3L72J

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l72J00
1NTKJ 3CWBJ 1SQQJ 2BCCJ 4D6TJ 1NTZJ 1L0NJ 3L75J 2IBZI 1SQBJ 3BCCJ 3L71J 1SQXJ 1SQVJ 1L0LJ 1P84I 3TGUJ 3H1LJ 1NU1J 3L73J 3H1KJ 4PD4I 3L72J 3L70J 3CX5I 3H1HJ 1EZVI 1SQPJ 2FYUJ 1BGYJ 3H1JJ 3L74J 1BCCJ 1BE3J 1PP9J 3H1IJ 1NTMJ 5KLVJ 1KB9I 4U3FJ 1KYOI 3CXHI
chains in the Genus database with same CATH superfamily
3CX5D 3H1JE 4O9BA 5DJUB 4N6JA 3CXHD 1HBWA 4WY4C 2FKWB 3HD7A 1X0TA 3E1IA 5KLVK 5BU5A 1NU1J 1HGZA 2KLVA 1IFDA 4ZMDA 1NTZK 2B88A 4U3FJ 1OXZA 2W8ZA 3HTKA 3L71G 1K9MQ 4C7NB 1MV8A 2AXTH 3AE8C 1J1DB 1N7SA 2P58A 2VRSA 1VQ5P 1PGQA 1VQPP 4RO0A 2E76D 2Y0DA 4BRYB 2WSCJ 3MUDA 2W90A 1IO4A 2A06D 2KYVA 1ZLLA 3U1CA 1GW4A 4Z1MH 5M1BA 3RL0D 3A0BE 1T8ZA 5KAFE 5GTIE 1KILA 1Y47A 2Z4EA 3CCUP 2LXCB 2JR8A 3UIAA 5CCHD 1NU1D 3BCCG 1WRGA 4A7PA 5KKZB 1H88A 1WMKA 1N73C 1SQXJ 1HVVA 2POHA 3L74G 2K37A 3H32B 1EZVE 2B9BA 3B4SA 2SPZA 2QSIA 2ZVOB 1FZGA 4N78D 3H1IE 1YJ9P 1NWQA 4OGQD 1X79B 1SQVJ 3H1HG 3H1LJ 1PZQA 1FZAA 1JOCA 2I8DA 2KIKA 1L0NK 1MFTA 1BSNA 2IYPA 3AE5C 2XV5A 4YXWH 1YJWP 4Y28J 2W27A 1URQD 4WY4B 2KXPB 3H1KG 1RE4A 1LTJA 3B5ND 1YTZI 2ZYDA 2OYIC 3KDPB 1SQXD 4PJ0E 4AYCA 3O6QA 3L70D 1FU1A 4EI2A 3AEAC 2MKVA 2E43A 1S5LH 1L0LG 5AVUB 3N7NA 2I1JA 2YMKA 3L72G 4Y99B 4BWNA 3H6PA 2A45H 1SQQK 3VOPA 4DOJA 1PPJE 2FYUJ 2WT7B 1SQVD 4EYYQ 4JPZB 3GHGA 3H1LD 1YJNP 2NPSA 1SQPD 5BVZA 4AQRD 2QM7A 2GA1A 2OYHB 2QJKB 1S2EA 2H7HA 2E75C 2D2CD 1KQLA 3PTZA 4TT3H 2K3RA 3CX5H 3GLMA 2W83C 2Q9IA 1N73B 3WUUA 1USDA 1SVFA 2V7QH 2O1JA 2QJYC 5APWA 1NTMG 1RF1C 2D2CC 4PD4E 1DX7A 2M3BA 4C7RA 5AVRB 1L4AC 2YKOA 2KS1B 5C39A 3T97B 1NTZJ 2FYUD 1PP9D 5APTA 2NZ2A 3Q2YA 1P84I 1OVUA 3L4FA 3H1JG 3HE4B 4GOFA 4HYTB 4PV1C 1NGMB 3EFGA 2E5TA 1IJDB 1Q2NA 3PJSK 1G1IA 4KT0J 3P32A 4WBAA 4ZKPA 2M5AB 1IFJA 4D6TE 2XKMA 1FJPA 1KMIZ 3AE1C 3M06A 1JB0J 3RBZA 3CPWO 3HUSA 2O1KA 3SWKA 1EDKA 1VQ7P 1BGYE 3AEGC 3V4WA 3RL0g 2YKPA 3MP7B 3C9IA 5CCGD 1DH3A 2JEEA 3C1LA 1QGKB 3R2PA 1GW3A 4RESB 1LNQA 3AE7C 1HJBA 1JY2O 4KJMA 1LP1B 1M90Q 1U57A 2P2UA 3GMAA 3EFFK 1KILC 4I7ZC 2JDIH 5KAIE 3A0BH 1BDCA 1EDJA 2E75B 2KP8A 3SSUA 3L75G 3RBXA 2FBWC 1NTKJ 5TISE 2E74C 1AFOA 3WMM0 1JY2P 1N7LA 1G1JA 3HE5A 1OW7A 1EZVG 1R8EA 2QJYB 3H1IG 5AVXB 2L91A 4W80A 1RF1B 3KYQA 1M57D 2WZ7A 2BCCG 1L4AB 1GZLA 3RK3C 2IYOA 3WU2H 2HODA 1KB9H 3CWBE 1ZV8A 3RGUA 1KC8Q 2C0WA 4WVZA 3TGUJ 3BCCE 4ASVA 3V6IA 4PV1B 1EXJA 3HD7B 4UB6H 1LTJC 3RK2C 5APXA 1VQMP 1J1EC 2KI7B 1N86A 3B8EB 3NFQA 2JWAA 3AEFC 1NTKD 1T2KD 1YYCA 3HTKB 1E5WA 1EZVI 2Z5HA 5CJ0A 4HH2A 3JCUH 1GK4A 3CCEP 1X22A 1AVOA 1KTMA 1SQXK 1N7SB 2QRXA 1ZOYC 3HE4A 2OTJP 1FZEA 3MD0A 1PPJG 1DIPA 3KPEA 4LGDE 3GHGC 1GU4A 4H0LC 3MHVA 2NPSC 4IL6E 1R5SA 1SQVK 3C8VA 4HJGH 1SP4A 3MGNA 1YI2P 1KILB 2OYIA 5KJ7D 1SQPK 4I7ZB 4EDFA 4UB8E 2WSEH 1SS1A 3G71P 1OVVA 3AECC 2FFDA 1LTBC 2M0BA 1Q82Q 3B5NA 4N3YB 1EXIA 2E74B 1JUNA 1JTHA 5KJ7C 3VMXA 3CI9A 2KZJA 3FXEA 2GM4A 3W68A 1GL2D 2O01H 2ZXXA 1HUCA 4PD4H 1BE3J 3K5BA 3RK3B 3P8CD 3A0HE 2BEZF 2V7QJ 2YO2A 1WT6A 1ZRTD 4K3AA 5KLVG 1SFCD 1NTZG 2W6BA 3CXHE 1KYOE 3L72D 1LTJB 3RK2B 2G3AA 2UWJE 2Q5UA 3M0AA 1J1EB 2KSEA 1FDMA 3GG2A 2QJPC 4XE5B 4L75A 2ZFCA 2C9LY 4PD4I 3O6QB 1P84D 4GIFA 1VQLP 3A2AA 1BCCE 1JY2N 1RY3A 3CCSP 1BE3D 3M9HA 5CBOA 3GHGB 4I2LC 4H0LB 2A06E 2NPSB 2W6AA 1OW8A 3AE4C 1SQBK 5AW0B 1KFMA 4GT1A 1YHQP 4RJTA 1VL2A 5DJTB 4JQ0D 3LW5H 2L5GB 3V5BA 4IFDK 5H2FH 3PLNA 4DZOA 1NKNA 1NU1E 3Q5SA 4XFJA 3GW6A 1ZXGA 2CK3H 4U3FE 3CD6P 3D71A 3VMYA 1JCDA 1JMBA 2HPCA 2B87A 5B66E 2E76C 5CCGA 3CWBG 3U1AA 3D6ZA 1L0NG 1VQ4P 2ZYGA 1PGOA 2R3SA 4H13D 2IDBA 3AEEC 4NPEA 3AE2C 3RL0C 1NAYA 1OMIA 3CMEP 3L75E 1KZUB 1S9KD 2H88C 1RH5B 3NXSA 1KQSO 3L70J 1U7MA 3PH0A 1ZW0A 3MTUE 1AV1A 2BEQD 5CCHC 2RN0A 1Q90D 1LT9A 3TGUG 4DT0A 2Y0EA 2N1TD 2QJPB 4H44D 2BCCE 1W5CE 3HUSB 1VQ9P 1L2PA 1NTKK 3L73J 3AE3C 1IZNB 1SQPJ 1SQQG 4BXLA 3WUTA 3HRNA 1N2DC 5L8RJ 1FDIA 4OGQC 3L37A 2JWDA 5AW9B 2Q3IA 1SQVE 3H1LE 4IFMA 2XZRA 1S72P 4W7YA 1KB9D 1URQC 3H1ID 1JNMA 2JKVA 3CCMP 2FFDC 5GTHH 3B5NC 1S5LX 1H8AA 1FS0E 3Q5RA 1PP9J 2A45G 1PFIA 2JP3A 3HE5B 1NJIQ 2XU6A 3L73D 1GK6A 2WSEJ 2O3JA 2H89C 2K1AA 1TU3F 3VTPC 1PGPA 2IFNA 4QMAA 2IBZD 1QLED 2FYNC 2YMYA 1P84H 2E76B 2HODB 3BRVB 3I5CA 2FYUE 1K73Q 3MIWA 3CLQA 3A0HH 2ZJSE 3VP9A 3RL0B 2O01J 2WITA 1PIXA 1G2CA 1QVGO 5KJ7A 1PV3A 3W67A 2OTKE 1PPJD 4L76A 1KYOH 1SQBJ 3SFDC 2WVRA 1VPCA 3QH9A 3ZDMA 1VQOP 4YTPC 2RMZA 1BCCG 2WMMA 1YBKA 1NOHA 4LLHA 3S1KA 3EQ2A 1KILE 2RH0A 2V4HA 2LKMA 5APYA 4OGQB 1GL2A 4D6TJ 4IOIH 5AVTB 5KLVE 1YQ4C 2A06G 1IFMA 1NTZE 1T6AA 2ZT9D 5E79E 1FOSF 1IK7A 1BGYJ 5AW3B 2OYIB 3CC2P 4PD4D 3L36A 1KYOI 1H89A 1SFCA 1URQB 1NU1G 4YPCA 2FFDB 1S4XA 5AVWB 3B5NB 4GODA 1SQBD 4U3FG 1FDOA 3RK3E 1CZQA 1QEXA 1JTHB 3NMDA 3LW5J 3SWYA 2GUSA 3O8ZA 2M3EA 1W2BO 1JY3O 4JYCA 2Q7CA 1AJYA 3L71J 5CCGC 1QX8A 2FYZA 4D6TD 5KAFH 2H8PD 5GTIH 1UIIA 3L35A 3E1RA 3KXDA 2AXTE 1NAFA 1BGYD 2Q6QA 1OX3A 2G8YA 5B5EE 4R4LA 2Q3EA 3QWOC 2D2CB 1T3UA 1LT9C 1Y8AA 1SLQA 1DEEG 2IZ1A 1OW6A 1IFNA 2O01N 1DD3A 1SQXG 3FXDA 2ITAA 3BCCJ 1L0NE 3CMAP 2I1KA 1HTLC 1Y9BA 3L71D 1LT1A 3L74J 2YNYA 5APUA 2QVAA 3OA7A 1SQVG 2OGUA 1M1KQ 3H1LG 1NO4A 2HR3A 5CCHA 1VF5D 3CCLP 1A02J 5AVVB 3TGUE 3ABVC 3G9RA 3H1HJ 1FBMA 2WTYA 5CHXA 1HJ0A 1NHLA 1ZN5A 3JSVC 1CW5A 4R4MA 5AVSB 4PJ0H 2FXOA 3SFEC 1SQQE 1FAVA 2WSSH 1R5LA 3CWBD 4I6MC 2WQYC 1T2KC 1NVOA 3H1KJ 3BCCD 2J59M 1GMJA 2N9YB 2J58A 3LIEA 4ZKUA 2HPCB 2B87B 4ZNCA 3BATA 3L74D 1RE3C 2PAJA 1JM0A 1L0LJ 2FYUG 1Q86Q 3L72J 1RHZB 1URQA 3LIDA 4WWIA 2KSJA 3H1HD 2KB7P 3TNUA 3CL3D 1J1DC 1YIJP 1KQGB 4HKZH 3AEBC 3F89A 4OH8B 4I1LA 1OVRA 1NKZB 1LT9B 1FZCA 3USSA 2PP6A 3M9BA 2QG4A 3CC7P 1EDIA 3H1KD 1QL1A 3KQGA 5AW7B 4GDOA 2HYNA 3VP8A 5AVQB 1GL2C 3CX5E 2QEXP 2WWWA 1NTMJ 1L0LD 2K9YA 1BE3E 2J5UA 1GTWA 3G6EP 1BSHA 2OYOA 1USEA 3H25A 3KZIE 1SFCC 3E7KA 5E79H 1H0TA 3H1JJ 3CCQP 1ZR2A 3M0DA 4CPGA 3AE6C 1UIXA 1OWAA 4WY4D 3BRTB 3V4QA 1JY3N 2C0XA 2IX7C 1EQ7A 1VQ6P 2XNDH 4L74A 2WPSA 1KYOD 4OVNF 4W7ZA 5KLIC 1FZBA 4GOEA 3FX0A 1NTMD 1RF0A 3M91A 1ZMEC 4TLFA 5AW4B 4YXDC 4WB4A 5KAIH 2CPBA 1IC2A 1JO5A 3KHUA 1G2CB 5TISH 1S9KE 1BCCD 1LTGC 3H1JD 2K9JA 1Q7YQ 4U7JA 5APQA 3Q5PA 4Y99C 1HGVA 2QIWA 3Q3DA 4XA4A 4DJGA 1IFIA 5B5EH 1FOSE 1NTKG 3FWNA 4N78E 3FWLA 4KHXA 4HB1A 1XTGB 2KNCA 1M1JC 3JC22 2OTLP 3L75J 2WSFH 1FZFA 1M8OB 1RQVA 3TYYA 4NPDA 2OYHC 3PRJA 2QJKC 2JO1A 1A02F 2AEJA 1GL2B 1YITP 2P1JA 1LWUA 1EDLA 3H1IJ 3PHLA 1GD2E 2Y0CA 2NRGA 3IF4A 2BCCJ 4H13C 2AEFA 1X8YA 5KTBA 1YTZT 4LC1A 4U3FD 1M56D 1MUUA 1XTCC 1SQXE 1SFCB 3L70E 2LR2A 3WU2E 3I55P 2PRRA 1KB9E 2R44A 3S4RA 1GU5A 3SWFA 1GDTA 4MN4C 2N1TC 4OWFA 4H44C 1KORA 5AW1B 1BDDA 3D70A 2Y9YA 3V2NA 2IFMA 3L75D 4UB6E 1VQNP 3L73E 3G3ZA 1SQPE 4IL6H 3VMAA 1EZVD 1VDFA 2LXBA 2IBZE 5KLIB 1M7LA 4IL6X 1E79H 2IZ0A 2YXRB 4DCKA 2BCCD 2M8RA 1KD1Q 4UB8H 2ZYAA 3JCUE 5APVA 5BU8B 3NTNA 1Z56A 2ZVNB 1FJKA 4C46A 5EFWB 1LTTC 2KOGA 1FZCC 5CJ4A 1IFPA 2PGDA 1CI6B 3MZWB 2E75D 1T3JA 3II6A 1RE3A 1K04A 1OFCX 4JF7A 3BVHA 1OZHA 2R5DA 2B89A 1PP9E 1M1JB 1VQ8P 1LTIC 1KV4A 2KZIA 1BE3G 1KN7A 4C7NA 2FY8A 4B86A 2HG5D 2C9NY 1L4AD 1L0LK 2OARA 4H13B 3CXHH 1HH0A 4BRYA 1AA0A 2A45I 3M9QA 1AVYA 3V2QA 4AUWA 1JEKA 3M0DC 4PV1D 2HLOA 3OAKA 3KZIH 1LTAC 1AQ5A 4JBZA 5KLVJ 1PL5A 3HD7D 2HFED 3TSIA 1S3JA 3ITKA 2N1TB 4H44B 3CC4P 1SQBE 1IK9A 2KK7A 1OIPA 2DW3A 3P8MC 5AW5B 2AEMA 3CX5I 4GKGA 2R32A 3HD7C 2H43A 3CXHI 1RF0C 1ZR4A 1N7SD 3IR9A 3H32A 5AW8B 5AVZB 1MZ9A 1N8RQ 2XNXA 1NTMK 1KFNA 2RKLA 2ZT9C 3AE9C 4JYBA 2Z5IA 3IAOA 2YIUC 3TNUB 1N7SC 1Q81Q 1KILD 5KLVD 1FZCB 3MUDC 1NTZD 1U7JA 3OW2O 3N4XA 4WY4A 2FYNB 3WUVA 2Q1KA 5B66H 2XDJA 2E74D 1KQFB 5H2FE 2WSCH 2QM8A 1NYHA 2P7JA 2FXMA 1LWUC 1ZP0C 3L71E 5CBNA 1MFZA 3A3YB 2FXPA 2WSFJ 1JY3P 2E5YA 2CPSA 3RK3D 3CWBJ 1CI6A 3CCJP 5AW2B 4EIJA 1NU1K 1L0NJ 1JMMA 2WT7A 1NTKE 1H0TB 2JJLA 2YXQB 3L70G 1K05A 1M1JA 2OYHA 2P67A 1X9VA 1J2JB 2OQQA 2R5BA 4K35A 3TDKA 3TK1A 3A5TA 3RK2D 2BASA 1NH4A 5AW6B 2KUBA 3L73G 2P10A 3IN6A 1SQPG 3S9OA 3Q1MA 2ZAEB 3PP5A 1K8AQ 5CMZA 5K5GB 1N73A 2IBZG 1JCCA 1RE4C 3L74E 1SQQJ 1AQTA 4EOTA 2KS1A 3AEDC 1PGJA 3T97A 1VF5C 2ZT9B 3VN0A 1L0ND 1S1CX 2N1TA 4H0LD 2AXCA 1LGHB 2NPSD 3V2PA 2YIUB 2K9JB 1MKMA 1KB9I 3H1HE 3TF5A 2Y9ZA 3CCVP 3F5HA 2QE7H 2KLUA 3P7KA 3FGAD 1DEBA 2R3CA 4IFFA 3BASA 2M5AA 1PP9G 2KNCB 3P8CE 3H1KE 3U59A 3TGUD 1FC2C 3B71A 3OJAB 2GUVA 1D7MA 1S5LE 1ZRTE 3R4YA 2IBZI 3CCRP 2QA4P 2WPVB 5GTHE 1FE6A 2MJZA 1LWUB 3GF7A 3V2RA 3A7OA 4RKUJ 1VQKP 1SQQD 5AVYB 1L0LE 4M3LA 2K88A 3L72E 4L73A 2WPQA 3D6YA 1QVFO 1LP1A 1YQ3C 1RQUA 2E42A 1P84E 2YKQA 3IFMA 1HWTC 3GF3A 2W6JH 4ASWA 3VYIA 2YO3A 1SQBG 1CSBA 1LJ2A 4NPFX 5KKZC 2FYUK 2N9BA 1HF9A 3VMZA 2PFXA 1BCCJ 5TJHA 4D6TG 2IPPA 2ZXEB 3EWKA 3I56P 1RF1A 1NTME 3G4SP 1QL2A 1L4AA 3HUSC 1VF5B 1BGYG 1EC5A 1W2EA 2WPRA 1LTSC 1DD4A 5APSA
chains in the Genus database with same CATH topology
1NTKJ 3CWBJ 1SQQJ 2BCCJ 4D6TJ 1NTZJ 1L0NJ 3L75J 2IBZI 1SQBJ 3BCCJ 3L71J 1SQXJ 1SQVJ 1L0LJ 1P84I 3TGUJ 3H1LJ 1NU1J 3L73J 3H1KJ 4PD4I 3L72J 3L70J 3CX5I 3H1HJ 1EZVI 1SQPJ 2FYUJ 1BGYJ 3H1JJ 3L74J 1BCCJ 1BE3J 1PP9J 3H1IJ 1NTMJ 5KLVJ 1KB9I 4U3FJ 1KYOI 3CXHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK J;  3CWB J;  1SQQ J;  2BCC J;  4D6T J;  1NTZ J;  1L0N J;  3L75 J;  2IBZ I;  1SQB J;  3BCC J;  3L71 J;  1SQX J;  1SQV J;  1L0L J;  1P84 I;  3TGU J;  3H1L J;  1NU1 J;  3L73 J;  3H1K J;  4PD4 I;  3L72 J;  3L70 J;  3CX5 I;  3H1H J;  1EZV I;  1SQP J;  2FYU J;  1BGY J;  3H1J J;  3L74 J;  1BCC J;  1BE3 J;  1PP9 J;  3H1I J;  1NTM J;  5KLV J;  1KB9 I;  4U3F J;  1KYO I;  3CXH I; 
#chains in the Genus database with same CATH topology
 3CX5 D;  3H1J E;  4O9B A;  5DJU B;  4N6J A;  3CXH D;  1HBW A;  4WY4 C;  2FKW B;  3HD7 A;  1X0T A;  3E1I A;  5KLV K;  5BU5 A;  1NU1 J;  1HGZ A;  2KLV A;  1IFD A;  4ZMD A;  1NTZ K;  2B88 A;  4U3F J;  1OXZ A;  2W8Z A;  3HTK A;  3L71 G;  1K9M Q;  4C7N B;  1MV8 A;  2AXT H;  3AE8 C;  1J1D B;  1N7S A;  2P58 A;  2VRS A;  1VQ5 P;  1PGQ A;  1VQP P;  4RO0 A;  2E76 D;  2Y0D A;  4BRY B;  2WSC J;  3MUD A;  2W90 A;  1IO4 A;  2A06 D;  2KYV A;  1ZLL A;  3U1C A;  1GW4 A;  4Z1M H;  5M1B A;  3RL0 D;  3A0B E;  1T8Z A;  5KAF E;  5GTI E;  1KIL A;  1Y47 A;  2Z4E A;  3CCU P;  2LXC B;  2JR8 A;  3UIA A;  5CCH D;  1NU1 D;  3BCC G;  1WRG A;  4A7P A;  5KKZ B;  1H88 A;  1WMK A;  1N73 C;  1SQX J;  1HVV A;  2POH A;  3L74 G;  2K37 A;  3H32 B;  1EZV E;  2B9B A;  3B4S A;  2SPZ A;  2QSI A;  2ZVO B;  1FZG A;  4N78 D;  3H1I E;  1YJ9 P;  1NWQ A;  4OGQ D;  1X79 B;  1SQV J;  3H1H G;  3H1L J;  1PZQ A;  1FZA A;  1JOC A;  2I8D A;  2KIK A;  1L0N K;  1MFT A;  1BSN A;  2IYP A;  3AE5 C;  2XV5 A;  4YXW H;  1YJW P;  4Y28 J;  2W27 A;  1URQ D;  4WY4 B;  2KXP B;  3H1K G;  1RE4 A;  1LTJ A;  3B5N D;  1YTZ I;  2ZYD A;  2OYI C;  3KDP B;  1SQX D;  4PJ0 E;  4AYC A;  3O6Q A;  3L70 D;  1FU1 A;  4EI2 A;  3AEA C;  2MKV A;  2E43 A;  1S5L H;  1L0L G;  5AVU B;  3N7N A;  2I1J A;  2YMK A;  3L72 G;  4Y99 B;  4BWN A;  3H6P A;  2A45 H;  1SQQ K;  3VOP A;  4DOJ A;  1PPJ E;  2FYU J;  2WT7 B;  1SQV D;  4EYY Q;  4JPZ B;  3GHG A;  3H1L D;  1YJN P;  2NPS A;  1SQP D;  5BVZ A;  4AQR D;  2QM7 A;  2GA1 A;  2OYH B;  2QJK B;  1S2E A;  2H7H A;  2E75 C;  2D2C D;  1KQL A;  3PTZ A;  4TT3 H;  2K3R A;  3CX5 H;  3GLM A;  2W83 C;  2Q9I A;  1N73 B;  3WUU A;  1USD A;  1SVF A;  2V7Q H;  2O1J A;  2QJY C;  5APW A;  1NTM G;  1RF1 C;  2D2C C;  4PD4 E;  1DX7 A;  2M3B A;  4C7R A;  5AVR B;  1L4A C;  2YKO A;  2KS1 B;  5C39 A;  3T97 B;  1NTZ J;  2FYU D;  1PP9 D;  5APT A;  2NZ2 A;  3Q2Y A;  1P84 I;  1OVU A;  3L4F A;  3H1J G;  3HE4 B;  4GOF A;  4HYT B;  4PV1 C;  1NGM B;  3EFG A;  2E5T A;  1IJD B;  1Q2N A;  3PJS K;  1G1I A;  4KT0 J;  3P32 A;  4WBA A;  4ZKP A;  2M5A B;  1IFJ A;  4D6T E;  2XKM A;  1FJP A;  1KMI Z;  3AE1 C;  3M06 A;  1JB0 J;  3RBZ A;  3CPW O;  3HUS A;  2O1K A;  3SWK A;  1EDK A;  1VQ7 P;  1BGY E;  3AEG C;  3V4W A;  3RL0 g;  2YKP A;  3MP7 B;  3C9I A;  5CCG D;  1DH3 A;  2JEE A;  3C1L A;  1QGK B;  3R2P A;  1GW3 A;  4RES B;  1LNQ A;  3AE7 C;  1HJB A;  1JY2 O;  4KJM A;  1LP1 B;  1M90 Q;  1U57 A;  2P2U A;  3GMA A;  3EFF K;  1KIL C;  4I7Z C;  2JDI H;  5KAI E;  3A0B H;  1BDC A;  1EDJ A;  2E75 B;  2KP8 A;  3SSU A;  3L75 G;  3RBX A;  2FBW C;  1NTK J;  5TIS E;  2E74 C;  1AFO A;  3WMM 0;  1JY2 P;  1N7L A;  1G1J A;  3HE5 A;  1OW7 A;  1EZV G;  1R8E A;  2QJY B;  3H1I G;  5AVX B;  2L91 A;  4W80 A;  1RF1 B;  3KYQ A;  1M57 D;  2WZ7 A;  2BCC G;  1L4A B;  1GZL A;  3RK3 C;  2IYO A;  3WU2 H;  2HOD A;  1KB9 H;  3CWB E;  1ZV8 A;  3RGU A;  1KC8 Q;  2C0W A;  4WVZ A;  3TGU J;  3BCC E;  4ASV A;  3V6I A;  4PV1 B;  1EXJ A;  3HD7 B;  4UB6 H;  1LTJ C;  3RK2 C;  5APX A;  1VQM P;  1J1E C;  2KI7 B;  1N86 A;  3B8E B;  3NFQ A;  2JWA A;  3AEF C;  1NTK D;  1T2K D;  1YYC A;  3HTK B;  1E5W A;  1EZV I;  2Z5H A;  5CJ0 A;  4HH2 A;  3JCU H;  1GK4 A;  3CCE P;  1X22 A;  1AVO A;  1KTM A;  1SQX K;  1N7S B;  2QRX A;  1ZOY C;  3HE4 A;  2OTJ P;  1FZE A;  3MD0 A;  1PPJ G;  1DIP A;  3KPE A;  4LGD E;  3GHG C;  1GU4 A;  4H0L C;  3MHV A;  2NPS C;  4IL6 E;  1R5S A;  1SQV K;  3C8V A;  4HJG H;  1SP4 A;  3MGN A;  1YI2 P;  1KIL B;  2OYI A;  5KJ7 D;  1SQP K;  4I7Z B;  4EDF A;  4UB8 E;  2WSE H;  1SS1 A;  3G71 P;  1OVV A;  3AEC C;  2FFD A;  1LTB C;  2M0B A;  1Q82 Q;  3B5N A;  4N3Y B;  1EXI A;  2E74 B;  1JUN A;  1JTH A;  5KJ7 C;  3VMX A;  3CI9 A;  2KZJ A;  3FXE A;  2GM4 A;  3W68 A;  1GL2 D;  2O01 H;  2ZXX A;  1HUC A;  4PD4 H;  1BE3 J;  3K5B A;  3RK3 B;  3P8C D;  3A0H E;  2BEZ F;  2V7Q J;  2YO2 A;  1WT6 A;  1ZRT D;  4K3A A;  5KLV G;  1SFC D;  1NTZ G;  2W6B A;  3CXH E;  1KYO E;  3L72 D;  1LTJ B;  3RK2 B;  2G3A A;  2UWJ E;  2Q5U A;  3M0A A;  1J1E B;  2KSE A;  1FDM A;  3GG2 A;  2QJP C;  4XE5 B;  4L75 A;  2ZFC A;  2C9L Y;  4PD4 I;  3O6Q B;  1P84 D;  4GIF A;  1VQL P;  3A2A A;  1BCC E;  1JY2 N;  1RY3 A;  3CCS P;  1BE3 D;  3M9H A;  5CBO A;  3GHG B;  4I2L C;  4H0L B;  2A06 E;  2NPS B;  2W6A A;  1OW8 A;  3AE4 C;  1SQB K;  5AW0 B;  1KFM A;  4GT1 A;  1YHQ P;  4RJT A;  1VL2 A;  5DJT B;  4JQ0 D;  3LW5 H;  2L5G B;  3V5B A;  4IFD K;  5H2F H;  3PLN A;  4DZO A;  1NKN A;  1NU1 E;  3Q5S A;  4XFJ A;  3GW6 A;  1ZXG A;  2CK3 H;  4U3F E;  3CD6 P;  3D71 A;  3VMY A;  1JCD A;  1JMB A;  2HPC A;  2B87 A;  5B66 E;  2E76 C;  5CCG A;  3CWB G;  3U1A A;  3D6Z A;  1L0N G;  1VQ4 P;  2ZYG A;  1PGO A;  2R3S A;  4H13 D;  2IDB A;  3AEE C;  4NPE A;  3AE2 C;  3RL0 C;  1NAY A;  1OMI A;  3CME P;  3L75 E;  1KZU B;  1S9K D;  2H88 C;  1RH5 B;  3NXS A;  1KQS O;  3L70 J;  1U7M A;  3PH0 A;  1ZW0 A;  3MTU E;  1AV1 A;  2BEQ D;  5CCH C;  2RN0 A;  1Q90 D;  1LT9 A;  3TGU G;  4DT0 A;  2Y0E A;  2N1T D;  2QJP B;  4H44 D;  2BCC E;  1W5C E;  3HUS B;  1VQ9 P;  1L2P A;  1NTK K;  3L73 J;  3AE3 C;  1IZN B;  1SQP J;  1SQQ G;  4BXL A;  3WUT A;  3HRN A;  1N2D C;  5L8R J;  1FDI A;  4OGQ C;  3L37 A;  2JWD A;  5AW9 B;  2Q3I A;  1SQV E;  3H1L E;  4IFM A;  2XZR A;  1S72 P;  4W7Y A;  1KB9 D;  1URQ C;  3H1I D;  1JNM A;  2JKV A;  3CCM P;  2FFD C;  5GTH H;  3B5N C;  1S5L X;  1H8A A;  1FS0 E;  3Q5R A;  1PP9 J;  2A45 G;  1PFI A;  2JP3 A;  3HE5 B;  1NJI Q;  2XU6 A;  3L73 D;  1GK6 A;  2WSE J;  2O3J A;  2H89 C;  2K1A A;  1TU3 F;  3VTP C;  1PGP A;  2IFN A;  4QMA A;  2IBZ D;  1QLE D;  2FYN C;  2YMY A;  1P84 H;  2E76 B;  2HOD B;  3BRV B;  3I5C A;  2FYU E;  1K73 Q;  3MIW A;  3CLQ A;  3A0H H;  2ZJS E;  3VP9 A;  3RL0 B;  2O01 J;  2WIT A;  1PIX A;  1G2C A;  1QVG O;  5KJ7 A;  1PV3 A;  3W67 A;  2OTK E;  1PPJ D;  4L76 A;  1KYO H;  1SQB J;  3SFD C;  2WVR A;  1VPC A;  3QH9 A;  3ZDM A;  1VQO P;  4YTP C;  2RMZ A;  1BCC G;  2WMM A;  1YBK A;  1NOH A;  4LLH A;  3S1K A;  3EQ2 A;  1KIL E;  2RH0 A;  2V4H A;  2LKM A;  5APY A;  4OGQ B;  1GL2 A;  4D6T J;  4IOI H;  5AVT B;  5KLV E;  1YQ4 C;  2A06 G;  1IFM A;  1NTZ E;  1T6A A;  2ZT9 D;  5E79 E;  1FOS F;  1IK7 A;  1BGY J;  5AW3 B;  2OYI B;  3CC2 P;  4PD4 D;  3L36 A;  1KYO I;  1H89 A;  1SFC A;  1URQ B;  1NU1 G;  4YPC A;  2FFD B;  1S4X A;  5AVW B;  3B5N B;  4GOD A;  1SQB D;  4U3F G;  1FDO A;  3RK3 E;  1CZQ A;  1QEX A;  1JTH B;  3NMD A;  3LW5 J;  3SWY A;  2GUS A;  3O8Z A;  2M3E A;  1W2B O;  1JY3 O;  4JYC A;  2Q7C A;  1AJY A;  3L71 J;  5CCG C;  1QX8 A;  2FYZ A;  4D6T D;  5KAF H;  2H8P D;  5GTI H;  1UII A;  3L35 A;  3E1R A;  3KXD A;  2AXT E;  1NAF A;  1BGY D;  2Q6Q A;  1OX3 A;  2G8Y A;  5B5E E;  4R4L A;  2Q3E A;  3QWO C;  2D2C B;  1T3U A;  1LT9 C;  1Y8A A;  1SLQ A;  1DEE G;  2IZ1 A;  1OW6 A;  1IFN A;  2O01 N;  1DD3 A;  1SQX G;  3FXD A;  2ITA A;  3BCC J;  1L0N E;  3CMA P;  2I1K A;  1HTL C;  1Y9B A;  3L71 D;  1LT1 A;  3L74 J;  2YNY A;  5APU A;  2QVA A;  3OA7 A;  1SQV G;  2OGU A;  1M1K Q;  3H1L G;  1NO4 A;  2HR3 A;  5CCH A;  1VF5 D;  3CCL P;  1A02 J;  5AVV B;  3TGU E;  3ABV C;  3G9R A;  3H1H J;  1FBM A;  2WTY A;  5CHX A;  1HJ0 A;  1NHL A;  1ZN5 A;  3JSV C;  1CW5 A;  4R4M A;  5AVS B;  4PJ0 H;  2FXO A;  3SFE C;  1SQQ E;  1FAV A;  2WSS H;  1R5L A;  3CWB D;  4I6M C;  2WQY C;  1T2K C;  1NVO A;  3H1K J;  3BCC D;  2J59 M;  1GMJ A;  2N9Y B;  2J58 A;  3LIE A;  4ZKU A;  2HPC B;  2B87 B;  4ZNC A;  3BAT A;  3L74 D;  1RE3 C;  2PAJ A;  1JM0 A;  1L0L J;  2FYU G;  1Q86 Q;  3L72 J;  1RHZ B;  1URQ A;  3LID A;  4WWI A;  2KSJ A;  3H1H D;  2KB7 P;  3TNU A;  3CL3 D;  1J1D C;  1YIJ P;  1KQG B;  4HKZ H;  3AEB C;  3F89 A;  4OH8 B;  4I1L A;  1OVR A;  1NKZ B;  1LT9 B;  1FZC A;  3USS A;  2PP6 A;  3M9B A;  2QG4 A;  3CC7 P;  1EDI A;  3H1K D;  1QL1 A;  3KQG A;  5AW7 B;  4GDO A;  2HYN A;  3VP8 A;  5AVQ B;  1GL2 C;  3CX5 E;  2QEX P;  2WWW A;  1NTM J;  1L0L D;  2K9Y A;  1BE3 E;  2J5U A;  1GTW A;  3G6E P;  1BSH A;  2OYO A;  1USE A;  3H25 A;  3KZI E;  1SFC C;  3E7K A;  5E79 H;  1H0T A;  3H1J J;  3CCQ P;  1ZR2 A;  3M0D A;  4CPG A;  3AE6 C;  1UIX A;  1OWA A;  4WY4 D;  3BRT B;  3V4Q A;  1JY3 N;  2C0X A;  2IX7 C;  1EQ7 A;  1VQ6 P;  2XND H;  4L74 A;  2WPS A;  1KYO D;  4OVN F;  4W7Z A;  5KLI C;  1FZB A;  4GOE A;  3FX0 A;  1NTM D;  1RF0 A;  3M91 A;  1ZME C;  4TLF A;  5AW4 B;  4YXD C;  4WB4 A;  5KAI H;  2CPB A;  1IC2 A;  1JO5 A;  3KHU A;  1G2C B;  5TIS H;  1S9K E;  1BCC D;  1LTG C;  3H1J D;  2K9J A;  1Q7Y Q;  4U7J A;  5APQ A;  3Q5P A;  4Y99 C;  1HGV A;  2QIW A;  3Q3D A;  4XA4 A;  4DJG A;  1IFI A;  5B5E H;  1FOS E;  1NTK G;  3FWN A;  4N78 E;  3FWL A;  4KHX A;  4HB1 A;  1XTG B;  2KNC A;  1M1J C;  3JC2 2;  2OTL P;  3L75 J;  2WSF H;  1FZF A;  1M8O B;  1RQV A;  3TYY A;  4NPD A;  2OYH C;  3PRJ A;  2QJK C;  2JO1 A;  1A02 F;  2AEJ A;  1GL2 B;  1YIT P;  2P1J A;  1LWU A;  1EDL A;  3H1I J;  3PHL A;  1GD2 E;  2Y0C A;  2NRG A;  3IF4 A;  2BCC J;  4H13 C;  2AEF A;  1X8Y A;  5KTB A;  1YTZ T;  4LC1 A;  4U3F D;  1M56 D;  1MUU A;  1XTC C;  1SQX E;  1SFC B;  3L70 E;  2LR2 A;  3WU2 E;  3I55 P;  2PRR A;  1KB9 E;  2R44 A;  3S4R A;  1GU5 A;  3SWF A;  1GDT A;  4MN4 C;  2N1T C;  4OWF A;  4H44 C;  1KOR A;  5AW1 B;  1BDD A;  3D70 A;  2Y9Y A;  3V2N A;  2IFM A;  3L75 D;  4UB6 E;  1VQN P;  3L73 E;  3G3Z A;  1SQP E;  4IL6 H;  3VMA A;  1EZV D;  1VDF A;  2LXB A;  2IBZ E;  5KLI B;  1M7L A;  4IL6 X;  1E79 H;  2IZ0 A;  2YXR B;  4DCK A;  2BCC D;  2M8R A;  1KD1 Q;  4UB8 H;  2ZYA A;  3JCU E;  5APV A;  5BU8 B;  3NTN A;  1Z56 A;  2ZVN B;  1FJK A;  4C46 A;  5EFW B;  1LTT C;  2KOG A;  1FZC C;  5CJ4 A;  1IFP A;  2PGD A;  1CI6 B;  3MZW B;  2E75 D;  1T3J A;  3II6 A;  1RE3 A;  1K04 A;  1OFC X;  4JF7 A;  3BVH A;  1OZH A;  2R5D A;  2B89 A;  1PP9 E;  1M1J B;  1VQ8 P;  1LTI C;  1KV4 A;  2KZI A;  1BE3 G;  1KN7 A;  4C7N A;  2FY8 A;  4B86 A;  2HG5 D;  2C9N Y;  1L4A D;  1L0L K;  2OAR A;  4H13 B;  3CXH H;  1HH0 A;  4BRY A;  1AA0 A;  2A45 I;  3M9Q A;  1AVY A;  3V2Q A;  4AUW A;  1JEK A;  3M0D C;  4PV1 D;  2HLO A;  3OAK A;  3KZI H;  1LTA C;  1AQ5 A;  4JBZ A;  5KLV J;  1PL5 A;  3HD7 D;  2HFE D;  3TSI A;  1S3J A;  3ITK A;  2N1T B;  4H44 B;  3CC4 P;  1SQB E;  1IK9 A;  2KK7 A;  1OIP A;  2DW3 A;  3P8M C;  5AW5 B;  2AEM A;  3CX5 I;  4GKG A;  2R32 A;  3HD7 C;  2H43 A;  3CXH I;  1RF0 C;  1ZR4 A;  1N7S D;  3IR9 A;  3H32 A;  5AW8 B;  5AVZ B;  1MZ9 A;  1N8R Q;  2XNX A;  1NTM K;  1KFN A;  2RKL A;  2ZT9 C;  3AE9 C;  4JYB A;  2Z5I A;  3IAO A;  2YIU C;  3TNU B;  1N7S C;  1Q81 Q;  1KIL D;  5KLV D;  1FZC B;  3MUD C;  1NTZ D;  1U7J A;  3OW2 O;  3N4X A;  4WY4 A;  2FYN B;  3WUV A;  2Q1K A;  5B66 H;  2XDJ A;  2E74 D;  1KQF B;  5H2F E;  2WSC H;  2QM8 A;  1NYH A;  2P7J A;  2FXM A;  1LWU C;  1ZP0 C;  3L71 E;  5CBN A;  1MFZ A;  3A3Y B;  2FXP A;  2WSF J;  1JY3 P;  2E5Y A;  2CPS A;  3RK3 D;  3CWB J;  1CI6 A;  3CCJ P;  5AW2 B;  4EIJ A;  1NU1 K;  1L0N J;  1JMM A;  2WT7 A;  1NTK E;  1H0T B;  2JJL A;  2YXQ B;  3L70 G;  1K05 A;  1M1J A;  2OYH A;  2P67 A;  1X9V A;  1J2J B;  2OQQ A;  2R5B A;  4K35 A;  3TDK A;  3TK1 A;  3A5T A;  3RK2 D;  2BAS A;  1NH4 A;  5AW6 B;  2KUB A;  3L73 G;  2P10 A;  3IN6 A;  1SQP G;  3S9O A;  3Q1M A;  2ZAE B;  3PP5 A;  1K8A Q;  5CMZ A;  5K5G B;  1N73 A;  2IBZ G;  1JCC A;  1RE4 C;  3L74 E;  1SQQ J;  1AQT A;  4EOT A;  2KS1 A;  3AED C;  1PGJ A;  3T97 A;  1VF5 C;  2ZT9 B;  3VN0 A;  1L0N D;  1S1C X;  2N1T A;  4H0L D;  2AXC A;  1LGH B;  2NPS D;  3V2P A;  2YIU B;  2K9J B;  1MKM A;  1KB9 I;  3H1H E;  3TF5 A;  2Y9Z A;  3CCV P;  3F5H A;  2QE7 H;  2KLU A;  3P7K A;  3FGA D;  1DEB A;  2R3C A;  4IFF A;  3BAS A;  2M5A A;  1PP9 G;  2KNC B;  3P8C E;  3H1K E;  3U59 A;  3TGU D;  1FC2 C;  3B71 A;  3OJA B;  2GUV A;  1D7M A;  1S5L E;  1ZRT E;  3R4Y A;  2IBZ I;  3CCR P;  2QA4 P;  2WPV B;  5GTH E;  1FE6 A;  2MJZ A;  1LWU B;  3GF7 A;  3V2R A;  3A7O A;  4RKU J;  1VQK P;  1SQQ D;  5AVY B;  1L0L E;  4M3L A;  2K88 A;  3L72 E;  4L73 A;  2WPQ A;  3D6Y A;  1QVF O;  1LP1 A;  1YQ3 C;  1RQU A;  2E42 A;  1P84 E;  2YKQ A;  3IFM A;  1HWT C;  3GF3 A;  2W6J H;  4ASW A;  3VYI A;  2YO3 A;  1SQB G;  1CSB A;  1LJ2 A;  4NPF X;  5KKZ C;  2FYU K;  2N9B A;  1HF9 A;  3VMZ A;  2PFX A;  1BCC J;  5TJH A;  4D6T G;  2IPP A;  2ZXE B;  3EWK A;  3I56 P;  1RF1 A;  1NTM E;  3G4S P;  1QL2 A;  1L4A A;  3HUS C;  1VF5 B;  1BGY G;  1EC5 A;  1W2E A;  2WPR A;  1LTS C;  1DD4 A;  5APS A; 
#chains in the Genus database with same CATH homology
 1NTK J;  3CWB J;  1SQQ J;  2BCC J;  4D6T J;  1NTZ J;  1L0N J;  3L75 J;  2IBZ I;  1SQB J;  3BCC J;  3L71 J;  1SQX J;  1SQV J;  1L0L J;  1P84 I;  3TGU J;  3H1L J;  1NU1 J;  3L73 J;  3H1K J;  4PD4 I;  3L72 J;  3L70 J;  3CX5 I;  3H1H J;  1EZV I;  1SQP J;  2FYU J;  1BGY J;  3H1J J;  3L74 J;  1BCC J;  1BE3 J;  1PP9 J;  3H1I J;  1NTM J;  5KLV J;  1KB9 I;  4U3F J;  1KYO I;  3CXH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...