3L72E

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 36
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l72E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l72E02
2E74D 1O7WA 3VCAA 2HMLA 1SQPE 2YFJA 3AZCA 4QUPA 3VCPA 2NVEA 4HM8A 2JZAA 1O7NA 3C0DA 3GTEA 4QURA 3GTSA 1KYOE 1BCCE 3EQQA 4HM1A 1SQBE 5KKZC 3L73E 5KLVE 3GOBA 4HM0A 4NB9D 1UUWA 4NBDD 1SQXE 4HM4A 1O7MA 2HMKA 4NB8D 2XR8A 4D6TE 1SQVE 4NBAD 1ULJA 3H1HE 1NYKA 1BGYE 3L72E 3TGUE 2DE5D 1Q90C 4QCKA 3GL2A 4NBFD 2QJKC 2QJYC 2ZYLA 1RFSA 5AEWA 1G8KB 2XSOA 3GZXA 3N0QA 4HM6A 4HM2A 4HM3A 3L70E 4AIVA 2ZT9D 4PV1D 3L74E 1EG9A 5CXMA 2A06E 2B24A 2FYUE 1L0LE 4QDDA 3GL0A 3H1KE 3CWBE 1RIEA 3DQYA 2HMJA 2QJPC 2HMOA 4P1BH 1G8JB 2BCCE 2BMQA 1O7PA 1PP9E 2XRXA 4QUQA 4HM7A 5HL4A 2HMMA 1P84E 2BMRA 2GBWA 3H1IE 1BE3E 1NTZE 2CKFA 1FQTA 2XSHA 3GB4A 1L0NE 2IBZE 1NDOA 3VMHD 2DE6D 4HKVA 4H13D 4AAYB 1NTME 3EN1A 1O7HA 3VMGD 1UUVA 2NWFA 4NBBD 3CX5E 1NTKE 4OGQD 2Q3WA 4NBED 1ULIA 2NVGA 2YFIA 4PD4E 1JM1A 5AEUA 4U3FE 2I7FA 4QDFB 5KLIC 2YVJB 1VM9A 2GBXA 2D2CD 4QDFA 3CXHE 2BMOA 2QPZA 3GCEA 2E76D 2JO6A 1WQLA 2E75D 3GKEA 2NUMA 4HM5A 2YIUC 3L71E 3VMID 1ZRTE 2NUKA 2E4QA 1KB9E 5BOKA 4NBCD 4H0LD 2YFLA 4NBHD 1PPJE 3H1JE 2B1XA 2FYNC 4H44D 3D89A 3H1LE 4HJLA 4QDCA 4EMJB 2NVFA 3GZYA 4P1CH 1VF5D 1NU1E 1SJGA 2HMNA 3L75E 3FOUA 1EZVE 3BCCE 4NBGD 2E4PA 1SQQE 2DE7D 1O7GA 1VCKA
chains in the Genus database with same CATH superfamily
4A7PA 1O7WA 1IFJA 4IFMA 2H8PD 3V2RA 5M1BA 1NKNA 4OH8B 3L73J 1JY3N 2JEEA 2JWDA 1VQ4P 4HM0A 4WWIA 1LP1B 2KLUA 3L71D 3L71J 4PD4I 1HUCA 3CWBG 1PPJG 4WB4A 3WU2H 2K3RA 3H1JG 2QJKC 2W6AA 2OYIC 2IBZI 1N7SC 4BWNA 2XSOA 2M3EA 3RL0C 1HJBA 3I55P 3Q2YA 5CXMA 1IZNB 2QJYB 3KDPB 2Q6QA 3NFQA 4U3FG 2HMJA 2C0XA 3CCUP 3S4RA 1OVRA 4WBAA 1VQ5P 1FDMA 2OYOA 1JCCA 1KORA 4R4LA 2K37A 4BRYB 1NTME 3BVHA 4KHXA 2DW3A 1BE3G 1AA0A 1X8YA 5AVSB 3BCCG 1SQXD 5AW9B 2IYPA 2A45H 1NTKJ 1E5WA 1XTGB 1NOHA 2D2CD 2HG5D 3EWKA 1M8OB 2QVAA 2E4QA 3CLQA 2PRRA 1KZUB 3H1JJ 5AW7B 2XNDH 4I6MC 1IFMA 5B5EH 1S5LH 1NU1K 1Q2NA 3G71P 3CX5D 2JR8A 3GTEA 4QURA 1KYOE 1N7SA 1L2PA 1HH0A 1KN7A 2QSIA 1SQQK 3V6IA 2NPSC 2FFDC 3C1LA 5CCHA 1PP9G 2HMKA 1XTCC 1SQPK 4NB8D 4KJMA 1IC2A 1G2CA 3LIEA 3CXHD 3S9OA 5C39A 1K73Q 1GL2D 3GL2A 3BCCD 1PIXA 4TT3H 2H89C 3CL3D 1FS0E 1PGOA 2KK7A 2WITA 1HF9A 3AEDC 1OW8A 3W68A 3PH0A 1WT6A 2FYUE 5BU8B 1JMBA 1JM0A 1H0TB 2B87A 1L4AC 5AW5B 4QUQA 2ZT9C 5GTIH 2GBWA 2KYVA 1FZBA 3L73D 1VQNP 2DE6D 1H89A 3MIWA 1EZVG 2KOGA 1HGVA 1VL2A 1NWQA 1L0LG 2A06G 2M0BA 1RF0A 3TNUB 3Q5RA 2E5YA 3E1IA 3MGNA 2J5UA 1NJIQ 4CPGA 1N8RQ 3A0BE 3NTNA 3CCVP 3T97A 3AZCA 3KXDA 3GHGA 2N1TB 1FOSE 1SQBG 2WSFJ 3H1IG 2IFMA 1FZEA 2LXBA 1ZRTD 1PGJA 1VQLP 3AE6C 1X79B 1SQVE 3CCSP 3K5BA 1KILA 3B5NB 4IFDK 3M06A 1ZP0C 4UB8H 3H32A 3HE4B 3AECC 3CMAP 3GZXA 4HM6A 4EIJA 3B5NC 2P1JA 4NPEA 2HPCB 2E75B 1G8JB 3VMYA 2GUSA 4HM7A 1VQKP 1PP9J 3VYIA 3OAKA 2JJLA 4C7NA 2KZIA 4EI2A 1AJYA 4GOEA 2XNXA 2WPQA 3L75G 4ZMDA 1AQ5A 1SQQG 1T6AA 1TU3F 1PGPA 3CCLP 4QDFB 2GBXA 4YPCA 4QDFA 1WQLA 2FYUK 3IF4A 3D6YA 2NUMA 3WU2E 3VMID 3MUDC 1T2KC 1GK6A 2B9BA 3B4SA 1KYOH 3JSVC 1NH4A 1GL2A 1NVOA 2B89A 2G3AA 1UIXA 1HTLC 4MN4C 1SQPE 2H43A 2FBWC 4DCKA 5KJ7A 1SFCC 5B66H 1O7MA 5APTA 1SS1A 1HBWA 4JYCA 2QRXA 1IK7A 3V4WA 1KTMA 2YXRB 3AE3C 4JF7A 2DE5D 5BU5A 2KI7B 3WUVA 2M5AA 4NBFD 4GIFA 4BXLA 4HM3A 4AIVA 1LTSC 2N9YB 1S9KE 1FE6A 3CWBE 1M90Q 3L4FA 5E79E 3CWBJ 1RF0C 1BCCJ 2NPSD 1P84E 1NTKG 5KKZB 5L8RJ 2AXTH 2Q9IA 3GB4A 5APSA 2OARA 1NTMK 3Q3DA 2NRGA 1LTJC 1J1EB 3VMAA 2I8DA 1MFZA 1SQBD 2RN0A 4L76A 1BDDA 1P84I 1M1JB 1NTKE 2I1KA 1IFIA 1CI6A 4PD4E 3H25A 5KTBA 3CCMP 4H44B 1W2EA 1GW3A 2BEQD 2P10A 1ZXGA 2E76D 1T8ZA 2OYHB 1KB9H 2CPBA 1NTMJ 2HPCA 4EMJB 4ASWA 2E76B 2R3CA 2ZYGA 3PP5A 1VQ6P 2R32A 4D6TG 3V2QA 4H44C 1RQUA 3QWOC 3L73G 3MP7B 1QX8A 3L70J 1URQC 1JTHB 3GOBA 1DX7A 4K35A 2L91A 1SQPG 1RE4A 3LW5H 5AW3B 1FDOA 1SQQD 3H1HE 3WUUA 3VP9A 1MFTA 5AW2B 3VOPA 1LTJA 1GL2B 1X22A 4HM2A 4UB6H 2ZT9D 4WY4B 1FDIA 1Y47A 3MHVA 3CC7P 4JQ0D 1LT9B 3G3ZA 2N9BA 2FFDB 1NTZK 2Z4EA 1L0LD 4WY4D 5HL4A 2C0WA 2BMRA 3H1IE 2WPVB 1LWUC 2FXPA 2ITAA 2JWAA 3TYYA 2OQQA 3SWYA 3B71A 4L73A 4QMAA 1OW7A 4IL6X 4M3LA 2FYUJ 3CCEP 4IOIH 3II6A 3A5TA 2Z5HA 2I7FA 1SQQJ 2AEMA 5CBOA 5CCGA 1NTKD 1HVVA 1GTWA 1Q81Q 3P8CD 2IYOA 1KB9E 2CPSA 3HE5B 4HJLA 1EXJA 3RBZA 3CMEP 3BCCE 2HFED 3LW5J 3KPEA 2YFJA 4LLHA 1RF1B 3C0DA 1BCCE 1LTTC 1RF1A 1Y9BA 1SQBE 1L0LK 2A06D 1ZR2A 1FZAA 1QL1A 4R4MA 1NU1D 1AVYA 2E75C 3TGUE 5B5EE 4EYYQ 2WWWA 1W2BO 2CK3H 3D71A 2QM7A 4W7YA 3F5HA 3B8EB 2QA4P 2KIKA 2HMOA 1FZCB 1JY2P 5GTHE 4LC1A 3RBXA 1N7SD 1OIPA 2XSHA 4PJ0H 2N1TC 5CCHD 1LJ2A 1FAVA 4NBED 2YFIA 1JY2N 1VQOP 5GTIE 2YVJB 3TF5A 1VM9A 1X0TA 2WZ7A 1Q90D 1K8AQ 2C9NY 3RK2B 4WY4A 3HD7D 3H1LJ 5APVA 2L5GB 4Y99C 2V7QJ 4XA4A 3H1LE 1LP1A 1R5SA 2W6JH 4RESB 3AEGC 1KB9D 1EZVE 3CD6P 3RL0g 1Y8AA 3OA7A 5CJ4A 3VCAA 3L70D 2BCCG 1BE3J 2BEZF 2Y9ZA 1BDCA 3D6ZA 2QIWA 3RGUA 4L74A 1ULJA 1VQPP 1NTZD 2JO1A 1Q90C 1YTZI 1SQPJ 2XDJA 2ZYLA 5AEWA 2Y9YA 1VQ8P 1S4XA 2Q5UA 1FBMA 3QH9A 2O1KA 1URQD 2B24A 3E7KA 1PPJD 3DQYA 4YTPC 3F89A 4PV1C 2QJPC 4Y28J 4P1BH 1NU1J 2XRXA 1RHZB 4Z1MH 1SQVK 5AW4B 1SQXG 2RH0A 3VN0A 5H2FH 1YI2P 4AAYB 1O7HA 1QVFO 1S5LE 2YKOA 3Q5PA 1NGMB 3N4XA 2E76C 1AQTA 1NTKK 2IPPA 1JO5A 5KLVD 2WSEH 2P7JA 4XE5B 5AVZB 4D6TJ 5K5GB 2YIUB 3CCRP 1OMIA 3GZYA 1BGYG 2E5TA 1FJPA 1G2CB 1GMJA 1S2EA 2FKWB 1PP9D 1HWTC 2JZAA 3EQQA 4GODA 4NBDD 4HM4A 3CX5I 2VRSA 3FWNA 3H1KG 1N7SB 1K04A 1QVGO 1ZOYC 3FWLA 2QJKB 5DJUB 1WRGA 3L70G 2YNYA 1MZ9A 1ZMEC 3RL0B 1PZQA 1EDLA 5CCGD 3HE5A 3H1HG 1N73A 1AVOA 1KMIZ 2Y0DA 2B88A 3KYQA 1SQXK 2Q3EA 2FXMA 2AXTE 5AVVB 1OXZA 1L0NJ 4HKVA 4H13D 3SWFA 3EN1A 1LTBC 3RK3B 2ZXXA 1FZGA 2IDBA 2YO2A 1M1JA 2XU6A 2Y0EA 2YO3A 3H6PA 1KQFB 1Q7YQ 2KXPB 3AE2C 3CXHE 1KV4A 3GKEA 3L71E 4U3FD 3KQGA 1PPJE 2B1XA 1SQXJ 2NVFA 2ZYAA 1KQLA 1BCCD 2POHA 1JEKA 3C8VA 1RE4C 1LWUB 3RK3C 3U1AA 1KILD 1T3UA 2JDIH 3RK3E 3L73E 1NTZG 3B5ND 3JCUH 1YYCA 1R8EA 1S72P 5CJ0A 1GDTA 2XR8A 3V2PA 3L75D 2E74B 2PGDA 3L72E 4QCKA 3L35A 1U7MA 2QJYC 2OTLP 1KB9I 1SQBJ 3AEFC 3H1IJ 4GDOA 2WSCH 3H1KE 1CI6B 1M57D 1PP9E 3FXEA 5DJTB 3HRNA 2HMMA 3JCUE 1DH3A 3TGUD 3HE4A 2IBZG 1Q82Q 3VMHD 1KILC 4OGQC 1YITP 2GA1A 2QG4A 2KSEA 4RO0A 2E43A 2NWFA 1HGZA 3CX5E 2E42A 4OGQD 5TISE 2NVGA 3M9QA 3FXDA 3GLMA 5APQA 2FYZA 5AEUA 1KYOD 2LKMA 5KAFH 1VPCA 5KLVJ 1IFDA 1BGYD 3GCEA 3Q5SA 2OYIA 1S3JA 2KSJA 2YIUC 5APXA 1M1KQ 2KUBA 1N86A 4H13B 3EFFK 3V5BA 1N73B 1RE3C 1JY3O 2P67A 1J2JB 2DE7D 3PJSK 4K3AA 3IAOA 1NTMG 1NAFA 1LTJB 5AVYB 3M0AA 2ZYDA 3GTSA 4ZKPA 4B86A 3BRVB 4I1LA 2RKLA 2WSEJ 5CBNA 2W8ZA 2HODB 3MUDA 2FY8A 3RK3D 2KB7P 4XFJA 1WMKA 4NBAD 2O01J 1DD4A 4PV1B 1L0NK 1LT9C 5AW0B 3HUSA 1YIJP 4DT0A 1ZW0A 2YMKA 4NPFX 2K1AA 2XKMA 2WMMA 1QGKB 1EZVI 3IFMA 3SFDC 4L75A 4YXWH 3USSA 1LNQA 3AE7C 1ZN5A 1K05A 3R4YA 1NTZE 1CW5A 1SFCD 1KILE 2WPRA 2OYHA 1JMMA 1NDOA 2M8RA 1YTZT 3P8MC 1JB0J 4RJTA 2WQYC 2ZJSE 1KQGB 1ZLLA 3AEBC 1EXIA 1JM1A 1VQ7P 5KJ7D 5KLVK 5AVWB 1AV1A 4N6JA 2KZJA 1BSNA 5TISH 2FYUG 5EFWB 3PLNA 2NUKA 2ZVNB 5CMZA 2FYNC 1JTHA 4H44D 3PHLA 3D89A 2J59M 2WPSA 4ZNCA 1VF5C 2HMNA 4HH2A 3FOUA 1Q86Q 2JP3A 2O01H 1AFOA 3AEEC 1FZFA 1J1EC 4QUPA 3VCPA 3BCCJ 1P84D 4KT0J 1DIPA 4HM8A 1U7JA 3E1RA 1BCCG 4YXDC 1URQA 1H0TA 3I56P 4IL6H 1BE3D 2P58A 3H1HJ 3U1CA 2QJPB 2R3SA 1NKZB 2OYIB 1IK9A 1EZVD 1SQPD 2G8YA 3L71G 2KNCA 4N3YB 1PFIA 1G8KB 3BRTB 3CXHH 1G1JA 2KNCB 3N0QA 2W6BA 4DJGA 3L72G 3O8ZA 1EG9A 3SSUA 3GL0A 1W5CE 4N78D 5APYA 1JY3P 4IL6E 1SQBK 1FOSF 1SFCB 3VTPC 1FQTA 3CC4P 3AEAC 4JBZA 2M5AB 4U3FJ 1LWUA 1L4AD 3RK2D 1N7LA 2W90A 2H88C 1ULIA 3CWBD 1JCDA 2ZAEB 4WVZA 2QM8A 1NU1G 4UB6E 4PD4H 2P2UA 3MTUE 4HM5A 4BRYA 4W80A 1YHQP 5BOKA 1SVFA 3U59A 2K9JA 1OW6A 1SQVD 2QE7H 1ZR4A 1NTZJ 2HMLA 2J58A 2C9LY 2KLVA 1ZV8A 2KS1B 2NPSA 5KLVE 5AVTB 3W67A 2WSFH 5GTHH 3IN6A 1BSHA 3CX5H 2WTYA 1VQMP 3PRJA 3L74G 2V4HA 1FZCA 3C9IA 1H88A 1YQ3C 4ZKUA 1A02F 3P8CE 4PD4D 2H7HA 1GL2C 4GKGA 3H1LD 1L0LE 1PGQA 2ZVOB 3GG2A 1LTAC 2LXCB 1GU4A 2YKPA 1RH5B 2IBZE 1URQB 2OTJP 1FC2C 3NMDA 2WSSH 2Q7CA 2Q3WA 1USEA 4AYCA 1EC5A 5AVUB 4JYBA 2D2CB 5KLIC 1VDFA 1L0LJ 1VF5B 3Q1MA 1GW4A 2AXCA 1NYHA 3M9HA 5AW1B 4NBCD 1JOCA 1KQSO 2D2CC 2UWJE 3O6QA 2FYUD 1VF5D 5KLIB 2JKVA 2IZ0A 4HKZH 3G6EP 2BCCD 4C46A 3A3YB 4HB1A 1KILB 3B5NA 1NO4A 1L0NG 4HM1A 5KKZC 1DD3A 1Z56A 1HJ0A 5AVXB 5KAIH 1QLED 1KFNA 5BVZA 1YJNP 2NZ2A 1MKMA 1J1DB 2XZRA 4EDFA 1NYKA 3GF3A 3SWKA 4AQRD 2MKVA 4EOTA 4PV1D 2A06E 4QDDA 5AW8B 1FU1A 1FJKA 1J1DC 1SQVG 3AE4C 3HD7A 3V4QA 1SLQA 3HD7B 3A0BH 1UIIA 5APWA 2QEXP 2YKQA 2NPSB 4OVNF 3R2PA 3M0DC 4TLFA 4I7ZB 3TDKA 3GHGC 1GK4A 2YXQB 5KAIE 3MZWB 1N73C 1OX3A 5AVQB 2LR2A 1RE3A 4DOJA 4AUWA 1JY2O 4H0LB 2V7QH 3N7NA 3H1ID 2YFLA 1QL2A 1SJGA 3L75E 3CCJP 2A45I 1CSBA 1SQQE 3H1HD 2ZXEB 3L37A 2E74D 5TJHA 2NVEA 1M1JC 4LGDE 1O7NA 1SFCA 3FGAD 4HJGH 1GD2E 1NAYA 3H1KD 3H1KJ 1LT9A 2PP6A 1OFCX 1PL5A 3H1LG 5CCGC 2IFNA 2PAJA 2N1TD 5CCHC 1D7MA 3V2NA 3L70E 3L74E 1LTIC 2ZFCA 2OGUA 3KZIE 4ASVA 1X9VA 3FX0A 1OVUA 4GOFA 4O9BA 1E79H 1CZQA 2E74C 2BCCE 1O7PA 2IX7C 3A7OA 3RL0D 2BCCJ 1K9MQ 5KLVG 1T3JA 2CKFA 1R5LA 1RF1C 1KYOI 2R5DA 2SPZA 3GW6A 2I1JA 4U7JA 4NBBD 4NPDA 3LIDA 1VQ9P 3KZIH 2K88A 3AE5C 3L74D 4N78E 2K9YA 1YQ4C 5AW6B 5KJ7C 2HYNA 3EQ2A 2IZ1A 4H0LC 3UIAA 4W7ZA 3A0HH 3SFEC 1A02J 3VMZA 3A2AA 1YJWP 2AEFA 1ZRTE 1T2KD 3HTKA 3OW2O 2GUVA 2HODA 3HTKB 3VMXA 4C7NB 4QDCA 1M7LA 1DEEG 1NU1E 2A45G 1GU5A 1U57A 4HYTB 5CHXA 2E4PA 3GHGB 2Q3IA 5H2FE 2Y0CA 1EDJA 3IR9A 2IBZD 3BASA 3CXHI 4D6TD 3GF7A 1UUWA 1SQXE 3H1JD 3GMAA 3HD7C 2ZT9B 3EFGA 3L75J 1RQVA 5APUA 3D70A 2FFDA 1BGYE 1L4AB 1BGYJ 1RFSA 1QEXA 4WY4C 2OTKE 2HR3A 4RKUJ 1EDIA 1RIEA 1M56D 1EQ7A 3O6QB 3P7KA 3CI9A 1RY3A 1G1IA 3NXSA 1BE3E 3AE9C 3TGUJ 1LT1A 3M91A 2R44A 2GM4A 4IFFA 1KD1Q 2MJZA 3HUSC 3VMGD 1UUVA 2KP8A 2W83C 3WUTA 2FXOA 3AE1C 4U3FE 1JUNA 2YMYA 2BMOA 2QPZA 2WT7A 2JO6A 2E75D 2Z5IA 2WT7B 2PFXA 2FYNB 2HLOA 3AE8C 1L0ND 4DZOA 3A0HE 3BATA 4H0LD 1OWAA 4NBHD 3H1JE 1OVVA 2B87B 2OYHC 1IFNA 1N2DC 3ITKA 1USDA 4C7RA 1SQVJ 1IO4A 1PV3A 1OZHA 3KHUA 4OGQB 3TSIA 1YBKA 3HUSB 3L36A 2BASA 1DEBA 3G9RA 1LTGC 4JPZB 3ZDMA 5KAFE 1FZCC 4NB9D 1NTMD 3VP8A 3ABVC 4D6TE 1S5LX 3TNUA 3I5CA 3L74J 3MD0A 4OWFA 1GZLA 3P32A 1IJDB 1KC8Q 2O3JA 5B66E 2WSCJ 4I2LC 3S1KA 3M9BA 1KFMA 5E79H 1IFPA 2W27A 3T97B 1S1CX 2RMZA 2R5BA 1H8AA 2BMQA 1LGHB 2N1TA 3M0DA 3TK1A 3JC22 1L0NE 3G4SP 2M3BA 2K9JB 2O1JA 2XV5A 1MUUA 1JNMA 1NHLA 3PTZA 1YJ9P 1EDKA 1P84H 3OJAB 1L4AA 2AEJA 1S9KD 1SP4A 4UB8E 3H32B 2KS1A 3CPWO 4Y99B 4H13C 2Q1KA 3WMM0 4PJ0E 3RK2C 3CC2P 5AVRB 3L72J 3L72D 3TGUG 4GT1A 4P1CH 4I7ZC 2O01N 4NBGD 2WVRA 3CCQP 1MV8A 1O7GA 1VCKA
chains in the Genus database with same CATH topology
2E74D 1O7WA 3VCAA 2HMLA 1SQPE 2YFJA 3AZCA 4QUPA 3VCPA 2NVEA 4HM8A 2JZAA 1O7NA 3C0DA 3GTEA 4QURA 3GTSA 1KYOE 1BCCE 3EQQA 4HM1A 1SQBE 5KKZC 3L73E 5KLVE 3GOBA 4HM0A 4NB9D 1UUWA 4NBDD 1SQXE 4HM4A 1O7MA 2HMKA 4NB8D 2XR8A 4D6TE 1SQVE 4NBAD 1ULJA 3H1HE 1NYKA 1BGYE 3L72E 3TGUE 2DE5D 1Q90C 4QCKA 3GL2A 4NBFD 2QJKC 2QJYC 2ZYLA 1RFSA 5AEWA 1G8KB 2XSOA 3GZXA 3N0QA 4HM6A 4HM2A 4HM3A 3L70E 4AIVA 2ZT9D 4PV1D 3L74E 1EG9A 5CXMA 2A06E 2B24A 2FYUE 1L0LE 4QDDA 3GL0A 3H1KE 3CWBE 1RIEA 3DQYA 2HMJA 2QJPC 2HMOA 4P1BH 1G8JB 2BCCE 2BMQA 1O7PA 1PP9E 2XRXA 4QUQA 4HM7A 5HL4A 2HMMA 1P84E 2BMRA 2GBWA 3H1IE 1BE3E 1NTZE 2CKFA 1FQTA 2XSHA 3GB4A 1L0NE 2IBZE 1NDOA 3VMHD 2DE6D 4HKVA 4H13D 4AAYB 1NTME 3EN1A 1O7HA 3VMGD 1UUVA 2NWFA 4NBBD 3CX5E 1NTKE 4OGQD 2Q3WA 4NBED 1ULIA 2NVGA 2YFIA 4PD4E 1JM1A 5AEUA 4U3FE 2I7FA 4QDFB 5KLIC 2YVJB 1VM9A 2GBXA 2D2CD 4QDFA 3CXHE 2BMOA 2QPZA 3GCEA 2E76D 2JO6A 1WQLA 2E75D 3GKEA 2NUMA 4HM5A 2YIUC 3L71E 3VMID 1ZRTE 2NUKA 2E4QA 1KB9E 5BOKA 4NBCD 4H0LD 2YFLA 4NBHD 1PPJE 3H1JE 2B1XA 2FYNC 4H44D 3D89A 3H1LE 4HJLA 4QDCA 4EMJB 2NVFA 3GZYA 4P1CH 1VF5D 1NU1E 1SJGA 2HMNA 3L75E 3FOUA 1EZVE 3BCCE 4NBGD 2E4PA 1SQQE 2DE7D 1O7GA 1VCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 D;  1O7W A;  3VCA A;  2HML A;  1SQP E;  2YFJ A;  3AZC A;  4QUP A;  3VCP A;  2NVE A;  4HM8 A;  2JZA A;  1O7N A;  3C0D A;  3GTE A;  4QUR A;  3GTS A;  1KYO E;  1BCC E;  3EQQ A;  4HM1 A;  1SQB E;  5KKZ C;  3L73 E;  5KLV E;  3GOB A;  4HM0 A;  4NB9 D;  1UUW A;  4NBD D;  1SQX E;  4HM4 A;  1O7M A;  2HMK A;  4NB8 D;  2XR8 A;  4D6T E;  1SQV E;  4NBA D;  1ULJ A;  3H1H E;  1NYK A;  1BGY E;  3L72 E;  3TGU E;  2DE5 D;  1Q90 C;  4QCK A;  3GL2 A;  4NBF D;  2QJK C;  2QJY C;  2ZYL A;  1RFS A;  5AEW A;  1G8K B;  2XSO A;  3GZX A;  3N0Q A;  4HM6 A;  4HM2 A;  4HM3 A;  3L70 E;  4AIV A;  2ZT9 D;  4PV1 D;  3L74 E;  1EG9 A;  5CXM A;  2A06 E;  2B24 A;  2FYU E;  1L0L E;  4QDD A;  3GL0 A;  3H1K E;  3CWB E;  1RIE A;  3DQY A;  2HMJ A;  2QJP C;  2HMO A;  4P1B H;  1G8J B;  2BCC E;  2BMQ A;  1O7P A;  1PP9 E;  2XRX A;  4QUQ A;  4HM7 A;  5HL4 A;  2HMM A;  1P84 E;  2BMR A;  2GBW A;  3H1I E;  1BE3 E;  1NTZ E;  2CKF A;  1FQT A;  2XSH A;  3GB4 A;  1L0N E;  2IBZ E;  1NDO A;  3VMH D;  2DE6 D;  4HKV A;  4H13 D;  4AAY B;  1NTM E;  3EN1 A;  1O7H A;  3VMG D;  1UUV A;  2NWF A;  4NBB D;  3CX5 E;  1NTK E;  4OGQ D;  2Q3W A;  4NBE D;  1ULI A;  2NVG A;  2YFI A;  4PD4 E;  1JM1 A;  5AEU A;  4U3F E;  2I7F A;  4QDF B;  5KLI C;  2YVJ B;  1VM9 A;  2GBX A;  2D2C D;  4QDF A;  3CXH E;  2BMO A;  2QPZ A;  3GCE A;  2E76 D;  2JO6 A;  1WQL A;  2E75 D;  3GKE A;  2NUM A;  4HM5 A;  2YIU C;  3L71 E;  3VMI D;  1ZRT E;  2NUK A;  2E4Q A;  1KB9 E;  5BOK A;  4NBC D;  4H0L D;  2YFL A;  4NBH D;  1PPJ E;  3H1J E;  2B1X A;  2FYN C;  4H44 D;  3D89 A;  3H1L E;  4HJL A;  4QDC A;  4EMJ B;  2NVF A;  3GZY A;  4P1C H;  1VF5 D;  1NU1 E;  1SJG A;  2HMN A;  3L75 E;  3FOU A;  1EZV E;  3BCC E;  4NBG D;  2E4P A;  1SQQ E;  2DE7 D;  1O7G A;  1VCK A; 
#chains in the Genus database with same CATH topology
 4A7P A;  1O7W A;  1IFJ A;  4IFM A;  2H8P D;  3V2R A;  5M1B A;  1NKN A;  4OH8 B;  3L73 J;  1JY3 N;  2JEE A;  2JWD A;  1VQ4 P;  4HM0 A;  4WWI A;  1LP1 B;  2KLU A;  3L71 D;  3L71 J;  4PD4 I;  1HUC A;  3CWB G;  1PPJ G;  4WB4 A;  3WU2 H;  2K3R A;  3H1J G;  2QJK C;  2W6A A;  2OYI C;  2IBZ I;  1N7S C;  4BWN A;  2XSO A;  2M3E A;  3RL0 C;  1HJB A;  3I55 P;  3Q2Y A;  5CXM A;  1IZN B;  2QJY B;  3KDP B;  2Q6Q A;  3NFQ A;  4U3F G;  2HMJ A;  2C0X A;  3CCU P;  3S4R A;  1OVR A;  4WBA A;  1VQ5 P;  1FDM A;  2OYO A;  1JCC A;  1KOR A;  4R4L A;  2K37 A;  4BRY B;  1NTM E;  3BVH A;  4KHX A;  2DW3 A;  1BE3 G;  1AA0 A;  1X8Y A;  5AVS B;  3BCC G;  1SQX D;  5AW9 B;  2IYP A;  2A45 H;  1NTK J;  1E5W A;  1XTG B;  1NOH A;  2D2C D;  2HG5 D;  3EWK A;  1M8O B;  2QVA A;  2E4Q A;  3CLQ A;  2PRR A;  1KZU B;  3H1J J;  5AW7 B;  2XND H;  4I6M C;  1IFM A;  5B5E H;  1S5L H;  1NU1 K;  1Q2N A;  3G71 P;  3CX5 D;  2JR8 A;  3GTE A;  4QUR A;  1KYO E;  1N7S A;  1L2P A;  1HH0 A;  1KN7 A;  2QSI A;  1SQQ K;  3V6I A;  2NPS C;  2FFD C;  3C1L A;  5CCH A;  1PP9 G;  2HMK A;  1XTC C;  1SQP K;  4NB8 D;  4KJM A;  1IC2 A;  1G2C A;  3LIE A;  3CXH D;  3S9O A;  5C39 A;  1K73 Q;  1GL2 D;  3GL2 A;  3BCC D;  1PIX A;  4TT3 H;  2H89 C;  3CL3 D;  1FS0 E;  1PGO A;  2KK7 A;  2WIT A;  1HF9 A;  3AED C;  1OW8 A;  3W68 A;  3PH0 A;  1WT6 A;  2FYU E;  5BU8 B;  1JMB A;  1JM0 A;  1H0T B;  2B87 A;  1L4A C;  5AW5 B;  4QUQ A;  2ZT9 C;  5GTI H;  2GBW A;  2KYV A;  1FZB A;  3L73 D;  1VQN P;  2DE6 D;  1H89 A;  3MIW A;  1EZV G;  2KOG A;  1HGV A;  1VL2 A;  1NWQ A;  1L0L G;  2A06 G;  2M0B A;  1RF0 A;  3TNU B;  3Q5R A;  2E5Y A;  3E1I A;  3MGN A;  2J5U A;  1NJI Q;  4CPG A;  1N8R Q;  3A0B E;  3NTN A;  3CCV P;  3T97 A;  3AZC A;  3KXD A;  3GHG A;  2N1T B;  1FOS E;  1SQB G;  2WSF J;  3H1I G;  2IFM A;  1FZE A;  2LXB A;  1ZRT D;  1PGJ A;  1VQL P;  3AE6 C;  1X79 B;  1SQV E;  3CCS P;  3K5B A;  1KIL A;  3B5N B;  4IFD K;  3M06 A;  1ZP0 C;  4UB8 H;  3H32 A;  3HE4 B;  3AEC C;  3CMA P;  3GZX A;  4HM6 A;  4EIJ A;  3B5N C;  2P1J A;  4NPE A;  2HPC B;  2E75 B;  1G8J B;  3VMY A;  2GUS A;  4HM7 A;  1VQK P;  1PP9 J;  3VYI A;  3OAK A;  2JJL A;  4C7N A;  2KZI A;  4EI2 A;  1AJY A;  4GOE A;  2XNX A;  2WPQ A;  3L75 G;  4ZMD A;  1AQ5 A;  1SQQ G;  1T6A A;  1TU3 F;  1PGP A;  3CCL P;  4QDF B;  2GBX A;  4YPC A;  4QDF A;  1WQL A;  2FYU K;  3IF4 A;  3D6Y A;  2NUM A;  3WU2 E;  3VMI D;  3MUD C;  1T2K C;  1GK6 A;  2B9B A;  3B4S A;  1KYO H;  3JSV C;  1NH4 A;  1GL2 A;  1NVO A;  2B89 A;  2G3A A;  1UIX A;  1HTL C;  4MN4 C;  1SQP E;  2H43 A;  2FBW C;  4DCK A;  5KJ7 A;  1SFC C;  5B66 H;  1O7M A;  5APT A;  1SS1 A;  1HBW A;  4JYC A;  2QRX A;  1IK7 A;  3V4W A;  1KTM A;  2YXR B;  3AE3 C;  4JF7 A;  2DE5 D;  5BU5 A;  2KI7 B;  3WUV A;  2M5A A;  4NBF D;  4GIF A;  4BXL A;  4HM3 A;  4AIV A;  1LTS C;  2N9Y B;  1S9K E;  1FE6 A;  3CWB E;  1M90 Q;  3L4F A;  5E79 E;  3CWB J;  1RF0 C;  1BCC J;  2NPS D;  1P84 E;  1NTK G;  5KKZ B;  5L8R J;  2AXT H;  2Q9I A;  3GB4 A;  5APS A;  2OAR A;  1NTM K;  3Q3D A;  2NRG A;  1LTJ C;  1J1E B;  3VMA A;  2I8D A;  1MFZ A;  1SQB D;  2RN0 A;  4L76 A;  1BDD A;  1P84 I;  1M1J B;  1NTK E;  2I1K A;  1IFI A;  1CI6 A;  4PD4 E;  3H25 A;  5KTB A;  3CCM P;  4H44 B;  1W2E A;  1GW3 A;  2BEQ D;  2P10 A;  1ZXG A;  2E76 D;  1T8Z A;  2OYH B;  1KB9 H;  2CPB A;  1NTM J;  2HPC A;  4EMJ B;  4ASW A;  2E76 B;  2R3C A;  2ZYG A;  3PP5 A;  1VQ6 P;  2R32 A;  4D6T G;  3V2Q A;  4H44 C;  1RQU A;  3QWO C;  3L73 G;  3MP7 B;  1QX8 A;  3L70 J;  1URQ C;  1JTH B;  3GOB A;  1DX7 A;  4K35 A;  2L91 A;  1SQP G;  1RE4 A;  3LW5 H;  5AW3 B;  1FDO A;  1SQQ D;  3H1H E;  3WUU A;  3VP9 A;  1MFT A;  5AW2 B;  3VOP A;  1LTJ A;  1GL2 B;  1X22 A;  4HM2 A;  4UB6 H;  2ZT9 D;  4WY4 B;  1FDI A;  1Y47 A;  3MHV A;  3CC7 P;  4JQ0 D;  1LT9 B;  3G3Z A;  2N9B A;  2FFD B;  1NTZ K;  2Z4E A;  1L0L D;  4WY4 D;  5HL4 A;  2C0W A;  2BMR A;  3H1I E;  2WPV B;  1LWU C;  2FXP A;  2ITA A;  2JWA A;  3TYY A;  2OQQ A;  3SWY A;  3B71 A;  4L73 A;  4QMA A;  1OW7 A;  4IL6 X;  4M3L A;  2FYU J;  3CCE P;  4IOI H;  3II6 A;  3A5T A;  2Z5H A;  2I7F A;  1SQQ J;  2AEM A;  5CBO A;  5CCG A;  1NTK D;  1HVV A;  1GTW A;  1Q81 Q;  3P8C D;  2IYO A;  1KB9 E;  2CPS A;  3HE5 B;  4HJL A;  1EXJ A;  3RBZ A;  3CME P;  3BCC E;  2HFE D;  3LW5 J;  3KPE A;  2YFJ A;  4LLH A;  1RF1 B;  3C0D A;  1BCC E;  1LTT C;  1RF1 A;  1Y9B A;  1SQB E;  1L0L K;  2A06 D;  1ZR2 A;  1FZA A;  1QL1 A;  4R4M A;  1NU1 D;  1AVY A;  2E75 C;  3TGU E;  5B5E E;  4EYY Q;  2WWW A;  1W2B O;  2CK3 H;  3D71 A;  2QM7 A;  4W7Y A;  3F5H A;  3B8E B;  2QA4 P;  2KIK A;  2HMO A;  1FZC B;  1JY2 P;  5GTH E;  4LC1 A;  3RBX A;  1N7S D;  1OIP A;  2XSH A;  4PJ0 H;  2N1T C;  5CCH D;  1LJ2 A;  1FAV A;  4NBE D;  2YFI A;  1JY2 N;  1VQO P;  5GTI E;  2YVJ B;  3TF5 A;  1VM9 A;  1X0T A;  2WZ7 A;  1Q90 D;  1K8A Q;  2C9N Y;  3RK2 B;  4WY4 A;  3HD7 D;  3H1L J;  5APV A;  2L5G B;  4Y99 C;  2V7Q J;  4XA4 A;  3H1L E;  1LP1 A;  1R5S A;  2W6J H;  4RES B;  3AEG C;  1KB9 D;  1EZV E;  3CD6 P;  3RL0 g;  1Y8A A;  3OA7 A;  5CJ4 A;  3VCA A;  3L70 D;  2BCC G;  1BE3 J;  2BEZ F;  2Y9Z A;  1BDC A;  3D6Z A;  2QIW A;  3RGU A;  4L74 A;  1ULJ A;  1VQP P;  1NTZ D;  2JO1 A;  1Q90 C;  1YTZ I;  1SQP J;  2XDJ A;  2ZYL A;  5AEW A;  2Y9Y A;  1VQ8 P;  1S4X A;  2Q5U A;  1FBM A;  3QH9 A;  2O1K A;  1URQ D;  2B24 A;  3E7K A;  1PPJ D;  3DQY A;  4YTP C;  3F89 A;  4PV1 C;  2QJP C;  4Y28 J;  4P1B H;  1NU1 J;  2XRX A;  1RHZ B;  4Z1M H;  1SQV K;  5AW4 B;  1SQX G;  2RH0 A;  3VN0 A;  5H2F H;  1YI2 P;  4AAY B;  1O7H A;  1QVF O;  1S5L E;  2YKO A;  3Q5P A;  1NGM B;  3N4X A;  2E76 C;  1AQT A;  1NTK K;  2IPP A;  1JO5 A;  5KLV D;  2WSE H;  2P7J A;  4XE5 B;  5AVZ B;  4D6T J;  5K5G B;  2YIU B;  3CCR P;  1OMI A;  3GZY A;  1BGY G;  2E5T A;  1FJP A;  1G2C B;  1GMJ A;  1S2E A;  2FKW B;  1PP9 D;  1HWT C;  2JZA A;  3EQQ A;  4GOD A;  4NBD D;  4HM4 A;  3CX5 I;  2VRS A;  3FWN A;  3H1K G;  1N7S B;  1K04 A;  1QVG O;  1ZOY C;  3FWL A;  2QJK B;  5DJU B;  1WRG A;  3L70 G;  2YNY A;  1MZ9 A;  1ZME C;  3RL0 B;  1PZQ A;  1EDL A;  5CCG D;  3HE5 A;  3H1H G;  1N73 A;  1AVO A;  1KMI Z;  2Y0D A;  2B88 A;  3KYQ A;  1SQX K;  2Q3E A;  2FXM A;  2AXT E;  5AVV B;  1OXZ A;  1L0N J;  4HKV A;  4H13 D;  3SWF A;  3EN1 A;  1LTB C;  3RK3 B;  2ZXX A;  1FZG A;  2IDB A;  2YO2 A;  1M1J A;  2XU6 A;  2Y0E A;  2YO3 A;  3H6P A;  1KQF B;  1Q7Y Q;  2KXP B;  3AE2 C;  3CXH E;  1KV4 A;  3GKE A;  3L71 E;  4U3F D;  3KQG A;  1PPJ E;  2B1X A;  1SQX J;  2NVF A;  2ZYA A;  1KQL A;  1BCC D;  2POH A;  1JEK A;  3C8V A;  1RE4 C;  1LWU B;  3RK3 C;  3U1A A;  1KIL D;  1T3U A;  2JDI H;  3RK3 E;  3L73 E;  1NTZ G;  3B5N D;  3JCU H;  1YYC A;  1R8E A;  1S72 P;  5CJ0 A;  1GDT A;  2XR8 A;  3V2P A;  3L75 D;  2E74 B;  2PGD A;  3L72 E;  4QCK A;  3L35 A;  1U7M A;  2QJY C;  2OTL P;  1KB9 I;  1SQB J;  3AEF C;  3H1I J;  4GDO A;  2WSC H;  3H1K E;  1CI6 B;  1M57 D;  1PP9 E;  3FXE A;  5DJT B;  3HRN A;  2HMM A;  3JCU E;  1DH3 A;  3TGU D;  3HE4 A;  2IBZ G;  1Q82 Q;  3VMH D;  1KIL C;  4OGQ C;  1YIT P;  2GA1 A;  2QG4 A;  2KSE A;  4RO0 A;  2E43 A;  2NWF A;  1HGZ A;  3CX5 E;  2E42 A;  4OGQ D;  5TIS E;  2NVG A;  3M9Q A;  3FXD A;  3GLM A;  5APQ A;  2FYZ A;  5AEU A;  1KYO D;  2LKM A;  5KAF H;  1VPC A;  5KLV J;  1IFD A;  1BGY D;  3GCE A;  3Q5S A;  2OYI A;  1S3J A;  2KSJ A;  2YIU C;  5APX A;  1M1K Q;  2KUB A;  1N86 A;  4H13 B;  3EFF K;  3V5B A;  1N73 B;  1RE3 C;  1JY3 O;  2P67 A;  1J2J B;  2DE7 D;  3PJS K;  4K3A A;  3IAO A;  1NTM G;  1NAF A;  1LTJ B;  5AVY B;  3M0A A;  2ZYD A;  3GTS A;  4ZKP A;  4B86 A;  3BRV B;  4I1L A;  2RKL A;  2WSE J;  5CBN A;  2W8Z A;  2HOD B;  3MUD A;  2FY8 A;  3RK3 D;  2KB7 P;  4XFJ A;  1WMK A;  4NBA D;  2O01 J;  1DD4 A;  4PV1 B;  1L0N K;  1LT9 C;  5AW0 B;  3HUS A;  1YIJ P;  4DT0 A;  1ZW0 A;  2YMK A;  4NPF X;  2K1A A;  2XKM A;  2WMM A;  1QGK B;  1EZV I;  3IFM A;  3SFD C;  4L75 A;  4YXW H;  3USS A;  1LNQ A;  3AE7 C;  1ZN5 A;  1K05 A;  3R4Y A;  1NTZ E;  1CW5 A;  1SFC D;  1KIL E;  2WPR A;  2OYH A;  1JMM A;  1NDO A;  2M8R A;  1YTZ T;  3P8M C;  1JB0 J;  4RJT A;  2WQY C;  2ZJS E;  1KQG B;  1ZLL A;  3AEB C;  1EXI A;  1JM1 A;  1VQ7 P;  5KJ7 D;  5KLV K;  5AVW B;  1AV1 A;  4N6J A;  2KZJ A;  1BSN A;  5TIS H;  2FYU G;  5EFW B;  3PLN A;  2NUK A;  2ZVN B;  5CMZ A;  2FYN C;  1JTH A;  4H44 D;  3PHL A;  3D89 A;  2J59 M;  2WPS A;  4ZNC A;  1VF5 C;  2HMN A;  4HH2 A;  3FOU A;  1Q86 Q;  2JP3 A;  2O01 H;  1AFO A;  3AEE C;  1FZF A;  1J1E C;  4QUP A;  3VCP A;  3BCC J;  1P84 D;  4KT0 J;  1DIP A;  4HM8 A;  1U7J A;  3E1R A;  1BCC G;  4YXD C;  1URQ A;  1H0T A;  3I56 P;  4IL6 H;  1BE3 D;  2P58 A;  3H1H J;  3U1C A;  2QJP B;  2R3S A;  1NKZ B;  2OYI B;  1IK9 A;  1EZV D;  1SQP D;  2G8Y A;  3L71 G;  2KNC A;  4N3Y B;  1PFI A;  1G8K B;  3BRT B;  3CXH H;  1G1J A;  2KNC B;  3N0Q A;  2W6B A;  4DJG A;  3L72 G;  3O8Z A;  1EG9 A;  3SSU A;  3GL0 A;  1W5C E;  4N78 D;  5APY A;  1JY3 P;  4IL6 E;  1SQB K;  1FOS F;  1SFC B;  3VTP C;  1FQT A;  3CC4 P;  3AEA C;  4JBZ A;  2M5A B;  4U3F J;  1LWU A;  1L4A D;  3RK2 D;  1N7L A;  2W90 A;  2H88 C;  1ULI A;  3CWB D;  1JCD A;  2ZAE B;  4WVZ A;  2QM8 A;  1NU1 G;  4UB6 E;  4PD4 H;  2P2U A;  3MTU E;  4HM5 A;  4BRY A;  4W80 A;  1YHQ P;  5BOK A;  1SVF A;  3U59 A;  2K9J A;  1OW6 A;  1SQV D;  2QE7 H;  1ZR4 A;  1NTZ J;  2HML A;  2J58 A;  2C9L Y;  2KLV A;  1ZV8 A;  2KS1 B;  2NPS A;  5KLV E;  5AVT B;  3W67 A;  2WSF H;  5GTH H;  3IN6 A;  1BSH A;  3CX5 H;  2WTY A;  1VQM P;  3PRJ A;  3L74 G;  2V4H A;  1FZC A;  3C9I A;  1H88 A;  1YQ3 C;  4ZKU A;  1A02 F;  3P8C E;  4PD4 D;  2H7H A;  1GL2 C;  4GKG A;  3H1L D;  1L0L E;  1PGQ A;  2ZVO B;  3GG2 A;  1LTA C;  2LXC B;  1GU4 A;  2YKP A;  1RH5 B;  2IBZ E;  1URQ B;  2OTJ P;  1FC2 C;  3NMD A;  2WSS H;  2Q7C A;  2Q3W A;  1USE A;  4AYC A;  1EC5 A;  5AVU B;  4JYB A;  2D2C B;  5KLI C;  1VDF A;  1L0L J;  1VF5 B;  3Q1M A;  1GW4 A;  2AXC A;  1NYH A;  3M9H A;  5AW1 B;  4NBC D;  1JOC A;  1KQS O;  2D2C C;  2UWJ E;  3O6Q A;  2FYU D;  1VF5 D;  5KLI B;  2JKV A;  2IZ0 A;  4HKZ H;  3G6E P;  2BCC D;  4C46 A;  3A3Y B;  4HB1 A;  1KIL B;  3B5N A;  1NO4 A;  1L0N G;  4HM1 A;  5KKZ C;  1DD3 A;  1Z56 A;  1HJ0 A;  5AVX B;  5KAI H;  1QLE D;  1KFN A;  5BVZ A;  1YJN P;  2NZ2 A;  1MKM A;  1J1D B;  2XZR A;  4EDF A;  1NYK A;  3GF3 A;  3SWK A;  4AQR D;  2MKV A;  4EOT A;  4PV1 D;  2A06 E;  4QDD A;  5AW8 B;  1FU1 A;  1FJK A;  1J1D C;  1SQV G;  3AE4 C;  3HD7 A;  3V4Q A;  1SLQ A;  3HD7 B;  3A0B H;  1UII A;  5APW A;  2QEX P;  2YKQ A;  2NPS B;  4OVN F;  3R2P A;  3M0D C;  4TLF A;  4I7Z B;  3TDK A;  3GHG C;  1GK4 A;  2YXQ B;  5KAI E;  3MZW B;  1N73 C;  1OX3 A;  5AVQ B;  2LR2 A;  1RE3 A;  4DOJ A;  4AUW A;  1JY2 O;  4H0L B;  2V7Q H;  3N7N A;  3H1I D;  2YFL A;  1QL2 A;  1SJG A;  3L75 E;  3CCJ P;  2A45 I;  1CSB A;  1SQQ E;  3H1H D;  2ZXE B;  3L37 A;  2E74 D;  5TJH A;  2NVE A;  1M1J C;  4LGD E;  1O7N A;  1SFC A;  3FGA D;  4HJG H;  1GD2 E;  1NAY A;  3H1K D;  3H1K J;  1LT9 A;  2PP6 A;  1OFC X;  1PL5 A;  3H1L G;  5CCG C;  2IFN A;  2PAJ A;  2N1T D;  5CCH C;  1D7M A;  3V2N A;  3L70 E;  3L74 E;  1LTI C;  2ZFC A;  2OGU A;  3KZI E;  4ASV A;  1X9V A;  3FX0 A;  1OVU A;  4GOF A;  4O9B A;  1E79 H;  1CZQ A;  2E74 C;  2BCC E;  1O7P A;  2IX7 C;  3A7O A;  3RL0 D;  2BCC J;  1K9M Q;  5KLV G;  1T3J A;  2CKF A;  1R5L A;  1RF1 C;  1KYO I;  2R5D A;  2SPZ A;  3GW6 A;  2I1J A;  4U7J A;  4NBB D;  4NPD A;  3LID A;  1VQ9 P;  3KZI H;  2K88 A;  3AE5 C;  3L74 D;  4N78 E;  2K9Y A;  1YQ4 C;  5AW6 B;  5KJ7 C;  2HYN A;  3EQ2 A;  2IZ1 A;  4H0L C;  3UIA A;  4W7Z A;  3A0H H;  3SFE C;  1A02 J;  3VMZ A;  3A2A A;  1YJW P;  2AEF A;  1ZRT E;  1T2K D;  3HTK A;  3OW2 O;  2GUV A;  2HOD A;  3HTK B;  3VMX A;  4C7N B;  4QDC A;  1M7L A;  1DEE G;  1NU1 E;  2A45 G;  1GU5 A;  1U57 A;  4HYT B;  5CHX A;  2E4P A;  3GHG B;  2Q3I A;  5H2F E;  2Y0C A;  1EDJ A;  3IR9 A;  2IBZ D;  3BAS A;  3CXH I;  4D6T D;  3GF7 A;  1UUW A;  1SQX E;  3H1J D;  3GMA A;  3HD7 C;  2ZT9 B;  3EFG A;  3L75 J;  1RQV A;  5APU A;  3D70 A;  2FFD A;  1BGY E;  1L4A B;  1BGY J;  1RFS A;  1QEX A;  4WY4 C;  2OTK E;  2HR3 A;  4RKU J;  1EDI A;  1RIE A;  1M56 D;  1EQ7 A;  3O6Q B;  3P7K A;  3CI9 A;  1RY3 A;  1G1I A;  3NXS A;  1BE3 E;  3AE9 C;  3TGU J;  1LT1 A;  3M91 A;  2R44 A;  2GM4 A;  4IFF A;  1KD1 Q;  2MJZ A;  3HUS C;  3VMG D;  1UUV A;  2KP8 A;  2W83 C;  3WUT A;  2FXO A;  3AE1 C;  4U3F E;  1JUN A;  2YMY A;  2BMO A;  2QPZ A;  2WT7 A;  2JO6 A;  2E75 D;  2Z5I A;  2WT7 B;  2PFX A;  2FYN B;  2HLO A;  3AE8 C;  1L0N D;  4DZO A;  3A0H E;  3BAT A;  4H0L D;  1OWA A;  4NBH D;  3H1J E;  1OVV A;  2B87 B;  2OYH C;  1IFN A;  1N2D C;  3ITK A;  1USD A;  4C7R A;  1SQV J;  1IO4 A;  1PV3 A;  1OZH A;  3KHU A;  4OGQ B;  3TSI A;  1YBK A;  3HUS B;  3L36 A;  2BAS A;  1DEB A;  3G9R A;  1LTG C;  4JPZ B;  3ZDM A;  5KAF E;  1FZC C;  4NB9 D;  1NTM D;  3VP8 A;  3ABV C;  4D6T E;  1S5L X;  3TNU A;  3I5C A;  3L74 J;  3MD0 A;  4OWF A;  1GZL A;  3P32 A;  1IJD B;  1KC8 Q;  2O3J A;  5B66 E;  2WSC J;  4I2L C;  3S1K A;  3M9B A;  1KFM A;  5E79 H;  1IFP A;  2W27 A;  3T97 B;  1S1C X;  2RMZ A;  2R5B A;  1H8A A;  2BMQ A;  1LGH B;  2N1T A;  3M0D A;  3TK1 A;  3JC2 2;  1L0N E;  3G4S P;  2M3B A;  2K9J B;  2O1J A;  2XV5 A;  1MUU A;  1JNM A;  1NHL A;  3PTZ A;  1YJ9 P;  1EDK A;  1P84 H;  3OJA B;  1L4A A;  2AEJ A;  1S9K D;  1SP4 A;  4UB8 E;  3H32 B;  2KS1 A;  3CPW O;  4Y99 B;  4H13 C;  2Q1K A;  3WMM 0;  4PJ0 E;  3RK2 C;  3CC2 P;  5AVR B;  3L72 J;  3L72 D;  3TGU G;  4GT1 A;  4P1C H;  4I7Z C;  2O01 N;  4NBG D;  2WVR A;  3CCQ P;  1MV8 A;  1O7G A;  1VCK A; 
#chains in the Genus database with same CATH homology
 2E74 D;  1O7W A;  3VCA A;  2HML A;  1SQP E;  2YFJ A;  3AZC A;  4QUP A;  3VCP A;  2NVE A;  4HM8 A;  2JZA A;  1O7N A;  3C0D A;  3GTE A;  4QUR A;  3GTS A;  1KYO E;  1BCC E;  3EQQ A;  4HM1 A;  1SQB E;  5KKZ C;  3L73 E;  5KLV E;  3GOB A;  4HM0 A;  4NB9 D;  1UUW A;  4NBD D;  1SQX E;  4HM4 A;  1O7M A;  2HMK A;  4NB8 D;  2XR8 A;  4D6T E;  1SQV E;  4NBA D;  1ULJ A;  3H1H E;  1NYK A;  1BGY E;  3L72 E;  3TGU E;  2DE5 D;  1Q90 C;  4QCK A;  3GL2 A;  4NBF D;  2QJK C;  2QJY C;  2ZYL A;  1RFS A;  5AEW A;  1G8K B;  2XSO A;  3GZX A;  3N0Q A;  4HM6 A;  4HM2 A;  4HM3 A;  3L70 E;  4AIV A;  2ZT9 D;  4PV1 D;  3L74 E;  1EG9 A;  5CXM A;  2A06 E;  2B24 A;  2FYU E;  1L0L E;  4QDD A;  3GL0 A;  3H1K E;  3CWB E;  1RIE A;  3DQY A;  2HMJ A;  2QJP C;  2HMO A;  4P1B H;  1G8J B;  2BCC E;  2BMQ A;  1O7P A;  1PP9 E;  2XRX A;  4QUQ A;  4HM7 A;  5HL4 A;  2HMM A;  1P84 E;  2BMR A;  2GBW A;  3H1I E;  1BE3 E;  1NTZ E;  2CKF A;  1FQT A;  2XSH A;  3GB4 A;  1L0N E;  2IBZ E;  1NDO A;  3VMH D;  2DE6 D;  4HKV A;  4H13 D;  4AAY B;  1NTM E;  3EN1 A;  1O7H A;  3VMG D;  1UUV A;  2NWF A;  4NBB D;  3CX5 E;  1NTK E;  4OGQ D;  2Q3W A;  4NBE D;  1ULI A;  2NVG A;  2YFI A;  4PD4 E;  1JM1 A;  5AEU A;  4U3F E;  2I7F A;  4QDF B;  5KLI C;  2YVJ B;  1VM9 A;  2GBX A;  2D2C D;  4QDF A;  3CXH E;  2BMO A;  2QPZ A;  3GCE A;  2E76 D;  2JO6 A;  1WQL A;  2E75 D;  3GKE A;  2NUM A;  4HM5 A;  2YIU C;  3L71 E;  3VMI D;  1ZRT E;  2NUK A;  2E4Q A;  1KB9 E;  5BOK A;  4NBC D;  4H0L D;  2YFL A;  4NBH D;  1PPJ E;  3H1J E;  2B1X A;  2FYN C;  4H44 D;  3D89 A;  3H1L E;  4HJL A;  4QDC A;  4EMJ B;  2NVF A;  3GZY A;  4P1C H;  1VF5 D;  1NU1 E;  1SJG A;  2HMN A;  3L75 E;  3FOU A;  1EZV E;  3BCC E;  4NBG D;  2E4P A;  1SQQ E;  2DE7 D;  1O7G A;  1VCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...