3L72J

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l72J00
2FYUJ 1KB9I 1NTMJ 1PP9J 1SQVJ 3L74J 1NTKJ 4PD4I 1L0LJ 3H1JJ 4U3FJ 3L72J 1NTZJ 1P84I 1SQQJ 3TGUJ 1SQPJ 3H1IJ 3L73J 2BCCJ 1SQBJ 1NU1J 1BGYJ 3BCCJ 3L70J 3L75J 4D6TJ 3L71J 3H1HJ 2IBZI 1BE3J 1BCCJ 3H1KJ 3H1LJ 3CWBJ 1L0NJ 1KYOI 3CXHI 5KLVJ 1SQXJ 3CX5I 1EZVI
chains in the Genus database with same CATH superfamily
2FYUE 1QVGO 3AE5C 5KLVD 1NTMJ 1YBKA 1IZNB 1YQ4C 4IL6E 2AEFA 3VMZA 3G71P 4PV1B 2FXPA 1L0LE 3M9BA 3VYIA 3L70D 5AW8B 4D6TD 1ZN5A 2I1JA 2XKMA 2V7QJ 2ZJSE 3TYYA 3WUVA 2WPRA 3V4WA 4L74A 4UB6H 1L0ND 1YHQP 5CCHD 3L75J 3HTKB 2WPVB 2B87A 3L75G 1VQ5P 2FXOA 1W2EA 2IX7C 1HUCA 2LR2A 5KKZB 2OTLP 1N7LA 2YNYA 4PD4H 3V2QA 1NTZK 2YIUC 3B5NB 3RL0B 2NPSB 3H1LJ 3H1KG 1FU1A 4C7NB 3L75D 1KILA 2NZ2A 4OGQC 1CZQA 2W83C 1AA0A 1KC8Q 3CX5D 1U7MA 3D6ZA 1KQSO 2WZ7A 1NWQA 3U1AA 2JWDA 1N73C 1OW7A 5KAIE 4AYCA 1GL2D 1SQXK 1CSBA 5APQA 3L73E 1JNMA 1FOSE 3CC4P 2IDBA 1URQD 1N7SB 1ZRTE 1FS0E 2PP6A 1YI2P 2SPZA 1EXJA 1NTZE 2FY8A 3B5NA 1KB9D 2Y0DA 2E76B 2E74B 4N6JA 2ZXEB 1SQQG 1DD3A 1NU1G 3AE8C 3L37A 1EZVE 2QVAA 3GG2A 3W68A 1G1JA 1BGYG 1ZW0A 2IBZD 1RF1B 4H0LD 1PP9G 5AVWB 4RKUJ 5AW7B 1JCDA 3H1HJ 1LGHB 4H13B 1DIPA 1LWUC 1NKNA 3M9QA 3D71A 1JM0A 4U3FG 2KB7P 5AW1B 5GTHE 1JEKA 1HF9A 1M8OB 1N7SA 4C7RA 1USDA 4GOEA 2QSIA 3BRTB 5AW5B 1FZBA 2GUSA 5APTA 1FZGA 4U3FD 1J1DC 2IZ0A 3S1KA 5L8RJ 1M57D 3VN0A 1KILD 1R5SA 2M5AB 4WY4B 5CJ0A 5GTIH 4ZKUA 1ZR2A 1IO4A 2KOGA 2QJKC 3CC7P 2QIWA 2O1JA 2AEMA 1NTKJ 2K37A 3A0HH 4H13D 4OGQD 4TT3H 5CHXA 3LIDA 1K9MQ 1SFCC 5AW9B 3MUDA 2MJZA 1P84H 5E79H 2XZRA 2R32A 1YTZT 3CCLP 2WSFH 3H1IJ 3L73J 1VF5B 2B87B 5CCGC 1RHZB 1KN7A 1SQBJ 1ZR4A 1PPJE 1SQBG 2YKPA 1FZFA 3L70E 1KB9H 3KYQA 1YITP 2FYZA 4MN4C 3CPWO 3KQGA 2XV5A 3P7KA 3AEEC 1BE3J 3B4SA 2M8RA 3BATA 3KZIE 1SQBD 1X79B 3GHGA 3PLNA 4L76A 1NOHA 5BVZA 1FZCC 2BEZF 2H88C 3NXSA 4A7PA 4UB8H 1SQXJ 2B88A 2OYIB 1HVVA 1OIPA 2RMZA 2K9JA 4N78E 1L4AC 2KNCB 1AQTA 1UIIA 2JP3A 3H32A 1EDIA 1SQBK 2XNXA 3UIAA 3G4SP 5KJ7D 2OYHB 3A0BH 3PTZA 3L74J 3CCUP 1URQA 3MP7B 2XNDH 4NPDA 1QX8A 2AXCA 3H1JG 4JBZA 4PD4E 4U3FJ 1BGYD 5APSA 1VQ4P 2W6AA 1FDMA 3HD7C 1M90Q 2YXQB 1E5WA 2OTJP 4IFMA 4OH8B 3SWFA 2BASA 1HH0A 2ZVNB 2KIKA 3RL0g 3AEFC 5AVUB 1LWUA 2AEJA 1IK9A 4D6TE 4IFFA 2CPBA 5CCGD 2OYIA 2E75D 1KFMA 1T3JA 2KXPB 3GLMA 2QE7H 2QJYC 3ABVC 3CI9A 1U7JA 1CI6A 1JTHA 4QMAA 2NPSD 2G3AA 2QM8A 4W7ZA 1NKZB 3RBXA 3TF5A 1XTGB 4AQRD 2O1KA 3RK3B 5KLIB 1W5CE 3AE1C 3IF4A 1HGZA 1J1DB 2YKQA 4YXWH 1ZOYC 3P32A 1KQFB 2KZJA 1EC5A 1JO5A 1LTJC 1N2DC 2WT7B 2O01N 2FFDA 1FDIA 4OVNF 3MUDC 1N73B 3VMYA 4R4MA 3AE9C 3L72E 1Q90D 1CI6B 1JTHB 2IYPA 1KILE 3GF7A 2H7HA 4TLFA 1HTLC 1PL5A 1SQXG 3TNUB 3V2RA 2M3EA 3VP9A 2HG5D 3H1LD 3Q2YA 4RJTA 2KSEA 1BGYJ 2IPPA 2HYNA 2WMMA 4JYCA 1JUNA 1GD2E 2FXMA 2AXTE 3CLQA 4H44B 2E5TA 5EFWB 1Q81Q 1XTCC 2P2UA 3WUTA 3L74G 3FXEA 2N1TC 3HE5A 2Y0CA 5AVSB 3H1KJ 1GTWA 1OFCX 3CWBE 3F89A 3NFQA 5C39A 1K73Q 1VQNP 3FWLA 2ZYAA 1NTZG 1U57A 4HJGH 3JCUH 4HH2A 1JY3N 3E7KA 1LTTC 4DOJA 3AEBC 3B5ND 4KJMA 1NTME 1RF0C 1KD1Q 2JEEA 2JDIH 1JCCA 1BE3G 1SQVE 2WSCH 4H44D 4JYBA 1S5LH 4BXLA 4CPGA 4RO0A 3Q5SA 2QM7A 3JSVC 2WPQA 3HE5B 2KLVA 1GL2A 1S9KD 1L2PA 1T2KD 2Z5HA 1BSHA 1SQQJ 1OX3A 1NJIQ 2WPSA 4C46A 1N73A 3H1IG 1LWUB 3L73G 4BRYA 1NU1J 1OZHA 5APVA 2PAJA 5CCGA 2DW3A 2KS1A 1NHLA 2FYUG 3L75E 1IFJA 3CMAP 2K3RA 2IBZI 3RGUA 2W6JH 3P8MC 3PJSK 4Y28J 2MKVA 5KLVK 1Q82Q 3EFGA 1L0NJ 1JB0J 1MUUA 2N1TD 2KI7B 4H13C 1SQVK 2QJKB 5M1BA 1VL2A 2WT7A 1RF1A 3L72D 1YJ9P 1YQ3C 2KNCA 4YPCA 1IFNA 1DX7A 1R5LA 1EXIA 1NO4A 2WQYC 1SQXD 3O6QA 2WSFJ 1VF5C 3H1LG 1DH3A 3L72G 2E43A 2V7QH 1AV1A 2H89C 1NTZJ 3JCUE 3TDKA 4EOTA 3FX0A 4HYTB 3CD6P 1IFIA 3MTUE 3LW5H 1S5LX 3MHVA 4WVZA 5B66H 4I1LA 5KAFE 4WBAA 1RF1C 1EDLA 2Q3IA 1JY3O 1T8ZA 3NTNA 1KQLA 1MFZA 1GK4A 1N86A 1OW8A 2W8ZA 3CCJP 1FOSF 2OYIC 3S4RA 3CX5E 2BCCD 2JWAA 3SFDC 3TSIA 2HPCB 2YIUB 3RL0C 1JOCA 4JF7A 2YO3A 2OQQA 1IC2A 3HE4A 1ZXGA 3L36A 4PV1C 3R4YA 2Q5UA 5APUA 4ZMDA 2ZYDA 2W6BA 2A06D 3L4FA 4HKZH 4IL6X 2B9BA 3V6IA 1S9KE 5TISE 3VMXA 1AFOA 1PP9E 5KAFH 3M9HA 4XA4A 3IFMA 1BCCG 1LTJA 1NTKE 5AW4B 1GL2B 3H1JJ 4W7YA 1L0LG 4M3LA 3CC2P 2IBZE 3A0BE 2M0BA 1SP4A 3ZDMA 1P84D 3M0AA 1X0TA 2WITA 1A02F 1FJPA 2J58A 1HGVA 1BCCD 2XU6A 3H1IE 1SQPG 1SQVD 2P67A 2WVRA 1L0LD 1PPJG 1SQBE 2R44A 5AVXB 3WU2E 4Y99B 1X9VA 3L70J 1IFMA 2KYVA 2YO2A 1KFNA 3LIEA 3L71E 1KYOD 3CXHD 1DEBA 2KLUA 1BE3E 1SQVG 1SQPD 3IAOA 1EZVD 3OA7A 1X8YA 1L0NK 3MGNA 1T2KC 1KTMA 2N1TA 1M7LA 2H8PD 2ZYGA 3BASA 1PP9D 5KLVG 3Q1MA 1LTJB 2L91A 2Q7CA 1SQXE 1PIXA 3PH0A 4PJ0E 5AW0B 1VQOP 1VDFA 1JY2P 2FYUK 2WWWA 1DD4A 2A45I 3CWBD 1P84E 3FGAD 5AVZB 4DCKA 3H6PA 5TISH 2IFNA 3ITKA 2Z4EA 1FE6A 3L74E 1EQ7A 4Z1MH 5AVYB 3CMEP 1NAYA 2J5UA 2YMKA 1OVRA 1L0NG 1M1JB 1PGOA 1SFCD 4U3FE 1N8RQ 4KHXA 1T6AA 2LXCB 4W80A 3OW2O 1KYOE 3CXHE 4WB4A 3TGUJ 2QRXA 1MZ9A 1GL2C 1IFPA 1SQPJ 1YIJP 2BCCE 1G1IA 1HBWA 3L70G 4GIFA 3HRNA 4D6TJ 1N7SD 2FBWC 2A45G 1VQ8P 3TNUA 1LTAC 2R5BA 3HE4B 3NMDA 2ZVOB 1BCCJ 2P10A 4EI2A 5K5GB 2BEQD 2J59M 2KZIA 1BDCA 5KLVJ 1Z56A 2O01H 1FZCB 1EDJA 4H44C 2R3SA 1MKMA 3MZWB 3L35A 3LW5J 4WY4A 1GMJA 1PGPA 3A0HE 4H0LC 3U1CA 2OGUA 3H1KD 1L4AB 3PRJA 1RE4A 3W67A 3A7OA 1UIXA 1KB9I 3RK2D 4NPFX 4OWFA 2K9YA 3AECC 1J1EC 3B71A 3WUUA 3GMAA 1PGJA 1G2CB 2ITAA 3FXDA 5B5EH 1H0TA 1KYOH 3CXHH 3L72J 3RL0D 1ZP0C 4U7JA 2RH0A 1FAVA 3MD0A 2FYNC 3T97B 1P84I 1M1KQ 1NTMK 3AEDC 4GODA 3HUSC 1NTKD 3D70A 1KILC 2W90A 5BU8B 1BGYE 3II6A 1PV3A 1HWTC 1SQQD 1FZAA 1LTBC 1Y47A 2UWJE 4JQ0D 2LKMA 4IOIH 3KPEA 3H1KE 1HJBA 1NU1D 1GZLA 3AE4C 1EDKA 1LTIC 1G2CA 2Q6QA 2O01J 2WSEJ 2YXRB 1URQB 3C1LA 3N7NA 1QL1A 1JMMA 2E75C 2C0XA 3L71D 4K35A 4YTPC 3V2PA 1LP1B 1USEA 2XDJA 3B5NC 4DZOA 2KS1B 1K05A 1QGKB 2G8YA 3OJAB 3I55P 4D6TG 3CCRP 3OAKA 4GOFA 1BSNA 1KMIZ 2WSSH 3V4QA 5AVRB 1RF0A 1ZLLA 3HD7B 3L71G 1H88A 1SQVJ 2H43A 4EIJA 4H0LB 3M06A 2L5GB 3G3ZA 2WSCJ 4GT1A 1PGQA 1SFCA 1RH5B 2JKVA 5CMZA 5AVQB 5KTBA 4I6MC 3AE6C 3P8CD 3BVHA 4AUWA 1NYHA 1SQQE 1J1EB 4KT0J 1LT9A 3AEGC 1VQMP 5APWA 1NU1E 5AW3B 5CCHC 3GW6A 3BCCJ 4Y99C 3CCSP 1LTSC 1YJWP 2VRSA 3WMM0 4UB6E 3K5BA 2QJPB 2QA4P 1S72P 2GUVA 5H2FE 2HODA 1L0NE 1KQGB 3GHGC 1WMKA 1IJDB 4N3YB 2ZXXA 2D2CD 2D2CB 1RE3A 1TU3F 3PHLA 5AW2B 3CX5H 2GM4A 2Q1KA 1RE4C 3HTKA 2OYHA 3BRVB 1L4AA 4EYYQ 2FYUJ 1IK7A 1KB9E 4IL6H 3I56P 3KXDA 3Q5RA 4L73A 3Q3DA 4L75A 3A5TA 4PD4I 1L0LJ 2IBZG 5E79E 2Y9ZA 1FBMA 1M1JC 2FYNB 3M0DA 3AE3C 3CCEP 1OVVA 3O8ZA 1WRGA 3AE2C 2IZ1A 1RE3C 5CBOA 1NGMB 3GF3A 3USSA 3H1JD 1NH4A 2OTKE 4LLHA 3BCCG 2V4HA 2CPSA 4EDFA 3CCVP 2K1AA 1VQPP 1K8AQ 1R8EA 1YYCA 3F5HA 1GU4A 2ZFCA 2KP8A 3H1LE 3QWOC 1SLQA 1AQ5A 3AE7C 2E5YA 2KSJA 1ZV8A 2ZT9B 4XE5B 3FWNA 5GTHH 3RK3D 3QH9A 3HD7A 3M91A 3V2NA 5AW6B 5CJ4A 4PD4D 4ASWA 5AVVB 1KZUB 2Z5IA 2GA1A 4PJ0H 5APYA 2C9NY 4O9BA 2OYOA 1QL2A 2K9JB 2Y9YA 3CL3D 1PP9J 3I5CA 1LNQA 1NTMG 1SQQK 4ZKPA 1H8AA 3G6EP 2FFDC 2PGDA 3H1JE 4B86A 5BU5A 4LGDE 3SWKA 2QG4A 3IN6A 4UB8E 5DJTB 1LJ2A 1MFTA 2HR3A 2I8DA 2I1KA 2WSEH 1GU5A 3TGUG 1JY2N 1NTMD 2JO1A 2YKOA 5DJUB 4K3AA 1S5LE 2M5AA 1VPCA 3RBZA 1JMBA 1GK6A 1NTZD 3C9IA 3PP5A 3U59A 3L71J 1BDDA 3H1HE 3EFFK 2FKWB 2K88A 4NPEA 1Y8AA 2M3BA 1IFDA 3RK2B 1RQUA 1S1CX 2HODB 4JPZB 2C9LY 4LC1A 4ZNCA 1Q86Q 1SS1A 1GDTA 1Y9BA 2W27A 4GKGA 5AVTB 4I7ZC 4DJGA 5KJ7C 1EZVI 3S9OA 2FFDB 2AXTH 1S2EA 3VP8A 4XFJA 3Q5PA 1OVUA 4PV1D 1D7MA 1LP1A 1AJYA 5KLIC 3E1RA 3TK1A 2E74C 2E76C 3VMAA 3R2PA 5H2FH 5CBNA 1NVOA 2IFMA 3MIWA 4N78D 1X22A 3BCCD 2A06G 1SFCB 2C0WA 2HFED 1H89A 2B89A 1OWAA 4YXDC 2Q3EA 3TGUE 1BE3D 1SQPE 1T3UA 1N7SC 2BCCJ 1HJ0A 2LXBA 5CCHA 3JC22 5B66E 3H25A 1NU1K 3D6YA 1AVYA 3P8CE 1LT9B 1QLED 3HUSB 3T97A 1Q2NA 1BCCE 1KILB 3H1ID 3L73D 2R3CA 1OMIA 1K04A 2QJPC 1M1JA 2PFXA 2RKLA 2ZT9D 2ZT9C 3VOPA 4C7NA 4OGQB 3E1IA 1FDOA 5KLVE 1NTKK 2PRRA 1Q7YQ 1A02J 1ZMEC 1MV8A 3RK2C 2RN0A 1EZVG 4R4LA 1AVOA 1S4XA 1NAFA 1L4AD 2E42A 2OYHC 5KAIH 4GDOA 1GW4A 2E75B 1SQPK 3TGUD 1VQ6P 3RK3E 2JJLA 2KUBA 1LT1A 4DT0A 1RQVA 2POHA 3CWBG 2A06E 2ZAEB 4RESB 1L0LK 1WT6A 1FC2C 3HUSA 2E74D 2E76D 1PFIA 1YJNP 1RY3A 3KHUA 1GW3A 1KORA 3L74D 1M56D 2OARA 4WWIA 1OXZA 2A45H 2N9BA 2Y0EA 4BRYB 2JR8A 2Q9IA 1QVFO 3B8EB 2D2CC 3A2AA 2CK3H 3EWKA 2QJYB 5B5EE 3A3YB 2NPSA 1KYOI 2NPSC 3CXHI 1LT9C 1URQC 1VF5D 3C8VA 2HPCA 1VQLP 1H0TB 5KJ7A 3SSUA 3WU2H 3H1HD 3KZIH 3CX5I 2BCCG 1ZRTD 3EQ2A 3KDPB 3M0DC 1FZEA 1LTGC 1QEXA 4WY4D 4WY4C 1VQKP 2N9YB 1J2JB 4I2LC 1VQ9P 2R5DA 2KK7A 3H1HG 1PPJD 2HLOA 1YTZI 1S3JA 2P7JA 2FYUD 3O6QB 3SFEC 1E79H 5KKZC 1OW6A 1JY3P 4HB1A 4ASVA 4BWNA 2O3JA 1JY2O 3BCCE 2YMYA 2IYOA 1DEEG 3IR9A 2WTYA 3AEAC 5GTIE 3CCQP 1KV4A 2NRGA 3RK3C 2P1JA 3HD7D 3VTPC 1VQ7P 1NTKG 2P58A 3N4XA 1FZCA 2N1TB 3GHGB 4IFDK 3CWBJ 3CCMP 1FJKA 1W2BO 5TJHA 3V5BA 3G9RA 2QEXP 1PZQA 4I7ZB 5APXA 3SWYA 3H32B 1SVFA 1CW5A
chains in the Genus database with same CATH topology
2FYUJ 1KB9I 1NTMJ 1PP9J 1SQVJ 3L74J 1NTKJ 4PD4I 1L0LJ 3H1JJ 4U3FJ 3L72J 1NTZJ 1P84I 1SQQJ 3TGUJ 1SQPJ 3H1IJ 3L73J 2BCCJ 1SQBJ 1NU1J 1BGYJ 3BCCJ 3L70J 3L75J 4D6TJ 3L71J 3H1HJ 2IBZI 1BE3J 1BCCJ 3H1KJ 3H1LJ 3CWBJ 1L0NJ 1KYOI 3CXHI 5KLVJ 1SQXJ 3CX5I 1EZVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU J;  1KB9 I;  1NTM J;  1PP9 J;  1SQV J;  3L74 J;  1NTK J;  4PD4 I;  1L0L J;  3H1J J;  4U3F J;  3L72 J;  1NTZ J;  1P84 I;  1SQQ J;  3TGU J;  1SQP J;  3H1I J;  3L73 J;  2BCC J;  1SQB J;  1NU1 J;  1BGY J;  3BCC J;  3L70 J;  3L75 J;  4D6T J;  3L71 J;  3H1H J;  2IBZ I;  1BE3 J;  1BCC J;  3H1K J;  3H1L J;  3CWB J;  1L0N J;  1KYO I;  3CXH I;  5KLV J;  1SQX J;  3CX5 I;  1EZV I; 
#chains in the Genus database with same CATH topology
 2FYU E;  1QVG O;  3AE5 C;  5KLV D;  1NTM J;  1YBK A;  1IZN B;  1YQ4 C;  4IL6 E;  2AEF A;  3VMZ A;  3G71 P;  4PV1 B;  2FXP A;  1L0L E;  3M9B A;  3VYI A;  3L70 D;  5AW8 B;  4D6T D;  1ZN5 A;  2I1J A;  2XKM A;  2V7Q J;  2ZJS E;  3TYY A;  3WUV A;  2WPR A;  3V4W A;  4L74 A;  4UB6 H;  1L0N D;  1YHQ P;  5CCH D;  3L75 J;  3HTK B;  2WPV B;  2B87 A;  3L75 G;  1VQ5 P;  2FXO A;  1W2E A;  2IX7 C;  1HUC A;  2LR2 A;  5KKZ B;  2OTL P;  1N7L A;  2YNY A;  4PD4 H;  3V2Q A;  1NTZ K;  2YIU C;  3B5N B;  3RL0 B;  2NPS B;  3H1L J;  3H1K G;  1FU1 A;  4C7N B;  3L75 D;  1KIL A;  2NZ2 A;  4OGQ C;  1CZQ A;  2W83 C;  1AA0 A;  1KC8 Q;  3CX5 D;  1U7M A;  3D6Z A;  1KQS O;  2WZ7 A;  1NWQ A;  3U1A A;  2JWD A;  1N73 C;  1OW7 A;  5KAI E;  4AYC A;  1GL2 D;  1SQX K;  1CSB A;  5APQ A;  3L73 E;  1JNM A;  1FOS E;  3CC4 P;  2IDB A;  1URQ D;  1N7S B;  1ZRT E;  1FS0 E;  2PP6 A;  1YI2 P;  2SPZ A;  1EXJ A;  1NTZ E;  2FY8 A;  3B5N A;  1KB9 D;  2Y0D A;  2E76 B;  2E74 B;  4N6J A;  2ZXE B;  1SQQ G;  1DD3 A;  1NU1 G;  3AE8 C;  3L37 A;  1EZV E;  2QVA A;  3GG2 A;  3W68 A;  1G1J A;  1BGY G;  1ZW0 A;  2IBZ D;  1RF1 B;  4H0L D;  1PP9 G;  5AVW B;  4RKU J;  5AW7 B;  1JCD A;  3H1H J;  1LGH B;  4H13 B;  1DIP A;  1LWU C;  1NKN A;  3M9Q A;  3D71 A;  1JM0 A;  4U3F G;  2KB7 P;  5AW1 B;  5GTH E;  1JEK A;  1HF9 A;  1M8O B;  1N7S A;  4C7R A;  1USD A;  4GOE A;  2QSI A;  3BRT B;  5AW5 B;  1FZB A;  2GUS A;  5APT A;  1FZG A;  4U3F D;  1J1D C;  2IZ0 A;  3S1K A;  5L8R J;  1M57 D;  3VN0 A;  1KIL D;  1R5S A;  2M5A B;  4WY4 B;  5CJ0 A;  5GTI H;  4ZKU A;  1ZR2 A;  1IO4 A;  2KOG A;  2QJK C;  3CC7 P;  2QIW A;  2O1J A;  2AEM A;  1NTK J;  2K37 A;  3A0H H;  4H13 D;  4OGQ D;  4TT3 H;  5CHX A;  3LID A;  1K9M Q;  1SFC C;  5AW9 B;  3MUD A;  2MJZ A;  1P84 H;  5E79 H;  2XZR A;  2R32 A;  1YTZ T;  3CCL P;  2WSF H;  3H1I J;  3L73 J;  1VF5 B;  2B87 B;  5CCG C;  1RHZ B;  1KN7 A;  1SQB J;  1ZR4 A;  1PPJ E;  1SQB G;  2YKP A;  1FZF A;  3L70 E;  1KB9 H;  3KYQ A;  1YIT P;  2FYZ A;  4MN4 C;  3CPW O;  3KQG A;  2XV5 A;  3P7K A;  3AEE C;  1BE3 J;  3B4S A;  2M8R A;  3BAT A;  3KZI E;  1SQB D;  1X79 B;  3GHG A;  3PLN A;  4L76 A;  1NOH A;  5BVZ A;  1FZC C;  2BEZ F;  2H88 C;  3NXS A;  4A7P A;  4UB8 H;  1SQX J;  2B88 A;  2OYI B;  1HVV A;  1OIP A;  2RMZ A;  2K9J A;  4N78 E;  1L4A C;  2KNC B;  1AQT A;  1UII A;  2JP3 A;  3H32 A;  1EDI A;  1SQB K;  2XNX A;  3UIA A;  3G4S P;  5KJ7 D;  2OYH B;  3A0B H;  3PTZ A;  3L74 J;  3CCU P;  1URQ A;  3MP7 B;  2XND H;  4NPD A;  1QX8 A;  2AXC A;  3H1J G;  4JBZ A;  4PD4 E;  4U3F J;  1BGY D;  5APS A;  1VQ4 P;  2W6A A;  1FDM A;  3HD7 C;  1M90 Q;  2YXQ B;  1E5W A;  2OTJ P;  4IFM A;  4OH8 B;  3SWF A;  2BAS A;  1HH0 A;  2ZVN B;  2KIK A;  3RL0 g;  3AEF C;  5AVU B;  1LWU A;  2AEJ A;  1IK9 A;  4D6T E;  4IFF A;  2CPB A;  5CCG D;  2OYI A;  2E75 D;  1KFM A;  1T3J A;  2KXP B;  3GLM A;  2QE7 H;  2QJY C;  3ABV C;  3CI9 A;  1U7J A;  1CI6 A;  1JTH A;  4QMA A;  2NPS D;  2G3A A;  2QM8 A;  4W7Z A;  1NKZ B;  3RBX A;  3TF5 A;  1XTG B;  4AQR D;  2O1K A;  3RK3 B;  5KLI B;  1W5C E;  3AE1 C;  3IF4 A;  1HGZ A;  1J1D B;  2YKQ A;  4YXW H;  1ZOY C;  3P32 A;  1KQF B;  2KZJ A;  1EC5 A;  1JO5 A;  1LTJ C;  1N2D C;  2WT7 B;  2O01 N;  2FFD A;  1FDI A;  4OVN F;  3MUD C;  1N73 B;  3VMY A;  4R4M A;  3AE9 C;  3L72 E;  1Q90 D;  1CI6 B;  1JTH B;  2IYP A;  1KIL E;  3GF7 A;  2H7H A;  4TLF A;  1HTL C;  1PL5 A;  1SQX G;  3TNU B;  3V2R A;  2M3E A;  3VP9 A;  2HG5 D;  3H1L D;  3Q2Y A;  4RJT A;  2KSE A;  1BGY J;  2IPP A;  2HYN A;  2WMM A;  4JYC A;  1JUN A;  1GD2 E;  2FXM A;  2AXT E;  3CLQ A;  4H44 B;  2E5T A;  5EFW B;  1Q81 Q;  1XTC C;  2P2U A;  3WUT A;  3L74 G;  3FXE A;  2N1T C;  3HE5 A;  2Y0C A;  5AVS B;  3H1K J;  1GTW A;  1OFC X;  3CWB E;  3F89 A;  3NFQ A;  5C39 A;  1K73 Q;  1VQN P;  3FWL A;  2ZYA A;  1NTZ G;  1U57 A;  4HJG H;  3JCU H;  4HH2 A;  1JY3 N;  3E7K A;  1LTT C;  4DOJ A;  3AEB C;  3B5N D;  4KJM A;  1NTM E;  1RF0 C;  1KD1 Q;  2JEE A;  2JDI H;  1JCC A;  1BE3 G;  1SQV E;  2WSC H;  4H44 D;  4JYB A;  1S5L H;  4BXL A;  4CPG A;  4RO0 A;  3Q5S A;  2QM7 A;  3JSV C;  2WPQ A;  3HE5 B;  2KLV A;  1GL2 A;  1S9K D;  1L2P A;  1T2K D;  2Z5H A;  1BSH A;  1SQQ J;  1OX3 A;  1NJI Q;  2WPS A;  4C46 A;  1N73 A;  3H1I G;  1LWU B;  3L73 G;  4BRY A;  1NU1 J;  1OZH A;  5APV A;  2PAJ A;  5CCG A;  2DW3 A;  2KS1 A;  1NHL A;  2FYU G;  3L75 E;  1IFJ A;  3CMA P;  2K3R A;  2IBZ I;  3RGU A;  2W6J H;  3P8M C;  3PJS K;  4Y28 J;  2MKV A;  5KLV K;  1Q82 Q;  3EFG A;  1L0N J;  1JB0 J;  1MUU A;  2N1T D;  2KI7 B;  4H13 C;  1SQV K;  2QJK B;  5M1B A;  1VL2 A;  2WT7 A;  1RF1 A;  3L72 D;  1YJ9 P;  1YQ3 C;  2KNC A;  4YPC A;  1IFN A;  1DX7 A;  1R5L A;  1EXI A;  1NO4 A;  2WQY C;  1SQX D;  3O6Q A;  2WSF J;  1VF5 C;  3H1L G;  1DH3 A;  3L72 G;  2E43 A;  2V7Q H;  1AV1 A;  2H89 C;  1NTZ J;  3JCU E;  3TDK A;  4EOT A;  3FX0 A;  4HYT B;  3CD6 P;  1IFI A;  3MTU E;  3LW5 H;  1S5L X;  3MHV A;  4WVZ A;  5B66 H;  4I1L A;  5KAF E;  4WBA A;  1RF1 C;  1EDL A;  2Q3I A;  1JY3 O;  1T8Z A;  3NTN A;  1KQL A;  1MFZ A;  1GK4 A;  1N86 A;  1OW8 A;  2W8Z A;  3CCJ P;  1FOS F;  2OYI C;  3S4R A;  3CX5 E;  2BCC D;  2JWA A;  3SFD C;  3TSI A;  2HPC B;  2YIU B;  3RL0 C;  1JOC A;  4JF7 A;  2YO3 A;  2OQQ A;  1IC2 A;  3HE4 A;  1ZXG A;  3L36 A;  4PV1 C;  3R4Y A;  2Q5U A;  5APU A;  4ZMD A;  2ZYD A;  2W6B A;  2A06 D;  3L4F A;  4HKZ H;  4IL6 X;  2B9B A;  3V6I A;  1S9K E;  5TIS E;  3VMX A;  1AFO A;  1PP9 E;  5KAF H;  3M9H A;  4XA4 A;  3IFM A;  1BCC G;  1LTJ A;  1NTK E;  5AW4 B;  1GL2 B;  3H1J J;  4W7Y A;  1L0L G;  4M3L A;  3CC2 P;  2IBZ E;  3A0B E;  2M0B A;  1SP4 A;  3ZDM A;  1P84 D;  3M0A A;  1X0T A;  2WIT A;  1A02 F;  1FJP A;  2J58 A;  1HGV A;  1BCC D;  2XU6 A;  3H1I E;  1SQP G;  1SQV D;  2P67 A;  2WVR A;  1L0L D;  1PPJ G;  1SQB E;  2R44 A;  5AVX B;  3WU2 E;  4Y99 B;  1X9V A;  3L70 J;  1IFM A;  2KYV A;  2YO2 A;  1KFN A;  3LIE A;  3L71 E;  1KYO D;  3CXH D;  1DEB A;  2KLU A;  1BE3 E;  1SQV G;  1SQP D;  3IAO A;  1EZV D;  3OA7 A;  1X8Y A;  1L0N K;  3MGN A;  1T2K C;  1KTM A;  2N1T A;  1M7L A;  2H8P D;  2ZYG A;  3BAS A;  1PP9 D;  5KLV G;  3Q1M A;  1LTJ B;  2L91 A;  2Q7C A;  1SQX E;  1PIX A;  3PH0 A;  4PJ0 E;  5AW0 B;  1VQO P;  1VDF A;  1JY2 P;  2FYU K;  2WWW A;  1DD4 A;  2A45 I;  3CWB D;  1P84 E;  3FGA D;  5AVZ B;  4DCK A;  3H6P A;  5TIS H;  2IFN A;  3ITK A;  2Z4E A;  1FE6 A;  3L74 E;  1EQ7 A;  4Z1M H;  5AVY B;  3CME P;  1NAY A;  2J5U A;  2YMK A;  1OVR A;  1L0N G;  1M1J B;  1PGO A;  1SFC D;  4U3F E;  1N8R Q;  4KHX A;  1T6A A;  2LXC B;  4W80 A;  3OW2 O;  1KYO E;  3CXH E;  4WB4 A;  3TGU J;  2QRX A;  1MZ9 A;  1GL2 C;  1IFP A;  1SQP J;  1YIJ P;  2BCC E;  1G1I A;  1HBW A;  3L70 G;  4GIF A;  3HRN A;  4D6T J;  1N7S D;  2FBW C;  2A45 G;  1VQ8 P;  3TNU A;  1LTA C;  2R5B A;  3HE4 B;  3NMD A;  2ZVO B;  1BCC J;  2P10 A;  4EI2 A;  5K5G B;  2BEQ D;  2J59 M;  2KZI A;  1BDC A;  5KLV J;  1Z56 A;  2O01 H;  1FZC B;  1EDJ A;  4H44 C;  2R3S A;  1MKM A;  3MZW B;  3L35 A;  3LW5 J;  4WY4 A;  1GMJ A;  1PGP A;  3A0H E;  4H0L C;  3U1C A;  2OGU A;  3H1K D;  1L4A B;  3PRJ A;  1RE4 A;  3W67 A;  3A7O A;  1UIX A;  1KB9 I;  3RK2 D;  4NPF X;  4OWF A;  2K9Y A;  3AEC C;  1J1E C;  3B71 A;  3WUU A;  3GMA A;  1PGJ A;  1G2C B;  2ITA A;  3FXD A;  5B5E H;  1H0T A;  1KYO H;  3CXH H;  3L72 J;  3RL0 D;  1ZP0 C;  4U7J A;  2RH0 A;  1FAV A;  3MD0 A;  2FYN C;  3T97 B;  1P84 I;  1M1K Q;  1NTM K;  3AED C;  4GOD A;  3HUS C;  1NTK D;  3D70 A;  1KIL C;  2W90 A;  5BU8 B;  1BGY E;  3II6 A;  1PV3 A;  1HWT C;  1SQQ D;  1FZA A;  1LTB C;  1Y47 A;  2UWJ E;  4JQ0 D;  2LKM A;  4IOI H;  3KPE A;  3H1K E;  1HJB A;  1NU1 D;  1GZL A;  3AE4 C;  1EDK A;  1LTI C;  1G2C A;  2Q6Q A;  2O01 J;  2WSE J;  2YXR B;  1URQ B;  3C1L A;  3N7N A;  1QL1 A;  1JMM A;  2E75 C;  2C0X A;  3L71 D;  4K35 A;  4YTP C;  3V2P A;  1LP1 B;  1USE A;  2XDJ A;  3B5N C;  4DZO A;  2KS1 B;  1K05 A;  1QGK B;  2G8Y A;  3OJA B;  3I55 P;  4D6T G;  3CCR P;  3OAK A;  4GOF A;  1BSN A;  1KMI Z;  2WSS H;  3V4Q A;  5AVR B;  1RF0 A;  1ZLL A;  3HD7 B;  3L71 G;  1H88 A;  1SQV J;  2H43 A;  4EIJ A;  4H0L B;  3M06 A;  2L5G B;  3G3Z A;  2WSC J;  4GT1 A;  1PGQ A;  1SFC A;  1RH5 B;  2JKV A;  5CMZ A;  5AVQ B;  5KTB A;  4I6M C;  3AE6 C;  3P8C D;  3BVH A;  4AUW A;  1NYH A;  1SQQ E;  1J1E B;  4KT0 J;  1LT9 A;  3AEG C;  1VQM P;  5APW A;  1NU1 E;  5AW3 B;  5CCH C;  3GW6 A;  3BCC J;  4Y99 C;  3CCS P;  1LTS C;  1YJW P;  2VRS A;  3WMM 0;  4UB6 E;  3K5B A;  2QJP B;  2QA4 P;  1S72 P;  2GUV A;  5H2F E;  2HOD A;  1L0N E;  1KQG B;  3GHG C;  1WMK A;  1IJD B;  4N3Y B;  2ZXX A;  2D2C D;  2D2C B;  1RE3 A;  1TU3 F;  3PHL A;  5AW2 B;  3CX5 H;  2GM4 A;  2Q1K A;  1RE4 C;  3HTK A;  2OYH A;  3BRV B;  1L4A A;  4EYY Q;  2FYU J;  1IK7 A;  1KB9 E;  4IL6 H;  3I56 P;  3KXD A;  3Q5R A;  4L73 A;  3Q3D A;  4L75 A;  3A5T A;  4PD4 I;  1L0L J;  2IBZ G;  5E79 E;  2Y9Z A;  1FBM A;  1M1J C;  2FYN B;  3M0D A;  3AE3 C;  3CCE P;  1OVV A;  3O8Z A;  1WRG A;  3AE2 C;  2IZ1 A;  1RE3 C;  5CBO A;  1NGM B;  3GF3 A;  3USS A;  3H1J D;  1NH4 A;  2OTK E;  4LLH A;  3BCC G;  2V4H A;  2CPS A;  4EDF A;  3CCV P;  2K1A A;  1VQP P;  1K8A Q;  1R8E A;  1YYC A;  3F5H A;  1GU4 A;  2ZFC A;  2KP8 A;  3H1L E;  3QWO C;  1SLQ A;  1AQ5 A;  3AE7 C;  2E5Y A;  2KSJ A;  1ZV8 A;  2ZT9 B;  4XE5 B;  3FWN A;  5GTH H;  3RK3 D;  3QH9 A;  3HD7 A;  3M91 A;  3V2N A;  5AW6 B;  5CJ4 A;  4PD4 D;  4ASW A;  5AVV B;  1KZU B;  2Z5I A;  2GA1 A;  4PJ0 H;  5APY A;  2C9N Y;  4O9B A;  2OYO A;  1QL2 A;  2K9J B;  2Y9Y A;  3CL3 D;  1PP9 J;  3I5C A;  1LNQ A;  1NTM G;  1SQQ K;  4ZKP A;  1H8A A;  3G6E P;  2FFD C;  2PGD A;  3H1J E;  4B86 A;  5BU5 A;  4LGD E;  3SWK A;  2QG4 A;  3IN6 A;  4UB8 E;  5DJT B;  1LJ2 A;  1MFT A;  2HR3 A;  2I8D A;  2I1K A;  2WSE H;  1GU5 A;  3TGU G;  1JY2 N;  1NTM D;  2JO1 A;  2YKO A;  5DJU B;  4K3A A;  1S5L E;  2M5A A;  1VPC A;  3RBZ A;  1JMB A;  1GK6 A;  1NTZ D;  3C9I A;  3PP5 A;  3U59 A;  3L71 J;  1BDD A;  3H1H E;  3EFF K;  2FKW B;  2K88 A;  4NPE A;  1Y8A A;  2M3B A;  1IFD A;  3RK2 B;  1RQU A;  1S1C X;  2HOD B;  4JPZ B;  2C9L Y;  4LC1 A;  4ZNC A;  1Q86 Q;  1SS1 A;  1GDT A;  1Y9B A;  2W27 A;  4GKG A;  5AVT B;  4I7Z C;  4DJG A;  5KJ7 C;  1EZV I;  3S9O A;  2FFD B;  2AXT H;  1S2E A;  3VP8 A;  4XFJ A;  3Q5P A;  1OVU A;  4PV1 D;  1D7M A;  1LP1 A;  1AJY A;  5KLI C;  3E1R A;  3TK1 A;  2E74 C;  2E76 C;  3VMA A;  3R2P A;  5H2F H;  5CBN A;  1NVO A;  2IFM A;  3MIW A;  4N78 D;  1X22 A;  3BCC D;  2A06 G;  1SFC B;  2C0W A;  2HFE D;  1H89 A;  2B89 A;  1OWA A;  4YXD C;  2Q3E A;  3TGU E;  1BE3 D;  1SQP E;  1T3U A;  1N7S C;  2BCC J;  1HJ0 A;  2LXB A;  5CCH A;  3JC2 2;  5B66 E;  3H25 A;  1NU1 K;  3D6Y A;  1AVY A;  3P8C E;  1LT9 B;  1QLE D;  3HUS B;  3T97 A;  1Q2N A;  1BCC E;  1KIL B;  3H1I D;  3L73 D;  2R3C A;  1OMI A;  1K04 A;  2QJP C;  1M1J A;  2PFX A;  2RKL A;  2ZT9 D;  2ZT9 C;  3VOP A;  4C7N A;  4OGQ B;  3E1I A;  1FDO A;  5KLV E;  1NTK K;  2PRR A;  1Q7Y Q;  1A02 J;  1ZME C;  1MV8 A;  3RK2 C;  2RN0 A;  1EZV G;  4R4L A;  1AVO A;  1S4X A;  1NAF A;  1L4A D;  2E42 A;  2OYH C;  5KAI H;  4GDO A;  1GW4 A;  2E75 B;  1SQP K;  3TGU D;  1VQ6 P;  3RK3 E;  2JJL A;  2KUB A;  1LT1 A;  4DT0 A;  1RQV A;  2POH A;  3CWB G;  2A06 E;  2ZAE B;  4RES B;  1L0L K;  1WT6 A;  1FC2 C;  3HUS A;  2E74 D;  2E76 D;  1PFI A;  1YJN P;  1RY3 A;  3KHU A;  1GW3 A;  1KOR A;  3L74 D;  1M56 D;  2OAR A;  4WWI A;  1OXZ A;  2A45 H;  2N9B A;  2Y0E A;  4BRY B;  2JR8 A;  2Q9I A;  1QVF O;  3B8E B;  2D2C C;  3A2A A;  2CK3 H;  3EWK A;  2QJY B;  5B5E E;  3A3Y B;  2NPS A;  1KYO I;  2NPS C;  3CXH I;  1LT9 C;  1URQ C;  1VF5 D;  3C8V A;  2HPC A;  1VQL P;  1H0T B;  5KJ7 A;  3SSU A;  3WU2 H;  3H1H D;  3KZI H;  3CX5 I;  2BCC G;  1ZRT D;  3EQ2 A;  3KDP B;  3M0D C;  1FZE A;  1LTG C;  1QEX A;  4WY4 D;  4WY4 C;  1VQK P;  2N9Y B;  1J2J B;  4I2L C;  1VQ9 P;  2R5D A;  2KK7 A;  3H1H G;  1PPJ D;  2HLO A;  1YTZ I;  1S3J A;  2P7J A;  2FYU D;  3O6Q B;  3SFE C;  1E79 H;  5KKZ C;  1OW6 A;  1JY3 P;  4HB1 A;  4ASV A;  4BWN A;  2O3J A;  1JY2 O;  3BCC E;  2YMY A;  2IYO A;  1DEE G;  3IR9 A;  2WTY A;  3AEA C;  5GTI E;  3CCQ P;  1KV4 A;  2NRG A;  3RK3 C;  2P1J A;  3HD7 D;  3VTP C;  1VQ7 P;  1NTK G;  2P58 A;  3N4X A;  1FZC A;  2N1T B;  3GHG B;  4IFD K;  3CWB J;  3CCM P;  1FJK A;  1W2B O;  5TJH A;  3V5B A;  3G9R A;  2QEX P;  1PZQ A;  4I7Z B;  5APX A;  3SWY A;  3H32 B;  1SVF A;  1CW5 A; 
#chains in the Genus database with same CATH homology
 2FYU J;  1KB9 I;  1NTM J;  1PP9 J;  1SQV J;  3L74 J;  1NTK J;  4PD4 I;  1L0L J;  3H1J J;  4U3F J;  3L72 J;  1NTZ J;  1P84 I;  1SQQ J;  3TGU J;  1SQP J;  3H1I J;  3L73 J;  2BCC J;  1SQB J;  1NU1 J;  1BGY J;  3BCC J;  3L70 J;  3L75 J;  4D6T J;  3L71 J;  3H1H J;  2IBZ I;  1BE3 J;  1BCC J;  3H1K J;  3H1L J;  3CWB J;  1L0N J;  1KYO I;  3CXH I;  5KLV J;  1SQX J;  3CX5 I;  1EZV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...