3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
2Y0EA 2N3BA 2AI5A 3O5CA 2CE0A 1RAPA 1U74B 5CIFB 3O1YA 4IL6V 2N9JA 5CICB 1N15A 5B5EV 3OCDA 1SQPD 3SWSA 1LC2A 3OA8B 1MZ4A 2RN0A 5CIDB 1I6DA 1GKSA 2ZOOA 3CXHW 1E8EA 3L74D 1DVVA 3ITKA 4K3IA 3H1KD 3PH2B 1C6SA 4O1WA 2B10B 1AOFA 1CYIA 3KZIV 1CRYA 3PXSA 5E79V 2N18B 1CRIA 1H32A 2ZBOA 2GIWA 2LIRA 1CTZA 4WQ8A 1QN2A 1A56A 1BGYD 1LMSA 4FB1A 1GU2A 1NMIA 1NTZD 1EZVD 3X39A 4DY9A 1NTMD 2C1VA 4WQ7A 3RN1A 1C2RA 5B66V 3TDKA 1VYDA 2BLFB 1NU1D 1IO3A 1NIRA 5KLVD 2C1DA 1HZUA 1LS9A 5DJQB 5C0ZA 1KX2A 3PRJA 3L4MA 1I55A 1FI3A 4FA9A 5B6QA 1IRWA 2CE1A 4O1QA 5AURA 4EICA 3VMAA 2JTIB 3ZIYA 1GIWA 1CSWA 3KHUA 3SXTA 3O0RC 4AAOA 1CC5A 3WFEC 2LITA 3H1JD 1FI7A 2B4ZA 4QAOA 2QJKB 2AXTV 1U75B 3CP5A 2BH5X 2BGVX 3H1ID 3ZOOA 4WQAA 2KNCB 1HROA 3PTZA 2JQRA 3VYMA 1BE3D 2BCNB 3ORVA 1CYJA 1A2SA 4H0KA 2N18C 4FANA 1H33B 1E2RA 4AANA 5CIBB 3HQ7A 1I8PA 1GJQA 4GEDB 1CHIA 1FCDC 2AIUA 1A8CA 5H2FV 4XXLA 1F1CA 1DIQC 5KAFV 1NTKD 2BCCD 5CIGB 2C9XB 3A0BV 1CYCA 5DJQC 1OAEA 4WQ9A 1PPJD 2QJYB 1HCMA 2CA3B 3PXTA 1ETPA 4D6TD 1DIIC 4L1QA 2Y0CA 2C2CA 1C7MA 1N9CA 1YCCA 1R0QA 3ZOWA 3WC8A 2GC4D 1L0ND 1L9JC 4MU8A 4PJ0V 4Q5PA 4YE1A 1N50A 1CIHA 3ZBMA 2O3JA 2YK3A 5CIHB 3O20A 4EIEA 1CSVA 2YQBA 1CRGA 1N90A 3TYIA 4WQDA 3GW6A 3ZCFA 1S6VB 1CXCA 3A0HV 5GTHV 1AOQA 1CIEA 5GTIV 1KYOW 2FWLA 3WU2V 2KS1A 1CSXA 1L0LD 1FHBA 4LJIA 4EIFA 1BL9A 3OCDB 3CYTI 1HRCA 2DVHA 1CTJA 1QL3A 2A06D 2MTAC 1H1OA 1M70A 1J3SA 5DF5A 1LC1A 3DMIA 1COTA 4EIDA 3L72D 1KB0A 1ZRTD 3RLMA 1B7VA 1C75A 3A9FA 1CHJA 1K3HA 3CU4A 3SJLA 1DVHA 1F1FA 1IZL0 1FI9A 2PCBB 5DFSA 3L4OA 4Y5RA 4U3FD 4UB8V 2GC7D 3CWBD 1H33A 4AX3A 2ZXYA 1RAQA 1CIFA 1FOCA 2C8SA 1RZ5A 4PW9B 1HJ5A 3WFBC 1C2NA 3MK7B 1RZ6A 1BCCD 2YIUB 1K3GA 2N9YB 1SQBD 1YEAA 2CA4B 2PACA 1CCHA 1NMLA 2C1UA 1SQVD 3TGUD 1DW1A 3L73D 4V2KA 1HH7A 1P84D 155CA 4AALA 1CORA 3DR0A 3SLEA 4KMGA 1H31A 4J20A 3DP5A 2Q3EA 2VHDA 1S5LV 1SQQD 1ZZHA 4WQBA 3CXHD 3L71D 1I54A 4RSZA 2QJPB 3OA8A 2I8FA 4L3GA 4AAMA 2Y0DA 1WVEC 4H0JA 1PP9D 4L3HA 1KB9D 2OZ1B 2DGEA 451CA 3H1HD 4RJTA 4GYDA 3NBTA 5TISV 1W5CT 2HV4A 4A7PA 1LFMA 2N3YA 1CXAA 3NBSA 1GDVA 2V07A 1YTCA 2ZONG 1IRVA 1H9XA 2YCCA 1I6EA 5TJHA 2GB8B 1CRCA 3CX5W 4FA4A 3MK7C 3NWVA 2B0ZB 1CO6A 2L4DA 2N9IA 1NNOA 1YEBA 3RN0A 1H9YA 1C6RA 4JCGA 1CSUA 1DW2A 1E29A 3HQ9A 1CTYA 5EXQA 3ZOYA 2D0SA 2ZZS1 4FA1A 1FJ0A 1SQXD 3BCCD 2MHMA 1L9BC 3C2CA 3PHLA 2BH4X 3WFDC 1M6ZA 3L70D 2L91A 1I8OA 3M97X 1H32B 2V08A 1QYZA 1MG3D 1YICA 1W2LA 2CXBA 1EB7A 3GG2A 4PD4D 3ZOXA 4NFGB 1QKSA 1M60A 2RMZA 1CRHA 1AKKA 3JBTB 3VRDA 1CRJA 2IBZD 4FAVA 2QG4A 1CEDA 1DT1A 351CA 1CNOA 5KLIB 1HJ3A 1DW3A 5CIEB 4WQCA 1YIQA 1C52A 1JDLA 2B11B 2C1DB 1HJ4A 3HQ6A 1KV9A 5IY51 2FRCA 1QL4A 2EXVA 1IQCA 3WUIA 5KKZB 4FA5A 2B12B 2ORLA 3RMZA 3WFCC 3H1LD 1I5TA 1WEJF 2OZ1A 4EDFA 1KIBA 1AYGA 5C9MA 3PLNA 3HQ8A 2FYNB 4UB6V 1YFCA 2JWAA 2PCCB 5CYTR 4WQEA 2XTSB 2K9JB 1CCRA 2BPBB 3CX5D 4PWAA 3SVWA 1CHHA 3VNWA 1HZVA 4P4QB 3L75D 1CIGA 3PXWA 3TF5A 2FYUD 4N0KA 3FWLA 1GQ1A 1YNRA 2D0WA 4XYDB 1KYOD 1OCDA 1MG2D 1DW0A 5KAIV 1KX7A 1C6OA 1H31B
chains in the Genus database with same CATH superfamily
3HTKA 1U74B 1T3JA 3CCJP 5CICB 1N15A 3BCCE 1DX7A 2YXRB 1R8EA 1GKSA 3AE2C 1BDCA 1E5WA 1E8EA 3P7KA 2JKVA 3PH2B 1S5LH 4PD4E 4ASVA 1U57A 3KZIV 5APYA 4OWFA 1AV1A 2UWJE 3KPEA 5GTHE 3A0HE 5C39A 4I2LC 3NTNA 3BCCJ 4HB1A 1GU2A 2ITAA 1QLED 1SQBE 4DY9A 1NTMD 1C2RA 5TISH 3RK3C 2BLFB 3H1LE 4JPZB 1IO3A 3L74G 1HH0A 5KLVD 5DJQB 1KX2A 1KYOI 4FA9A 4AYCA 4YTPC 1CSBA 3BRTB 1S5LX 4H44C 3V4QA 1H8AA 2J59M 1GIWA 1PP9E 2KZIA 3RBXA 3CPWO 1EXIA 1SQBJ 4AAOA 5CMZA 5CCHD 3BCCG 2LITA 3B71A 3O6QB 2K1AA 1S9KD 1JCDA 1A02J 3H1LJ 2HODB 4C46A 3MP7B 5AW5B 3CP5A 4GOFA 1D7MA 1WRGA 2JO1A 2YMYA 1EDJA 5BU5A 3HUSB 1VQOP 1GL2C 5APUA 1CYJA 2N18C 1DEBA 3MHVA 2BASA 1KTMA 2WMMA 1E2RA 3NXSA 4RKUJ 3HD7D 5H2FE 5H2FV 4XXLA 1EZVI 3PJSK 2QIWA 1DIQC 2KZJA 3H1LG 2HPCB 1GZLA 1IFMA 3A0BE 3A0BV 1LJ2A 2OYOA 1IO4A 1CYCA 4W7YA 1NTKK 2XV5A 2Q6QA 1SFCD 4L1QA 3KDPB 2PAJA 2C2CA 1HUCA 4ASWA 4WWIA 3H32A 1OW6A 1FZBA 4YE1A 4GOEA 4PV1D 3MUDA 1L0NK 1CSVA 1JY3N 2IPPA 3CL3D 2W27A 3BASA 2M3BA 1LTJC 1T8ZA 2E76D 1N90A 1KILB 4WQDA 2R44A 4RO0A 1EDIA 1CXCA 2WPQA 3OAKA 2XNXA 2FYZA 2NRGA 5GTIV 3V5BA 3RK3D 2FWLA 4B86A 1NTMJ 1S2EA 4EIFA 5KJ7D 3OCDB 3CYTI 2B87A 3P32A 1HRCA 1QVFO 1OVRA 3S4RA 5KLVJ 3AE8C 3CLQA 5APVA 2A06D 2IFMA 5CCGD 3O6QA 1NVOA 1M70A 3AE6C 3CMEP 2ZYAA 1LC1A 1KN7A 2WSSH 4Y99C 4EIDA 3L72D 5APXA 1ZOYC 1B7VA 2QJYC 1FZCA 1FJPA 2JWDA 3VMYA 3CU4A 3SJLA 2PFXA 3HUSA 2R5DA 4R4LA 1DVHA 3V6IA 2PCBB 3L4OA 2OTJP 4Y5RA 1L0LG 4BRYB 2IZ1A 1NTMG 4LC1A 2GC7D 4PD4H 4IFFA 1QL2A 2B9BA 2FXOA 4AX3A 1RAQA 1RE4C 1RZ5A 1HJ5A 3MK7B 3RL0g 1K9MQ 5KLVG 1RZ6A 1JOCA 5GTHH 3A0HH 1BCCD 1K3GA 2J5UA 2CA4B 2K9YA 3Q3DA 1CCHA 3VN0A 5AW9B 1BDDA 1KV4A 2M0BA 5APQA 3SLEA 4JF7A 4KMGA 3VMZA 1LTAC 2IZ0A 2OARA 4DZOA 1SQQD 3QH9A 2V7QJ 1ZZHA 3B5NB 2YNYA 2FXMA 1I54A 1GD2E 1FZAA 2Y0DA 3QWOC 1M57D 1PZQA 1KB9D 3AE7C 451CA 1JY2P 3C9IA 4RJTA 4GYDA 3RGUA 5AVZB 1HJBA 1PIXA 1S3JA 1N86A 2ZT9C 3RK3E 2ZYDA 3CCUP 1LFMA 1KILA 1T2KC 2W90A 1CXAA 1U7MA 3NBSA 3E1RA 1L2PA 2Q1KA 3U1AA 1H9XA 5TJHA 2A06E 2GB8B 2L5GB 5CBOA 3CX5W 3SSUA 4FA4A 1J2JB 4WY4C 3L72E 2N1TB 4M3LA 1YI2P 1K05A 1ZP0C 5H2FH 3EQ2A 1E29A 2O1KA 2AEMA 3LIDA 3CC4P 1VQPP 1CTYA 1H0TB 3I55P 3ZOYA 1URQC 3A0BH 3CXHI 1FJKA 4FA1A 3D71A 1SQXD 2KSEA 2H8PD 1BCCE 1L9BC 4BRYA 2E75B 1CZQA 2BH4X 2OYIC 3WFDC 3L4FA 3L70D 3L72J 2C9LY 1H32B 3IF4A 1LTTC 1OWAA 2HYNA 4NFGB 1QKSA 3T97B 4LLHA 3RL0C 2IBZD 4FAVA 1HWTC 1CNOA 5KLIB 1HJ3A 4WQCA 1BCCJ 1KB9E 2C1DB 3FX0A 3B5NA 5GTIH 1YHQP 2B12B 4D6TE 3HRNA 2OTLP 3I56P 1PV3A 1LWUC 1KIBA 1AYGA 3IN6A 1L0NE 3D6YA 1EDLA 3HQ8A 2FY8A 2FYNB 1N2DC 4UB6V 4UB6E 1DH3A 1DD4A 3JC22 2PCCB 1W2EA 2XTSB 2ZT9D 1CCRA 2LXCB 1HVVA 1BCCG 2I8DA 1LTIC 1H88A 1JMBA 2K88A 1J1DB 1JCCA 3TF5A 1FZFA 3FWLA 1GQ1A 3AEBC 4N3YB 2FFDC 2V7QH 5KAIV 5KAIE 1C6OA 1H31B 4N6JA 1N7SC 1NAYA 2Y0EA 3D6ZA 1SQQG 3G4SP 2WVRA 3RK2B 2W6AA 1RAPA 1VQ5P 5CIFB 1G1JA 3WUVA 2FKWB 3VP9A 1DIPA 2N9JA 2YMKA 5B5EE 5B5EV 1SQXE 4ZMDA 3OA8B 1OVVA 3WUUA 3KXDA 2A45H 3L70E 3SFEC 1H0TA 3L74D 1DVVA 1JY2O 3ITKA 5BU8B 1URQD 1K73Q 1HGVA 2B10B 2P58A 2XKMA 1CRYA 3PXSA 3AECC 2N18B 2E43A 1H32A 2ZBOA 2GIWA 2LIRA 3FWNA 2IBZE 1QN2A 3P8MC 4LGDE 1A56A 1SQXJ 1NTZD 1RH5B 4HH2A 2H89C 3T97A 4RESB 2KI7B 3L70J 3FGAD 1VQ4P 2IDBA 2C1VA 1RHZB 2WPRA 2M8RA 3TDKA 3RL0D 1NU1D 4U7JA 1NTMK 1Q2NA 3S1KA 2C1DA 2KIKA 1HZUA 5C0ZA 2KS1B 1Q86Q 1I55A 1FI3A 1MFZA 3AE5C 2E74C 2PGDA 2P7JA 2CE1A 5KLVK 2C9NY 4O1QA 5AURA 1XTCC 3CCQP 3KQGA 4EICA 3VMAA 2JTIB 3ZIYA 1FDOA 1VL2A 4WBAA 3SXTA 3O0RC 4DT0A 3A5TA 1T3UA 1SQXG 2A45I 2WQYC 1VQ8P 4ZKPA 1ZW0A 4QAOA 2KLVA 3L70G 5DJTB 2QJKB 1NJIQ 5CCHC 1JNMA 2BH5X 2BGVX 1LTJB 1M1JB 4WQAA 1MKMA 3BATA 3U1CA 4WB4A 1RE3C 1HROA 3PTZA 3IAOA 1FOSE 2BCNB 4H0KA 1HTLC 5AVUB 4FANA 4BXLA 3HQ7A 1GJQA 5M1BA 1FCDC 1F1CA 2YKPA 2W8ZA 3M0DC 4H0LC 3L74E 1USDA 4H13D 4IOIH 3TSIA 1TU3F 5KAFE 3D0WA 5KAFV 1N73B 3HD7C 2BCCD 1Y47A 4I7ZC 2C9XB 1G2CB 4L73A 4Y99B 4WQ9A 4GIFA 2QJYB 1KD1Q 3D70A 2CA3B 3PXTA 1ETPA 1KB9H 3M06A 3V2NA 1IC2A 2Y0CA 1C7MA 1NTZE 1U7JA 1JEKA 3CC7P 2GC4D 1SFCC 3L74J 4ZNCA 3GHGB 3ZBMA 3L35A 2O3JA 2YK3A 5CIHB 4EIEA 2IYOA 2BEZF 2YQBA 3CCSP 2XNDH 3KYQA 3AEAC 1CRGA 1RF0A 1S72P 1Q81Q 1RQVA 4UB6H 4PV1C 1VQLP 2WSFJ 5GTHV 3A0HV 1LTBC 2ZXEB 1CIEA 1OZHA 2E76C 1NTZJ 3HE4A 1KYOW 1KMIZ 2DW3A 2KS1A 1CSXA 3SWYA 1L0LD 2O01J 1LP1B 3SWFA 4LJIA 3B5ND 2KSJA 1BL9A 1G1IA 2GUSA 2WWWA 2E74D 1XTGB 5KAIH 5AW8B 3CMAP 5KJ7C 3E7KA 1VQNP 3H25A 4DJGA 5B5EH 3DMIA 1COTA 2WSCH 3V2PA 1M56D 1LTJA 3RLMA 1M1JA 5CCGC 2H43A 1ZMEC 1CHJA 1K3HA 2WPVB 1NTZG 3CX5E 3CCEP 1LT1A 1HJ0A 3OA7A 2YO2A 1IK9A 1JM0A 2E5YA 3M9HA 4L76A 1CIFA 1FOCA 1NU1G 2GUVA 3WFBC 2K3RA 4WY4B 2YIUB 1SS1A 2HR3A 2I1KA 4KT0J 4KJMA 4WVZA 1N73A 4H0LD 4OH8B 1ZXGA 4IFDK 1P84D 3K5BA 1G2CA 4J20A 3E1IA 2Q3EA 1Q82Q 2M5AB 3L71D 2BCCJ 2QJPB 1GK4A 4AAMA 1SQQK 2E75D 3AE1C 1VQ6P 3H1HD 3GHGA 1PGQA 2QA4P 3WMM0 1W5CT 1L0LE 1IFJA 1NTME 2W6JH 2LXBA 2D2CD 2V07A 1GK6A 1FE6A 4OGQD 1IRVA 5KLVE 1I6EA 2BCCG 1VPCA 3NWVA 1CO6A 2L4DA 2PRRA 1LWUB 1SVFA 2WTYA 3MGNA 1C6RA 4JCGA 1L0LJ 1GU5A 3P8CD 4YXDC 1DW2A 1VQKP 5KAFH 1S9KE 5APTA 5EXQA 3MTUE 1FJ0A 2WSFH 1L4AD 3PHLA 2JEEA 2OTKE 1S1CX 2HODA 3G71P 3M97X 1SQXK 1OFCX 2V08A 4KHXA 1QYZA 2FFDB 1P84E 3R2PA 1M60A 3C1LA 2YKOA 4EYYQ 3H6PA 2RMZA 3Q5PA 3L71E 2AEJA 1EXJA 2NPSB 351CA 4I1LA 1DW3A 1C52A 2M5AA 1JDLA 4QMAA 3H1HE 2OYHB 1BSHA 2FRCA 1QL4A 1IQCA 3TNUB 3WFCC 1YYCA 2HPCA 2KXPB 1NH4A 1WEJF 2WT7B 1IFPA 3W67A 4Z1MH 3L71J 4R4MA 3V2QA 1HF9A 2JWAA 1FZGA 2K9JB 4DCKA 3H1HJ 1Y8AA 1PL5A 4HKZH 2KP8A 1CHHA 3MUDC 2BEQD 3L75D 1CIGA 1GW3A 3A3YB 2FYUD 4N0KA 2GA1A 1Q90D 3CX5H 1NGMB 1KYOD 1PGJA 1OCDA 1MG2D 1DW0A 5CJ0A 4PD4I 1KQLA 1LWUA 3G3ZA 5L8RJ 2N3BA 3AEGC 1BSNA 3L71G 3O1YA 3OCDA 1SQPD 1LC2A 2YXQB 1A02F 2C0WA 1MZ4A 5CIDB 1I6DA 2IX7C 3AE4C 3L37A 3H1HG 2QSIA 3CXHW 1VDFA 4PJ0E 4JQ0D 3C8VA 4K3IA 3H1KD 1YJ9P 4K35A 1AOFA 1CYIA 4YXWH 1X8YA 1CRIA 1FZCC 1NHLA 1VQ9P 1SP4A 4HJGH 3HUSC 2Z5HA 1NMIA 1M8OB 3A7OA 1EZVD 2JDIH 5AW0B 2JR8A 3V2RA 1H89A 1VF5D 1HBWA 3RN1A 1KC8Q 1NTZK 5B66E 5B66V 1YJNP 2NPSA 3CX5I 1VYDA 1NYHA 2P2UA 2ZFCA 2R32A 2IYPA 2OYHA 1NU1K 1SQQE 2RH0A 3TNUA 1FU1A 4C7RA 2WT7A 1JY3P 1CSWA 3KHUA 3WFEC 1SFCB 3H1JD 2ZYGA 1FI7A 2B4ZA 1QVGO 1U75B 2CPSA 1J1EC 1KYOE 1OW8A 2K9JA 3ZOOA 2KNCB 1SQQJ 2CK3H 1BE3D 3ORVA 3GLMA 1A2SA 1KILC 2Q5UA 2J58A 3AEDC 5CIBB 1SQPE 3IR9A 1I8PA 4OVNF 3RK3B 1P84H 1A8CA 3L75J 2NZ2A 2FYUJ 2QRXA 3H1KE 4XE5B 1QX8A 5CIGB 1OMIA 4H44B 4H13C 2N1TA 1OAEA 1VQMP 3W68A 2KYVA 1PPJD 3FXDA 1HCMA 1SQPJ 2WZ7A 4GDOA 1EZVE 1YCCA 1R0QA 3WC8A 3II6A 1IK7A 1YTZI 1L9JC 4Q5PA 1N50A 1CIHA 3H1KJ 3L75G 2FYUG 2QVAA 1GL2B 4W7ZA 5AVTB 3M0DA 3TYIA 1N8RQ 3ZCFA 2OGUA 3CCVP 3SWKA 2FBWC 1FS0E 1FHBA 1SQPG 5APSA 3H1JE 2QEXP 5AVVB 3BRVB 1VQ7P 3AEFC 1KORA 1L0LK 1WT6A 3Q5SA 2QE7H 1QL3A 3Q5RA 3B5NC 3H1KG 2MTAC 2XZRA 3U59A 2ZVNB 1BE3E 1J3SA 2JJLA 1EQ7A 2N9BA 5APWA 1ZRTD 1C75A 3GMAA 2KNCA 3MD0A 1PGOA 2KLUA 3G9RA 3H1JJ 4PJ0H 1EZVG 3N7NA 5EFWB 1AFOA 1M90Q 3CWBD 3OW2O 1KILD 1GDTA 4C7NB 2M3EA 1BE3J 2N9YB 5AVYB 1SQBD 1NMLA 1SQVD 3TGUD 1K04A 3O8ZA 2Z5IA 3AE9C 1DW1A 4V2KA 1HH7A 1X79B 155CA 1CORA 1JUNA 3DR0A 1MUUA 1LGHB 5B66H 1H31A 3DP5A 1JY3O 2VHDA 2LKMA 3H1JG 2QM8A 3CXHD 2ZXXA 1NKNA 4U3FG 1AVYA 3OA8A 1LT9C 2R3SA 1PP9D 2G8YA 2OZ1B 2DGEA 3JSVC 1OXZA 5CJ4A 1BE3G 2E75C 1GL2A 3PP5A 2XDJA 3NBTA 1LTSC 2HV4A 2H7HA 1KYOH 2NPSD 1YTCA 1NU1E 5AVXB 2YCCA 3F89A 5DJUB 2D2CC 1KQGB 5KLIC 4OGQC 2N9IA 3BVHA 1YEBA 1PPJG 1H9YA 1ZRTE 4L74A 3PH0A 3VMXA 1CSUA 1W5CE 3KZIE 3NFQA 3V4WA 3CWBE 1NU1J 3CCMP 3N4XA 4HYTB 2B89A 1FZEA 3H32B 1X9VA 2D0SA 2FYNC 1KILE 1KFMA 1R5SA 5AW3B 4JYCA 1OVUA 3C2CA 4MN4C 1Z56A 1EC5A 2ZT9B 1KB9I 1SQVE 1I8OA 3TGUE 3JCUE 5AVRB 3EWKA 2WITA 4C7NA 1L4AC 1MG3D 1YICA 1J1DC 4NPEA 2HG5D 4NPFX 2KB7P 3CCRP 1NWQA 3VOPA 5AW4B 1IZNB 1JY2N 3CWBJ 3CXHE 1AKKA 3VRDA 2B87B 2QG4A 1CEDA 2BCCE 5CIEB 1RF1C 1UIIA 3RK2C 1MV8A 3EFFK 2B11B 5AVSB 5AW2B 2N1TD 3HQ6A 1KV9A 5IY51 1SQVJ 3TGUJ 3WUIA 4FA5A 3RMZA 4O9BA 4N78D 4JYBA 2OZ1A 1FZCB 1GU4A 3PLNA 1URQB 1YIJP 3CWBG 1SLQA 3ABVC 2OYIB 1PP9J 5CYTR 1AVOA 2BPBB 4CPGA 1AQTA 3TK1A 1RE4A 1SQBG 5AW6B 1LTGC 1HZVA 4P4QB 5K5GB 1SQVG 3TGUG 1RF0C 1CI6B 1DD3A 3RL0B 1KX7A 3UIAA 2FYUK 3O5CA 2AI5A 3HE5B 2CE0A 5CHXA 1EDKA 3NMDA 1LP1A 4IL6E 4IL6V 3SWSA 2IBZI 1PP9G 1S4XA 3CCLP 2RN0A 4BWNA 1AA0A 3SFDC 2ZOOA 4EOTA 1SQPK 1IFDA 3LW5J 1J1EB 5KKZC 2WSEJ 3F5HA 1C6SA 4O1WA 2QJKC 2O1JA 1QEXA 4L75A 5E79E 5E79V 3VP8A 1M1JC 3VYIA 4TLFA 1KQSO 1CTZA 4WQ8A 2W83C 2Y9ZA 1MFTA 1BGYD 1LMSA 4FB1A 1N7LA 4GODA 2LR2A 5GTIE 1ZR4A 4GT1A 3X39A 1W2BO 1Q7YQ 1YBKA 1FDIA 3Q2YA 4WQ7A 3MZWB 3AE3C 2O01H 1FOSF 4N78E 4WY4A 5KTBA 1NIRA 4H44D 1VF5C 2CPBA 1N7SB 4H13B 2HFED 1LS9A 3PRJA 1N73C 3RK2D 3L4MA 5B6QA 1IRWA 1E79H 2MJZA 2C0XA 2Z4EA 3AEEC 2YO3A 1CC5A 1URQA 2HLOA 1ZLLA 1ZR2A 2I1JA 1GL2D 2OYIA 2AXTE 2AXTV 3KZIH 4Y28J 3H1ID 2IFNA 1KQFB 3GHGC 4TT3H 2JQRA 3VYMA 1FBMA 3S9OA 1NKZB 5CBNA 3FXEA 1NO4A 1CI6A 1H33B 4AANA 2P67A 3JCUH 4GEDB 2KUBA 1CHIA 2AIUA 1USEA 3HE5A 2P1JA 4EIJA 2KK7A 2Y9YA 3P8CE 3M9QA 1RQUA 4NPDA 1NTKD 3EFGA 3CXHH 2E74B 3LIEA 1JB0J 1RY3A 5DJQC 2P10A 3USSA 4AQRD 1YTZT 4D6TD 1DIIC 1BGYE 1N9CA 3ZOWA 3ZDMA 1L0ND 2OQQA 4MU8A 4PJ0V 2JP3A 4YPCA 2R5BA 2ZJSE 2WPSA 3B4SA 3O20A 1HGZA 4IFMA 3GW6A 2FFDA 1ZN5A 2B88A 1S6VB 4DOJA 1AOQA 2YIUC 1DEEG 1BGYJ 2AXCA 1N7SA 3WU2E 3WU2V 1LNQA 2RKLA 1QL1A 2A45G 1R5LA 4H0LB 3LW5H 2E5TA 3GF7A 2YKQA 3IFMA 1AQ5A 2WSEH 5AW7B 3HD7B 2DVHA 1CTJA 1LT9B 1K8AQ 4XA4A 4I7ZB 3L36A 3H1IE 3GF3A 2G3AA 2SPZA 2QJPC 1H1OA 2O01N 1FC2C 5DF5A 1MZ9A 4IL6H 3A2AA 4JBZA 1KB0A 1NOHA 3A9FA 1JTHB 1UIXA 1BGYG 2QM7A 1YITP 1F1FA 1IZL0 1FI9A 5DFSA 3RBZA 3M91A 2Q3IA 4U3FD 2E42A 3L75E 4I6MC 4K3AA 4UB8V 4UB8E 1GW4A 4ZKUA 2FYUE 2ZAEB 1H33A 3H1IJ 1FDMA 2D2CB 5E79H 2ZXYA 1NTKE 2C8SA 4PW9B 4PV1B 1ZV8A 1C2NA 3CD6P 4OGQB 2A06G 3OJAB 1YEAA 2E76B 2PACA 3I5CA 2C1UA 1JO5A 3L73D 1SQBK 3L72G 4AALA 1X0TA 1QGKB 1SQVK 4IL6X 3M0AA 1S5LE 1S5LV 4WQBA 2VRSA 1AJYA 4RSZA 1NTKJ 2I8FA 4L3GA 1WVEC 4H0JA 1YQ3C 3H1IG 4L3HA 5CCHA 3CI9A 1L4AB 5AVWB 1T2KD 4D6TJ 1RE3A 1YJWP 4GKGA 5TISE 5TISV 4A7PA 1L0NJ 2AXTH 2N3YA 5BVZA 1GDVA 1OX3A 1T6AA 2ZONG 1RF1B 1OIPA 4WY4D 3M9BA 4AUWA 1NTKG 1CRCA 2NPSC 2XU6A 2W6BA 3MK7C 3HD7A 1IFIA 1LT9A 2B0ZB 1PGPA 1NNOA 3RN0A 2OYHC 3HTKB 2K37A 4D6TG 1X22A 2PP6A 1M7LA 1P84I 4U3FE 1L0NG 3HQ9A 1OW7A 1JTHA 2AEFA 1SFCA 2ZZS1 1NAFA 1CW5A 2WSCJ 3BCCD 5AVQB 2MHMA 1M6ZA 2KOGA 2L91A 3L73E 3R4YA 1W2LA 2CXBA 1EB7A 1Y9BA 3GG2A 4PD4D 3ZOXA 1FAVA 3HE4B 1GMJA 4U3FJ 2Q9IA 1CRHA 2R3CA 3JBTB 1CRJA 1DT1A 3B8EB 1YIQA 2FXPA 1HJ4A 5KJ7A 1PPJE 2EXVA 5KKZB 5AW1B 3WU2H 3L73J 3WUTA 2ORLA 4XFJA 2H88C 3VTPC 1KFNA 3H1LD 1PFIA 1I5TA 2N1TC 2Q7CA 4EDFA 5C9MA 1KZUB 5CCGA 1L4AA 3Q1MA 2POHA 1YFCA 2IBZG 1YQ4C 4WQEA 2ZVOB 1JMMA 3G6EP 3CX5D 4PWAA 3SVWA 4EI2A 2GM4A 3VNWA 1RF1A 4W80A 1M1KQ 3PXWA 1WMKA 1VF5B 1GTWA 3TYYA 1N7SD 3L73G 1YNRA 2D0WA 4XYDB 4UB8H 2MKVA 3MIWA 2V4HA 3CC2P 1IJDB 1IFNA
chains in the Genus database with same CATH topology
2Y0EA 2N3BA 2AI5A 3O5CA 2CE0A 1RAPA 1U74B 5CIFB 3O1YA 4IL6V 2N9JA 5CICB 1N15A 5B5EV 3OCDA 1SQPD 3SWSA 1LC2A 3OA8B 1MZ4A 2RN0A 5CIDB 1I6DA 1GKSA 2ZOOA 3CXHW 1E8EA 3L74D 1DVVA 3ITKA 4K3IA 3H1KD 3PH2B 1C6SA 4O1WA 2B10B 1AOFA 1CYIA 3KZIV 1CRYA 3PXSA 5E79V 2N18B 1CRIA 1H32A 2ZBOA 2GIWA 2LIRA 1CTZA 4WQ8A 1QN2A 1A56A 1BGYD 1LMSA 4FB1A 1GU2A 1NMIA 1NTZD 1EZVD 3X39A 4DY9A 1NTMD 2C1VA 4WQ7A 3RN1A 1C2RA 5B66V 3TDKA 1VYDA 2BLFB 1NU1D 1IO3A 1NIRA 5KLVD 2C1DA 1HZUA 1LS9A 5DJQB 5C0ZA 1KX2A 3PRJA 3L4MA 1I55A 1FI3A 4FA9A 5B6QA 1IRWA 2CE1A 4O1QA 5AURA 4EICA 3VMAA 2JTIB 3ZIYA 1GIWA 1CSWA 3KHUA 3SXTA 3O0RC 4AAOA 1CC5A 3WFEC 2LITA 3H1JD 1FI7A 2B4ZA 4QAOA 2QJKB 2AXTV 1U75B 3CP5A 2BH5X 2BGVX 3H1ID 3ZOOA 4WQAA 2KNCB 1HROA 3PTZA 2JQRA 3VYMA 1BE3D 2BCNB 3ORVA 1CYJA 1A2SA 4H0KA 2N18C 4FANA 1H33B 1E2RA 4AANA 5CIBB 3HQ7A 1I8PA 1GJQA 4GEDB 1CHIA 1FCDC 2AIUA 1A8CA 5H2FV 4XXLA 1F1CA 1DIQC 5KAFV 1NTKD 2BCCD 5CIGB 2C9XB 3A0BV 1CYCA 5DJQC 1OAEA 4WQ9A 1PPJD 2QJYB 1HCMA 2CA3B 3PXTA 1ETPA 4D6TD 1DIIC 4L1QA 2Y0CA 2C2CA 1C7MA 1N9CA 1YCCA 1R0QA 3ZOWA 3WC8A 2GC4D 1L0ND 1L9JC 4MU8A 4PJ0V 4Q5PA 4YE1A 1N50A 1CIHA 3ZBMA 2O3JA 2YK3A 5CIHB 3O20A 4EIEA 1CSVA 2YQBA 1CRGA 1N90A 3TYIA 4WQDA 3GW6A 3ZCFA 1S6VB 1CXCA 3A0HV 5GTHV 1AOQA 1CIEA 5GTIV 1KYOW 2FWLA 3WU2V 2KS1A 1CSXA 1L0LD 1FHBA 4LJIA 4EIFA 1BL9A 3OCDB 3CYTI 1HRCA 2DVHA 1CTJA 1QL3A 2A06D 2MTAC 1H1OA 1M70A 1J3SA 5DF5A 1LC1A 3DMIA 1COTA 4EIDA 3L72D 1KB0A 1ZRTD 3RLMA 1B7VA 1C75A 3A9FA 1CHJA 1K3HA 3CU4A 3SJLA 1DVHA 1F1FA 1IZL0 1FI9A 2PCBB 5DFSA 3L4OA 4Y5RA 4U3FD 4UB8V 2GC7D 3CWBD 1H33A 4AX3A 2ZXYA 1RAQA 1CIFA 1FOCA 2C8SA 1RZ5A 4PW9B 1HJ5A 3WFBC 1C2NA 3MK7B 1RZ6A 1BCCD 2YIUB 1K3GA 2N9YB 1SQBD 1YEAA 2CA4B 2PACA 1CCHA 1NMLA 2C1UA 1SQVD 3TGUD 1DW1A 3L73D 4V2KA 1HH7A 1P84D 155CA 4AALA 1CORA 3DR0A 3SLEA 4KMGA 1H31A 4J20A 3DP5A 2Q3EA 2VHDA 1S5LV 1SQQD 1ZZHA 4WQBA 3CXHD 3L71D 1I54A 4RSZA 2QJPB 3OA8A 2I8FA 4L3GA 4AAMA 2Y0DA 1WVEC 4H0JA 1PP9D 4L3HA 1KB9D 2OZ1B 2DGEA 451CA 3H1HD 4RJTA 4GYDA 3NBTA 5TISV 1W5CT 2HV4A 4A7PA 1LFMA 2N3YA 1CXAA 3NBSA 1GDVA 2V07A 1YTCA 2ZONG 1IRVA 1H9XA 2YCCA 1I6EA 5TJHA 2GB8B 1CRCA 3CX5W 4FA4A 3MK7C 3NWVA 2B0ZB 1CO6A 2L4DA 2N9IA 1NNOA 1YEBA 3RN0A 1H9YA 1C6RA 4JCGA 1CSUA 1DW2A 1E29A 3HQ9A 1CTYA 5EXQA 3ZOYA 2D0SA 2ZZS1 4FA1A 1FJ0A 1SQXD 3BCCD 2MHMA 1L9BC 3C2CA 3PHLA 2BH4X 3WFDC 1M6ZA 3L70D 2L91A 1I8OA 3M97X 1H32B 2V08A 1QYZA 1MG3D 1YICA 1W2LA 2CXBA 1EB7A 3GG2A 4PD4D 3ZOXA 4NFGB 1QKSA 1M60A 2RMZA 1CRHA 1AKKA 3JBTB 3VRDA 1CRJA 2IBZD 4FAVA 2QG4A 1CEDA 1DT1A 351CA 1CNOA 5KLIB 1HJ3A 1DW3A 5CIEB 4WQCA 1YIQA 1C52A 1JDLA 2B11B 2C1DB 1HJ4A 3HQ6A 1KV9A 5IY51 2FRCA 1QL4A 2EXVA 1IQCA 3WUIA 5KKZB 4FA5A 2B12B 2ORLA 3RMZA 3WFCC 3H1LD 1I5TA 1WEJF 2OZ1A 4EDFA 1KIBA 1AYGA 5C9MA 3PLNA 3HQ8A 2FYNB 4UB6V 1YFCA 2JWAA 2PCCB 5CYTR 4WQEA 2XTSB 2K9JB 1CCRA 2BPBB 3CX5D 4PWAA 3SVWA 1CHHA 3VNWA 1HZVA 4P4QB 3L75D 1CIGA 3PXWA 3TF5A 2FYUD 4N0KA 3FWLA 1GQ1A 1YNRA 2D0WA 4XYDB 1KYOD 1OCDA 1MG2D 1DW0A 5KAIV 1KX7A 1C6OA 1H31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0E A;  2N3B A;  2AI5 A;  3O5C A;  2CE0 A;  1RAP A;  1U74 B;  5CIF B;  3O1Y A;  4IL6 V;  2N9J A;  5CIC B;  1N15 A;  5B5E V;  3OCD A;  1SQP D;  3SWS A;  1LC2 A;  3OA8 B;  1MZ4 A;  2RN0 A;  5CID B;  1I6D A;  1GKS A;  2ZOO A;  3CXH W;  1E8E A;  3L74 D;  1DVV A;  3ITK A;  4K3I A;  3H1K D;  3PH2 B;  1C6S A;  4O1W A;  2B10 B;  1AOF A;  1CYI A;  3KZI V;  1CRY A;  3PXS A;  5E79 V;  2N18 B;  1CRI A;  1H32 A;  2ZBO A;  2GIW A;  2LIR A;  1CTZ A;  4WQ8 A;  1QN2 A;  1A56 A;  1BGY D;  1LMS A;  4FB1 A;  1GU2 A;  1NMI A;  1NTZ D;  1EZV D;  3X39 A;  4DY9 A;  1NTM D;  2C1V A;  4WQ7 A;  3RN1 A;  1C2R A;  5B66 V;  3TDK A;  1VYD A;  2BLF B;  1NU1 D;  1IO3 A;  1NIR A;  5KLV D;  2C1D A;  1HZU A;  1LS9 A;  5DJQ B;  5C0Z A;  1KX2 A;  3PRJ A;  3L4M A;  1I55 A;  1FI3 A;  4FA9 A;  5B6Q A;  1IRW A;  2CE1 A;  4O1Q A;  5AUR A;  4EIC A;  3VMA A;  2JTI B;  3ZIY A;  1GIW A;  1CSW A;  3KHU A;  3SXT A;  3O0R C;  4AAO A;  1CC5 A;  3WFE C;  2LIT A;  3H1J D;  1FI7 A;  2B4Z A;  4QAO A;  2QJK B;  2AXT V;  1U75 B;  3CP5 A;  2BH5 X;  2BGV X;  3H1I D;  3ZOO A;  4WQA A;  2KNC B;  1HRO A;  3PTZ A;  2JQR A;  3VYM A;  1BE3 D;  2BCN B;  3ORV A;  1CYJ A;  1A2S A;  4H0K A;  2N18 C;  4FAN A;  1H33 B;  1E2R A;  4AAN A;  5CIB B;  3HQ7 A;  1I8P A;  1GJQ A;  4GED B;  1CHI A;  1FCD C;  2AIU A;  1A8C A;  5H2F V;  4XXL A;  1F1C A;  1DIQ C;  5KAF V;  1NTK D;  2BCC D;  5CIG B;  2C9X B;  3A0B V;  1CYC A;  5DJQ C;  1OAE A;  4WQ9 A;  1PPJ D;  2QJY B;  1HCM A;  2CA3 B;  3PXT A;  1ETP A;  4D6T D;  1DII C;  4L1Q A;  2Y0C A;  2C2C A;  1C7M A;  1N9C A;  1YCC A;  1R0Q A;  3ZOW A;  3WC8 A;  2GC4 D;  1L0N D;  1L9J C;  4MU8 A;  4PJ0 V;  4Q5P A;  4YE1 A;  1N50 A;  1CIH A;  3ZBM A;  2O3J A;  2YK3 A;  5CIH B;  3O20 A;  4EIE A;  1CSV A;  2YQB A;  1CRG A;  1N90 A;  3TYI A;  4WQD A;  3GW6 A;  3ZCF A;  1S6V B;  1CXC A;  3A0H V;  5GTH V;  1AOQ A;  1CIE A;  5GTI V;  1KYO W;  2FWL A;  3WU2 V;  2KS1 A;  1CSX A;  1L0L D;  1FHB A;  4LJI A;  4EIF A;  1BL9 A;  3OCD B;  3CYT I;  1HRC A;  2DVH A;  1CTJ A;  1QL3 A;  2A06 D;  2MTA C;  1H1O A;  1M70 A;  1J3S A;  5DF5 A;  1LC1 A;  3DMI A;  1COT A;  4EID A;  3L72 D;  1KB0 A;  1ZRT D;  3RLM A;  1B7V A;  1C75 A;  3A9F A;  1CHJ A;  1K3H A;  3CU4 A;  3SJL A;  1DVH A;  1F1F A;  1IZL 0;  1FI9 A;  2PCB B;  5DFS A;  3L4O A;  4Y5R A;  4U3F D;  4UB8 V;  2GC7 D;  3CWB D;  1H33 A;  4AX3 A;  2ZXY A;  1RAQ A;  1CIF A;  1FOC A;  2C8S A;  1RZ5 A;  4PW9 B;  1HJ5 A;  3WFB C;  1C2N A;  3MK7 B;  1RZ6 A;  1BCC D;  2YIU B;  1K3G A;  2N9Y B;  1SQB D;  1YEA A;  2CA4 B;  2PAC A;  1CCH A;  1NML A;  2C1U A;  1SQV D;  3TGU D;  1DW1 A;  3L73 D;  4V2K A;  1HH7 A;  1P84 D;  155C A;  4AAL A;  1COR A;  3DR0 A;  3SLE A;  4KMG A;  1H31 A;  4J20 A;  3DP5 A;  2Q3E A;  2VHD A;  1S5L V;  1SQQ D;  1ZZH A;  4WQB A;  3CXH D;  3L71 D;  1I54 A;  4RSZ A;  2QJP B;  3OA8 A;  2I8F A;  4L3G A;  4AAM A;  2Y0D A;  1WVE C;  4H0J A;  1PP9 D;  4L3H A;  1KB9 D;  2OZ1 B;  2DGE A;  451C A;  3H1H D;  4RJT A;  4GYD A;  3NBT A;  5TIS V;  1W5C T;  2HV4 A;  4A7P A;  1LFM A;  2N3Y A;  1CXA A;  3NBS A;  1GDV A;  2V07 A;  1YTC A;  2ZON G;  1IRV A;  1H9X A;  2YCC A;  1I6E A;  5TJH A;  2GB8 B;  1CRC A;  3CX5 W;  4FA4 A;  3MK7 C;  3NWV A;  2B0Z B;  1CO6 A;  2L4D A;  2N9I A;  1NNO A;  1YEB A;  3RN0 A;  1H9Y A;  1C6R A;  4JCG A;  1CSU A;  1DW2 A;  1E29 A;  3HQ9 A;  1CTY A;  5EXQ A;  3ZOY A;  2D0S A;  2ZZS 1;  4FA1 A;  1FJ0 A;  1SQX D;  3BCC D;  2MHM A;  1L9B C;  3C2C A;  3PHL A;  2BH4 X;  3WFD C;  1M6Z A;  3L70 D;  2L91 A;  1I8O A;  3M97 X;  1H32 B;  2V08 A;  1QYZ A;  1MG3 D;  1YIC A;  1W2L A;  2CXB A;  1EB7 A;  3GG2 A;  4PD4 D;  3ZOX A;  4NFG B;  1QKS A;  1M60 A;  2RMZ A;  1CRH A;  1AKK A;  3JBT B;  3VRD A;  1CRJ A;  2IBZ D;  4FAV A;  2QG4 A;  1CED A;  1DT1 A;  351C A;  1CNO A;  5KLI B;  1HJ3 A;  1DW3 A;  5CIE B;  4WQC A;  1YIQ A;  1C52 A;  1JDL A;  2B11 B;  2C1D B;  1HJ4 A;  3HQ6 A;  1KV9 A;  5IY5 1;  2FRC A;  1QL4 A;  2EXV A;  1IQC A;  3WUI A;  5KKZ B;  4FA5 A;  2B12 B;  2ORL A;  3RMZ A;  3WFC C;  3H1L D;  1I5T A;  1WEJ F;  2OZ1 A;  4EDF A;  1KIB A;  1AYG A;  5C9M A;  3PLN A;  3HQ8 A;  2FYN B;  4UB6 V;  1YFC A;  2JWA A;  2PCC B;  5CYT R;  4WQE A;  2XTS B;  2K9J B;  1CCR A;  2BPB B;  3CX5 D;  4PWA A;  3SVW A;  1CHH A;  3VNW A;  1HZV A;  4P4Q B;  3L75 D;  1CIG A;  3PXW A;  3TF5 A;  2FYU D;  4N0K A;  3FWL A;  1GQ1 A;  1YNR A;  2D0W A;  4XYD B;  1KYO D;  1OCD A;  1MG2 D;  1DW0 A;  5KAI V;  1KX7 A;  1C6O A;  1H31 B; 
#chains in the Genus database with same CATH topology
 3HTK A;  1U74 B;  1T3J A;  3CCJ P;  5CIC B;  1N15 A;  3BCC E;  1DX7 A;  2YXR B;  1R8E A;  1GKS A;  3AE2 C;  1BDC A;  1E5W A;  1E8E A;  3P7K A;  2JKV A;  3PH2 B;  1S5L H;  4PD4 E;  4ASV A;  1U57 A;  3KZI V;  5APY A;  4OWF A;  1AV1 A;  2UWJ E;  3KPE A;  5GTH E;  3A0H E;  5C39 A;  4I2L C;  3NTN A;  3BCC J;  4HB1 A;  1GU2 A;  2ITA A;  1QLE D;  1SQB E;  4DY9 A;  1NTM D;  1C2R A;  5TIS H;  3RK3 C;  2BLF B;  3H1L E;  4JPZ B;  1IO3 A;  3L74 G;  1HH0 A;  5KLV D;  5DJQ B;  1KX2 A;  1KYO I;  4FA9 A;  4AYC A;  4YTP C;  1CSB A;  3BRT B;  1S5L X;  4H44 C;  3V4Q A;  1H8A A;  2J59 M;  1GIW A;  1PP9 E;  2KZI A;  3RBX A;  3CPW O;  1EXI A;  1SQB J;  4AAO A;  5CMZ A;  5CCH D;  3BCC G;  2LIT A;  3B71 A;  3O6Q B;  2K1A A;  1S9K D;  1JCD A;  1A02 J;  3H1L J;  2HOD B;  4C46 A;  3MP7 B;  5AW5 B;  3CP5 A;  4GOF A;  1D7M A;  1WRG A;  2JO1 A;  2YMY A;  1EDJ A;  5BU5 A;  3HUS B;  1VQO P;  1GL2 C;  5APU A;  1CYJ A;  2N18 C;  1DEB A;  3MHV A;  2BAS A;  1KTM A;  2WMM A;  1E2R A;  3NXS A;  4RKU J;  3HD7 D;  5H2F E;  5H2F V;  4XXL A;  1EZV I;  3PJS K;  2QIW A;  1DIQ C;  2KZJ A;  3H1L G;  2HPC B;  1GZL A;  1IFM A;  3A0B E;  3A0B V;  1LJ2 A;  2OYO A;  1IO4 A;  1CYC A;  4W7Y A;  1NTK K;  2XV5 A;  2Q6Q A;  1SFC D;  4L1Q A;  3KDP B;  2PAJ A;  2C2C A;  1HUC A;  4ASW A;  4WWI A;  3H32 A;  1OW6 A;  1FZB A;  4YE1 A;  4GOE A;  4PV1 D;  3MUD A;  1L0N K;  1CSV A;  1JY3 N;  2IPP A;  3CL3 D;  2W27 A;  3BAS A;  2M3B A;  1LTJ C;  1T8Z A;  2E76 D;  1N90 A;  1KIL B;  4WQD A;  2R44 A;  4RO0 A;  1EDI A;  1CXC A;  2WPQ A;  3OAK A;  2XNX A;  2FYZ A;  2NRG A;  5GTI V;  3V5B A;  3RK3 D;  2FWL A;  4B86 A;  1NTM J;  1S2E A;  4EIF A;  5KJ7 D;  3OCD B;  3CYT I;  2B87 A;  3P32 A;  1HRC A;  1QVF O;  1OVR A;  3S4R A;  5KLV J;  3AE8 C;  3CLQ A;  5APV A;  2A06 D;  2IFM A;  5CCG D;  3O6Q A;  1NVO A;  1M70 A;  3AE6 C;  3CME P;  2ZYA A;  1LC1 A;  1KN7 A;  2WSS H;  4Y99 C;  4EID A;  3L72 D;  5APX A;  1ZOY C;  1B7V A;  2QJY C;  1FZC A;  1FJP A;  2JWD A;  3VMY A;  3CU4 A;  3SJL A;  2PFX A;  3HUS A;  2R5D A;  4R4L A;  1DVH A;  3V6I A;  2PCB B;  3L4O A;  2OTJ P;  4Y5R A;  1L0L G;  4BRY B;  2IZ1 A;  1NTM G;  4LC1 A;  2GC7 D;  4PD4 H;  4IFF A;  1QL2 A;  2B9B A;  2FXO A;  4AX3 A;  1RAQ A;  1RE4 C;  1RZ5 A;  1HJ5 A;  3MK7 B;  3RL0 g;  1K9M Q;  5KLV G;  1RZ6 A;  1JOC A;  5GTH H;  3A0H H;  1BCC D;  1K3G A;  2J5U A;  2CA4 B;  2K9Y A;  3Q3D A;  1CCH A;  3VN0 A;  5AW9 B;  1BDD A;  1KV4 A;  2M0B A;  5APQ A;  3SLE A;  4JF7 A;  4KMG A;  3VMZ A;  1LTA C;  2IZ0 A;  2OAR A;  4DZO A;  1SQQ D;  3QH9 A;  2V7Q J;  1ZZH A;  3B5N B;  2YNY A;  2FXM A;  1I54 A;  1GD2 E;  1FZA A;  2Y0D A;  3QWO C;  1M57 D;  1PZQ A;  1KB9 D;  3AE7 C;  451C A;  1JY2 P;  3C9I A;  4RJT A;  4GYD A;  3RGU A;  5AVZ B;  1HJB A;  1PIX A;  1S3J A;  1N86 A;  2ZT9 C;  3RK3 E;  2ZYD A;  3CCU P;  1LFM A;  1KIL A;  1T2K C;  2W90 A;  1CXA A;  1U7M A;  3NBS A;  3E1R A;  1L2P A;  2Q1K A;  3U1A A;  1H9X A;  5TJH A;  2A06 E;  2GB8 B;  2L5G B;  5CBO A;  3CX5 W;  3SSU A;  4FA4 A;  1J2J B;  4WY4 C;  3L72 E;  2N1T B;  4M3L A;  1YI2 P;  1K05 A;  1ZP0 C;  5H2F H;  3EQ2 A;  1E29 A;  2O1K A;  2AEM A;  3LID A;  3CC4 P;  1VQP P;  1CTY A;  1H0T B;  3I55 P;  3ZOY A;  1URQ C;  3A0B H;  3CXH I;  1FJK A;  4FA1 A;  3D71 A;  1SQX D;  2KSE A;  2H8P D;  1BCC E;  1L9B C;  4BRY A;  2E75 B;  1CZQ A;  2BH4 X;  2OYI C;  3WFD C;  3L4F A;  3L70 D;  3L72 J;  2C9L Y;  1H32 B;  3IF4 A;  1LTT C;  1OWA A;  2HYN A;  4NFG B;  1QKS A;  3T97 B;  4LLH A;  3RL0 C;  2IBZ D;  4FAV A;  1HWT C;  1CNO A;  5KLI B;  1HJ3 A;  4WQC A;  1BCC J;  1KB9 E;  2C1D B;  3FX0 A;  3B5N A;  5GTI H;  1YHQ P;  2B12 B;  4D6T E;  3HRN A;  2OTL P;  3I56 P;  1PV3 A;  1LWU C;  1KIB A;  1AYG A;  3IN6 A;  1L0N E;  3D6Y A;  1EDL A;  3HQ8 A;  2FY8 A;  2FYN B;  1N2D C;  4UB6 V;  4UB6 E;  1DH3 A;  1DD4 A;  3JC2 2;  2PCC B;  1W2E A;  2XTS B;  2ZT9 D;  1CCR A;  2LXC B;  1HVV A;  1BCC G;  2I8D A;  1LTI C;  1H88 A;  1JMB A;  2K88 A;  1J1D B;  1JCC A;  3TF5 A;  1FZF A;  3FWL A;  1GQ1 A;  3AEB C;  4N3Y B;  2FFD C;  2V7Q H;  5KAI V;  5KAI E;  1C6O A;  1H31 B;  4N6J A;  1N7S C;  1NAY A;  2Y0E A;  3D6Z A;  1SQQ G;  3G4S P;  2WVR A;  3RK2 B;  2W6A A;  1RAP A;  1VQ5 P;  5CIF B;  1G1J A;  3WUV A;  2FKW B;  3VP9 A;  1DIP A;  2N9J A;  2YMK A;  5B5E E;  5B5E V;  1SQX E;  4ZMD A;  3OA8 B;  1OVV A;  3WUU A;  3KXD A;  2A45 H;  3L70 E;  3SFE C;  1H0T A;  3L74 D;  1DVV A;  1JY2 O;  3ITK A;  5BU8 B;  1URQ D;  1K73 Q;  1HGV A;  2B10 B;  2P58 A;  2XKM A;  1CRY A;  3PXS A;  3AEC C;  2N18 B;  2E43 A;  1H32 A;  2ZBO A;  2GIW A;  2LIR A;  3FWN A;  2IBZ E;  1QN2 A;  3P8M C;  4LGD E;  1A56 A;  1SQX J;  1NTZ D;  1RH5 B;  4HH2 A;  2H89 C;  3T97 A;  4RES B;  2KI7 B;  3L70 J;  3FGA D;  1VQ4 P;  2IDB A;  2C1V A;  1RHZ B;  2WPR A;  2M8R A;  3TDK A;  3RL0 D;  1NU1 D;  4U7J A;  1NTM K;  1Q2N A;  3S1K A;  2C1D A;  2KIK A;  1HZU A;  5C0Z A;  2KS1 B;  1Q86 Q;  1I55 A;  1FI3 A;  1MFZ A;  3AE5 C;  2E74 C;  2PGD A;  2P7J A;  2CE1 A;  5KLV K;  2C9N Y;  4O1Q A;  5AUR A;  1XTC C;  3CCQ P;  3KQG A;  4EIC A;  3VMA A;  2JTI B;  3ZIY A;  1FDO A;  1VL2 A;  4WBA A;  3SXT A;  3O0R C;  4DT0 A;  3A5T A;  1T3U A;  1SQX G;  2A45 I;  2WQY C;  1VQ8 P;  4ZKP A;  1ZW0 A;  4QAO A;  2KLV A;  3L70 G;  5DJT B;  2QJK B;  1NJI Q;  5CCH C;  1JNM A;  2BH5 X;  2BGV X;  1LTJ B;  1M1J B;  4WQA A;  1MKM A;  3BAT A;  3U1C A;  4WB4 A;  1RE3 C;  1HRO A;  3PTZ A;  3IAO A;  1FOS E;  2BCN B;  4H0K A;  1HTL C;  5AVU B;  4FAN A;  4BXL A;  3HQ7 A;  1GJQ A;  5M1B A;  1FCD C;  1F1C A;  2YKP A;  2W8Z A;  3M0D C;  4H0L C;  3L74 E;  1USD A;  4H13 D;  4IOI H;  3TSI A;  1TU3 F;  5KAF E;  3D0W A;  5KAF V;  1N73 B;  3HD7 C;  2BCC D;  1Y47 A;  4I7Z C;  2C9X B;  1G2C B;  4L73 A;  4Y99 B;  4WQ9 A;  4GIF A;  2QJY B;  1KD1 Q;  3D70 A;  2CA3 B;  3PXT A;  1ETP A;  1KB9 H;  3M06 A;  3V2N A;  1IC2 A;  2Y0C A;  1C7M A;  1NTZ E;  1U7J A;  1JEK A;  3CC7 P;  2GC4 D;  1SFC C;  3L74 J;  4ZNC A;  3GHG B;  3ZBM A;  3L35 A;  2O3J A;  2YK3 A;  5CIH B;  4EIE A;  2IYO A;  2BEZ F;  2YQB A;  3CCS P;  2XND H;  3KYQ A;  3AEA C;  1CRG A;  1RF0 A;  1S72 P;  1Q81 Q;  1RQV A;  4UB6 H;  4PV1 C;  1VQL P;  2WSF J;  5GTH V;  3A0H V;  1LTB C;  2ZXE B;  1CIE A;  1OZH A;  2E76 C;  1NTZ J;  3HE4 A;  1KYO W;  1KMI Z;  2DW3 A;  2KS1 A;  1CSX A;  3SWY A;  1L0L D;  2O01 J;  1LP1 B;  3SWF A;  4LJI A;  3B5N D;  2KSJ A;  1BL9 A;  1G1I A;  2GUS A;  2WWW A;  2E74 D;  1XTG B;  5KAI H;  5AW8 B;  3CMA P;  5KJ7 C;  3E7K A;  1VQN P;  3H25 A;  4DJG A;  5B5E H;  3DMI A;  1COT A;  2WSC H;  3V2P A;  1M56 D;  1LTJ A;  3RLM A;  1M1J A;  5CCG C;  2H43 A;  1ZME C;  1CHJ A;  1K3H A;  2WPV B;  1NTZ G;  3CX5 E;  3CCE P;  1LT1 A;  1HJ0 A;  3OA7 A;  2YO2 A;  1IK9 A;  1JM0 A;  2E5Y A;  3M9H A;  4L76 A;  1CIF A;  1FOC A;  1NU1 G;  2GUV A;  3WFB C;  2K3R A;  4WY4 B;  2YIU B;  1SS1 A;  2HR3 A;  2I1K A;  4KT0 J;  4KJM A;  4WVZ A;  1N73 A;  4H0L D;  4OH8 B;  1ZXG A;  4IFD K;  1P84 D;  3K5B A;  1G2C A;  4J20 A;  3E1I A;  2Q3E A;  1Q82 Q;  2M5A B;  3L71 D;  2BCC J;  2QJP B;  1GK4 A;  4AAM A;  1SQQ K;  2E75 D;  3AE1 C;  1VQ6 P;  3H1H D;  3GHG A;  1PGQ A;  2QA4 P;  3WMM 0;  1W5C T;  1L0L E;  1IFJ A;  1NTM E;  2W6J H;  2LXB A;  2D2C D;  2V07 A;  1GK6 A;  1FE6 A;  4OGQ D;  1IRV A;  5KLV E;  1I6E A;  2BCC G;  1VPC A;  3NWV A;  1CO6 A;  2L4D A;  2PRR A;  1LWU B;  1SVF A;  2WTY A;  3MGN A;  1C6R A;  4JCG A;  1L0L J;  1GU5 A;  3P8C D;  4YXD C;  1DW2 A;  1VQK P;  5KAF H;  1S9K E;  5APT A;  5EXQ A;  3MTU E;  1FJ0 A;  2WSF H;  1L4A D;  3PHL A;  2JEE A;  2OTK E;  1S1C X;  2HOD A;  3G71 P;  3M97 X;  1SQX K;  1OFC X;  2V08 A;  4KHX A;  1QYZ A;  2FFD B;  1P84 E;  3R2P A;  1M60 A;  3C1L A;  2YKO A;  4EYY Q;  3H6P A;  2RMZ A;  3Q5P A;  3L71 E;  2AEJ A;  1EXJ A;  2NPS B;  351C A;  4I1L A;  1DW3 A;  1C52 A;  2M5A A;  1JDL A;  4QMA A;  3H1H E;  2OYH B;  1BSH A;  2FRC A;  1QL4 A;  1IQC A;  3TNU B;  3WFC C;  1YYC A;  2HPC A;  2KXP B;  1NH4 A;  1WEJ F;  2WT7 B;  1IFP A;  3W67 A;  4Z1M H;  3L71 J;  4R4M A;  3V2Q A;  1HF9 A;  2JWA A;  1FZG A;  2K9J B;  4DCK A;  3H1H J;  1Y8A A;  1PL5 A;  4HKZ H;  2KP8 A;  1CHH A;  3MUD C;  2BEQ D;  3L75 D;  1CIG A;  1GW3 A;  3A3Y B;  2FYU D;  4N0K A;  2GA1 A;  1Q90 D;  3CX5 H;  1NGM B;  1KYO D;  1PGJ A;  1OCD A;  1MG2 D;  1DW0 A;  5CJ0 A;  4PD4 I;  1KQL A;  1LWU A;  3G3Z A;  5L8R J;  2N3B A;  3AEG C;  1BSN A;  3L71 G;  3O1Y A;  3OCD A;  1SQP D;  1LC2 A;  2YXQ B;  1A02 F;  2C0W A;  1MZ4 A;  5CID B;  1I6D A;  2IX7 C;  3AE4 C;  3L37 A;  3H1H G;  2QSI A;  3CXH W;  1VDF A;  4PJ0 E;  4JQ0 D;  3C8V A;  4K3I A;  3H1K D;  1YJ9 P;  4K35 A;  1AOF A;  1CYI A;  4YXW H;  1X8Y A;  1CRI A;  1FZC C;  1NHL A;  1VQ9 P;  1SP4 A;  4HJG H;  3HUS C;  2Z5H A;  1NMI A;  1M8O B;  3A7O A;  1EZV D;  2JDI H;  5AW0 B;  2JR8 A;  3V2R A;  1H89 A;  1VF5 D;  1HBW A;  3RN1 A;  1KC8 Q;  1NTZ K;  5B66 E;  5B66 V;  1YJN P;  2NPS A;  3CX5 I;  1VYD A;  1NYH A;  2P2U A;  2ZFC A;  2R32 A;  2IYP A;  2OYH A;  1NU1 K;  1SQQ E;  2RH0 A;  3TNU A;  1FU1 A;  4C7R A;  2WT7 A;  1JY3 P;  1CSW A;  3KHU A;  3WFE C;  1SFC B;  3H1J D;  2ZYG A;  1FI7 A;  2B4Z A;  1QVG O;  1U75 B;  2CPS A;  1J1E C;  1KYO E;  1OW8 A;  2K9J A;  3ZOO A;  2KNC B;  1SQQ J;  2CK3 H;  1BE3 D;  3ORV A;  3GLM A;  1A2S A;  1KIL C;  2Q5U A;  2J58 A;  3AED C;  5CIB B;  1SQP E;  3IR9 A;  1I8P A;  4OVN F;  3RK3 B;  1P84 H;  1A8C A;  3L75 J;  2NZ2 A;  2FYU J;  2QRX A;  3H1K E;  4XE5 B;  1QX8 A;  5CIG B;  1OMI A;  4H44 B;  4H13 C;  2N1T A;  1OAE A;  1VQM P;  3W68 A;  2KYV A;  1PPJ D;  3FXD A;  1HCM A;  1SQP J;  2WZ7 A;  4GDO A;  1EZV E;  1YCC A;  1R0Q A;  3WC8 A;  3II6 A;  1IK7 A;  1YTZ I;  1L9J C;  4Q5P A;  1N50 A;  1CIH A;  3H1K J;  3L75 G;  2FYU G;  2QVA A;  1GL2 B;  4W7Z A;  5AVT B;  3M0D A;  3TYI A;  1N8R Q;  3ZCF A;  2OGU A;  3CCV P;  3SWK A;  2FBW C;  1FS0 E;  1FHB A;  1SQP G;  5APS A;  3H1J E;  2QEX P;  5AVV B;  3BRV B;  1VQ7 P;  3AEF C;  1KOR A;  1L0L K;  1WT6 A;  3Q5S A;  2QE7 H;  1QL3 A;  3Q5R A;  3B5N C;  3H1K G;  2MTA C;  2XZR A;  3U59 A;  2ZVN B;  1BE3 E;  1J3S A;  2JJL A;  1EQ7 A;  2N9B A;  5APW A;  1ZRT D;  1C75 A;  3GMA A;  2KNC A;  3MD0 A;  1PGO A;  2KLU A;  3G9R A;  3H1J J;  4PJ0 H;  1EZV G;  3N7N A;  5EFW B;  1AFO A;  1M90 Q;  3CWB D;  3OW2 O;  1KIL D;  1GDT A;  4C7N B;  2M3E A;  1BE3 J;  2N9Y B;  5AVY B;  1SQB D;  1NML A;  1SQV D;  3TGU D;  1K04 A;  3O8Z A;  2Z5I A;  3AE9 C;  1DW1 A;  4V2K A;  1HH7 A;  1X79 B;  155C A;  1COR A;  1JUN A;  3DR0 A;  1MUU A;  1LGH B;  5B66 H;  1H31 A;  3DP5 A;  1JY3 O;  2VHD A;  2LKM A;  3H1J G;  2QM8 A;  3CXH D;  2ZXX A;  1NKN A;  4U3F G;  1AVY A;  3OA8 A;  1LT9 C;  2R3S A;  1PP9 D;  2G8Y A;  2OZ1 B;  2DGE A;  3JSV C;  1OXZ A;  5CJ4 A;  1BE3 G;  2E75 C;  1GL2 A;  3PP5 A;  2XDJ A;  3NBT A;  1LTS C;  2HV4 A;  2H7H A;  1KYO H;  2NPS D;  1YTC A;  1NU1 E;  5AVX B;  2YCC A;  3F89 A;  5DJU B;  2D2C C;  1KQG B;  5KLI C;  4OGQ C;  2N9I A;  3BVH A;  1YEB A;  1PPJ G;  1H9Y A;  1ZRT E;  4L74 A;  3PH0 A;  3VMX A;  1CSU A;  1W5C E;  3KZI E;  3NFQ A;  3V4W A;  3CWB E;  1NU1 J;  3CCM P;  3N4X A;  4HYT B;  2B89 A;  1FZE A;  3H32 B;  1X9V A;  2D0S A;  2FYN C;  1KIL E;  1KFM A;  1R5S A;  5AW3 B;  4JYC A;  1OVU A;  3C2C A;  4MN4 C;  1Z56 A;  1EC5 A;  2ZT9 B;  1KB9 I;  1SQV E;  1I8O A;  3TGU E;  3JCU E;  5AVR B;  3EWK A;  2WIT A;  4C7N A;  1L4A C;  1MG3 D;  1YIC A;  1J1D C;  4NPE A;  2HG5 D;  4NPF X;  2KB7 P;  3CCR P;  1NWQ A;  3VOP A;  5AW4 B;  1IZN B;  1JY2 N;  3CWB J;  3CXH E;  1AKK A;  3VRD A;  2B87 B;  2QG4 A;  1CED A;  2BCC E;  5CIE B;  1RF1 C;  1UII A;  3RK2 C;  1MV8 A;  3EFF K;  2B11 B;  5AVS B;  5AW2 B;  2N1T D;  3HQ6 A;  1KV9 A;  5IY5 1;  1SQV J;  3TGU J;  3WUI A;  4FA5 A;  3RMZ A;  4O9B A;  4N78 D;  4JYB A;  2OZ1 A;  1FZC B;  1GU4 A;  3PLN A;  1URQ B;  1YIJ P;  3CWB G;  1SLQ A;  3ABV C;  2OYI B;  1PP9 J;  5CYT R;  1AVO A;  2BPB B;  4CPG A;  1AQT A;  3TK1 A;  1RE4 A;  1SQB G;  5AW6 B;  1LTG C;  1HZV A;  4P4Q B;  5K5G B;  1SQV G;  3TGU G;  1RF0 C;  1CI6 B;  1DD3 A;  3RL0 B;  1KX7 A;  3UIA A;  2FYU K;  3O5C A;  2AI5 A;  3HE5 B;  2CE0 A;  5CHX A;  1EDK A;  3NMD A;  1LP1 A;  4IL6 E;  4IL6 V;  3SWS A;  2IBZ I;  1PP9 G;  1S4X A;  3CCL P;  2RN0 A;  4BWN A;  1AA0 A;  3SFD C;  2ZOO A;  4EOT A;  1SQP K;  1IFD A;  3LW5 J;  1J1E B;  5KKZ C;  2WSE J;  3F5H A;  1C6S A;  4O1W A;  2QJK C;  2O1J A;  1QEX A;  4L75 A;  5E79 E;  5E79 V;  3VP8 A;  1M1J C;  3VYI A;  4TLF A;  1KQS O;  1CTZ A;  4WQ8 A;  2W83 C;  2Y9Z A;  1MFT A;  1BGY D;  1LMS A;  4FB1 A;  1N7L A;  4GOD A;  2LR2 A;  5GTI E;  1ZR4 A;  4GT1 A;  3X39 A;  1W2B O;  1Q7Y Q;  1YBK A;  1FDI A;  3Q2Y A;  4WQ7 A;  3MZW B;  3AE3 C;  2O01 H;  1FOS F;  4N78 E;  4WY4 A;  5KTB A;  1NIR A;  4H44 D;  1VF5 C;  2CPB A;  1N7S B;  4H13 B;  2HFE D;  1LS9 A;  3PRJ A;  1N73 C;  3RK2 D;  3L4M A;  5B6Q A;  1IRW A;  1E79 H;  2MJZ A;  2C0X A;  2Z4E A;  3AEE C;  2YO3 A;  1CC5 A;  1URQ A;  2HLO A;  1ZLL A;  1ZR2 A;  2I1J A;  1GL2 D;  2OYI A;  2AXT E;  2AXT V;  3KZI H;  4Y28 J;  3H1I D;  2IFN A;  1KQF B;  3GHG C;  4TT3 H;  2JQR A;  3VYM A;  1FBM A;  3S9O A;  1NKZ B;  5CBN A;  3FXE A;  1NO4 A;  1CI6 A;  1H33 B;  4AAN A;  2P67 A;  3JCU H;  4GED B;  2KUB A;  1CHI A;  2AIU A;  1USE A;  3HE5 A;  2P1J A;  4EIJ A;  2KK7 A;  2Y9Y A;  3P8C E;  3M9Q A;  1RQU A;  4NPD A;  1NTK D;  3EFG A;  3CXH H;  2E74 B;  3LIE A;  1JB0 J;  1RY3 A;  5DJQ C;  2P10 A;  3USS A;  4AQR D;  1YTZ T;  4D6T D;  1DII C;  1BGY E;  1N9C A;  3ZOW A;  3ZDM A;  1L0N D;  2OQQ A;  4MU8 A;  4PJ0 V;  2JP3 A;  4YPC A;  2R5B A;  2ZJS E;  2WPS A;  3B4S A;  3O20 A;  1HGZ A;  4IFM A;  3GW6 A;  2FFD A;  1ZN5 A;  2B88 A;  1S6V B;  4DOJ A;  1AOQ A;  2YIU C;  1DEE G;  1BGY J;  2AXC A;  1N7S A;  3WU2 E;  3WU2 V;  1LNQ A;  2RKL A;  1QL1 A;  2A45 G;  1R5L A;  4H0L B;  3LW5 H;  2E5T A;  3GF7 A;  2YKQ A;  3IFM A;  1AQ5 A;  2WSE H;  5AW7 B;  3HD7 B;  2DVH A;  1CTJ A;  1LT9 B;  1K8A Q;  4XA4 A;  4I7Z B;  3L36 A;  3H1I E;  3GF3 A;  2G3A A;  2SPZ A;  2QJP C;  1H1O A;  2O01 N;  1FC2 C;  5DF5 A;  1MZ9 A;  4IL6 H;  3A2A A;  4JBZ A;  1KB0 A;  1NOH A;  3A9F A;  1JTH B;  1UIX A;  1BGY G;  2QM7 A;  1YIT P;  1F1F A;  1IZL 0;  1FI9 A;  5DFS A;  3RBZ A;  3M91 A;  2Q3I A;  4U3F D;  2E42 A;  3L75 E;  4I6M C;  4K3A A;  4UB8 V;  4UB8 E;  1GW4 A;  4ZKU A;  2FYU E;  2ZAE B;  1H33 A;  3H1I J;  1FDM A;  2D2C B;  5E79 H;  2ZXY A;  1NTK E;  2C8S A;  4PW9 B;  4PV1 B;  1ZV8 A;  1C2N A;  3CD6 P;  4OGQ B;  2A06 G;  3OJA B;  1YEA A;  2E76 B;  2PAC A;  3I5C A;  2C1U A;  1JO5 A;  3L73 D;  1SQB K;  3L72 G;  4AAL A;  1X0T A;  1QGK B;  1SQV K;  4IL6 X;  3M0A A;  1S5L E;  1S5L V;  4WQB A;  2VRS A;  1AJY A;  4RSZ A;  1NTK J;  2I8F A;  4L3G A;  1WVE C;  4H0J A;  1YQ3 C;  3H1I G;  4L3H A;  5CCH A;  3CI9 A;  1L4A B;  5AVW B;  1T2K D;  4D6T J;  1RE3 A;  1YJW P;  4GKG A;  5TIS E;  5TIS V;  4A7P A;  1L0N J;  2AXT H;  2N3Y A;  5BVZ A;  1GDV A;  1OX3 A;  1T6A A;  2ZON G;  1RF1 B;  1OIP A;  4WY4 D;  3M9B A;  4AUW A;  1NTK G;  1CRC A;  2NPS C;  2XU6 A;  2W6B A;  3MK7 C;  3HD7 A;  1IFI A;  1LT9 A;  2B0Z B;  1PGP A;  1NNO A;  3RN0 A;  2OYH C;  3HTK B;  2K37 A;  4D6T G;  1X22 A;  2PP6 A;  1M7L A;  1P84 I;  4U3F E;  1L0N G;  3HQ9 A;  1OW7 A;  1JTH A;  2AEF A;  1SFC A;  2ZZS 1;  1NAF A;  1CW5 A;  2WSC J;  3BCC D;  5AVQ B;  2MHM A;  1M6Z A;  2KOG A;  2L91 A;  3L73 E;  3R4Y A;  1W2L A;  2CXB A;  1EB7 A;  1Y9B A;  3GG2 A;  4PD4 D;  3ZOX A;  1FAV A;  3HE4 B;  1GMJ A;  4U3F J;  2Q9I A;  1CRH A;  2R3C A;  3JBT B;  1CRJ A;  1DT1 A;  3B8E B;  1YIQ A;  2FXP A;  1HJ4 A;  5KJ7 A;  1PPJ E;  2EXV A;  5KKZ B;  5AW1 B;  3WU2 H;  3L73 J;  3WUT A;  2ORL A;  4XFJ A;  2H88 C;  3VTP C;  1KFN A;  3H1L D;  1PFI A;  1I5T A;  2N1T C;  2Q7C A;  4EDF A;  5C9M A;  1KZU B;  5CCG A;  1L4A A;  3Q1M A;  2POH A;  1YFC A;  2IBZ G;  1YQ4 C;  4WQE A;  2ZVO B;  1JMM A;  3G6E P;  3CX5 D;  4PWA A;  3SVW A;  4EI2 A;  2GM4 A;  3VNW A;  1RF1 A;  4W80 A;  1M1K Q;  3PXW A;  1WMK A;  1VF5 B;  1GTW A;  3TYY A;  1N7S D;  3L73 G;  1YNR A;  2D0W A;  4XYD B;  4UB8 H;  2MKV A;  3MIW A;  2V4H A;  3CC2 P;  1IJD B;  1IFN A; 
#chains in the Genus database with same CATH homology
 2Y0E A;  2N3B A;  2AI5 A;  3O5C A;  2CE0 A;  1RAP A;  1U74 B;  5CIF B;  3O1Y A;  4IL6 V;  2N9J A;  5CIC B;  1N15 A;  5B5E V;  3OCD A;  1SQP D;  3SWS A;  1LC2 A;  3OA8 B;  1MZ4 A;  2RN0 A;  5CID B;  1I6D A;  1GKS A;  2ZOO A;  3CXH W;  1E8E A;  3L74 D;  1DVV A;  3ITK A;  4K3I A;  3H1K D;  3PH2 B;  1C6S A;  4O1W A;  2B10 B;  1AOF A;  1CYI A;  3KZI V;  1CRY A;  3PXS A;  5E79 V;  2N18 B;  1CRI A;  1H32 A;  2ZBO A;  2GIW A;  2LIR A;  1CTZ A;  4WQ8 A;  1QN2 A;  1A56 A;  1BGY D;  1LMS A;  4FB1 A;  1GU2 A;  1NMI A;  1NTZ D;  1EZV D;  3X39 A;  4DY9 A;  1NTM D;  2C1V A;  4WQ7 A;  3RN1 A;  1C2R A;  5B66 V;  3TDK A;  1VYD A;  2BLF B;  1NU1 D;  1IO3 A;  1NIR A;  5KLV D;  2C1D A;  1HZU A;  1LS9 A;  5DJQ B;  5C0Z A;  1KX2 A;  3PRJ A;  3L4M A;  1I55 A;  1FI3 A;  4FA9 A;  5B6Q A;  1IRW A;  2CE1 A;  4O1Q A;  5AUR A;  4EIC A;  3VMA A;  2JTI B;  3ZIY A;  1GIW A;  1CSW A;  3KHU A;  3SXT A;  3O0R C;  4AAO A;  1CC5 A;  3WFE C;  2LIT A;  3H1J D;  1FI7 A;  2B4Z A;  4QAO A;  2QJK B;  2AXT V;  1U75 B;  3CP5 A;  2BH5 X;  2BGV X;  3H1I D;  3ZOO A;  4WQA A;  2KNC B;  1HRO A;  3PTZ A;  2JQR A;  3VYM A;  1BE3 D;  2BCN B;  3ORV A;  1CYJ A;  1A2S A;  4H0K A;  2N18 C;  4FAN A;  1H33 B;  1E2R A;  4AAN A;  5CIB B;  3HQ7 A;  1I8P A;  1GJQ A;  4GED B;  1CHI A;  1FCD C;  2AIU A;  1A8C A;  5H2F V;  4XXL A;  1F1C A;  1DIQ C;  5KAF V;  1NTK D;  2BCC D;  5CIG B;  2C9X B;  3A0B V;  1CYC A;  5DJQ C;  1OAE A;  4WQ9 A;  1PPJ D;  2QJY B;  1HCM A;  2CA3 B;  3PXT A;  1ETP A;  4D6T D;  1DII C;  4L1Q A;  2Y0C A;  2C2C A;  1C7M A;  1N9C A;  1YCC A;  1R0Q A;  3ZOW A;  3WC8 A;  2GC4 D;  1L0N D;  1L9J C;  4MU8 A;  4PJ0 V;  4Q5P A;  4YE1 A;  1N50 A;  1CIH A;  3ZBM A;  2O3J A;  2YK3 A;  5CIH B;  3O20 A;  4EIE A;  1CSV A;  2YQB A;  1CRG A;  1N90 A;  3TYI A;  4WQD A;  3GW6 A;  3ZCF A;  1S6V B;  1CXC A;  3A0H V;  5GTH V;  1AOQ A;  1CIE A;  5GTI V;  1KYO W;  2FWL A;  3WU2 V;  2KS1 A;  1CSX A;  1L0L D;  1FHB A;  4LJI A;  4EIF A;  1BL9 A;  3OCD B;  3CYT I;  1HRC A;  2DVH A;  1CTJ A;  1QL3 A;  2A06 D;  2MTA C;  1H1O A;  1M70 A;  1J3S A;  5DF5 A;  1LC1 A;  3DMI A;  1COT A;  4EID A;  3L72 D;  1KB0 A;  1ZRT D;  3RLM A;  1B7V A;  1C75 A;  3A9F A;  1CHJ A;  1K3H A;  3CU4 A;  3SJL A;  1DVH A;  1F1F A;  1IZL 0;  1FI9 A;  2PCB B;  5DFS A;  3L4O A;  4Y5R A;  4U3F D;  4UB8 V;  2GC7 D;  3CWB D;  1H33 A;  4AX3 A;  2ZXY A;  1RAQ A;  1CIF A;  1FOC A;  2C8S A;  1RZ5 A;  4PW9 B;  1HJ5 A;  3WFB C;  1C2N A;  3MK7 B;  1RZ6 A;  1BCC D;  2YIU B;  1K3G A;  2N9Y B;  1SQB D;  1YEA A;  2CA4 B;  2PAC A;  1CCH A;  1NML A;  2C1U A;  1SQV D;  3TGU D;  1DW1 A;  3L73 D;  4V2K A;  1HH7 A;  1P84 D;  155C A;  4AAL A;  1COR A;  3DR0 A;  3SLE A;  4KMG A;  1H31 A;  4J20 A;  3DP5 A;  2Q3E A;  2VHD A;  1S5L V;  1SQQ D;  1ZZH A;  4WQB A;  3CXH D;  3L71 D;  1I54 A;  4RSZ A;  2QJP B;  3OA8 A;  2I8F A;  4L3G A;  4AAM A;  2Y0D A;  1WVE C;  4H0J A;  1PP9 D;  4L3H A;  1KB9 D;  2OZ1 B;  2DGE A;  451C A;  3H1H D;  4RJT A;  4GYD A;  3NBT A;  5TIS V;  1W5C T;  2HV4 A;  4A7P A;  1LFM A;  2N3Y A;  1CXA A;  3NBS A;  1GDV A;  2V07 A;  1YTC A;  2ZON G;  1IRV A;  1H9X A;  2YCC A;  1I6E A;  5TJH A;  2GB8 B;  1CRC A;  3CX5 W;  4FA4 A;  3MK7 C;  3NWV A;  2B0Z B;  1CO6 A;  2L4D A;  2N9I A;  1NNO A;  1YEB A;  3RN0 A;  1H9Y A;  1C6R A;  4JCG A;  1CSU A;  1DW2 A;  1E29 A;  3HQ9 A;  1CTY A;  5EXQ A;  3ZOY A;  2D0S A;  2ZZS 1;  4FA1 A;  1FJ0 A;  1SQX D;  3BCC D;  2MHM A;  1L9B C;  3C2C A;  3PHL A;  2BH4 X;  3WFD C;  1M6Z A;  3L70 D;  2L91 A;  1I8O A;  3M97 X;  1H32 B;  2V08 A;  1QYZ A;  1MG3 D;  1YIC A;  1W2L A;  2CXB A;  1EB7 A;  3GG2 A;  4PD4 D;  3ZOX A;  4NFG B;  1QKS A;  1M60 A;  2RMZ A;  1CRH A;  1AKK A;  3JBT B;  3VRD A;  1CRJ A;  2IBZ D;  4FAV A;  2QG4 A;  1CED A;  1DT1 A;  351C A;  1CNO A;  5KLI B;  1HJ3 A;  1DW3 A;  5CIE B;  4WQC A;  1YIQ A;  1C52 A;  1JDL A;  2B11 B;  2C1D B;  1HJ4 A;  3HQ6 A;  1KV9 A;  5IY5 1;  2FRC A;  1QL4 A;  2EXV A;  1IQC A;  3WUI A;  5KKZ B;  4FA5 A;  2B12 B;  2ORL A;  3RMZ A;  3WFC C;  3H1L D;  1I5T A;  1WEJ F;  2OZ1 A;  4EDF A;  1KIB A;  1AYG A;  5C9M A;  3PLN A;  3HQ8 A;  2FYN B;  4UB6 V;  1YFC A;  2JWA A;  2PCC B;  5CYT R;  4WQE A;  2XTS B;  2K9J B;  1CCR A;  2BPB B;  3CX5 D;  4PWA A;  3SVW A;  1CHH A;  3VNW A;  1HZV A;  4P4Q B;  3L75 D;  1CIG A;  3PXW A;  3TF5 A;  2FYU D;  4N0K A;  3FWL A;  1GQ1 A;  1YNR A;  2D0W A;  4XYD B;  1KYO D;  1OCD A;  1MG2 D;  1DW0 A;  5KAI V;  1KX7 A;  1C6O A;  1H31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...