2P10 A;  1KQS O;  1LTG C;  4C7N B;  4ZKP A;  1QX8 A;  4ZKU A;  1Y8A A;  1OX3 A;  5B66 H;  3CWB G;  3H1K E; 
#chains in the Genus database with same CATH homology
 1O7M A;  2XSO A;  2HMM A;  4H44 D;  1PPJ E;  4HM3 A;  3VCA A;  2B24 A;  1O7P A;  3GOB A;  3H1J E;  4P1B H;  3GL2 A;  2B1X A;  1SQV E;  4QCK A;  5HL4 A;  1P84 E;  3L70 E;  3H1I E;  1O7H A;  1VCK A;  2GBW A;  5KLV E;  2DE5 D;  2A06 E;  1VM9 A;  1SQQ E;  1SJG A;  2E4Q A;  2JO6 A;  3AZC A;  4NB8 D;  2XR8 A;  1G8K B;  4NBH D;  2ZT9 D;  2XSH A;  2YIU C;  2NUK A;  3D89 A;  1ZRT E;  4H0L D;  4HM0 A;  3GZX A;  3GKE A;  3L75 E;  2JZA A;  4PV1 D;  4U3F E;  2DE7 D;  3VMH D;  1KYO E;  5BOK A;  2BMR A;  4OGQ D;  3GL0 A;  3FOU A;  1BGY E;  4NBB D;  2YFI A;  3GZY A;  1KB9 E;  1UUW A;  4NBF D;  4EMJ B;  4P1C H;  2HMO A;  2YVJ B;  1Q90 C;  4HM5 A;  1NU1 E;  4PD4 E;  2Q3W A;  1G8J B;  4HM2 A;  4AAY B;  3CWB E;  4NBD D;  4AIV A;  2I7F A;  2QJK C;  2HMJ A;  1NTM E;  5KLI C;  1BCC E;  2FYN C;  1L0L E;  3H1K E;  2HMK A;  4HM6 A;  5KKZ C;  4NBA D;  1VF5 D;  1WQL A;  3GTS A;  3CX5 E;  2D2C D;  4NB9 D;  2NUM A;  3VCP A;  3L74 E;  3GB4 A;  2QJP C;  2QPZ A;  4HM7 A;  2FYU E;  1SQP E;  2NVF A;  3VMG D;  3VMI D;  2E75 D;  3TGU E;  1UUV A;  1O7G A;  2YFL A;  1NYK A;  3CXH E;  2QJY C;  2E4P A;  4QDC A;  1ULJ A;  4HM4 A;  2E76 D;  1RFS A;  1NDO A;  5AEU A;  3GTE A;  2BCC E;  1O7N A;  1SQX E;  2NWF A;  1JM1 A;  4H13 D;  1EG9 A;  4NBG D;  1NTZ E;  3H1L E;  3BCC E;  4HKV A;  1RIE A;  2XRX A;  4QDF A;  3GCE A;  2NVG A;  2CKF A;  3EQQ A;  4QUR A;  1PP9 E;  3L71 E;  1ULI A;  1SQB E;  4HJL A;  1NTK E;  2IBZ E;  3N0Q A;  4QDD A;  2YFJ A;  3DQY A;  4QUQ A;  5CXM A;  2BMO A;  3H1H E;  3C0D A;  2HMN A;  3L72 E;  1L0N E;  1BE3 E;  1FQT A;  2E74 D;  4QDF B;  2GBX A;  2DE6 D;  4NBC D;  5AEW A;  2HML A;  4HM8 A;  2NVE A;  1EZV E;  1O7W A;  4QUP A;  3EN1 A;  2ZYL A;  4D6T E;  2BMQ A;  3L73 E;  4HM1 A;  4NBE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...