3L72J

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l72J00
2BCCJ 1SQXJ 1L0NJ 1L0LJ 3BCCJ 3H1KJ 3L74J 3CX5I 1EZVI 3H1LJ 3L72J 1SQPJ 1SQBJ 1PP9J 3CWBJ 3H1HJ 1BCCJ 1SQQJ 2FYUJ 3L73J 3L70J 3CXHI 2IBZI 1KYOI 4PD4I 3L75J 4D6TJ 1NU1J 4U3FJ 3L71J 3TGUJ 3H1JJ 1NTKJ 1P84I 1BGYJ 3H1IJ 1BE3J 1NTMJ 1KB9I 1NTZJ 5KLVJ 1SQVJ
chains in the Genus database with same CATH superfamily
5TISH 3E1RA 1NTKK 1VDFA 5E79E 5AW2B 2N9YB 3P7KA 1WMKA 2W6JH 5CMZA 1N2DC 1VQ6P 3HE5B 2QG4A 1PP9E 2FYUK 1NAFA 2YKOA 2W90A 3HD7A 1JTHB 5L8RJ 2XKMA 3VTPC 2KIKA 1AVYA 2J58A 1G1IA 2QJKB 3AE6C 2FFDB 4PD4E 4A7PA 1LGHB 2O01N 5KLIC 3OW2O 1X8YA 1L4AC 3AE2C 1SQVD 1PIXA 3CXHH 3WUVA 3MD0A 1L0NG 2W6AA 1J1EC 3M06A 1KYOE 3P8MC 2FXOA 4XE5B 4UB6H 4D6TG 1HJ0A 5AVRB 3TGUJ 3E7KA 2KS1A 2YKPA 5H2FE 2I8DA 1MZ9A 3U1AA 3CMEP 1ZMEC 1AVOA 1MV8A 2PAJA 4JF7A 1R5LA 1LTSC 3G9RA 2E74D 1CI6A 3LIEA 5KLIB 4PV1D 3G6EP 2BCCG 1L4AB 2ZXEB 1HGZA 2CPBA 2FBWC 3SFDC 1DD4A 1SQQG 1LP1A 1J1EB 1PGOA 4C7NB 4PD4I 4OH8B 2RKLA 1PV3A 1NTKG 1L0ND 2KLUA 3GF3A 4DJGA 1Y47A 2ZT9B 3JCUH 4RO0A 1DH3A 5AVVB 1M8OB 3L70J 1KYOI 1IK7A 3QH9A 1G1JA 2E5YA 2NPSC 2KSJA 5TJHA 1EXIA 1AQTA 1GZLA 1KD1Q 2P67A 5GTIH 5TISE 3KYQA 3W68A 1NAYA 1SQVE 2QIWA 3ZDMA 5CCHD 3L72E 1NH4A 5GTHE 1GMJA 2BCCD 5AW8B 1OMIA 1YHQP 1FZEA 1SQQD 4UB8H 3IFMA 2WSFJ 1HGVA 1NTKD 2HLOA 1N8RQ 2OYOA 2WPSA 3D70A 1X9VA 5KLVG 4BWNA 3Q5PA 1M1JA 3CX5D 4H13C 4ZMDA 2FYUD 1FAVA 2NPSB 3CXHE 3CC4P 5AVZB 5BU5A 1DEBA 3I56P 2YXQB 2YNYA 2B89A 3NMDA 4UB6E 4W7YA 1KILC 4Y99C 3CCLP 2ZYGA 3L73J 4NPFX 1N73A 2A06G 1U7MA 5CCHA 5AVTB 1S5LH 1L0NE 2HYNA 3L35A 4LGDE 1VQOP 1URQC 1NTMK 3L72J 2YMKA 1BCCJ 1KN7A 1Q81Q 1RQVA 1J1DB 1ZLLA 1Q7YQ 3T97A 4U3FJ 2IFMA 5KLVD 1SFCD 2YO2A 1OWAA 1NHLA 1UIIA 4IFFA 1P84H 2DW3A 3PP5A 3H1HJ 2HPCA 1NVOA 3FXEA 1KILB 3CXHI 2YMYA 3JCUE 4Y99B 3P32A 4AQRD 1NU1G 2C0XA 2D2CD 4QMAA 2WVRA 4IFMA 1JTHA 3MUDA 1URQB 3IAOA 1L4AD 2A06D 1PGPA 2VRSA 1NTKE 3SSUA 1GTWA 1M1KQ 3TGUG 2E42A 1P84D 4ASVA 3CX5E 1IZNB 2FYUE 1JMMA 1IK9A 2YKQA 3I55P 2ZT9D 2OTJP 2M3BA 2R3SA 3RL0C 1SFCA 2RN0A 4OGQD 2O01H 4UB8E 2K9YA 2N9BA 3IF4A 2M0BA 2GM4A 2KI7B 3GF7A 3Q5SA 3VMXA 2W8ZA 4H0LC 3B5NC 2Y9ZA 3F5HA 1GD2E 1DEEG 2KNCB 2POHA 3V5BA 3A0HH 1NTZJ 3RK3C 2E76C 1L4AA 2QM8A 1KQGB 3SWKA 1ZR2A 1IFJA 3L70G 4ASWA 3TGUD 1BDCA 4WBAA 4C7NA 3GW6A 3HUSB 3AE5C 1TU3F 3RL0B 1PFIA 1FZCC 1S5LE 1SLQA 3CX5I 2Z4EA 1RQUA 4DOJA 1PGJA 1SQPJ 3L37A 2FYUJ 3OAKA 3A7OA 3ABVC 3AE9C 3H1LE 3B5NB 1PZQA 2XDJA 3KDPB 1K9MQ 2H89C 1GW4A 1QEXA 3RK3B 2AXTH 3ITKA 2E76B 1RF0C 1OXZA 2FYZA 1P84E 2YO3A 3M91A 1K04A 3AECC 2IYOA 2AEFA 2R5BA 5APXA 1MFZA 3GHGA 2OQQA 1S1CX 1IFPA 1U7JA 2RMZA 3WU2E 1H8AA 1RE3C 2R32A 3L70D 1FZCB 1FU1A 2M5AB 1EDKA 3O6QA 3NXSA 1KYOD 1OW6A 1EDLA 2UWJE 3HTKA 1VQ9P 1SQXJ 1N7SD 4I2LC 2Z5HA 1VL2A 2B87B 3L73G 1GK6A 3CC7P 5APSA 2QJYC 1CW5A 5CBNA 3HRNA 1E5WA 4OVNF 1BDDA 3H1LJ 3L72G 1NTZK 1BCCG 3R4YA 3TGUE 4IOIH 2W83C 2WT7B 1KQSO 2K88A 4ZKPA 1LT9C 1N86A 2KK7A 4U3FG 1W2EA 1P84I 5C39A 1FBMA 1NOHA 1NYHA 1NO4A 1JB0J 1USDA 1IFMA 3H1HG 3L71E 1FE6A 1JY3N 2ZYAA 3M0DA 2ITAA 1SQPK 1EDJA 2CK3H 1AQ5A 5CJ0A 2QJYB 2WSCH 1N7SA 5B5EH 4K35A 4BRYA 2AEMA 1A02J 3FXDA 2V7QH 4IFDK 1ZXGA 3L73D 1HBWA 1NTME 2FY8A 2KLVA 4GODA 4GT1A 5KAFH 3CLQA 4YPCA 1LNQA 1WRGA 1RF1B 1LT9B 3L72D 2ZXXA 3L70E 4EIJA 1BCCD 1PPJG 2XZRA 1L0LK 2GA1A 3V6IA 1BE3E 1MUUA 3Q1MA 4U3FD 2O01J 2XNXA 2A45H 1SS1A 4JQ0D 3MGNA 1RE4C 3VOPA 1IC2A 2MKVA 3TDKA 5AVWB 3H1HD 1Q82Q 2KYVA 1SQXK 3F89A 1JY3O 3CCQP 1DX7A 4WWIA 3CXHD 4NPEA 3L71J 2I1JA 1S4XA 3R2PA 1YQ3C 3OA7A 3B5ND 2V4HA 2FKWB 2N1TC 3QWOC 3I5CA 1SQBK 4H44C 3TF5A 1FZFA 2SPZA 2JDIH 5B66E 3USSA 3Q3DA 4ZKUA 3M0AA 1RY3A 2OYHA 1N7LA 4TT3H 1HTLC 1NTMJ 4C46A 1PPJD 2E43A 3C9IA 1SQPG 2QM7A 5AVSB 2FYNC 2FYUG 3B71A 5AW5B 4WY4C 1T2KD 3AE1C 1OW7A 5DJTB 1LJ2A 3HUSA 1BE3J 3V4WA 2JKVA 1OIPA 3L73E 4JPZB 1M56D 5APUA 3O8ZA 1YIJP 3WUTA 3MTUE 3GG2A 2P7JA 4AYCA 2K1AA 1OVRA 1FZBA 2WPQA 1DIPA 2N1TB 3H1KE 2MJZA 4H44B 3CCRP 1NTZD 3B5NA 1BCCE 2R5DA 2P2UA 4LC1A 1FC2C 3NTNA 5B5EE 4U3FE 1IFDA 1ZRTD 4M3LA 1T3JA 2H8PD 2FYNB 3V2QA 4WY4B 3H1HE 3RK2C 2QRXA 1SQPD 1SQXG 1VF5C 5KAFE 4GOFA 2KOGA 1KMIZ 4KT0J 5KJ7C 1KB9H 3MZWB 4I1LA 2OYIC 3AEEC 2M5AA 2QEXP 3PJSK 1ZR4A 2K3RA 1NJIQ 4EOTA 2K9JA 3VMYA 1KFMA 3NFQA 4C7RA 3H1LG 1OFCX 3RK3E 2B87A 2KZJA 1L2PA 4JYBA 4HJGH 1M90Q 1OVUA 1PPJE 5CBOA 1KB9D 3UIAA 1E79H 3H1KJ 1QX8A 2C9NY 4L74A 3BRTB 3RK2B 1G2CA 1VF5B 2Y0CA 4H13B 3TNUB 3VMZA 1YTZI 3M9HA 4YXWH 3KHUA 1RE3A 2WSEH 2WSCJ 1RH5B 1LTJA 2JEEA 1SQXD 1S9KD 2V7QJ 2W27A 3AE4C 4PJ0H 2WSSH 3AEFC 1NTZE 3H1ID 1JY2N 2IBZG 3HE5A 2HG5D 5CCGC 5K5GB 1GW3A 1NKNA 1SQBD 3H1LD 3D71A 1JY3P 3KQGA 1ZRTE 4MN4C 1YYCA 5APWA 2FFDA 1LTTC 1BSHA 1T3UA 4N6JA 1S2EA 5GTIE 4WVZA 1SQPE 2C0WA 2WTYA 1RF1A 3H32B 4IL6H 3BCCJ 3B8EB 3CWBJ 1LTBC 3FWLA 4WB4A 1YTZT 1OX3A 1KFNA 2KS1B 3C1LA 4N3YB 3L71G 4KHXA 2Q6QA 3K5BA 4HB1A 4W7ZA 2B9BA 1QVFO 3CL3D 3V2PA 2FXPA 3CCEP 2IBZD 1JCCA 3G4SP 2HFED 1L0LE 3AEAC 1KB9E 1CI6B 2WPRA 5DJUB 1KC8Q 1NTMG 1PL5A 4BXLA 1K8AQ 4I7ZC 3L74J 1LP1B 3VMAA 2E74C 3RGUA 1KZUB 1PGQA 4PV1C 2J5UA 2XV5A 1SP4A 5AVXB 1BGYD 4GKGA 1VQPP 1SQXE 1S9KE 3PLNA 5AW1B 3BVHA 1BE3G 3IR9A 2E75C 3LW5H 1EC5A 2Q3EA 1YITP 1Q86Q 2ZVNB 3H1IE 2NPSD 2AXCA 3L71D 4H0LB 1M1JC 2QVAA 1H0TB 1SQBE 2CPSA 1W5CE 2OTLP 4PD4H 1S5LX 2PP6A 2KP8A 1R5SA 4I7ZB 1U57A 1K05A 4W80A 2JJLA 2E74B 4PJ0E 1HF9A 4PV1B 1NTMD 2ZAEB 1KB9I 1FS0E 2Q3IA 4HH2A 1L0LJ 1N73C 5CCHC 3RBZA 2OTKE 4GOEA 1S72P 1EQ7A 2ZJSE 3N4XA 1KTMA 3MHVA 2E75B 1R8EA 1CSBA 4CPGA 3PRJA 5H2FH 5AW3B 1LTGC 3H1JD 3EQ2A 1BE3D 4H13D 3FX0A 1GU5A 1KQFB 5KJ7D 2XU6A 1AFOA 2KUBA 3TK1A 5APQA 2IBZE 2NPSA 4IL6E 4YTPC 1LT1A 4L73A 1LWUC 1UIXA 4HKZH 1OW8A 2AEJA 4DCKA 1KILD 1JCDA 4GDOA 2JWAA 3H1IJ 2Q9IA 1A02F 2Y9YA 3H1KG 4L76A 1M7LA 3Q5RA 1SQBJ 2YIUC 5AW7B 1GU4A 1N73B 1BGYE 3HE4B 2WSEJ 1URQD 2JO1A 3RL0g 1GL2C 1Q90D 3MUDC 2P10A 1QVGO 4AUWA 1KORA 2Y0DA 4JYCA 5APVA 2RH0A 3BRVB 1EDIA 3H25A 2QA4P 3SWYA 1JEKA 3FWNA 3A0HE 2GUSA 3L75D 1VQMP 1FDOA 3T97B 1SQQK 3TNUA 2QSIA 5KJ7A 3G3ZA 3VN0A 1LWUB 3II6A 4EI2A 2HPCB 2WQYC 1VQ5P 2G8YA 1SFCC 2BEZF 5GTHH 5CCGD 1FOSE 3A0BH 2YXRB 2A45G 2IBZI 5AW9B 2YIUB 1KILA 5AVQB 1VQKP 3B4SA 3AEDC 1FDIA 1GL2B 3H1KD 2L5GB 3WUUA 1AJYA 1Q2NA 3BCCG 2M8RA 1OZHA 3CWBG 1S3JA 2R44A 5M1BA 2D2CC 3H1JE 1JY2P 1URQA 2KXPB 1LTIC 1FOSF 1NU1J 3MIWA 1GK4A 1HH0A 3CCJP 2AXTE 3U59A 2JWDA 4JBZA 1BGYJ 3CCSP 2OGUA 4XFJA 2Q5UA 3H32A 2NZ2A 1FZAA 3A5TA 1IJDB 3RL0D 2I1KA 2IDBA 1KILE 1YJNP 1SFCB 4O9BA 3CCMP 1XTCC 1ZN5A 1KV4A 4EDFA 2LXBA 3CD6P 2ZT9C 4H0LD 1NTZG 3AE8C 3L74G 1EXJA 1FJPA 4KJMA 5KLVK 5CCGA 4OGQC 3AEGC 2KZIA 2P1JA 2JP3A 3U1CA 2LXCB 2QE7H 5KKZC 1LTAC 3RK3D 2H88C 2D2CB 1Z56A 2E76D 5AW4B 4OWFA 3LW5J 3GMAA 3BCCD 1PP9J 2WITA 2WMMA 2KNCA 3CWBD 2IFNA 4L75A 3L75E 2HODB 2PFXA 3GHGC 2E75D 2ZYDA 3S9OA 1RHZB 1JUNA 4K3AA 1YJWP 1X0TA 1JOCA 3H1JJ 2R3CA 1DD3A 1QL2A 3W67A 3JC22 4R4LA 2WZ7A 1YI2P 3RBXA 1ZP0C 4D6TD 4OGQB 1NKZB 5KKZB 1H0TA 1FDMA 1MFTA 1JMBA 3L74D 4YXDC 1L0LG 2J59M 2H7HA 3CX5H 1H89A 1VQ4P 2IX7C 3LIDA 3GHGB 1AV1A 3A0BE 2OARA 1NU1K 1HUCA 3V4QA 2LR2A 1Y8AA 5APTA 2KB7P 3O6QB 4LLHA 1QL1A 1FZCA 3M9BA 3L75J 2Q1KA 3HTKB 4U7JA 1AA0A 3H1IG 1Y9BA 3M0DC 5KAIH 3TSIA 5AW6B 5CJ4A 1J1DC 5AVYB 1SQBG 1CZQA 3FGAD 1EZVG 3KXDA 1N7SC 2GUVA 3HD7C 1X79B 3CC2P 3BCCE 3CWBE 1RF0A 1L0LD 5APYA 2LKMA 3VP8A 2Y0EA 1GL2D 3EWKA 3M9QA 2Q7CA 3HE4A 2WT7A 1HVVA 3V2NA 2OYIB 1SQVJ 2WPVB 2O1KA 2K37A 4D6TE 5CHXA 2M3EA 3L74E 1IO4A 1N7SB 1H88A 3HD7B 2W6BA 4BRYB 1LWUA 2O3JA 1VQ7P 1EZVD 4N78D 3D6ZA 1VQ8P 3MP7B 3VYIA 5AW0B 1HJBA 1ZOYC 1KQLA 2A45I 1T8ZA 2BCCE 1BSNA 3WU2H 2BEQD 1QGKB 2PGDA 1VQLP 1BGYG 2IZ0A 1SQQE 3TYYA 5EFWB 1GL2A 1LT9A 2ZVOB 1YBKA 3GLMA 4XA4A 2OYHC 1D7MA 1VQNP 4TLFA 1T6AA 4GIFA 1XTGB 2XNDH 3EFGA 3WMM0 4EYYQ 2KSEA 1MKMA 2WWWA 3S1KA 3VP9A 1USEA 1L0NJ 4DZOA 2Z5IA 5AVUB 2G3AA 1OVVA 1J2JB 3HUSC 5BVZA 2P58A 3IN6A 1JY2O 4D6TJ 3KZIH 4RKUJ 3AEBC 3Q2YA 4Z1MH 2N1TD 1X22A 1PP9G 1JNMA 4H44D 3A2AA 1JM0A 3G71P 1SVFA 1HWTC 2JR8A 5KAIE 1K73Q 1NU1D 2OYHB 5KTBA 2NRGA 2BASA 3H1JG 5E79H 2QJPC 2BCCJ 4WY4D 3V2RA 1ZW0A 1SQVK 4RJTA 1NWQA 1RE4A 1SQQJ 3P8CD 3BATA 1JO5A 3SFEC 4NPDA 2HODA 5KLVE 4R4MA 4RESB 3AE3C 1NTKJ 3H6PA 2B88A 1EZVE 4N78E 1T2KC 3OJAB 1YJ9P 1GDTA 2HR3A 1M57D 3S4RA 3AE7C 4DT0A 3CMAP 3CI9A 1IFIA 2IZ1A 1YQ4C 2IPPA 4I6MC 1ZV8A 2N1TA 1PP9D 1IFNA 2L91A 1WT6A 1KYOH 3CCUP 2A06E 2O1JA 1VPCA 2ZFCA 3PTZA 2QJPB 2PRRA 3RK2D 4PD4D 3L75G 1VF5D 2FXMA 3BASA 3E1IA 4WY4A 1M1JB 1FJKA 4B86A 4Y28J 1W2BO 2C9LY 1L0NK 1LTJC 3KPEA 3PH0A 3D6YA 2H43A 2K9JB 2WSFH 3N7NA 1NGMB 5KLVJ 3HD7D 1EZVI 5B66H 5BU8B 3EFFK 1NU1E 3PHLA 2IYPA 4IL6X 2E5TA 3JSVC 3CCVP 3A3YB 3C8VA 1FZGA 1SQVG 2QJKC 3KZIE 2FFDC 1G2CB 1QLED 3P8CE 3CPWO 4HYTB 4ZNCA 3L4FA 1RF1C 3L36A 3SWFA 1LTJB 2OYIA
chains in the Genus database with same CATH topology
2BCCJ 1SQXJ 1L0NJ 1L0LJ 3BCCJ 3H1KJ 3L74J 3CX5I 1EZVI 3H1LJ 3L72J 1SQPJ 1SQBJ 1PP9J 3CWBJ 3H1HJ 1BCCJ 1SQQJ 2FYUJ 3L73J 3L70J 3CXHI 2IBZI 1KYOI 4PD4I 3L75J 4D6TJ 1NU1J 4U3FJ 3L71J 3TGUJ 3H1JJ 1NTKJ 1P84I 1BGYJ 3H1IJ 1BE3J 1NTMJ 1KB9I 1NTZJ 5KLVJ 1SQVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC J;  1SQX J;  1L0N J;  1L0L J;  3BCC J;  3H1K J;  3L74 J;  3CX5 I;  1EZV I;  3H1L J;  3L72 J;  1SQP J;  1SQB J;  1PP9 J;  3CWB J;  3H1H J;  1BCC J;  1SQQ J;  2FYU J;  3L73 J;  3L70 J;  3CXH I;  2IBZ I;  1KYO I;  4PD4 I;  3L75 J;  4D6T J;  1NU1 J;  4U3F J;  3L71 J;  3TGU J;  3H1J J;  1NTK J;  1P84 I;  1BGY J;  3H1I J;  1BE3 J;  1NTM J;  1KB9 I;  1NTZ J;  5KLV J;  1SQV J; 
#chains in the Genus database with same CATH topology
 5TIS H;  3E1R A;  1NTK K;  1VDF A;  5E79 E;  5AW2 B;  2N9Y B;  3P7K A;  1WMK A;  2W6J H;  5CMZ A;  1N2D C;  1VQ6 P;  3HE5 B;  2QG4 A;  1PP9 E;  2FYU K;  1NAF A;  2YKO A;  2W90 A;  3HD7 A;  1JTH B;  5L8R J;  2XKM A;  3VTP C;  2KIK A;  1AVY A;  2J58 A;  1G1I A;  2QJK B;  3AE6 C;  2FFD B;  4PD4 E;  4A7P A;  1LGH B;  2O01 N;  5KLI C;  3OW2 O;  1X8Y A;  1L4A C;  3AE2 C;  1SQV D;  1PIX A;  3CXH H;  3WUV A;  3MD0 A;  1L0N G;  2W6A A;  1J1E C;  3M06 A;  1KYO E;  3P8M C;  2FXO A;  4XE5 B;  4UB6 H;  4D6T G;  1HJ0 A;  5AVR B;  3TGU J;  3E7K A;  2KS1 A;  2YKP A;  5H2F E;  2I8D A;  1MZ9 A;  3U1A A;  3CME P;  1ZME C;  1AVO A;  1MV8 A;  2PAJ A;  4JF7 A;  1R5L A;  1LTS C;  3G9R A;  2E74 D;  1CI6 A;  3LIE A;  5KLI B;  4PV1 D;  3G6E P;  2BCC G;  1L4A B;  2ZXE B;  1HGZ A;  2CPB A;  2FBW C;  3SFD C;  1DD4 A;  1SQQ G;  1LP1 A;  1J1E B;  1PGO A;  4C7N B;  4PD4 I;  4OH8 B;  2RKL A;  1PV3 A;  1NTK G;  1L0N D;  2KLU A;  3GF3 A;  4DJG A;  1Y47 A;  2ZT9 B;  3JCU H;  4RO0 A;  1DH3 A;  5AVV B;  1M8O B;  3L70 J;  1KYO I;  1IK7 A;  3QH9 A;  1G1J A;  2E5Y A;  2NPS C;  2KSJ A;  5TJH A;  1EXI A;  1AQT A;  1GZL A;  1KD1 Q;  2P67 A;  5GTI H;  5TIS E;  3KYQ A;  3W68 A;  1NAY A;  1SQV E;  2QIW A;  3ZDM A;  5CCH D;  3L72 E;  1NH4 A;  5GTH E;  1GMJ A;  2BCC D;  5AW8 B;  1OMI A;  1YHQ P;  1FZE A;  1SQQ D;  4UB8 H;  3IFM A;  2WSF J;  1HGV A;  1NTK D;  2HLO A;  1N8R Q;  2OYO A;  2WPS A;  3D70 A;  1X9V A;  5KLV G;  4BWN A;  3Q5P A;  1M1J A;  3CX5 D;  4H13 C;  4ZMD A;  2FYU D;  1FAV A;  2NPS B;  3CXH E;  3CC4 P;  5AVZ B;  5BU5 A;  1DEB A;  3I56 P;  2YXQ B;  2YNY A;  2B89 A;  3NMD A;  4UB6 E;  4W7Y A;  1KIL C;  4Y99 C;  3CCL P;  2ZYG A;  3L73 J;  4NPF X;  1N73 A;  2A06 G;  1U7M A;  5CCH A;  5AVT B;  1S5L H;  1L0N E;  2HYN A;  3L35 A;  4LGD E;  1VQO P;  1URQ C;  1NTM K;  3L72 J;  2YMK A;  1BCC J;  1KN7 A;  1Q81 Q;  1RQV A;  1J1D B;  1ZLL A;  1Q7Y Q;  3T97 A;  4U3F J;  2IFM A;  5KLV D;  1SFC D;  2YO2 A;  1OWA A;  1NHL A;  1UII A;  4IFF A;  1P84 H;  2DW3 A;  3PP5 A;  3H1H J;  2HPC A;  1NVO A;  3FXE A;  1KIL B;  3CXH I;  2YMY A;  3JCU E;  4Y99 B;  3P32 A;  4AQR D;  1NU1 G;  2C0X A;  2D2C D;  4QMA A;  2WVR A;  4IFM A;  1JTH A;  3MUD A;  1URQ B;  3IAO A;  1L4A D;  2A06 D;  1PGP A;  2VRS A;  1NTK E;  3SSU A;  1GTW A;  1M1K Q;  3TGU G;  2E42 A;  1P84 D;  4ASV A;  3CX5 E;  1IZN B;  2FYU E;  1JMM A;  1IK9 A;  2YKQ A;  3I55 P;  2ZT9 D;  2OTJ P;  2M3B A;  2R3S A;  3RL0 C;  1SFC A;  2RN0 A;  4OGQ D;  2O01 H;  4UB8 E;  2K9Y A;  2N9B A;  3IF4 A;  2M0B A;  2GM4 A;  2KI7 B;  3GF7 A;  3Q5S A;  3VMX A;  2W8Z A;  4H0L C;  3B5N C;  2Y9Z A;  3F5H A;  1GD2 E;  1DEE G;  2KNC B;  2POH A;  3V5B A;  3A0H H;  1NTZ J;  3RK3 C;  2E76 C;  1L4A A;  2QM8 A;  1KQG B;  3SWK A;  1ZR2 A;  1IFJ A;  3L70 G;  4ASW A;  3TGU D;  1BDC A;  4WBA A;  4C7N A;  3GW6 A;  3HUS B;  3AE5 C;  1TU3 F;  3RL0 B;  1PFI A;  1FZC C;  1S5L E;  1SLQ A;  3CX5 I;  2Z4E A;  1RQU A;  4DOJ A;  1PGJ A;  1SQP J;  3L37 A;  2FYU J;  3OAK A;  3A7O A;  3ABV C;  3AE9 C;  3H1L E;  3B5N B;  1PZQ A;  2XDJ A;  3KDP B;  1K9M Q;  2H89 C;  1GW4 A;  1QEX A;  3RK3 B;  2AXT H;  3ITK A;  2E76 B;  1RF0 C;  1OXZ A;  2FYZ A;  1P84 E;  2YO3 A;  3M91 A;  1K04 A;  3AEC C;  2IYO A;  2AEF A;  2R5B A;  5APX A;  1MFZ A;  3GHG A;  2OQQ A;  1S1C X;  1IFP A;  1U7J A;  2RMZ A;  3WU2 E;  1H8A A;  1RE3 C;  2R32 A;  3L70 D;  1FZC B;  1FU1 A;  2M5A B;  1EDK A;  3O6Q A;  3NXS A;  1KYO D;  1OW6 A;  1EDL A;  2UWJ E;  3HTK A;  1VQ9 P;  1SQX J;  1N7S D;  4I2L C;  2Z5H A;  1VL2 A;  2B87 B;  3L73 G;  1GK6 A;  3CC7 P;  5APS A;  2QJY C;  1CW5 A;  5CBN A;  3HRN A;  1E5W A;  4OVN F;  1BDD A;  3H1L J;  3L72 G;  1NTZ K;  1BCC G;  3R4Y A;  3TGU E;  4IOI H;  2W83 C;  2WT7 B;  1KQS O;  2K88 A;  4ZKP A;  1LT9 C;  1N86 A;  2KK7 A;  4U3F G;  1W2E A;  1P84 I;  5C39 A;  1FBM A;  1NOH A;  1NYH A;  1NO4 A;  1JB0 J;  1USD A;  1IFM A;  3H1H G;  3L71 E;  1FE6 A;  1JY3 N;  2ZYA A;  3M0D A;  2ITA A;  1SQP K;  1EDJ A;  2CK3 H;  1AQ5 A;  5CJ0 A;  2QJY B;  2WSC H;  1N7S A;  5B5E H;  4K35 A;  4BRY A;  2AEM A;  1A02 J;  3FXD A;  2V7Q H;  4IFD K;  1ZXG A;  3L73 D;  1HBW A;  1NTM E;  2FY8 A;  2KLV A;  4GOD A;  4GT1 A;  5KAF H;  3CLQ A;  4YPC A;  1LNQ A;  1WRG A;  1RF1 B;  1LT9 B;  3L72 D;  2ZXX A;  3L70 E;  4EIJ A;  1BCC D;  1PPJ G;  2XZR A;  1L0L K;  2GA1 A;  3V6I A;  1BE3 E;  1MUU A;  3Q1M A;  4U3F D;  2O01 J;  2XNX A;  2A45 H;  1SS1 A;  4JQ0 D;  3MGN A;  1RE4 C;  3VOP A;  1IC2 A;  2MKV A;  3TDK A;  5AVW B;  3H1H D;  1Q82 Q;  2KYV A;  1SQX K;  3F89 A;  1JY3 O;  3CCQ P;  1DX7 A;  4WWI A;  3CXH D;  4NPE A;  3L71 J;  2I1J A;  1S4X A;  3R2P A;  1YQ3 C;  3OA7 A;  3B5N D;  2V4H A;  2FKW B;  2N1T C;  3QWO C;  3I5C A;  1SQB K;  4H44 C;  3TF5 A;  1FZF A;  2SPZ A;  2JDI H;  5B66 E;  3USS A;  3Q3D A;  4ZKU A;  3M0A A;  1RY3 A;  2OYH A;  1N7L A;  4TT3 H;  1HTL C;  1NTM J;  4C46 A;  1PPJ D;  2E43 A;  3C9I A;  1SQP G;  2QM7 A;  5AVS B;  2FYN C;  2FYU G;  3B71 A;  5AW5 B;  4WY4 C;  1T2K D;  3AE1 C;  1OW7 A;  5DJT B;  1LJ2 A;  3HUS A;  1BE3 J;  3V4W A;  2JKV A;  1OIP A;  3L73 E;  4JPZ B;  1M56 D;  5APU A;  3O8Z A;  1YIJ P;  3WUT A;  3MTU E;  3GG2 A;  2P7J A;  4AYC A;  2K1A A;  1OVR A;  1FZB A;  2WPQ A;  1DIP A;  2N1T B;  3H1K E;  2MJZ A;  4H44 B;  3CCR P;  1NTZ D;  3B5N A;  1BCC E;  2R5D A;  2P2U A;  4LC1 A;  1FC2 C;  3NTN A;  5B5E E;  4U3F E;  1IFD A;  1ZRT D;  4M3L A;  1T3J A;  2H8P D;  2FYN B;  3V2Q A;  4WY4 B;  3H1H E;  3RK2 C;  2QRX A;  1SQP D;  1SQX G;  1VF5 C;  5KAF E;  4GOF A;  2KOG A;  1KMI Z;  4KT0 J;  5KJ7 C;  1KB9 H;  3MZW B;  4I1L A;  2OYI C;  3AEE C;  2M5A A;  2QEX P;  3PJS K;  1ZR4 A;  2K3R A;  1NJI Q;  4EOT A;  2K9J A;  3VMY A;  1KFM A;  3NFQ A;  4C7R A;  3H1L G;  1OFC X;  3RK3 E;  2B87 A;  2KZJ A;  1L2P A;  4JYB A;  4HJG H;  1M90 Q;  1OVU A;  1PPJ E;  5CBO A;  1KB9 D;  3UIA A;  1E79 H;  3H1K J;  1QX8 A;  2C9N Y;  4L74 A;  3BRT B;  3RK2 B;  1G2C A;  1VF5 B;  2Y0C A;  4H13 B;  3TNU B;  3VMZ A;  1YTZ I;  3M9H A;  4YXW H;  3KHU A;  1RE3 A;  2WSE H;  2WSC J;  1RH5 B;  1LTJ A;  2JEE A;  1SQX D;  1S9K D;  2V7Q J;  2W27 A;  3AE4 C;  4PJ0 H;  2WSS H;  3AEF C;  1NTZ E;  3H1I D;  1JY2 N;  2IBZ G;  3HE5 A;  2HG5 D;  5CCG C;  5K5G B;  1GW3 A;  1NKN A;  1SQB D;  3H1L D;  3D71 A;  1JY3 P;  3KQG A;  1ZRT E;  4MN4 C;  1YYC A;  5APW A;  2FFD A;  1LTT C;  1BSH A;  1T3U A;  4N6J A;  1S2E A;  5GTI E;  4WVZ A;  1SQP E;  2C0W A;  2WTY A;  1RF1 A;  3H32 B;  4IL6 H;  3BCC J;  3B8E B;  3CWB J;  1LTB C;  3FWL A;  4WB4 A;  1YTZ T;  1OX3 A;  1KFN A;  2KS1 B;  3C1L A;  4N3Y B;  3L71 G;  4KHX A;  2Q6Q A;  3K5B A;  4HB1 A;  4W7Z A;  2B9B A;  1QVF O;  3CL3 D;  3V2P A;  2FXP A;  3CCE P;  2IBZ D;  1JCC A;  3G4S P;  2HFE D;  1L0L E;  3AEA C;  1KB9 E;  1CI6 B;  2WPR A;  5DJU B;  1KC8 Q;  1NTM G;  1PL5 A;  4BXL A;  1K8A Q;  4I7Z C;  3L74 J;  1LP1 B;  3VMA A;  2E74 C;  3RGU A;  1KZU B;  1PGQ A;  4PV1 C;  2J5U A;  2XV5 A;  1SP4 A;  5AVX B;  1BGY D;  4GKG A;  1VQP P;  1SQX E;  1S9K E;  3PLN A;  5AW1 B;  3BVH A;  1BE3 G;  3IR9 A;  2E75 C;  3LW5 H;  1EC5 A;  2Q3E A;  1YIT P;  1Q86 Q;  2ZVN B;  3H1I E;  2NPS D;  2AXC A;  3L71 D;  4H0L B;  1M1J C;  2QVA A;  1H0T B;  1SQB E;  2CPS A;  1W5C E;  2OTL P;  4PD4 H;  1S5L X;  2PP6 A;  2KP8 A;  1R5S A;  4I7Z B;  1U57 A;  1K05 A;  4W80 A;  2JJL A;  2E74 B;  4PJ0 E;  1HF9 A;  4PV1 B;  1NTM D;  2ZAE B;  1KB9 I;  1FS0 E;  2Q3I A;  4HH2 A;  1L0L J;  1N73 C;  5CCH C;  3RBZ A;  2OTK E;  4GOE A;  1S72 P;  1EQ7 A;  2ZJS E;  3N4X A;  1KTM A;  3MHV A;  2E75 B;  1R8E A;  1CSB A;  4CPG A;  3PRJ A;  5H2F H;  5AW3 B;  1LTG C;  3H1J D;  3EQ2 A;  1BE3 D;  4H13 D;  3FX0 A;  1GU5 A;  1KQF B;  5KJ7 D;  2XU6 A;  1AFO A;  2KUB A;  3TK1 A;  5APQ A;  2IBZ E;  2NPS A;  4IL6 E;  4YTP C;  1LT1 A;  4L73 A;  1LWU C;  1UIX A;  4HKZ H;  1OW8 A;  2AEJ A;  4DCK A;  1KIL D;  1JCD A;  4GDO A;  2JWA A;  3H1I J;  2Q9I A;  1A02 F;  2Y9Y A;  3H1K G;  4L76 A;  1M7L A;  3Q5R A;  1SQB J;  2YIU C;  5AW7 B;  1GU4 A;  1N73 B;  1BGY E;  3HE4 B;  2WSE J;  1URQ D;  2JO1 A;  3RL0 g;  1GL2 C;  1Q90 D;  3MUD C;  2P10 A;  1QVG O;  4AUW A;  1KOR A;  2Y0D A;  4JYC A;  5APV A;  2RH0 A;  3BRV B;  1EDI A;  3H25 A;  2QA4 P;  3SWY A;  1JEK A;  3FWN A;  3A0H E;  2GUS A;  3L75 D;  1VQM P;  1FDO A;  3T97 B;  1SQQ K;  3TNU A;  2QSI A;  5KJ7 A;  3G3Z A;  3VN0 A;  1LWU B;  3II6 A;  4EI2 A;  2HPC B;  2WQY C;  1VQ5 P;  2G8Y A;  1SFC C;  2BEZ F;  5GTH H;  5CCG D;  1FOS E;  3A0B H;  2YXR B;  2A45 G;  2IBZ I;  5AW9 B;  2YIU B;  1KIL A;  5AVQ B;  1VQK P;  3B4S A;  3AED C;  1FDI A;  1GL2 B;  3H1K D;  2L5G B;  3WUU A;  1AJY A;  1Q2N A;  3BCC G;  2M8R A;  1OZH A;  3CWB G;  1S3J A;  2R44 A;  5M1B A;  2D2C C;  3H1J E;  1JY2 P;  1URQ A;  2KXP B;  1LTI C;  1FOS F;  1NU1 J;  3MIW A;  1GK4 A;  1HH0 A;  3CCJ P;  2AXT E;  3U59 A;  2JWD A;  4JBZ A;  1BGY J;  3CCS P;  2OGU A;  4XFJ A;  2Q5U A;  3H32 A;  2NZ2 A;  1FZA A;  3A5T A;  1IJD B;  3RL0 D;  2I1K A;  2IDB A;  1KIL E;  1YJN P;  1SFC B;  4O9B A;  3CCM P;  1XTC C;  1ZN5 A;  1KV4 A;  4EDF A;  2LXB A;  3CD6 P;  2ZT9 C;  4H0L D;  1NTZ G;  3AE8 C;  3L74 G;  1EXJ A;  1FJP A;  4KJM A;  5KLV K;  5CCG A;  4OGQ C;  3AEG C;  2KZI A;  2P1J A;  2JP3 A;  3U1C A;  2LXC B;  2QE7 H;  5KKZ C;  1LTA C;  3RK3 D;  2H88 C;  2D2C B;  1Z56 A;  2E76 D;  5AW4 B;  4OWF A;  3LW5 J;  3GMA A;  3BCC D;  1PP9 J;  2WIT A;  2WMM A;  2KNC A;  3CWB D;  2IFN A;  4L75 A;  3L75 E;  2HOD B;  2PFX A;  3GHG C;  2E75 D;  2ZYD A;  3S9O A;  1RHZ B;  1JUN A;  4K3A A;  1YJW P;  1X0T A;  1JOC A;  3H1J J;  2R3C A;  1DD3 A;  1QL2 A;  3W67 A;  3JC2 2;  4R4L A;  2WZ7 A;  1YI2 P;  3RBX A;  1ZP0 C;  4D6T D;  4OGQ B;  1NKZ B;  5KKZ B;  1H0T A;  1FDM A;  1MFT A;  1JMB A;  3L74 D;  4YXD C;  1L0L G;  2J59 M;  2H7H A;  3CX5 H;  1H89 A;  1VQ4 P;  2IX7 C;  3LID A;  3GHG B;  1AV1 A;  3A0B E;  2OAR A;  1NU1 K;  1HUC A;  3V4Q A;  2LR2 A;  1Y8A A;  5APT A;  2KB7 P;  3O6Q B;  4LLH A;  1QL1 A;  1FZC A;  3M9B A;  3L75 J;  2Q1K A;  3HTK B;  4U7J A;  1AA0 A;  3H1I G;  1Y9B A;  3M0D C;  5KAI H;  3TSI A;  5AW6 B;  5CJ4 A;  1J1D C;  5AVY B;  1SQB G;  1CZQ A;  3FGA D;  1EZV G;  3KXD A;  1N7S C;  2GUV A;  3HD7 C;  1X79 B;  3CC2 P;  3BCC E;  3CWB E;  1RF0 A;  1L0L D;  5APY A;  2LKM A;  3VP8 A;  2Y0E A;  1GL2 D;  3EWK A;  3M9Q A;  2Q7C A;  3HE4 A;  2WT7 A;  1HVV A;  3V2N A;  2OYI B;  1SQV J;  2WPV B;  2O1K A;  2K37 A;  4D6T E;  5CHX A;  2M3E A;  3L74 E;  1IO4 A;  1N7S B;  1H88 A;  3HD7 B;  2W6B A;  4BRY B;  1LWU A;  2O3J A;  1VQ7 P;  1EZV D;  4N78 D;  3D6Z A;  1VQ8 P;  3MP7 B;  3VYI A;  5AW0 B;  1HJB A;  1ZOY C;  1KQL A;  2A45 I;  1T8Z A;  2BCC E;  1BSN A;  3WU2 H;  2BEQ D;  1QGK B;  2PGD A;  1VQL P;  1BGY G;  2IZ0 A;  1SQQ E;  3TYY A;  5EFW B;  1GL2 A;  1LT9 A;  2ZVO B;  1YBK A;  3GLM A;  4XA4 A;  2OYH C;  1D7M A;  1VQN P;  4TLF A;  1T6A A;  4GIF A;  1XTG B;  2XND H;  3EFG A;  3WMM 0;  4EYY Q;  2KSE A;  1MKM A;  2WWW A;  3S1K A;  3VP9 A;  1USE A;  1L0N J;  4DZO A;  2Z5I A;  5AVU B;  2G3A A;  1OVV A;  1J2J B;  3HUS C;  5BVZ A;  2P58 A;  3IN6 A;  1JY2 O;  4D6T J;  3KZI H;  4RKU J;  3AEB C;  3Q2Y A;  4Z1M H;  2N1T D;  1X22 A;  1PP9 G;  1JNM A;  4H44 D;  3A2A A;  1JM0 A;  3G71 P;  1SVF A;  1HWT C;  2JR8 A;  5KAI E;  1K73 Q;  1NU1 D;  2OYH B;  5KTB A;  2NRG A;  2BAS A;  3H1J G;  5E79 H;  2QJP C;  2BCC J;  4WY4 D;  3V2R A;  1ZW0 A;  1SQV K;  4RJT A;  1NWQ A;  1RE4 A;  1SQQ J;  3P8C D;  3BAT A;  1JO5 A;  3SFE C;  4NPD A;  2HOD A;  5KLV E;  4R4M A;  4RES B;  3AE3 C;  1NTK J;  3H6P A;  2B88 A;  1EZV E;  4N78 E;  1T2K C;  3OJA B;  1YJ9 P;  1GDT A;  2HR3 A;  1M57 D;  3S4R A;  3AE7 C;  4DT0 A;  3CMA P;  3CI9 A;  1IFI A;  2IZ1 A;  1YQ4 C;  2IPP A;  4I6M C;  1ZV8 A;  2N1T A;  1PP9 D;  1IFN A;  2L91 A;  1WT6 A;  1KYO H;  3CCU P;  2A06 E;  2O1J A;  1VPC A;  2ZFC A;  3PTZ A;  2QJP B;  2PRR A;  3RK2 D;  4PD4 D;  3L75 G;  1VF5 D;  2FXM A;  3BAS A;  3E1I A;  4WY4 A;  1M1J B;  1FJK A;  4B86 A;  4Y28 J;  1W2B O;  2C9L Y;  1L0N K;  1LTJ C;  3KPE A;  3PH0 A;  3D6Y A;  2H43 A;  2K9J B;  2WSF H;  3N7N A;  1NGM B;  5KLV J;  3HD7 D;  1EZV I;  5B66 H;  5BU8 B;  3EFF K;  1NU1 E;  3PHL A;  2IYP A;  4IL6 X;  2E5T A;  3JSV C;  3CCV P;  3A3Y B;  3C8V A;  1FZG A;  1SQV G;  2QJK C;  3KZI E;  2FFD C;  1G2C B;  1QLE D;  3P8C E;  3CPW O;  4HYT B;  4ZNC A;  3L4F A;  1RF1 C;  3L36 A;  3SWF A;  1LTJ B;  2OYI A; 
#chains in the Genus database with same CATH homology
 2BCC J;  1SQX J;  1L0N J;  1L0L J;  3BCC J;  3H1K J;  3L74 J;  3CX5 I;  1EZV I;  3H1L J;  3L72 J;  1SQP J;  1SQB J;  1PP9 J;  3CWB J;  3H1H J;  1BCC J;  1SQQ J;  2FYU J;  3L73 J;  3L70 J;  3CXH I;  2IBZ I;  1KYO I;  4PD4 I;  3L75 J;  4D6T J;  1NU1 J;  4U3F J;  3L71 J;  3TGU J;  3H1J J;  1NTK J;  1P84 I;  1BGY J;  3H1I J;  1BE3 J;  1NTM J;  1KB9 I;  1NTZ J;  5KLV J;  1SQV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...