3L72E

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 36
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l72E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l72E02
3D89A 4PD4E 1O7WA 1Q90C 4NBAD 4NBBD 1P84E 3DQYA 2YFJA 4HJLA 3CX5E 2JZAA 2Q3WA 4NB8D 3BCCE 2E74D 2NVFA 1SQBE 3H1HE 2QJYC 4QURA 4QDFA 4QDDA 1G8KB 1PPJE 4NBHD 3GCEA 1SQPE 1O7PA 1SQXE 5KLIC 4HM8A 4HKVA 3FOUA 1L0LE 4P1BH 3GL0A 1VCKA 1BCCE 1ZRTE 4P1CH 1G8JB 4AAYB 1NDOA 2QJPC 1ULIA 2D2CD 4NB9D 1PP9E 1SQVE 2BMRA 5AEUA 4H13D 2B24A 2E4PA 3VMID 1EZVE 3L73E 1UUWA 2QJKC 3GZXA 4H44D 1EG9A 3GTSA 1L0NE 2DE7D 1VF5D 1NU1E 2DE6D 2FYUE 2NUKA 2HMKA 3VCAA 2GBXA 4QDCA 4HM3A 1NTZE 4H0LD 2QPZA 2CKFA 2HMJA 2YFIA 3L75E 1KB9E 2YIUC 3EQQA 1BGYE 1VM9A 1O7MA 2E76D 3N0QA 4EMJB 3VCPA 2XR8A 4HM6A 2XSHA 2B1XA 2FYNC 4HM5A 5KKZC 4OGQD 5KLVE 4HM2A 3VMHD 4QUQA 2BMQA 4HM0A 2BMOA 4NBGD 3H1IE 1WQLA 1RIEA 3TGUE 4QUPA 2YFLA 4HM7A 3L71E 3GZYA 3CWBE 2NVGA 1JM1A 2E4QA 1SQQE 4HM4A 3AZCA 2NWFA 1BE3E 2HMMA 1KYOE 4NBED 3EN1A 1O7HA 2NUMA 2I7FA 2HMLA 1ULJA 2E75D 5CXMA 3CXHE 4NBDD 1NTKE 1NTME 3GTEA 4U3FE 2DE5D 3H1JE 3H1KE 3GKEA 1O7NA 3H1LE 2ZYLA 2HMOA 2GBWA 4NBCD 4PV1D 4QDFB 1FQTA 3GOBA 2ZT9D 4NBFD 3GB4A 3L70E 3L72E 4D6TE 5AEWA 2JO6A 2XRXA 4AIVA 2XSOA 3C0DA 1SJGA 2BCCE 5BOKA 1RFSA 4QCKA 4HM1A 2HMNA 2A06E 1NYKA 5HL4A 2NVEA 3VMGD 2IBZE 3L74E 2YVJB 1UUVA 1O7GA 3GL2A
chains in the Genus database with same CATH superfamily
1O7WA 1KILB 2WPRA 1AFOA 1YQ3C 1KILA 1GL2D 3FGAD 1P84H 5KLIC 2GUVA 3B5NC 1FJKA 1YHQP 4W7ZA 5CCGC 1NDOA 3WUUA 1PP9E 2FBWC 5APUA 3GHGA 2POHA 3RL0C 5AVQB 2IYPA 3BRVB 4L76A 2Y0EA 2WSFH 4KT0J 1SQPK 1NKZB 1SQXK 4OH8B 3Q5PA 1FZAA 3WU2H 2CKFA 1SQQD 3L75E 1T2KD 2ZT9B 1BE3D 1VQ5P 3VCPA 2XR8A 2B1XA 5KKZC 2IFMA 1H89A 2Q1KA 4HM2A 4GOFA 4WB4A 2BMQA 1USEA 1GK6A 2B9BA 1DIPA 1PPJD 1OXZA 2BCCD 3M0AA 4I7ZC 1SQQJ 1QL2A 1BE3J 4YTPC 3EQ2A 1HJBA 4LLHA 2JDIH 3C0DA 1AV1A 1IJDB 3VMXA 2R32A 5B5EH 2L91A 1KC8Q 5KAIE 3M0DA 2JO1A 1ZRTD 2IBZE 2QG4A 1XTCC 2BCCJ 5AW6B 2AEMA 3RK2C 2NPSA 2WZ7A 3D89A 2E76B 2YFJA 3H6PA 3CX5E 3QH9A 1KQLA 2QM8A 4B86A 1S9KD 4QDDA 3V4QA 2HODA 2YMYA 1HVVA 1JY2N 2QIWA 3OJAB 1VCKA 1BCCE 2KZIA 1FZEA 1OVVA 3H1HG 1KN7A 5AEUA 1USDA 4Z1MH 2YKPA 3KQGA 2FFDB 1L0LG 2E75B 1ZMEC 1WT6A 3H1ID 3O6QB 3TGUD 5APQA 1ZXGA 2JKVA 4JYCA 1BSHA 1VM9A 1O7MA 3V2NA 2XSHA 1KYOH 1NTKD 2QM7A 5GTHE 2WWWA 2K88A 2PGDA 2N1TB 2J58A 3AZCA 2NWFA 2N1TA 3H1IJ 3TGUJ 1YJNP 1LP1B 1Q2NA 5M1BA 3HD7D 1VPCA 3OW2O 1NO4A 2IDBA 4IL6X 4PD4D 1BSNA 2OYIA 2LKMA 3CXHH 1NTKJ 2IX7C 3BCCD 3ABVC 2WPQA 4XE5B 5AW3B 5CCGD 3H1JG 2NRGA 5H2FH 1YIJP 3RL0D 2M3BA 1EZVI 1M1JA 3NMDA 1X0TA 2IFNA 3FX0A 4NBBD 4ZKUA 1VQNP 3Q5RA 2WITA 1NU1D 3BCCJ 4LGDE 3B5NB 2J5UA 2D2CD 1N2DC 2WSCH 1AJYA 2BMRA 3SFDC 5KLVD 1SQXG 2E4PA 2Q7CA 5TISE 4BXLA 1KMIZ 1ZLLA 3L71D 1G2CA 3H25A 1KB9E 1EDJA 3VMZA 3WUVA 4HM6A 4RJTA 2NZ2A 2Y0DA 4ZKPA 3AE9C 2SPZA 4GOEA 2FYUK 5KLVJ 3CWBE 3AEEC 2I1JA 1YTZT 3U1AA 1FDMA 2RH0A 3BASA 3LW5J 3L71J 1ULJA 1KORA 4PJ0H 2K1AA 5AW1B 2L5GB 3G9RA 2W8ZA 1IFNA 1L4AC 4AIVA 4XFJA 3VN0A 4K3AA 3Q3DA 2ZYDA 4A7PA 2KB7P 5AW8B 1P84I 1E5WA 4D6TG 3MIWA 3RK2B 1S72P 2GM4A 5CHXA 1PP9D 1HBWA 5AW9B 4DCKA 1LWUA 1OW6A 3BRTB 1QEXA 3JCUH 3BATA 2HR3A 2KK7A 1SVFA 1PPJE 1G8KB 4OWFA 1M90Q 3TNUA 1OZHA 3AECC 1L2PA 3L75D 3V6IA 2O3JA 1ZOYC 1URQA 2CK3H 5AVWB 1PP9J 4HYTB 4UB6H 1NTZE 2K37A 1SFCC 2IZ1A 3CCMP 2QJPB 1MZ9A 4JPZB 3VMHD 3L75J 1L0NK 2JWDA 2Y9YA 3TK1A 1RY3A 2C0WA 2WSEJ 1LT9A 3TDKA 1JM0A 2P7JA 1VF5C 1GL2C 5CBOA 1OFCX 2OARA 2IBZD 3CX5D 1N7SA 1S5LX 2C0XA 5AW0B 2KXPB 2R5BA 4U3FG 3H32B 3L35A 1IC2A 1BCCD 3L74E 1PGOA 5CBNA 1Q90C 2A06G 2OYHA 4OVNF 4BWNA 5GTIE 2H89C 1LTTC 1JY3O 5B66H 2FXPA 1S5LE 2K9JA 4N3YB 2XV5A 4U7JA 4HM8A 2XNXA 4HKVA 1H8AA 1X9VA 3FXEA 2M5AB 4BRYB 1NTMK 1JOCA 2QEXP 2N9YB 1FZCA 2ZJSE 1VQLP 1BCCJ 2GA1A 2RMZA 1J1DB 1KYOI 3U59A 3L74G 4L74A 1HWTC 2YXQB 3CC7P 1LTBC 3M9QA 2E74C 3L4FA 1EZVG 3GG2A 1SQVK 3JC22 1L4AD 1EDLA 4NBGD 1JO5A 3RK3E 1WQLA 1W5CE 5AVZB 1X8YA 2PRRA 3CCRP 1A02J 2YKOA 3AE4C 1UIIA 3Q5SA 1UIXA 2DE5D 1SLQA 2OYOA 3L70E 1L4AB 2XRXA 2V7QJ 1AVOA 2KI7B 1M57D 2Y9ZA 4ZNCA 4HM1A 2Q9IA 2IZ0A 1GTWA 2UWJE 1S4XA 3CC2P 1NHLA 1P84E 3DQYA 1GD2E 1T3UA 1N73C 3CCVP 4IFFA 1VQ4P 1LTIC 1HGVA 1LTJA 4NBHD 5AVUB 3CCSP 3TYYA 2BEZF 2GUSA 1KB9D 1YJ9P 1DD3A 4W80A 1FS0E 3AEBC 3AE6C 2QJKC 3L73E 3HE5B 1CI6A 3PRJA 3WU2E 1VF5D 1HJ0A 3HD7C 4KJMA 2JEEA 3MD0A 3CWBD 3AEDC 3VCAA 2GBXA 4QDCA 4RESB 1QGKB 1OVRA 4HM3A 3HE4B 1SFCB 2KSEA 1L0NG 1FZBA 4HM5A 3CMEP 1JMBA 4WBAA 3CCQP 1BGYG 4QUPA 1J1EB 1FJPA 2YO3A 1MUUA 3CD6P 4H13C 1GU4A 4H44C 3RK3C 2HMMA 1Q90D 2V4HA 1GL2B 3CWBJ 3L73G 1OW8A 1S2EA 1MFTA 1K9MQ 3N7NA 1NTME 2W6BA 4NPFX 2ZYLA 1M1KQ 2D2CC 3V2PA 5B5EE 2W90A 3GB4A 1EXIA 1SJGA 1VQMP 2HMNA 1KFMA 5HL4A 3L37A 4IFMA 2FXOA 1RE4A 1NYHA 3L72G 1IK9A 1RQUA 3D71A 2ZFCA 5DJTB 4GT1A 3CMAP 3RBXA 3S9OA 2E74D 1SQBE 3H1HE 1VDFA 1NTMG 4C46A 3NFQA 2Q6QA 1L0LE 3GW6A 1NTZD 4P1CH 3AE1C 3AE2C 1A02F 5APTA 1WRGA 3CCLP 1K8AQ 1FU1A 2M3EA 3K5BA 2XZRA 1SQVG 2ITAA 2NUKA 1X22A 1IFPA 1JTHB 4H0LD 3M91A 2YFIA 2A06D 3M9BA 4MN4C 3G6EP 2O1JA 2XKMA 1LWUC 1NTZJ 1SQBG 4HM0A 3HRNA 4I1LA 3D6YA 2AXTH 1DEBA 2FFDA 1CW5A 3GZYA 4JBZA 2YMKA 3O6QA 5AVXB 3EN1A 2HMLA 3CXHE 4QMAA 3AEAC 1URQC 1QX8A 1BDDA 3L74D 1LTAC 5KAIH 3H1JE 1NVOA 1OX3A 2GBWA 1K05A 3CCUP 2G3AA 1FQTA 3VP8A 1ZV8A 5H2FE 1R5SA 1SQQK 4RKUJ 5BOKA 3CL3D 1OVUA 2O01J 1VQOP 3KZIE 3M9HA 2WPVB 1LP1A 1HH0A 2XU6A 3HUSC 3MHVA 1LT9C 3L74J 3SSUA 1N73B 1PV3A 3RL0g 2NVFA 1T6AA 2QJYC 3SFEC 3GCEA 1SQPE 1SQXE 3A2AA 3CI9A 1EC5A 4Y99B 4YXDC 1YBKA 1NOHA 3FWNA 4TT3H 1U7JA 1PGJA 2R3CA 4H13D 5AVTB 1N7SC 3B8EB 2J59M 2QJKB 4H44D 5E79H 3RK3D 2DE7D 3KDPB 1LJ2A 3HD7B 2YNYA 1LNQA 3E7KA 2QPZA 1M8OB 2YIUC 5KLIB 3LIDA 3RGUA 1XTGB 4YXWH 5AW7B 2DW3A 5BVZA 3RBZA 2OYHC 5CCHA 1QL1A 3B5NA 3MP7B 1SQPG 3RL0B 3AE5C 5APSA 2H8PD 1DX7A 3R4YA 3L70D 1JUNA 1MKMA 3V2QA 4PJ0E 1KILE 1PGPA 1YJWP 4NBED 1T3JA 2WT7B 1FZCC 4WY4C 4W7YA 1VQ9P 3S1KA 3VMYA 3OA7A 5AVRB 2HLOA 3V5BA 5KKZB 3MTUE 1S1CX 1H0TB 3GKEA 4DJGA 1P84D 2HMOA 1R5LA 2D2CB 4D6TE 4IL6H 1OWAA 1JEKA 3L70J 1NTKK 4I7ZB 4JQ0D 3JCUE 3GL2A 1JY3N 3S4RA 2R44A 3L73D 2B87B 4I6MC 3A0BH 2AEFA 2PAJA 4PV1C 1RF1C 1JMMA 3AEFC 4ZMDA 1KD1Q 1KB9H 2Z5HA 4IOIH 3KHUA 1Z56A 3GZXA 4GODA 2VRSA 2AXCA 4AUWA 2WSSH 2WSFJ 3L72D 2ZVNB 4XA4A 2WVRA 1URQD 3L73J 2HMJA 1AVYA 1NGMB 4AQRD 1NTMD 3EWKA 1QLED 1LTJC 1QVFO 1RIEA 1NU1K 2YXRB 2Q3IA 2HPCB 5KJ7A 3G71P 3F89A 2H88C 2ZXXA 2K3RA 4HM4A 3II6A 3PTZA 3GLMA 2AEJA 2KNCB 3L72J 5DJUB 3U1CA 1GDTA 5KLVK 1EQ7A 3FXDA 1KILC 4U3FE 1SQQG 2JJLA 3A7OA 1O7NA 4OGQC 4QDFB 1NTMJ 1SQBD 3H1HD 1Y8AA 3CCJP 2A06E 3T97B 1PZQA 1L0LD 1IFMA 1N7SD 3GHGC 2WQYC 3P8MC 1KQFB 1DEEG 5B66E 1YTZI 3HUSB 2O1KA 1RF0A 3MUDA 4HJLA 2OQQA 1BDCA 2QJYB 4C7NB 2ZT9C 4JYBA 5KAFH 1SQBJ 3H1HJ 3A0HH 1RE3A 3H32A 4UB8H 1L0LJ 5AVSB 2KLVA 1EZVE 1NAFA 4N6JA 1GU5A 1EG9A 1KFNA 1LTGC 1FDIA 2A45H 4WY4D 1N86A 1RHZB 2FYUE 1RE4C 2KS1B 4R4LA 2OTLP 1ZW0A 4EMJB 2K9YA 3CXHD 3VMAA 2M5AA 4BRYA 3H1JD 3IFMA 2IPPA 1Q7YQ 3M0DC 4N78E 2IBZI 2KIKA 3I55P 1FOSF 2NPSC 3PH0A 3TGUG 3P8CE 1O7HA 4WY4B 3HTKB 3AE3C 2FY8A 2FYUG 4PV1D 3GOBA 2KP8A 2W27A 1NTKG 1IFIA 3TSIA 1FAVA 3H1JJ 4EDFA 1SQPD 3CC4P 1SQXD 1NYKA 3C9IA 4H0LC 4R4MA 4NBAD 2E75C 1R8EA 2I8DA 4PD4H 1L4AA 4PV1B 5CMZA 1RF1B 3FOUA 3N4XA 5AVYB 3WMM0 1SQPJ 2WSCJ 1JY2P 1SQXJ 1T8ZA 2R3SA 1FOSE 1KQSO 3GF3A 3IR9A 1UUWA 3GTSA 1L0NE 5APWA 2N1TC 3CCEP 1N8RQ 3VP9A 3E1IA 1KILD 1BGYE 2JWAA 3SWFA 3N0QA 2KYVA 4OGQD 1NU1G 2OYIC 5CJ4A 2BMOA 2QA4P 4EOTA 1M7LA 3V4WA 3A3YB 3VTPC 2LR2A 2YFLA 4ASWA 2NVGA 3HE5A 4D6TD 5L8RJ 2KUBA 1M1JC 3LW5H 2I7FA 3W68A 2M8RA 3HE4A 1SFCA 3KXDA 4O9BA 4NBCD 1W2EA 3G4SP 4OGQB 1WMKA 2ZT9D 3L72E 5AEWA 2OGUA 1NJIQ 2PFXA 5CCHC 4D6TJ 1VF5B 1E79H 3GHGB 5AW4B 1GL2A 2ZYGA 4GIFA 2JZAA 2Q3WA 2W6AA 3JSVC 1KB9I 1KV4A 3PHLA 1QVGO 1HF9A 1G8JB 1SQVE 1Y47A 3Q2YA 2KZJA 5KTBA 4EYYQ 2N9BA 2NPSD 1PP9G 1OMIA 2W6JH 1PGQA 2E76D 2HG5D 1IFDA 1NAYA 2AXTE 1ZN5A 4K35A 4U3FD 1VQKP 3L75G 1FE6A 3ZDMA 1MFZA 1VQ8P 1YITP 2WSEH 1AA0A 1KYOE 2NPSB 1EDKA 2E74B 2WTYA 1JTHA 2E75D 4NBDD 3VYIA 3IF4A 4KHXA 2HODB 4U3FJ 2QRXA 1JY3P 5AVVB 2FXMA 4QCKA 2KSJA 4WVZA 1MV8A 4DZOA 1X79B 2NVEA 4I2LC 4HJGH 4H0LB 2N1TD 5KJ7C 2Z4EA 1YYCA 1DD4A 4NB8D 3USSA 1EZVD 4GKGA 2IBZG 2WMMA 1J2JB 2FYUD 2OTKE 3CX5H 3NTNA 4AAYB 2A45I 2QJPC 3C1LA 5E79E 4NB9D 1DH3A 5BU5A 4TLFA 3IN6A 1BCCG 1RQVA 2RKLA 4EI2A 4L75A 1LT1A 3W67A 2Z5IA 1N73A 4ASVA 4N78D 2P10A 2KOGA 1RF0C 1W2BO 1VQ7P 3MUDC 2FYUJ 2FYNC 3F5HA 3P8CD 1IFJA 1YI2P 2OYIB 1JCDA 4QUQA 1U7MA 2HYNA 1EDIA 1SP4A 1ZP0C 2E5YA 2FKWB 1TU3F 1OIPA 5CCHD 5CJ0A 2PP6A 3B5ND 1NTZK 5GTHH 2LXBA 3SWYA 1FZFA 2FYZA 2Q5UA 3HD7A 1N7LA 1RE3C 2W83C 1M1JB 1IZNB 1GW3A 1M56D 2QE7H 5CXMA 1H88A 3KZIH 3GTEA 4IL6E 3H1KE 5CCGA 3H1LE 3G3ZA 1PIXA 3D6ZA 5K5GB 3VOPA 2XSOA 2V7QH 4H13B 5AW5B 1RFSA 1ZR2A 4H44B 4YPCA 2ZYAA 3RK3B 4PD4I 2RN0A 3P32A 2WT7A 2XNDH 5BU8B 1K04A 3A0BE 4HH2A 2QVAA 1PFIA 5APYA 3B4SA 2P2UA 1J1DC 1H0TA 2WPSA 3GF7A 3PP5A 1G2CB 1L0ND 1Q86Q 2P58A 1KTMA 3MGNA 3FWLA 5AW2B 3H1KG 3R2PA 1VQPP 3H1LG 1NU1J 3EFFK 1BGYD 1JY2O 3TF5A 1GMJA 2MJZA 2P1JA 2XDJA 3D70A 3OAKA 3PJSK 1RH5B 1FBMA 2DE6D 3GMAA 2HMKA 3RK2D 3A5TA 5TISH 2B87A 2OTJP 3KPEA 1L0NJ 3KYQA 4GDOA 2LXCB 4UB6E 1BGYJ 2H43A 5TJHA 4AYCA 3P7KA 1JCCA 2M0BA 2E4QA 2HFED 1SQQE 4DT0A 1BE3E 3AEGC 5KJ7D 2YO2A 3CWBG 2E42A 1LWUB 2JR8A 5EFWB 1U57A 4NBFD 3TNUB 2BCCE 2HPCA 3EFGA 2R5DA 2MKVA 2I1KA 3SWKA 1GW4A 1AQTA 1JNMA 2KNCA 2YVJB 1NWQA 1S3JA 1URQB 1O7GA 1SQVD 2B89A 1AQ5A 1BE3G 1GK4A 4L73A 5KAFE 4Y28J 4WWIA 4QDFA 3A0HE 2G8YA 1D7MA 4UB8E 4P1BH 3GL0A 1ZRTE 1CSBA 2KLUA 3T97A 5APVA 1PPJG 2BCCG 2QSIA 1J1EC 3HUSA 1S9KE 1LT9B 1SQVJ 3UIAA 3LIEA 1FC2C 2ZVOB 1Q81Q 3EQQA 1KYOD 4C7NA 1VQ6P 2YKQA 2FYNB 1G1IA 1KQGB 1NTZG 3I56P 1N7SB 3H1IE 1HUCA 3TGUE 2E43A 3B71A 4HM7A 4NPEA 4HB1A 3AE8C 4M3LA 1NKNA 2Q3EA 2A45G 1EXJA 3Q1MA 1HGZA 2YIUB 2KS1A 4RO0A 1NTKE 2OYHB 1T2KC 5APXA 1IO4A 2K9JB 3ITKA 4JF7A 2CPSA 2JO6A 2C9LY 2O01H 3M06A 1LGHB 2C9NY 1FZCB 1OW7A 3H1IG 2BASA 2ZXEB 3CX5I 1LTSC 1UUVA 4WY4A 4PD4E 2E76C 3HTKA 2CPBA 1IK7A 1YQ4C 2B88A 3BCCE 1FZGA 4QURA 2O01N 1CZQA 4IFDK 1O7PA 3AE7C 1PL5A 5GTIH 2P67A 1S5LH 1ULIA 2E5TA 3O8ZA 3I5CA 2B24A 2ZAEB 2FFDC 4CPGA 4EIJA 3VMID 1SQBK 1NH4A 3L36A 1NU1E 3MZWB 3CLQA 3PLNA 1L0LK 3CXHI 3E1RA 3BVHA 1RF1A 3BCCG 3CPWO 5KLVE 1KZUB 4DOJA 2Y0CA 1HTLC 3H1KD 3H1LD 3L71E 2IYOA 1JM1A 3C8VA 2H7HA 5C39A 1GZLA 1FDOA 3NXSA 1K73Q 1SS1A 2NUMA 2JP3A 1Q82Q 4NPDA 4C7RA 3WUTA 3IAOA 1LTJB 3QWOC 1SFCD 3V2RA 1Y9BA 3H1KJ 3H1LJ 5KLVG 1ZR4A 4HKZH 4LC1A 4Y99C 3VMGD 1JB0J 1G1JA 1VL2A 3L70G 2BEQD 3L71G 1CI6B
chains in the Genus database with same CATH topology
3D89A 4PD4E 1O7WA 1Q90C 4NBAD 4NBBD 1P84E 3DQYA 2YFJA 4HJLA 3CX5E 2JZAA 2Q3WA 4NB8D 3BCCE 2E74D 2NVFA 1SQBE 3H1HE 2QJYC 4QURA 4QDFA 4QDDA 1G8KB 1PPJE 4NBHD 3GCEA 1SQPE 1O7PA 1SQXE 5KLIC 4HM8A 4HKVA 3FOUA 1L0LE 4P1BH 3GL0A 1VCKA 1BCCE 1ZRTE 4P1CH 1G8JB 4AAYB 1NDOA 2QJPC 1ULIA 2D2CD 4NB9D 1PP9E 1SQVE 2BMRA 5AEUA 4H13D 2B24A 2E4PA 3VMID 1EZVE 3L73E 1UUWA 2QJKC 3GZXA 4H44D 1EG9A 3GTSA 1L0NE 2DE7D 1VF5D 1NU1E 2DE6D 2FYUE 2NUKA 2HMKA 3VCAA 2GBXA 4QDCA 4HM3A 1NTZE 4H0LD 2QPZA 2CKFA 2HMJA 2YFIA 3L75E 1KB9E 2YIUC 3EQQA 1BGYE 1VM9A 1O7MA 2E76D 3N0QA 4EMJB 3VCPA 2XR8A 4HM6A 2XSHA 2B1XA 2FYNC 4HM5A 5KKZC 4OGQD 5KLVE 4HM2A 3VMHD 4QUQA 2BMQA 4HM0A 2BMOA 4NBGD 3H1IE 1WQLA 1RIEA 3TGUE 4QUPA 2YFLA 4HM7A 3L71E 3GZYA 3CWBE 2NVGA 1JM1A 2E4QA 1SQQE 4HM4A 3AZCA 2NWFA 1BE3E 2HMMA 1KYOE 4NBED 3EN1A 1O7HA 2NUMA 2I7FA 2HMLA 1ULJA 2E75D 5CXMA 3CXHE 4NBDD 1NTKE 1NTME 3GTEA 4U3FE 2DE5D 3H1JE 3H1KE 3GKEA 1O7NA 3H1LE 2ZYLA 2HMOA 2GBWA 4NBCD 4PV1D 4QDFB 1FQTA 3GOBA 2ZT9D 4NBFD 3GB4A 3L70E 3L72E 4D6TE 5AEWA 2JO6A 2XRXA 4AIVA 2XSOA 3C0DA 1SJGA 2BCCE 5BOKA 1RFSA 4QCKA 4HM1A 2HMNA 2A06E 1NYKA 5HL4A 2NVEA 3VMGD 2IBZE 3L74E 2YVJB 1UUVA 1O7GA 3GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D89 A;  4PD4 E;  1O7W A;  1Q90 C;  4NBA D;  4NBB D;  1P84 E;  3DQY A;  2YFJ A;  4HJL A;  3CX5 E;  2JZA A;  2Q3W A;  4NB8 D;  3BCC E;  2E74 D;  2NVF A;  1SQB E;  3H1H E;  2QJY C;  4QUR A;  4QDF A;  4QDD A;  1G8K B;  1PPJ E;  4NBH D;  3GCE A;  1SQP E;  1O7P A;  1SQX E;  5KLI C;  4HM8 A;  4HKV A;  3FOU A;  1L0L E;  4P1B H;  3GL0 A;  1VCK A;  1BCC E;  1ZRT E;  4P1C H;  1G8J B;  4AAY B;  1NDO A;  2QJP C;  1ULI A;  2D2C D;  4NB9 D;  1PP9 E;  1SQV E;  2BMR A;  5AEU A;  4H13 D;  2B24 A;  2E4P A;  3VMI D;  1EZV E;  3L73 E;  1UUW A;  2QJK C;  3GZX A;  4H44 D;  1EG9 A;  3GTS A;  1L0N E;  2DE7 D;  1VF5 D;  1NU1 E;  2DE6 D;  2FYU E;  2NUK A;  2HMK A;  3VCA A;  2GBX A;  4QDC A;  4HM3 A;  1NTZ E;  4H0L D;  2QPZ A;  2CKF A;  2HMJ A;  2YFI A;  3L75 E;  1KB9 E;  2YIU C;  3EQQ A;  1BGY E;  1VM9 A;  1O7M A;  2E76 D;  3N0Q A;  4EMJ B;  3VCP A;  2XR8 A;  4HM6 A;  2XSH A;  2B1X A;  2FYN C;  4HM5 A;  5KKZ C;  4OGQ D;  5KLV E;  4HM2 A;  3VMH D;  4QUQ A;  2BMQ A;  4HM0 A;  2BMO A;  4NBG D;  3H1I E;  1WQL A;  1RIE A;  3TGU E;  4QUP A;  2YFL A;  4HM7 A;  3L71 E;  3GZY A;  3CWB E;  2NVG A;  1JM1 A;  2E4Q A;  1SQQ E;  4HM4 A;  3AZC A;  2NWF A;  1BE3 E;  2HMM A;  1KYO E;  4NBE D;  3EN1 A;  1O7H A;  2NUM A;  2I7F A;  2HML A;  1ULJ A;  2E75 D;  5CXM A;  3CXH E;  4NBD D;  1NTK E;  1NTM E;  3GTE A;  4U3F E;  2DE5 D;  3H1J E;  3H1K E;  3GKE A;  1O7N A;  3H1L E;  2ZYL A;  2HMO A;  2GBW A;  4NBC D;  4PV1 D;  4QDF B;  1FQT A;  3GOB A;  2ZT9 D;  4NBF D;  3GB4 A;  3L70 E;  3L72 E;  4D6T E;  5AEW A;  2JO6 A;  2XRX A;  4AIV A;  2XSO A;  3C0D A;  1SJG A;  2BCC E;  5BOK A;  1RFS A;  4QCK A;  4HM1 A;  2HMN A;  2A06 E;  1NYK A;  5HL4 A;  2NVE A;  3VMG D;  2IBZ E;  3L74 E;  2YVJ B;  1UUV A;  1O7G A;  3GL2 A; 
#chains in the Genus database with same CATH topology
 1O7W A;  1KIL B;  2WPR A;  1AFO A;  1YQ3 C;  1KIL A;  1GL2 D;  3FGA D;  1P84 H;  5KLI C;  2GUV A;  3B5N C;  1FJK A;  1YHQ P;  4W7Z A;  5CCG C;  1NDO A;  3WUU A;  1PP9 E;  2FBW C;  5APU A;  3GHG A;  2POH A;  3RL0 C;  5AVQ B;  2IYP A;  3BRV B;  4L76 A;  2Y0E A;  2WSF H;  4KT0 J;  1SQP K;  1NKZ B;  1SQX K;  4OH8 B;  3Q5P A;  1FZA A;  3WU2 H;  2CKF A;  1SQQ D;  3L75 E;  1T2K D;  2ZT9 B;  1BE3 D;  1VQ5 P;  3VCP A;  2XR8 A;  2B1X A;  5KKZ C;  2IFM A;  1H89 A;  2Q1K A;  4HM2 A;  4GOF A;  4WB4 A;  2BMQ A;  1USE A;  1GK6 A;  2B9B A;  1DIP A;  1PPJ D;  1OXZ A;  2BCC D;  3M0A A;  4I7Z C;  1SQQ J;  1QL2 A;  1BE3 J;  4YTP C;  3EQ2 A;  1HJB A;  4LLH A;  2JDI H;  3C0D A;  1AV1 A;  1IJD B;  3VMX A;  2R32 A;  5B5E H;  2L91 A;  1KC8 Q;  5KAI E;  3M0D A;  2JO1 A;  1ZRT D;  2IBZ E;  2QG4 A;  1XTC C;  2BCC J;  5AW6 B;  2AEM A;  3RK2 C;  2NPS A;  2WZ7 A;  3D89 A;  2E76 B;  2YFJ A;  3H6P A;  3CX5 E;  3QH9 A;  1KQL A;  2QM8 A;  4B86 A;  1S9K D;  4QDD A;  3V4Q A;  2HOD A;  2YMY A;  1HVV A;  1JY2 N;  2QIW A;  3OJA B;  1VCK A;  1BCC E;  2KZI A;  1FZE A;  1OVV A;  3H1H G;  1KN7 A;  5AEU A;  1USD A;  4Z1M H;  2YKP A;  3KQG A;  2FFD B;  1L0L G;  2E75 B;  1ZME C;  1WT6 A;  3H1I D;  3O6Q B;  3TGU D;  5APQ A;  1ZXG A;  2JKV A;  4JYC A;  1BSH A;  1VM9 A;  1O7M A;  3V2N A;  2XSH A;  1KYO H;  1NTK D;  2QM7 A;  5GTH E;  2WWW A;  2K88 A;  2PGD A;  2N1T B;  2J58 A;  3AZC A;  2NWF A;  2N1T A;  3H1I J;  3TGU J;  1YJN P;  1LP1 B;  1Q2N A;  5M1B A;  3HD7 D;  1VPC A;  3OW2 O;  1NO4 A;  2IDB A;  4IL6 X;  4PD4 D;  1BSN A;  2OYI A;  2LKM A;  3CXH H;  1NTK J;  2IX7 C;  3BCC D;  3ABV C;  2WPQ A;  4XE5 B;  5AW3 B;  5CCG D;  3H1J G;  2NRG A;  5H2F H;  1YIJ P;  3RL0 D;  2M3B A;  1EZV I;  1M1J A;  3NMD A;  1X0T A;  2IFN A;  3FX0 A;  4NBB D;  4ZKU A;  1VQN P;  3Q5R A;  2WIT A;  1NU1 D;  3BCC J;  4LGD E;  3B5N B;  2J5U A;  2D2C D;  1N2D C;  2WSC H;  1AJY A;  2BMR A;  3SFD C;  5KLV D;  1SQX G;  2E4P A;  2Q7C A;  5TIS E;  4BXL A;  1KMI Z;  1ZLL A;  3L71 D;  1G2C A;  3H25 A;  1KB9 E;  1EDJ A;  3VMZ A;  3WUV A;  4HM6 A;  4RJT A;  2NZ2 A;  2Y0D A;  4ZKP A;  3AE9 C;  2SPZ A;  4GOE A;  2FYU K;  5KLV J;  3CWB E;  3AEE C;  2I1J A;  1YTZ T;  3U1A A;  1FDM A;  2RH0 A;  3BAS A;  3LW5 J;  3L71 J;  1ULJ A;  1KOR A;  4PJ0 H;  2K1A A;  5AW1 B;  2L5G B;  3G9R A;  2W8Z A;  1IFN A;  1L4A C;  4AIV A;  4XFJ A;  3VN0 A;  4K3A A;  3Q3D A;  2ZYD A;  4A7P A;  2KB7 P;  5AW8 B;  1P84 I;  1E5W A;  4D6T G;  3MIW A;  3RK2 B;  1S72 P;  2GM4 A;  5CHX A;  1PP9 D;  1HBW A;  5AW9 B;  4DCK A;  1LWU A;  1OW6 A;  3BRT B;  1QEX A;  3JCU H;  3BAT A;  2HR3 A;  2KK7 A;  1SVF A;  1PPJ E;  1G8K B;  4OWF A;  1M90 Q;  3TNU A;  1OZH A;  3AEC C;  1L2P A;  3L75 D;  3V6I A;  2O3J A;  1ZOY C;  1URQ A;  2CK3 H;  5AVW B;  1PP9 J;  4HYT B;  4UB6 H;  1NTZ E;  2K37 A;  1SFC C;  2IZ1 A;  3CCM P;  2QJP B;  1MZ9 A;  4JPZ B;  3VMH D;  3L75 J;  1L0N K;  2JWD A;  2Y9Y A;  3TK1 A;  1RY3 A;  2C0W A;  2WSE J;  1LT9 A;  3TDK A;  1JM0 A;  2P7J A;  1VF5 C;  1GL2 C;  5CBO A;  1OFC X;  2OAR A;  2IBZ D;  3CX5 D;  1N7S A;  1S5L X;  2C0X A;  5AW0 B;  2KXP B;  2R5B A;  4U3F G;  3H32 B;  3L35 A;  1IC2 A;  1BCC D;  3L74 E;  1PGO A;  5CBN A;  1Q90 C;  2A06 G;  2OYH A;  4OVN F;  4BWN A;  5GTI E;  2H89 C;  1LTT C;  1JY3 O;  5B66 H;  2FXP A;  1S5L E;  2K9J A;  4N3Y B;  2XV5 A;  4U7J A;  4HM8 A;  2XNX A;  4HKV A;  1H8A A;  1X9V A;  3FXE A;  2M5A B;  4BRY B;  1NTM K;  1JOC A;  2QEX P;  2N9Y B;  1FZC A;  2ZJS E;  1VQL P;  1BCC J;  2GA1 A;  2RMZ A;  1J1D B;  1KYO I;  3U59 A;  3L74 G;  4L74 A;  1HWT C;  2YXQ B;  3CC7 P;  1LTB C;  3M9Q A;  2E74 C;  3L4F A;  1EZV G;  3GG2 A;  1SQV K;  3JC2 2;  1L4A D;  1EDL A;  4NBG D;  1JO5 A;  3RK3 E;  1WQL A;  1W5C E;  5AVZ B;  1X8Y A;  2PRR A;  3CCR P;  1A02 J;  2YKO A;  3AE4 C;  1UII A;  3Q5S A;  1UIX A;  2DE5 D;  1SLQ A;  2OYO A;  3L70 E;  1L4A B;  2XRX A;  2V7Q J;  1AVO A;  2KI7 B;  1M57 D;  2Y9Z A;  4ZNC A;  4HM1 A;  2Q9I A;  2IZ0 A;  1GTW A;  2UWJ E;  1S4X A;  3CC2 P;  1NHL A;  1P84 E;  3DQY A;  1GD2 E;  1T3U A;  1N73 C;  3CCV P;  4IFF A;  1VQ4 P;  1LTI C;  1HGV A;  1LTJ A;  4NBH D;  5AVU B;  3CCS P;  3TYY A;  2BEZ F;  2GUS A;  1KB9 D;  1YJ9 P;  1DD3 A;  4W80 A;  1FS0 E;  3AEB C;  3AE6 C;  2QJK C;  3L73 E;  3HE5 B;  1CI6 A;  3PRJ A;  3WU2 E;  1VF5 D;  1HJ0 A;  3HD7 C;  4KJM A;  2JEE A;  3MD0 A;  3CWB D;  3AED C;  3VCA A;  2GBX A;  4QDC A;  4RES B;  1QGK B;  1OVR A;  4HM3 A;  3HE4 B;  1SFC B;  2KSE A;  1L0N G;  1FZB A;  4HM5 A;  3CME P;  1JMB A;  4WBA A;  3CCQ P;  1BGY G;  4QUP A;  1J1E B;  1FJP A;  2YO3 A;  1MUU A;  3CD6 P;  4H13 C;  1GU4 A;  4H44 C;  3RK3 C;  2HMM A;  1Q90 D;  2V4H A;  1GL2 B;  3CWB J;  3L73 G;  1OW8 A;  1S2E A;  1MFT A;  1K9M Q;  3N7N A;  1NTM E;  2W6B A;  4NPF X;  2ZYL A;  1M1K Q;  2D2C C;  3V2P A;  5B5E E;  2W90 A;  3GB4 A;  1EXI A;  1SJG A;  1VQM P;  2HMN A;  1KFM A;  5HL4 A;  3L37 A;  4IFM A;  2FXO A;  1RE4 A;  1NYH A;  3L72 G;  1IK9 A;  1RQU A;  3D71 A;  2ZFC A;  5DJT B;  4GT1 A;  3CMA P;  3RBX A;  3S9O A;  2E74 D;  1SQB E;  3H1H E;  1VDF A;  1NTM G;  4C46 A;  3NFQ A;  2Q6Q A;  1L0L E;  3GW6 A;  1NTZ D;  4P1C H;  3AE1 C;  3AE2 C;  1A02 F;  5APT A;  1WRG A;  3CCL P;  1K8A Q;  1FU1 A;  2M3E A;  3K5B A;  2XZR A;  1SQV G;  2ITA A;  2NUK A;  1X22 A;  1IFP A;  1JTH B;  4H0L D;  3M91 A;  2YFI A;  2A06 D;  3M9B A;  4MN4 C;  3G6E P;  2O1J A;  2XKM A;  1LWU C;  1NTZ J;  1SQB G;  4HM0 A;  3HRN A;  4I1L A;  3D6Y A;  2AXT H;  1DEB A;  2FFD A;  1CW5 A;  3GZY A;  4JBZ A;  2YMK A;  3O6Q A;  5AVX B;  3EN1 A;  2HML A;  3CXH E;  4QMA A;  3AEA C;  1URQ C;  1QX8 A;  1BDD A;  3L74 D;  1LTA C;  5KAI H;  3H1J E;  1NVO A;  1OX3 A;  2GBW A;  1K05 A;  3CCU P;  2G3A A;  1FQT A;  3VP8 A;  1ZV8 A;  5H2F E;  1R5S A;  1SQQ K;  4RKU J;  5BOK A;  3CL3 D;  1OVU A;  2O01 J;  1VQO P;  3KZI E;  3M9H A;  2WPV B;  1LP1 A;  1HH0 A;  2XU6 A;  3HUS C;  3MHV A;  1LT9 C;  3L74 J;  3SSU A;  1N73 B;  1PV3 A;  3RL0 g;  2NVF A;  1T6A A;  2QJY C;  3SFE C;  3GCE A;  1SQP E;  1SQX E;  3A2A A;  3CI9 A;  1EC5 A;  4Y99 B;  4YXD C;  1YBK A;  1NOH A;  3FWN A;  4TT3 H;  1U7J A;  1PGJ A;  2R3C A;  4H13 D;  5AVT B;  1N7S C;  3B8E B;  2J59 M;  2QJK B;  4H44 D;  5E79 H;  3RK3 D;  2DE7 D;  3KDP B;  1LJ2 A;  3HD7 B;  2YNY A;  1LNQ A;  3E7K A;  2QPZ A;  1M8O B;  2YIU C;  5KLI B;  3LID A;  3RGU A;  1XTG B;  4YXW H;  5AW7 B;  2DW3 A;  5BVZ A;  3RBZ A;  2OYH C;  5CCH A;  1QL1 A;  3B5N A;  3MP7 B;  1SQP G;  3RL0 B;  3AE5 C;  5APS A;  2H8P D;  1DX7 A;  3R4Y A;  3L70 D;  1JUN A;  1MKM A;  3V2Q A;  4PJ0 E;  1KIL E;  1PGP A;  1YJW P;  4NBE D;  1T3J A;  2WT7 B;  1FZC C;  4WY4 C;  4W7Y A;  1VQ9 P;  3S1K A;  3VMY A;  3OA7 A;  5AVR B;  2HLO A;  3V5B A;  5KKZ B;  3MTU E;  1S1C X;  1H0T B;  3GKE A;  4DJG A;  1P84 D;  2HMO A;  1R5L A;  2D2C B;  4D6T E;  4IL6 H;  1OWA A;  1JEK A;  3L70 J;  1NTK K;  4I7Z B;  4JQ0 D;  3JCU E;  3GL2 A;  1JY3 N;  3S4R A;  2R44 A;  3L73 D;  2B87 B;  4I6M C;  3A0B H;  2AEF A;  2PAJ A;  4PV1 C;  1RF1 C;  1JMM A;  3AEF C;  4ZMD A;  1KD1 Q;  1KB9 H;  2Z5H A;  4IOI H;  3KHU A;  1Z56 A;  3GZX A;  4GOD A;  2VRS A;  2AXC A;  4AUW A;  2WSS H;  2WSF J;  3L72 D;  2ZVN B;  4XA4 A;  2WVR A;  1URQ D;  3L73 J;  2HMJ A;  1AVY A;  1NGM B;  4AQR D;  1NTM D;  3EWK A;  1QLE D;  1LTJ C;  1QVF O;  1RIE A;  1NU1 K;  2YXR B;  2Q3I A;  2HPC B;  5KJ7 A;  3G71 P;  3F89 A;  2H88 C;  2ZXX A;  2K3R A;  4HM4 A;  3II6 A;  3PTZ A;  3GLM A;  2AEJ A;  2KNC B;  3L72 J;  5DJU B;  3U1C A;  1GDT A;  5KLV K;  1EQ7 A;  3FXD A;  1KIL C;  4U3F E;  1SQQ G;  2JJL A;  3A7O A;  1O7N A;  4OGQ C;  4QDF B;  1NTM J;  1SQB D;  3H1H D;  1Y8A A;  3CCJ P;  2A06 E;  3T97 B;  1PZQ A;  1L0L D;  1IFM A;  1N7S D;  3GHG C;  2WQY C;  3P8M C;  1KQF B;  1DEE G;  5B66 E;  1YTZ I;  3HUS B;  2O1K A;  1RF0 A;  3MUD A;  4HJL A;  2OQQ A;  1BDC A;  2QJY B;  4C7N B;  2ZT9 C;  4JYB A;  5KAF H;  1SQB J;  3H1H J;  3A0H H;  1RE3 A;  3H32 A;  4UB8 H;  1L0L J;  5AVS B;  2KLV A;  1EZV E;  1NAF A;  4N6J A;  1GU5 A;  1EG9 A;  1KFN A;  1LTG C;  1FDI A;  2A45 H;  4WY4 D;  1N86 A;  1RHZ B;  2FYU E;  1RE4 C;  2KS1 B;  4R4L A;  2OTL P;  1ZW0 A;  4EMJ B;  2K9Y A;  3CXH D;  3VMA A;  2M5A A;  4BRY A;  3H1J D;  3IFM A;  2IPP A;  1Q7Y Q;  3M0D C;  4N78 E;  2IBZ I;  2KIK A;  3I55 P;  1FOS F;  2NPS C;  3PH0 A;  3TGU G;  3P8C E;  1O7H A;  4WY4 B;  3HTK B;  3AE3 C;  2FY8 A;  2FYU G;  4PV1 D;  3GOB A;  2KP8 A;  2W27 A;  1NTK G;  1IFI A;  3TSI A;  1FAV A;  3H1J J;  4EDF A;  1SQP D;  3CC4 P;  1SQX D;  1NYK A;  3C9I A;  4H0L C;  4R4M A;  4NBA D;  2E75 C;  1R8E A;  2I8D A;  4PD4 H;  1L4A A;  4PV1 B;  5CMZ A;  1RF1 B;  3FOU A;  3N4X A;  5AVY B;  3WMM 0;  1SQP J;  2WSC J;  1JY2 P;  1SQX J;  1T8Z A;  2R3S A;  1FOS E;  1KQS O;  3GF3 A;  3IR9 A;  1UUW A;  3GTS A;  1L0N E;  5APW A;  2N1T C;  3CCE P;  1N8R Q;  3VP9 A;  3E1I A;  1KIL D;  1BGY E;  2JWA A;  3SWF A;  3N0Q A;  2KYV A;  4OGQ D;  1NU1 G;  2OYI C;  5CJ4 A;  2BMO A;  2QA4 P;  4EOT A;  1M7L A;  3V4W A;  3A3Y B;  3VTP C;  2LR2 A;  2YFL A;  4ASW A;  2NVG A;  3HE5 A;  4D6T D;  5L8R J;  2KUB A;  1M1J C;  3LW5 H;  2I7F A;  3W68 A;  2M8R A;  3HE4 A;  1SFC A;  3KXD A;  4O9B A;  4NBC D;  1W2E A;  3G4S P;  4OGQ B;  1WMK A;  2ZT9 D;  3L72 E;  5AEW A;  2OGU A;  1NJI Q;  2PFX A;  5CCH C;  4D6T J;  1VF5 B;  1E79 H;  3GHG B;  5AW4 B;  1GL2 A;  2ZYG A;  4GIF A;  2JZA A;  2Q3W A;  2W6A A;  3JSV C;  1KB9 I;  1KV4 A;  3PHL A;  1QVG O;  1HF9 A;  1G8J B;  1SQV E;  1Y47 A;  3Q2Y A;  2KZJ A;  5KTB A;  4EYY Q;  2N9B A;  2NPS D;  1PP9 G;  1OMI A;  2W6J H;  1PGQ A;  2E76 D;  2HG5 D;  1IFD A;  1NAY A;  2AXT E;  1ZN5 A;  4K35 A;  4U3F D;  1VQK P;  3L75 G;  1FE6 A;  3ZDM A;  1MFZ A;  1VQ8 P;  1YIT P;  2WSE H;  1AA0 A;  1KYO E;  2NPS B;  1EDK A;  2E74 B;  2WTY A;  1JTH A;  2E75 D;  4NBD D;  3VYI A;  3IF4 A;  4KHX A;  2HOD B;  4U3F J;  2QRX A;  1JY3 P;  5AVV B;  2FXM A;  4QCK A;  2KSJ A;  4WVZ A;  1MV8 A;  4DZO A;  1X79 B;  2NVE A;  4I2L C;  4HJG H;  4H0L B;  2N1T D;  5KJ7 C;  2Z4E A;  1YYC A;  1DD4 A;  4NB8 D;  3USS A;  1EZV D;  4GKG A;  2IBZ G;  2WMM A;  1J2J B;  2FYU D;  2OTK E;  3CX5 H;  3NTN A;  4AAY B;  2A45 I;  2QJP C;  3C1L A;  5E79 E;  4NB9 D;  1DH3 A;  5BU5 A;  4TLF A;  3IN6 A;  1BCC G;  1RQV A;  2RKL A;  4EI2 A;  4L75 A;  1LT1 A;  3W67 A;  2Z5I A;  1N73 A;  4ASV A;  4N78 D;  2P10 A;  2KOG A;  1RF0 C;  1W2B O;  1VQ7 P;  3MUD C;  2FYU J;  2FYN C;  3F5H A;  3P8C D;  1IFJ A;  1YI2 P;  2OYI B;  1JCD A;  4QUQ A;  1U7M A;  2HYN A;  1EDI A;  1SP4 A;  1ZP0 C;  2E5Y A;  2FKW B;  1TU3 F;  1OIP A;  5CCH D;  5CJ0 A;  2PP6 A;  3B5N D;  1NTZ K;  5GTH H;  2LXB A;  3SWY A;  1FZF A;  2FYZ A;  2Q5U A;  3HD7 A;  1N7L A;  1RE3 C;  2W83 C;  1M1J B;  1IZN B;  1GW3 A;  1M56 D;  2QE7 H;  5CXM A;  1H88 A;  3KZI H;  3GTE A;  4IL6 E;  3H1K E;  5CCG A;  3H1L E;  3G3Z A;  1PIX A;  3D6Z A;  5K5G B;  3VOP A;  2XSO A;  2V7Q H;  4H13 B;  5AW5 B;  1RFS A;  1ZR2 A;  4H44 B;  4YPC A;  2ZYA A;  3RK3 B;  4PD4 I;  2RN0 A;  3P32 A;  2WT7 A;  2XND H;  5BU8 B;  1K04 A;  3A0B E;  4HH2 A;  2QVA A;  1PFI A;  5APY A;  3B4S A;  2P2U A;  1J1D C;  1H0T A;  2WPS A;  3GF7 A;  3PP5 A;  1G2C B;  1L0N D;  1Q86 Q;  2P58 A;  1KTM A;  3MGN A;  3FWL A;  5AW2 B;  3H1K G;  3R2P A;  1VQP P;  3H1L G;  1NU1 J;  3EFF K;  1BGY D;  1JY2 O;  3TF5 A;  1GMJ A;  2MJZ A;  2P1J A;  2XDJ A;  3D70 A;  3OAK A;  3PJS K;  1RH5 B;  1FBM A;  2DE6 D;  3GMA A;  2HMK A;  3RK2 D;  3A5T A;  5TIS H;  2B87 A;  2OTJ P;  3KPE A;  1L0N J;  3KYQ A;  4GDO A;  2LXC B;  4UB6 E;  1BGY J;  2H43 A;  5TJH A;  4AYC A;  3P7K A;  1JCC A;  2M0B A;  2E4Q A;  2HFE D;  1SQQ E;  4DT0 A;  1BE3 E;  3AEG C;  5KJ7 D;  2YO2 A;  3CWB G;  2E42 A;  1LWU B;  2JR8 A;  5EFW B;  1U57 A;  4NBF D;  3TNU B;  2BCC E;  2HPC A;  3EFG A;  2R5D A;  2MKV A;  2I1K A;  3SWK A;  1GW4 A;  1AQT A;  1JNM A;  2KNC A;  2YVJ B;  1NWQ A;  1S3J A;  1URQ B;  1O7G A;  1SQV D;  2B89 A;  1AQ5 A;  1BE3 G;  1GK4 A;  4L73 A;  5KAF E;  4Y28 J;  4WWI A;  4QDF A;  3A0H E;  2G8Y A;  1D7M A;  4UB8 E;  4P1B H;  3GL0 A;  1ZRT E;  1CSB A;  2KLU A;  3T97 A;  5APV A;  1PPJ G;  2BCC G;  2QSI A;  1J1E C;  3HUS A;  1S9K E;  1LT9 B;  1SQV J;  3UIA A;  3LIE A;  1FC2 C;  2ZVO B;  1Q81 Q;  3EQQ A;  1KYO D;  4C7N A;  1VQ6 P;  2YKQ A;  2FYN B;  1G1I A;  1KQG B;  1NTZ G;  3I56 P;  1N7S B;  3H1I E;  1HUC A;  3TGU E;  2E43 A;  3B71 A;  4HM7 A;  4NPE A;  4HB1 A;  3AE8 C;  4M3L A;  1NKN A;  2Q3E A;  2A45 G;  1EXJ A;  3Q1M A;  1HGZ A;  2YIU B;  2KS1 A;  4RO0 A;  1NTK E;  2OYH B;  1T2K C;  5APX A;  1IO4 A;  2K9J B;  3ITK A;  4JF7 A;  2CPS A;  2JO6 A;  2C9L Y;  2O01 H;  3M06 A;  1LGH B;  2C9N Y;  1FZC B;  1OW7 A;  3H1I G;  2BAS A;  2ZXE B;  3CX5 I;  1LTS C;  1UUV A;  4WY4 A;  4PD4 E;  2E76 C;  3HTK A;  2CPB A;  1IK7 A;  1YQ4 C;  2B88 A;  3BCC E;  1FZG A;  4QUR A;  2O01 N;  1CZQ A;  4IFD K;  1O7P A;  3AE7 C;  1PL5 A;  5GTI H;  2P67 A;  1S5L H;  1ULI A;  2E5T A;  3O8Z A;  3I5C A;  2B24 A;  2ZAE B;  2FFD C;  4CPG A;  4EIJ A;  3VMI D;  1SQB K;  1NH4 A;  3L36 A;  1NU1 E;  3MZW B;  3CLQ A;  3PLN A;  1L0L K;  3CXH I;  3E1R A;  3BVH A;  1RF1 A;  3BCC G;  3CPW O;  5KLV E;  1KZU B;  4DOJ A;  2Y0C A;  1HTL C;  3H1K D;  3H1L D;  3L71 E;  2IYO A;  1JM1 A;  3C8V A;  2H7H A;  5C39 A;  1GZL A;  1FDO A;  3NXS A;  1K73 Q;  1SS1 A;  2NUM A;  2JP3 A;  1Q82 Q;  4NPD A;  4C7R A;  3WUT A;  3IAO A;  1LTJ B;  3QWO C;  1SFC D;  3V2R A;  1Y9B A;  3H1K J;  3H1L J;  5KLV G;  1ZR4 A;  4HKZ H;  4LC1 A;  4Y99 C;  3VMG D;  1JB0 J;  1G1J A;  1VL2 A;  3L70 G;  2BEQ D;  3L71 G;  1CI6 B; 
#chains in the Genus database with same CATH homology
 3D89 A;  4PD4 E;  1O7W A;  1Q90 C;  4NBA D;  4NBB D;  1P84 E;  3DQY A;  2YFJ A;  4HJL A;  3CX5 E;  2JZA A;  2Q3W A;  4NB8 D;  3BCC E;  2E74 D;  2NVF A;  1SQB E;  3H1H E;  2QJY C;  4QUR A;  4QDF A;  4QDD A;  1G8K B;  1PPJ E;  4NBH D;  3GCE A;  1SQP E;  1O7P A;  1SQX E;  5KLI C;  4HM8 A;  4HKV A;  3FOU A;  1L0L E;  4P1B H;  3GL0 A;  1VCK A;  1BCC E;  1ZRT E;  4P1C H;  1G8J B;  4AAY B;  1NDO A;  2QJP C;  1ULI A;  2D2C D;  4NB9 D;  1PP9 E;  1SQV E;  2BMR A;  5AEU A;  4H13 D;  2B24 A;  2E4P A;  3VMI D;  1EZV E;  3L73 E;  1UUW A;  2QJK C;  3GZX A;  4H44 D;  1EG9 A;  3GTS A;  1L0N E;  2DE7 D;  1VF5 D;  1NU1 E;  2DE6 D;  2FYU E;  2NUK A;  2HMK A;  3VCA A;  2GBX A;  4QDC A;  4HM3 A;  1NTZ E;  4H0L D;  2QPZ A;  2CKF A;  2HMJ A;  2YFI A;  3L75 E;  1KB9 E;  2YIU C;  3EQQ A;  1BGY E;  1VM9 A;  1O7M A;  2E76 D;  3N0Q A;  4EMJ B;  3VCP A;  2XR8 A;  4HM6 A;  2XSH A;  2B1X A;  2FYN C;  4HM5 A;  5KKZ C;  4OGQ D;  5KLV E;  4HM2 A;  3VMH D;  4QUQ A;  2BMQ A;  4HM0 A;  2BMO A;  4NBG D;  3H1I E;  1WQL A;  1RIE A;  3TGU E;  4QUP A;  2YFL A;  4HM7 A;  3L71 E;  3GZY A;  3CWB E;  2NVG A;  1JM1 A;  2E4Q A;  1SQQ E;  4HM4 A;  3AZC A;  2NWF A;  1BE3 E;  2HMM A;  1KYO E;  4NBE D;  3EN1 A;  1O7H A;  2NUM A;  2I7F A;  2HML A;  1ULJ A;  2E75 D;  5CXM A;  3CXH E;  4NBD D;  1NTK E;  1NTM E;  3GTE A;  4U3F E;  2DE5 D;  3H1J E;  3H1K E;  3GKE A;  1O7N A;  3H1L E;  2ZYL A;  2HMO A;  2GBW A;  4NBC D;  4PV1 D;  4QDF B;  1FQT A;  3GOB A;  2ZT9 D;  4NBF D;  3GB4 A;  3L70 E;  3L72 E;  4D6T E;  5AEW A;  2JO6 A;  2XRX A;  4AIV A;  2XSO A;  3C0D A;  1SJG A;  2BCC E;  5BOK A;  1RFS A;  4QCK A;  4HM1 A;  2HMN A;  2A06 E;  1NYK A;  5HL4 A;  2NVE A;  3VMG D;  2IBZ E;  3L74 E;  2YVJ B;  1UUV A;  1O7G A;  3GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...