3L72J

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l72J00
1L0LJ 1KB9I 3H1IJ 3L71J 3H1KJ 1SQBJ 3L72J 1BCCJ 3TGUJ 3H1JJ 1NU1J 3L73J 3L75J 5KLVJ 4D6TJ 3L70J 1NTKJ 3L74J 1SQXJ 2FYUJ 2IBZI 3BCCJ 3CWBJ 4U3FJ 1P84I 3CX5I 1BE3J 3H1LJ 1NTZJ 3CXHI 4PD4I 1KYOI 2BCCJ 1SQVJ 1EZVI 1NTMJ 1SQQJ 1PP9J 1SQPJ 1L0NJ 3H1HJ 1BGYJ
chains in the Genus database with same CATH superfamily
2WT7B 3Q2YA 1DIPA 1LT9C 4JF7A 3H1IJ 3L71J 3A5TA 3H1JE 3H6PA 3CPWO 4U3FD 1FZEA 1AJYA 1X9VA 2B9BA 1L4AB 2GA1A 2JDIH 2WSFJ 3AE3C 4U7JA 3CC7P 3KZIH 1RF1B 3E1IA 3E7KA 3H1LE 3AECC 3AEFC 2P10A 3TNUA 4BXLA 1N8RQ 2FYUE 1ZR2A 4GIFA 2K9JB 2KLVA 2C0XA 3CC2P 5APQA 3SFEC 5GTHH 2QSIA 4OVNF 2O1JA 2E5YA 2HR3A 2R44A 1H89A 2WTYA 1T3JA 4D6TG 1PPJG 1ZOYC 2R3SA 1N7SD 2ZYGA 3A2AA 3HUSB 4RJTA 1L0ND 1VQ4P 4HYTB 1NTMJ 1OXZA 2E75D 2HODB 1SLQA 4IL6H 3KXDA 5AVTB 2Y9ZA 1HVVA 5KTBA 4WY4D 3M0DA 2I1KA 1KILE 1L0LJ 2Z5IA 3BASA 2JWDA 5B66E 3HTKA 1CSBA 1T6AA 1SQBJ 3SFDC 1OFCX 1AQ5A 1CI6A 4XA4A 2LR2A 2R5DA 2M5AA 3OW2O 2KYVA 2P2UA 1JB0J 3L72E 4WY4B 2YMYA 1KORA 4HJGH 3HE5B 3RGUA 1KQGB 4YXWH 2B87B 1SS1A 2N9YB 5H2FE 2ZJSE 1JY2O 2XDJA 4KT0J 5K5GB 2OTLP 2D2CD 3V2PA 1RY3A 4H44B 5B5EE 3U1AA 2ZYDA 3H1IG 1LT9B 1SQQG 5H2FH 2YIUB 1OW6A 3PP5A 1SQQK 5CCGC 2RH0A 3SSUA 4TT3H 4IL6X 1FU1A 2E75C 3CCJP 2FXMA 1GTWA 2OTKE 2YO3A 3LW5H 1SVFA 2I1JA 2H89C 2IFMA 3B5NB 3EFFK 3BCCG 4PJ0E 5APSA 1KILC 3QWOC 3CWBE 1BE3G 4OWFA 1SQPJ 1HUCA 2YKQA 3H1LG 3H1IE 3L4FA 3WUTA 4R4LA 1DD4A 1SQXG 1LWUB 4HH2A 2QIWA 4Y99C 3CMAP 1JMBA 1EDJA 3MUDA 1ZP0C 3MD0A 1G2CA 1KQFB 1JY3N 3PHLA 3P8CE 2PP6A 1EQ7A 1M1JB 1Z56A 3AEAC 2FYNC 1Q2NA 1JCCA 3L70D 3H1KE 1GDTA 1L0NG 5TJHA 1N7SB 1L0NK 1OX3A 2QJPC 2KLUA 3MTUE 2AEFA 2O01J 2WQYC 4WY4A 3VMAA 2M5AB 3H25A 3BCCJ 5CCHC 1YYCA 1VQ9P 2B88A 2E74C 1HGZA 1PFIA 3HE4A 3CX5E 3Q1MA 2BEZF 3KZIE 2P1JA 1YJNP 1BSHA 4ZKUA 3OJAB 1FZFA 5AW2B 1FZAA 5KAIE 1VQOP 1K73Q 1USDA 1PP9J 5KLIC 3VOPA 2Y0DA 2J58A 3L74G 3AE2C 2B89A 3QH9A 3PLNA 2R32A 3VTPC 5APUA 3A0BH 3H1HE 2QRXA 2JJLA 1Q81Q 1LT1A 1GL2B 1UIXA 3AE7C 4C7RA 3FX0A 2KUBA 1YTZI 1S9KD 3JC22 1KYOE 2A45G 2OYHA 1FZCC 1NTKD 1GZLA 3H1JJ 4WVZA 1HGVA 3L71G 5KLVJ 4I7ZC 2A06E 2JKVA 2G8YA 1EZVG 2WSEH 3EQ2A 1KQSO 3SWYA 1XTCC 2E76B 1S72P 1L0LK 1SQBD 4PD4D 2OYIB 1L0LG 3T97B 1SQQE 5L8RJ 3S1KA 3B71A 4K3AA 1PL5A 3NTNA 4UB6H 2HYNA 4OGQB 3VP9A 3GMAA 3M9HA 1VPCA 3FXEA 5TISH 3HD7A 2HPCB 3TK1A 1DX7A 3I56P 2MJZA 4L74A 2AEJA 5CMZA 1BE3E 1SQVD 3HE4B 5APWA 2KZJA 3O6QB 1L0LE 5CCHD 1MKMA 1M1KQ 2OYIC 1SQXE 3H1JG 1NTMK 1M90Q 3D6YA 1MZ9A 1WRGA 1NTMG 3PRJA 4N78D 2C9LY 1FZGA 1K8AQ 1S1CX 3TF5A 1EDIA 3L74D 3N4XA 2OGUA 3TGUJ 3B5ND 3TGUD 1T8ZA 4H0LB 4GKGA 2P67A 1NTKJ 2NRGA 3AEEC 1DEBA 3A3YB 1NAYA 1J2JB 2UWJE 2LKMA 3H32B 3L36A 1AV1A 2K1AA 2K37A 2W6JH 1RHZB 3R4YA 1P84I 1IFMA 4W7ZA 1LTTC 3RL0g 2FY8A 1GD2E 1PGJA 4DCKA 1EZVI 3JCUE 2M8RA 2YKPA 3C9IA 1X22A 1WMKA 3LIDA 2QJYC 1QEXA 3Q5PA 1GL2D 1P84D 1SQBK 5KJ7A 1GU4A 2R3CA 5GTIE 3PTZA 1PGPA 4L73A 2IX7C 5AVVB 1SQPE 3BRTB 1Q7YQ 1JO5A 3V4QA 1EZVD 1T2KC 2E74B 2HLOA 5AW5B 1VQLP 1YITP 1AVYA 1KB9E 1VQMP 2ZYAA 1KFMA 3LW5J 3HD7D 4IFMA 1JCDA 2GUVA 3I55P 2WZ7A 1NU1D 2QJYB 1AQTA 1SFCD 1BSNA 1MUUA 1YJWP 3AE4C 1PPJD 3V6IA 1IO4A 3V2RA 4C7NB 2KI7B 1CZQA 2K3RA 1IFPA 2KSEA 2Y0CA 4C46A 5KKZB 1OVVA 3L35A 1SFCB 3L75E 4LLHA 4PD4I 4TLFA 4IFDK 5BU5A 2QJKB 2ZVNB 3M0AA 4PD4H 2BCCE 3HD7B 3V5BA 1FJKA 1U7MA 3CWBG 2FYUK 3CCMP 3BCCE 4W80A 3HUSA 4YTPC 1FE6A 2FYZA 3CC4P 3L73J 4JPZB 4H44C 1AA0A 2WITA 2M3EA 1H88A 1DD3A 1KB9I 4IOIH 1URQD 1IJDB 3A0HE 1K04A 2NPSA 2YXRB 1NAFA 5KAFH 1VQ6P 2CK3H 1ZMEC 2BCCG 5AVXB 4EDFA 1AFOA 1T3UA 1K9MQ 2M0BA 1LJ2A 3FWLA 3O8ZA 4UB8E 2QE7H 2OYHB 3P32A 4NPFX 5AW3B 1ZRTD 2XNDH 1MV8A 1ZLLA 2QEXP 3GHGA 3RL0B 3CCSP 2W27A 5DJTB 2QA4P 3B8EB 1S5LH 2C0WA 5CCHA 3L72D 3P7KA 2V7QJ 1JNMA 2OQQA 1Y47A 2Y9YA 5KLVE 2KB7P 4L75A 1HWTC 2WVRA 1ZR4A 1M1JC 1NO4A 2Z5HA 1NTZE 2IFNA 5E79E 3W68A 3ZDMA 1BCCG 5GTHE 2KP8A 3WUUA 4U3FE 3G6EP 1Q86Q 3KHUA 4I6MC 3GF3A 1VQ8P 2XKMA 2FXPA 1NTMD 2IYOA 3MUDC 5CCGD 3IN6A 2L5GB 4I2LC 3UIAA 1FOSF 1GK4A 3L37A 1MFZA 2KNCB 3USSA 3CCQP 3MP7B 1RQVA 2E42A 3CWBD 1NH4A 1SFCC 1PP9E 2FYUD 2E75B 3BRVB 3N7NA 4WB4A 1PZQA 5C39A 4GOFA 3TDKA 1JY3P 2E5TA 4N3YB 1J1DB 1S5LX 3B5NC 1RE3A 3HE5A 2KOGA 2A06G 3L75J 3WU2E 2KSJA 4D6TD 3VMYA 2WPQA 4EOTA 1NWQA 3CCLP 3MIWA 1LNQA 1IFJA 1SQXJ 1GU5A 2Q6QA 2FKWB 1JTHB 3TNUB 1PP9G 3D71A 1K05A 4N6JA 1N73B 1NVOA 2I8DA 1NU1K 3CXHI 1BGYD 3L71D 1OVUA 3L72G 1NJIQ 3E1RA 3U1CA 3G3ZA 1FOSE 4LGDE 2H7HA 1D7MA 1KILD 2JO1A 1VF5C 3RK3D 2AXCA 5AVQB 5DJUB 1NOHA 3ITKA 2M3BA 2IPPA 3M9QA 2ZXXA 1HH0A 1Q82Q 3RBZA 1S3JA 2A45I 2YMKA 1E5WA 4AQRD 1R8EA 2AEMA 3TYYA 1FAVA 2P58A 2QG4A 3RL0C 1FBMA 4ASWA 2QM7A 1E79H 3AE1C 3CXHE 3T97A 4EIJA 2OYIA 2GM4A 1IK7A 1VF5B 2RMZA 1CI6B 4OH8B 5KLIB 1NTZK 4GODA 1LGHB 1RE4A 1BCCD 3D6ZA 3CI9A 2IBZI 3NMDA 1FDIA 1NTKE 1G1JA 1VL2A 1R5SA 3C8VA 3GLMA 4BWNA 1X8YA 5B5EH 1HF9A 4ZKPA 2WWWA 1HTLC 2WPSA 2R5BA 3L70G 4DT0A 2BCCJ 3AE9C 5AVUB 1HJBA 3M9BA 1RE4C 2FYUG 3OAKA 3A0HH 1SQQD 1LWUA 1MFTA 2HG5D 2PFXA 3GHGC 2YXQB 4W7YA 2NZ2A 3C1LA 4H44D 4RKUJ 1NGMB 1FC2C 1DEEG 2JP3A 2N1TD 3P8CD 4H0LD 4PV1D 2HPCA 1S2EA 1IFNA 2D2CC 3LIEA 3V4WA 3L70E 1H0TB 3H1KJ 1BE3D 1KMIZ 1FZBA 2J5UA 1RF0C 1SP4A 2BASA 5APYA 1SQVK 4HB1A 5CBOA 2G3AA 2N1TB 3H1JD 4PV1B 1OZHA 2W6AA 5APVA 3A0BE 3L74J 1IZNB 3RBXA 2JR8A 3HTKB 3I5CA 3SWKA 5CCGA 1YIJP 1LWUC 2IBZG 1IFIA 2FYUJ 3Q5RA 1EDLA 3BATA 2D2CB 5KLVK 5AW0B 1NTZJ 1GL2C 2ITAA 1KQLA 1KYOI 1OW8A 1LTBC 2HODA 2KXPB 5AW8B 1SQVJ 1VQ7P 3D70A 3L73D 1T2KD 1VQNP 1HBWA 1SQBG 1JY2N 2PRRA 1W2EA 5KAFE 3H1HJ 4O9BA 4YPCA 1S5LE 1BGYJ 1L0NE 2HFED 1KYOD 1JY2P 3IFMA 5AW9B 3S4RA 3M0DC 4A7PA 1N73A 4LC1A 1NKNA 1SFCA 1N73C 1CW5A 1VQ5P 3II6A 2H43A 1QX8A 4OGQC 1L4AD 3L72J 3VMXA 3VYIA 2FBWC 3FGAD 1SQBE 4PD4E 4C7NA 1RF1A 1KILA 5APXA 4JYCA 2WMMA 3H32A 4EYYQ 2N1TA 2B87A 2KK7A 4NPEA 2YKOA 2POHA 2K9YA 5CJ4A 4IL6E 3HRNA 4Y99B 2OARA 5AVYB 4KJMA 3CCRP 1R5LA 1BE3J 1EXIA 1NU1G 1Y8AA 2Y0EA 3WMM0 5KLVG 3H1HG 1FJPA 2IBZD 3V2QA 2CPBA 1N7LA 1PPJE 2K88A 1H8AA 2Q9IA 3CLQA 2IYPA 3W67A 3RK2B 5AVSB 4DOJA 1KTMA 1JOCA 2MKVA 2ZT9D 3GW6A 1SQXK 1PV3A 3RK3E 3VP8A 4YXDC 2OYOA 1WT6A 2BCCD 3F5HA 4CPGA 3H1LD 2FFDA 3BCCD 3GF7A 2V4HA 5CHXA 4R4MA 2ZT9B 1UIIA 1A02F 2WPRA 2YO2A 1LP1B 3RK3B 3PH0A 1YBKA 1QVGO 1JEKA 1NU1J 2LXBA 3JSVC 4H13D 1OVRA 5B66H 2E43A 1ZV8A 2W83C 2ZVOB 1X79B 3EWKA 1KC8Q 2J59M 1H0TA 3KDPB 3CX5I 3TGUG 3WU2H 3CCUP 4OGQD 1ZRTE 3H1KD 3CCVP 1YJ9P 2H88C 1W2BO 2Q3EA 1L4AA 1OWAA 2WSFH 4GT1A 1P84H 3CXHH 3PJSK 5CBNA 1SQPD 2FXOA 5AVRB 2E76D 1EZVE 2KS1A 3Q5SA 4GDOA 2O01N 4I7ZB 1PGOA 3CX5D 4H0LC 1KB9D 1OIPA 2O01H 2QM8A 1KV4A 2XV5A 1YQ4C 2KIKA 1HJ0A 1NTZD 3MGNA 2ZAEB 4WBAA 1TU3F 2YIUC 1M57D 3L75G 1EXJA 5KKZC 3CCEP 2Q7CA 1FDOA 5KAIH 5KJ7D 1IFDA 1JY3O 1LTIC 1NKZB 1M8OB 1JTHA 1URQB 2XZRA 3AEGC 1DH3A 1BCCJ 2JEEA 4NPDA 3Q3DA 1A02J 1JUNA 3MHVA 1ZN5A 2WSSH 3M91A 3U59A 3L75D 3H1KG 1M7LA 1RQUA 5GTIH 3G9RA 2AXTE 2P7JA 3ABVC 1BGYG 2VRSA 3FWNA 2L91A 4U3FJ 2IDBA 1BDDA 1GW3A 3IAOA 3JCUH 4D6TE 1KZUB 2ZT9C 3H1ID 3KPEA 1G1IA 1FZCB 1J1DC 3S9OA 3SWFA 1LTSC 1LTAC 2A45H 2FYNB 1SQQJ 2N1TC 1LTJA 1PIXA 3O6QA 4IFFA 4PV1C 2SPZA 4BRYA 1FS0E 2PGDA 1BGYE 1L0NJ 3L71E 3TSIA 2RN0A 3B5NA 1KN7A 1AVOA 1OMIA 4ASVA 4H13C 1SQVE 3HUSC 3RK2D 1EDKA 2E74D 4L76A 1OW7A 1KYOH 5AW1B 4DZOA 2Z4EA 4U3FG 1SQXD 1U57A 3AE5C 1Q90D 4XFJA 1GW4A 3GHGB 4N78E 4Y28J 5BVZA 1URQA 2GUSA 1NHLA 2IZ0A 3B4SA 2WSEJ 3L70J 5KLVD 4D6TJ 5AW7B 1LTJC 2H8PD 2W8ZA 3CXHD 1GK6A 4HKZH 5AW6B 2WT7A 1XTGB 1GL2A 1N2DC 1YTZT 3TGUE 3NFQA 3GG2A 3AE6C 1VQPP 1NTME 1URQC 4UB8H 3CL3D 3KYQA 4KHXA 2W6BA 4Z1MH 1KB9H 1YHQP 1VF5D 1YQ3C 3RK3C 1QVFO 3H1HD 1FZCA 2OYHC 3CD6P 3VMZA 2RKLA 1PP9D 1U7JA 4MN4C 4B86A 2E76C 1S9KE 1LTJB 4BRYB 2FFDC 2NPSC 1RF0A 3MZWB 5CJ0A 1NYHA 2A06D 2ZXEB 4EI2A 1IK9A 3P8MC 5BU8B 2Q1KA 4RESB 1KILB 1L2PA 1NTZG 2XU6A 1IC2A 2K9JA 4M3LA 3G4SP 1W5CE 2KZIA 2WSCH 1M56D 4QMAA 3IR9A 3KQGA 4AYCA 2ZFCA 1JMMA 1Y9BA 2NPSB 3CWBJ 2PAJA 1NU1E 1QL2A 4WWIA 5AVZB 1G2CB 1SQPG 2KNCA 2YNYA 3H1LJ 5E79H 1L4AC 1SQPK 3L73G 4PJ0H 2N9BA 5AVWB 3WUVA 1L0LD 2Q3IA 2QVAA 3CX5H 3G71P 2JWAA 1RF1C 2WPVB 4WY4C 4JQ0D 4UB6E 4XE5B 1N86A 2DW3A 1RE3C 2NPSD 2O3JA 3F89A 4I1LA 1VQKP 2AXTH 1PGQA 1X0TA 4JYBA 1NTKK 1N7SC 2QJPB 3K5BA 3L74E 3AEBC 1NTKG 4JBZA 4ZNCA 2OTJP 1FDMA 2CPSA 2KS1B 5AW4B 4DJGA 4ZMDA 3L73E 3BVHA 3A7OA 2V7QH 5EFWB 3IF4A 3VN0A 3NXSA 5APTA 1J1EC 1USEA 3EFGA 5TISE 1LT9A 1SQVG 1BCCE 1N7SA 3FXDA 2QJKC 3CMEP 4RO0A 1LP1A 3HD7C 2BEQD 2O1KA 2Q5UA 3RK2C 1LTGC 1VDFA 3AE8C 1BDCA 4AUWA 1M1JA 2W90A 5KJ7C 2IZ1A 2FFDB 1KFNA 1ZXGA 1YI2P 1RH5B 1ZW0A 1KD1Q 1P84E 1J1EB 4H13B 1EC5A 1QL1A 3RL0D 2C9NY 3M06A 1QLED 2LXCB 3AEDC 1S4XA 2XNXA 4K35A 3OA7A 3V2NA 4GOEA 1GMJA 2IBZE 3R2PA 5M1BA 1QGKB 2WSCJ 1JM0A
chains in the Genus database with same CATH topology
1L0LJ 1KB9I 3H1IJ 3L71J 3H1KJ 1SQBJ 3L72J 1BCCJ 3TGUJ 3H1JJ 1NU1J 3L73J 3L75J 5KLVJ 4D6TJ 3L70J 1NTKJ 3L74J 1SQXJ 2FYUJ 2IBZI 3BCCJ 3CWBJ 4U3FJ 1P84I 3CX5I 1BE3J 3H1LJ 1NTZJ 3CXHI 4PD4I 1KYOI 2BCCJ 1SQVJ 1EZVI 1NTMJ 1SQQJ 1PP9J 1SQPJ 1L0NJ 3H1HJ 1BGYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L J;  1KB9 I;  3H1I J;  3L71 J;  3H1K J;  1SQB J;  3L72 J;  1BCC J;  3TGU J;  3H1J J;  1NU1 J;  3L73 J;  3L75 J;  5KLV J;  4D6T J;  3L70 J;  1NTK J;  3L74 J;  1SQX J;  2FYU J;  2IBZ I;  3BCC J;  3CWB J;  4U3F J;  1P84 I;  3CX5 I;  1BE3 J;  3H1L J;  1NTZ J;  3CXH I;  4PD4 I;  1KYO I;  2BCC J;  1SQV J;  1EZV I;  1NTM J;  1SQQ J;  1PP9 J;  1SQP J;  1L0N J;  3H1H J;  1BGY J; 
#chains in the Genus database with same CATH topology
 2WT7 B;  3Q2Y A;  1DIP A;  1LT9 C;  4JF7 A;  3H1I J;  3L71 J;  3A5T A;  3H1J E;  3H6P A;  3CPW O;  4U3F D;  1FZE A;  1AJY A;  1X9V A;  2B9B A;  1L4A B;  2GA1 A;  2JDI H;  2WSF J;  3AE3 C;  4U7J A;  3CC7 P;  3KZI H;  1RF1 B;  3E1I A;  3E7K A;  3H1L E;  3AEC C;  3AEF C;  2P10 A;  3TNU A;  4BXL A;  1N8R Q;  2FYU E;  1ZR2 A;  4GIF A;  2K9J B;  2KLV A;  2C0X A;  3CC2 P;  5APQ A;  3SFE C;  5GTH H;  2QSI A;  4OVN F;  2O1J A;  2E5Y A;  2HR3 A;  2R44 A;  1H89 A;  2WTY A;  1T3J A;  4D6T G;  1PPJ G;  1ZOY C;  2R3S A;  1N7S D;  2ZYG A;  3A2A A;  3HUS B;  4RJT A;  1L0N D;  1VQ4 P;  4HYT B;  1NTM J;  1OXZ A;  2E75 D;  2HOD B;  1SLQ A;  4IL6 H;  3KXD A;  5AVT B;  2Y9Z A;  1HVV A;  5KTB A;  4WY4 D;  3M0D A;  2I1K A;  1KIL E;  1L0L J;  2Z5I A;  3BAS A;  2JWD A;  5B66 E;  3HTK A;  1CSB A;  1T6A A;  1SQB J;  3SFD C;  1OFC X;  1AQ5 A;  1CI6 A;  4XA4 A;  2LR2 A;  2R5D A;  2M5A A;  3OW2 O;  2KYV A;  2P2U A;  1JB0 J;  3L72 E;  4WY4 B;  2YMY A;  1KOR A;  4HJG H;  3HE5 B;  3RGU A;  1KQG B;  4YXW H;  2B87 B;  1SS1 A;  2N9Y B;  5H2F E;  2ZJS E;  1JY2 O;  2XDJ A;  4KT0 J;  5K5G B;  2OTL P;  2D2C D;  3V2P A;  1RY3 A;  4H44 B;  5B5E E;  3U1A A;  2ZYD A;  3H1I G;  1LT9 B;  1SQQ G;  5H2F H;  2YIU B;  1OW6 A;  3PP5 A;  1SQQ K;  5CCG C;  2RH0 A;  3SSU A;  4TT3 H;  4IL6 X;  1FU1 A;  2E75 C;  3CCJ P;  2FXM A;  1GTW A;  2OTK E;  2YO3 A;  3LW5 H;  1SVF A;  2I1J A;  2H89 C;  2IFM A;  3B5N B;  3EFF K;  3BCC G;  4PJ0 E;  5APS A;  1KIL C;  3QWO C;  3CWB E;  1BE3 G;  4OWF A;  1SQP J;  1HUC A;  2YKQ A;  3H1L G;  3H1I E;  3L4F A;  3WUT A;  4R4L A;  1DD4 A;  1SQX G;  1LWU B;  4HH2 A;  2QIW A;  4Y99 C;  3CMA P;  1JMB A;  1EDJ A;  3MUD A;  1ZP0 C;  3MD0 A;  1G2C A;  1KQF B;  1JY3 N;  3PHL A;  3P8C E;  2PP6 A;  1EQ7 A;  1M1J B;  1Z56 A;  3AEA C;  2FYN C;  1Q2N A;  1JCC A;  3L70 D;  3H1K E;  1GDT A;  1L0N G;  5TJH A;  1N7S B;  1L0N K;  1OX3 A;  2QJP C;  2KLU A;  3MTU E;  2AEF A;  2O01 J;  2WQY C;  4WY4 A;  3VMA A;  2M5A B;  3H25 A;  3BCC J;  5CCH C;  1YYC A;  1VQ9 P;  2B88 A;  2E74 C;  1HGZ A;  1PFI A;  3HE4 A;  3CX5 E;  3Q1M A;  2BEZ F;  3KZI E;  2P1J A;  1YJN P;  1BSH A;  4ZKU A;  3OJA B;  1FZF A;  5AW2 B;  1FZA A;  5KAI E;  1VQO P;  1K73 Q;  1USD A;  1PP9 J;  5KLI C;  3VOP A;  2Y0D A;  2J58 A;  3L74 G;  3AE2 C;  2B89 A;  3QH9 A;  3PLN A;  2R32 A;  3VTP C;  5APU A;  3A0B H;  3H1H E;  2QRX A;  2JJL A;  1Q81 Q;  1LT1 A;  1GL2 B;  1UIX A;  3AE7 C;  4C7R A;  3FX0 A;  2KUB A;  1YTZ I;  1S9K D;  3JC2 2;  1KYO E;  2A45 G;  2OYH A;  1FZC C;  1NTK D;  1GZL A;  3H1J J;  4WVZ A;  1HGV A;  3L71 G;  5KLV J;  4I7Z C;  2A06 E;  2JKV A;  2G8Y A;  1EZV G;  2WSE H;  3EQ2 A;  1KQS O;  3SWY A;  1XTC C;  2E76 B;  1S72 P;  1L0L K;  1SQB D;  4PD4 D;  2OYI B;  1L0L G;  3T97 B;  1SQQ E;  5L8R J;  3S1K A;  3B71 A;  4K3A A;  1PL5 A;  3NTN A;  4UB6 H;  2HYN A;  4OGQ B;  3VP9 A;  3GMA A;  3M9H A;  1VPC A;  3FXE A;  5TIS H;  3HD7 A;  2HPC B;  3TK1 A;  1DX7 A;  3I56 P;  2MJZ A;  4L74 A;  2AEJ A;  5CMZ A;  1BE3 E;  1SQV D;  3HE4 B;  5APW A;  2KZJ A;  3O6Q B;  1L0L E;  5CCH D;  1MKM A;  1M1K Q;  2OYI C;  1SQX E;  3H1J G;  1NTM K;  1M90 Q;  3D6Y A;  1MZ9 A;  1WRG A;  1NTM G;  3PRJ A;  4N78 D;  2C9L Y;  1FZG A;  1K8A Q;  1S1C X;  3TF5 A;  1EDI A;  3L74 D;  3N4X A;  2OGU A;  3TGU J;  3B5N D;  3TGU D;  1T8Z A;  4H0L B;  4GKG A;  2P67 A;  1NTK J;  2NRG A;  3AEE C;  1DEB A;  3A3Y B;  1NAY A;  1J2J B;  2UWJ E;  2LKM A;  3H32 B;  3L36 A;  1AV1 A;  2K1A A;  2K37 A;  2W6J H;  1RHZ B;  3R4Y A;  1P84 I;  1IFM A;  4W7Z A;  1LTT C;  3RL0 g;  2FY8 A;  1GD2 E;  1PGJ A;  4DCK A;  1EZV I;  3JCU E;  2M8R A;  2YKP A;  3C9I A;  1X22 A;  1WMK A;  3LID A;  2QJY C;  1QEX A;  3Q5P A;  1GL2 D;  1P84 D;  1SQB K;  5KJ7 A;  1GU4 A;  2R3C A;  5GTI E;  3PTZ A;  1PGP A;  4L73 A;  2IX7 C;  5AVV B;  1SQP E;  3BRT B;  1Q7Y Q;  1JO5 A;  3V4Q A;  1EZV D;  1T2K C;  2E74 B;  2HLO A;  5AW5 B;  1VQL P;  1YIT P;  1AVY A;  1KB9 E;  1VQM P;  2ZYA A;  1KFM A;  3LW5 J;  3HD7 D;  4IFM A;  1JCD A;  2GUV A;  3I55 P;  2WZ7 A;  1NU1 D;  2QJY B;  1AQT A;  1SFC D;  1BSN A;  1MUU A;  1YJW P;  3AE4 C;  1PPJ D;  3V6I A;  1IO4 A;  3V2R A;  4C7N B;  2KI7 B;  1CZQ A;  2K3R A;  1IFP A;  2KSE A;  2Y0C A;  4C46 A;  5KKZ B;  1OVV A;  3L35 A;  1SFC B;  3L75 E;  4LLH A;  4PD4 I;  4TLF A;  4IFD K;  5BU5 A;  2QJK B;  2ZVN B;  3M0A A;  4PD4 H;  2BCC E;  3HD7 B;  3V5B A;  1FJK A;  1U7M A;  3CWB G;  2FYU K;  3CCM P;  3BCC E;  4W80 A;  3HUS A;  4YTP C;  1FE6 A;  2FYZ A;  3CC4 P;  3L73 J;  4JPZ B;  4H44 C;  1AA0 A;  2WIT A;  2M3E A;  1H88 A;  1DD3 A;  1KB9 I;  4IOI H;  1URQ D;  1IJD B;  3A0H E;  1K04 A;  2NPS A;  2YXR B;  1NAF A;  5KAF H;  1VQ6 P;  2CK3 H;  1ZME C;  2BCC G;  5AVX B;  4EDF A;  1AFO A;  1T3U A;  1K9M Q;  2M0B A;  1LJ2 A;  3FWL A;  3O8Z A;  4UB8 E;  2QE7 H;  2OYH B;  3P32 A;  4NPF X;  5AW3 B;  1ZRT D;  2XND H;  1MV8 A;  1ZLL A;  2QEX P;  3GHG A;  3RL0 B;  3CCS P;  2W27 A;  5DJT B;  2QA4 P;  3B8E B;  1S5L H;  2C0W A;  5CCH A;  3L72 D;  3P7K A;  2V7Q J;  1JNM A;  2OQQ A;  1Y47 A;  2Y9Y A;  5KLV E;  2KB7 P;  4L75 A;  1HWT C;  2WVR A;  1ZR4 A;  1M1J C;  1NO4 A;  2Z5H A;  1NTZ E;  2IFN A;  5E79 E;  3W68 A;  3ZDM A;  1BCC G;  5GTH E;  2KP8 A;  3WUU A;  4U3F E;  3G6E P;  1Q86 Q;  3KHU A;  4I6M C;  3GF3 A;  1VQ8 P;  2XKM A;  2FXP A;  1NTM D;  2IYO A;  3MUD C;  5CCG D;  3IN6 A;  2L5G B;  4I2L C;  3UIA A;  1FOS F;  1GK4 A;  3L37 A;  1MFZ A;  2KNC B;  3USS A;  3CCQ P;  3MP7 B;  1RQV A;  2E42 A;  3CWB D;  1NH4 A;  1SFC C;  1PP9 E;  2FYU D;  2E75 B;  3BRV B;  3N7N A;  4WB4 A;  1PZQ A;  5C39 A;  4GOF A;  3TDK A;  1JY3 P;  2E5T A;  4N3Y B;  1J1D B;  1S5L X;  3B5N C;  1RE3 A;  3HE5 A;  2KOG A;  2A06 G;  3L75 J;  3WU2 E;  2KSJ A;  4D6T D;  3VMY A;  2WPQ A;  4EOT A;  1NWQ A;  3CCL P;  3MIW A;  1LNQ A;  1IFJ A;  1SQX J;  1GU5 A;  2Q6Q A;  2FKW B;  1JTH B;  3TNU B;  1PP9 G;  3D71 A;  1K05 A;  4N6J A;  1N73 B;  1NVO A;  2I8D A;  1NU1 K;  3CXH I;  1BGY D;  3L71 D;  1OVU A;  3L72 G;  1NJI Q;  3E1R A;  3U1C A;  3G3Z A;  1FOS E;  4LGD E;  2H7H A;  1D7M A;  1KIL D;  2JO1 A;  1VF5 C;  3RK3 D;  2AXC A;  5AVQ B;  5DJU B;  1NOH A;  3ITK A;  2M3B A;  2IPP A;  3M9Q A;  2ZXX A;  1HH0 A;  1Q82 Q;  3RBZ A;  1S3J A;  2A45 I;  2YMK A;  1E5W A;  4AQR D;  1R8E A;  2AEM A;  3TYY A;  1FAV A;  2P58 A;  2QG4 A;  3RL0 C;  1FBM A;  4ASW A;  2QM7 A;  1E79 H;  3AE1 C;  3CXH E;  3T97 A;  4EIJ A;  2OYI A;  2GM4 A;  1IK7 A;  1VF5 B;  2RMZ A;  1CI6 B;  4OH8 B;  5KLI B;  1NTZ K;  4GOD A;  1LGH B;  1RE4 A;  1BCC D;  3D6Z A;  3CI9 A;  2IBZ I;  3NMD A;  1FDI A;  1NTK E;  1G1J A;  1VL2 A;  1R5S A;  3C8V A;  3GLM A;  4BWN A;  1X8Y A;  5B5E H;  1HF9 A;  4ZKP A;  2WWW A;  1HTL C;  2WPS A;  2R5B A;  3L70 G;  4DT0 A;  2BCC J;  3AE9 C;  5AVU B;  1HJB A;  3M9B A;  1RE4 C;  2FYU G;  3OAK A;  3A0H H;  1SQQ D;  1LWU A;  1MFT A;  2HG5 D;  2PFX A;  3GHG C;  2YXQ B;  4W7Y A;  2NZ2 A;  3C1L A;  4H44 D;  4RKU J;  1NGM B;  1FC2 C;  1DEE G;  2JP3 A;  2N1T D;  3P8C D;  4H0L D;  4PV1 D;  2HPC A;  1S2E A;  1IFN A;  2D2C C;  3LIE A;  3V4W A;  3L70 E;  1H0T B;  3H1K J;  1BE3 D;  1KMI Z;  1FZB A;  2J5U A;  1RF0 C;  1SP4 A;  2BAS A;  5APY A;  1SQV K;  4HB1 A;  5CBO A;  2G3A A;  2N1T B;  3H1J D;  4PV1 B;  1OZH A;  2W6A A;  5APV A;  3A0B E;  3L74 J;  1IZN B;  3RBX A;  2JR8 A;  3HTK B;  3I5C A;  3SWK A;  5CCG A;  1YIJ P;  1LWU C;  2IBZ G;  1IFI A;  2FYU J;  3Q5R A;  1EDL A;  3BAT A;  2D2C B;  5KLV K;  5AW0 B;  1NTZ J;  1GL2 C;  2ITA A;  1KQL A;  1KYO I;  1OW8 A;  1LTB C;  2HOD A;  2KXP B;  5AW8 B;  1SQV J;  1VQ7 P;  3D70 A;  3L73 D;  1T2K D;  1VQN P;  1HBW A;  1SQB G;  1JY2 N;  2PRR A;  1W2E A;  5KAF E;  3H1H J;  4O9B A;  4YPC A;  1S5L E;  1BGY J;  1L0N E;  2HFE D;  1KYO D;  1JY2 P;  3IFM A;  5AW9 B;  3S4R A;  3M0D C;  4A7P A;  1N73 A;  4LC1 A;  1NKN A;  1SFC A;  1N73 C;  1CW5 A;  1VQ5 P;  3II6 A;  2H43 A;  1QX8 A;  4OGQ C;  1L4A D;  3L72 J;  3VMX A;  3VYI A;  2FBW C;  3FGA D;  1SQB E;  4PD4 E;  4C7N A;  1RF1 A;  1KIL A;  5APX A;  4JYC A;  2WMM A;  3H32 A;  4EYY Q;  2N1T A;  2B87 A;  2KK7 A;  4NPE A;  2YKO A;  2POH A;  2K9Y A;  5CJ4 A;  4IL6 E;  3HRN A;  4Y99 B;  2OAR A;  5AVY B;  4KJM A;  3CCR P;  1R5L A;  1BE3 J;  1EXI A;  1NU1 G;  1Y8A A;  2Y0E A;  3WMM 0;  5KLV G;  3H1H G;  1FJP A;  2IBZ D;  3V2Q A;  2CPB A;  1N7L A;  1PPJ E;  2K88 A;  1H8A A;  2Q9I A;  3CLQ A;  2IYP A;  3W67 A;  3RK2 B;  5AVS B;  4DOJ A;  1KTM A;  1JOC A;  2MKV A;  2ZT9 D;  3GW6 A;  1SQX K;  1PV3 A;  3RK3 E;  3VP8 A;  4YXD C;  2OYO A;  1WT6 A;  2BCC D;  3F5H A;  4CPG A;  3H1L D;  2FFD A;  3BCC D;  3GF7 A;  2V4H A;  5CHX A;  4R4M A;  2ZT9 B;  1UII A;  1A02 F;  2WPR A;  2YO2 A;  1LP1 B;  3RK3 B;  3PH0 A;  1YBK A;  1QVG O;  1JEK A;  1NU1 J;  2LXB A;  3JSV C;  4H13 D;  1OVR A;  5B66 H;  2E43 A;  1ZV8 A;  2W83 C;  2ZVO B;  1X79 B;  3EWK A;  1KC8 Q;  2J59 M;  1H0T A;  3KDP B;  3CX5 I;  3TGU G;  3WU2 H;  3CCU P;  4OGQ D;  1ZRT E;  3H1K D;  3CCV P;  1YJ9 P;  2H88 C;  1W2B O;  2Q3E A;  1L4A A;  1OWA A;  2WSF H;  4GT1 A;  1P84 H;  3CXH H;  3PJS K;  5CBN A;  1SQP D;  2FXO A;  5AVR B;  2E76 D;  1EZV E;  2KS1 A;  3Q5S A;  4GDO A;  2O01 N;  4I7Z B;  1PGO A;  3CX5 D;  4H0L C;  1KB9 D;  1OIP A;  2O01 H;  2QM8 A;  1KV4 A;  2XV5 A;  1YQ4 C;  2KIK A;  1HJ0 A;  1NTZ D;  3MGN A;  2ZAE B;  4WBA A;  1TU3 F;  2YIU C;  1M57 D;  3L75 G;  1EXJ A;  5KKZ C;  3CCE P;  2Q7C A;  1FDO A;  5KAI H;  5KJ7 D;  1IFD A;  1JY3 O;  1LTI C;  1NKZ B;  1M8O B;  1JTH A;  1URQ B;  2XZR A;  3AEG C;  1DH3 A;  1BCC J;  2JEE A;  4NPD A;  3Q3D A;  1A02 J;  1JUN A;  3MHV A;  1ZN5 A;  2WSS H;  3M91 A;  3U59 A;  3L75 D;  3H1K G;  1M7L A;  1RQU A;  5GTI H;  3G9R A;  2AXT E;  2P7J A;  3ABV C;  1BGY G;  2VRS A;  3FWN A;  2L91 A;  4U3F J;  2IDB A;  1BDD A;  1GW3 A;  3IAO A;  3JCU H;  4D6T E;  1KZU B;  2ZT9 C;  3H1I D;  3KPE A;  1G1I A;  1FZC B;  1J1D C;  3S9O A;  3SWF A;  1LTS C;  1LTA C;  2A45 H;  2FYN B;  1SQQ J;  2N1T C;  1LTJ A;  1PIX A;  3O6Q A;  4IFF A;  4PV1 C;  2SPZ A;  4BRY A;  1FS0 E;  2PGD A;  1BGY E;  1L0N J;  3L71 E;  3TSI A;  2RN0 A;  3B5N A;  1KN7 A;  1AVO A;  1OMI A;  4ASV A;  4H13 C;  1SQV E;  3HUS C;  3RK2 D;  1EDK A;  2E74 D;  4L76 A;  1OW7 A;  1KYO H;  5AW1 B;  4DZO A;  2Z4E A;  4U3F G;  1SQX D;  1U57 A;  3AE5 C;  1Q90 D;  4XFJ A;  1GW4 A;  3GHG B;  4N78 E;  4Y28 J;  5BVZ A;  1URQ A;  2GUS A;  1NHL A;  2IZ0 A;  3B4S A;  2WSE J;  3L70 J;  5KLV D;  4D6T J;  5AW7 B;  1LTJ C;  2H8P D;  2W8Z A;  3CXH D;  1GK6 A;  4HKZ H;  5AW6 B;  2WT7 A;  1XTG B;  1GL2 A;  1N2D C;  1YTZ T;  3TGU E;  3NFQ A;  3GG2 A;  3AE6 C;  1VQP P;  1NTM E;  1URQ C;  4UB8 H;  3CL3 D;  3KYQ A;  4KHX A;  2W6B A;  4Z1M H;  1KB9 H;  1YHQ P;  1VF5 D;  1YQ3 C;  3RK3 C;  1QVF O;  3H1H D;  1FZC A;  2OYH C;  3CD6 P;  3VMZ A;  2RKL A;  1PP9 D;  1U7J A;  4MN4 C;  4B86 A;  2E76 C;  1S9K E;  1LTJ B;  4BRY B;  2FFD C;  2NPS C;  1RF0 A;  3MZW B;  5CJ0 A;  1NYH A;  2A06 D;  2ZXE B;  4EI2 A;  1IK9 A;  3P8M C;  5BU8 B;  2Q1K A;  4RES B;  1KIL B;  1L2P A;  1NTZ G;  2XU6 A;  1IC2 A;  2K9J A;  4M3L A;  3G4S P;  1W5C E;  2KZI A;  2WSC H;  1M56 D;  4QMA A;  3IR9 A;  3KQG A;  4AYC A;  2ZFC A;  1JMM A;  1Y9B A;  2NPS B;  3CWB J;  2PAJ A;  1NU1 E;  1QL2 A;  4WWI A;  5AVZ B;  1G2C B;  1SQP G;  2KNC A;  2YNY A;  3H1L J;  5E79 H;  1L4A C;  1SQP K;  3L73 G;  4PJ0 H;  2N9B A;  5AVW B;  3WUV A;  1L0L D;  2Q3I A;  2QVA A;  3CX5 H;  3G71 P;  2JWA A;  1RF1 C;  2WPV B;  4WY4 C;  4JQ0 D;  4UB6 E;  4XE5 B;  1N86 A;  2DW3 A;  1RE3 C;  2NPS D;  2O3J A;  3F89 A;  4I1L A;  1VQK P;  2AXT H;  1PGQ A;  1X0T A;  4JYB A;  1NTK K;  1N7S C;  2QJP B;  3K5B A;  3L74 E;  3AEB C;  1NTK G;  4JBZ A;  4ZNC A;  2OTJ P;  1FDM A;  2CPS A;  2KS1 B;  5AW4 B;  4DJG A;  4ZMD A;  3L73 E;  3BVH A;  3A7O A;  2V7Q H;  5EFW B;  3IF4 A;  3VN0 A;  3NXS A;  5APT A;  1J1E C;  1USE A;  3EFG A;  5TIS E;  1LT9 A;  1SQV G;  1BCC E;  1N7S A;  3FXD A;  2QJK C;  3CME P;  4RO0 A;  1LP1 A;  3HD7 C;  2BEQ D;  2O1K A;  2Q5U A;  3RK2 C;  1LTG C;  1VDF A;  3AE8 C;  1BDC A;  4AUW A;  1M1J A;  2W90 A;  5KJ7 C;  2IZ1 A;  2FFD B;  1KFN A;  1ZXG A;  1YI2 P;  1RH5 B;  1ZW0 A;  1KD1 Q;  1P84 E;  1J1E B;  4H13 B;  1EC5 A;  1QL1 A;  3RL0 D;  2C9N Y;  3M06 A;  1QLE D;  2LXC B;  3AED C;  1S4X A;  2XNX A;  4K35 A;  3OA7 A;  3V2N A;  4GOE A;  1GMJ A;  2IBZ E;  3R2P A;  5M1B A;  1QGK B;  2WSC J;  1JM0 A; 
#chains in the Genus database with same CATH homology
 1L0L J;  1KB9 I;  3H1I J;  3L71 J;  3H1K J;  1SQB J;  3L72 J;  1BCC J;  3TGU J;  3H1J J;  1NU1 J;  3L73 J;  3L75 J;  5KLV J;  4D6T J;  3L70 J;  1NTK J;  3L74 J;  1SQX J;  2FYU J;  2IBZ I;  3BCC J;  3CWB J;  4U3F J;  1P84 I;  3CX5 I;  1BE3 J;  3H1L J;  1NTZ J;  3CXH I;  4PD4 I;  1KYO I;  2BCC J;  1SQV J;  1EZV I;  1NTM J;  1SQQ J;  1PP9 J;  1SQP J;  1L0N J;  3H1H J;  1BGY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...