3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
2CXBA 1CCRA 3MK7B 1N90A 3PTZA 4WQCA 3A0BV 5GTHV 2B11B 1GKSA 1HZVA 1CSUA 3O0RC 5B5EV 3PRJA 5C0ZA 1RAPA 1J3SA 3TF5A 1I8PA 5KKZB 1M6ZA 2MHMA 1CIGA 1FHBA 2N9IA 1H31B 5E79V 2ZZS1 4WQAA 1CYJA 3H1KD 1C6SA 3ZIYA 2B12B 4EIFA 3TDKA 3HQ6A 1SQPD 1NTKD 1DIQC 2JQRA 3PH2B 1CTJA 4WQEA 1EB7A 1M70A 1I54A 1IRVA 1DW0A 4J20A 4EIEA 3OCDA 3ZOWA 1L9JC 2PACA 5TISV 4GEDB 1SQVD 1NMIA 1NTMD 4AX3A 4PD4D 3L4OA 2Q3EA 2CE1A 2B4ZA 3KZIV 4H0JA 1GU2A 1HRCA 1C75A 3CWBD 2O3JA 1KB9D 3CXHD 1KYOW 3HQ9A 3ORVA 3PXWA 3WFEC 1CEDA 1I8OA 3O1YA 3WFDC 2DVHA 1BCCD 4FA9A 1YIQA 2C8SA 1L9BC 1DW2A 1QN2A 4EIDA 5H2FV 2BPBB 1CRHA 4FANA 2AI5A 4N0KA 3A0HV 1QKSA 1KX7A 4LJIA 3H1ID 4IL6V 3L4MA 4EICA 1IRWA 1N9CA 3NWVA 3GG2A 4EDFA 5EXQA 1CC5A 1I6DA 4L3GA 1IQCA 1RAQA 1H1OA 2LITA 3CYTI 3HQ7A 4L1QA 1H33A 2FRCA 2RMZA 1I55A 2GB8B 1FI7A 1I5TA 1QYZA 3NBSA 3CX5W 1AOFA 1YICA 1HJ4A 2ZBOA 4PWAA 3SVWA 2C1DA 3C2CA 3DR0A 5DFSA 3BCCD 1KV9A 3DP5A 1QL3A 4RSZA 1DIIC 1IZL0 1OAEA 2V08A 3L70D 3PHLA 1CIHA 351CA 3ZOXA 1HJ3A 3A9FA 1S5LV 1SQBD 3OA8B 2A06D 2C1VA 4WQ7A 1I6EA 1E8EA 2QJYB 4FB1A 3CXHW 1SQQD 1CIFA 1COTA 2GC7D 5CIFB 5C9MA 2K9JB 1CRGA 1CHIA 1N50A 1EZVD 5CIEB 5CIHB 5KLIB 1NNOA 1CRJA 2YCCA 3WC8A 5DJQB 3PLNA 5DF5A 1CRIA 3L73D 3L75D 1CTZA 2N3BA 4JCGA 1NIRA 2BH4X 1CYCA 2BLFB 1K3GA 2BCNB 1RZ6A 1LS9A 1C2RA 2C1DB 2C9XB 4WQBA 1YTCA 4UB6V 4MU8A 3SLEA 4PJ0V 3JBTB 4YE1A 2KS1A 2N18C 4FA1A 1HH7A 2FWLA 3DMIA 4PW9B 451CA 1NTZD 2BH5X 2I8FA 2Y0DA 1M60A 1H9YA 1KYOD 1CORA 3ZBMA 1FJ0A 4AAOA 5CIDB 4UB8V 5KLVD 2RN0A 4AAMA 1CIEA 1NU1D 3H1LD 3CX5D 1LMSA 1H9XA 1LC2A 2AIUA 2MTAC 1W5CT 2N9JA 2GIWA 1BL9A 4XYDB 1E29A 4RJTA 1LFMA 1A56A 4L3HA 1KX2A 1OCDA 3WFCC 2YQBA 3CU4A 1B7VA 3FWLA 1FI3A 3ZCFA 1K3HA 4FA4A 1CNOA 1AYGA 4QAOA 1CHHA 3VRDA 1GDVA 1C6OA 1C6RA 2FYNB 3OA8A 1PPJD 4Y5RA 2CA3B 3PXTA 1H32B 4H0KA 1C2NA 4V2KA 5B6QA 1F1FA 2L4DA 1L0LD 2ZXYA 3VNWA 3L72D 4DY9A 2C1UA 3OCDB 2EXVA 3L71D 2YIUB 1U74B 1AKKA 4A7PA 2YK3A 1BE3D 4FAVA 1H33B 4WQ8A 1CXCA 3SXTA 2FYUD 1GJQA 2QG4A 1R0QA 1WEJF 1NMLA 1DVVA 1AOQA 3TGUD 4AANA 3VYMA 1SQXD 1FCDC 3TYIA 2OZ1A 2JWAA 2IBZD 1JDLA 1HROA 2N18B 1GIWA 2XTSB 2HV4A 1MZ4A 1QL4A 1BGYD 5CIGB 1E2RA 1VYDA 5GTIV 1FI9A 155CA 1W2LA 1YNRA 1MG3D 1HZUA 3CP5A 1YEAA 5IY51 5AURA 4GYDA 2CA4B 1KIBA 2DGEA 3ZOYA 2JTIB 3RMZA 1CTYA 1GQ1A 1P84D 1YFCA 2KNCB 2QJKB 1S6VB 4KMGA 1DW3A 2N3YA 3L74D 4U3FD 5CICB 5DJQC 1L0ND 2B10B 4D6TD 1FOCA 4WQ9A 1A8CA 4K3IA 1RZ5A 3ZOOA 2BCCD 4FA5A 4XXLA 3SJLA 1DVHA 1LC1A 1YEBA 4AALA 2D0SA 1CO6A 3H1HD 1IO3A 1CSWA 1U75B 1CSXA 1H32A 3M97X 4P4QB 1H31A 5KAIV 2L91A 4O1QA 2PCCB 5KAFV 2ZONG 1PP9D 4NFGB 2CE0A 1WVEC 4Q5PA 1F1CA 2Y0CA 1ZZHA 3HQ8A 3KHUA 1C52A 2VHDA 2QJPB 1DT1A 1CHJA 3VMAA 4WQDA 3RN1A 1CRCA 3ITKA 3RN0A 1N15A 3PXSA 5CIBB 1HCMA 1HJ5A 3GW6A 2AXTV 2D0WA 2V07A 3X39A 3SWSA 2OZ1B 3WUIA 1CRYA 4O1WA 1A2SA 1CYIA 1CXAA 2BGVX 5CYTR 1ETPA 2N9YB 1MG2D 1ZRTD 3MK7C 3NBTA 3O5CA 1C7MA 5TJHA 2ZOOA 3H1JD 3WU2V 2PCBB 2B0ZB 2GC4D 2LIRA 2C2CA 2ORLA 1CCHA 2Y0EA 1KB0A 1YCCA 1DW1A 3O20A 1CSVA 3RLMA 3WFBC 5B66V
chains in the Genus database with same CATH superfamily
2GM4A 3NFQA 3H1IJ 3C8VA 1OW6A 3PTZA 1GKSA 4GODA 2SPZA 1CSUA 1L0NJ 5B5EV 3PRJA 5C0ZA 2C0XA 1SQQK 5AW0B 5KAIE 1KTMA 5KKZB 2FFDC 1HWTC 2OQQA 2N9IA 2IBZI 2NPSC 3H1HE 1QGKB 2ZZS1 4WQAA 3EWKA 3RK3C 1QVFO 4K35A 3C9IA 1C6SA 3B4SA 3RL0D 4EIFA 1ZV8A 1WRGA 3HQ6A 2BCCJ 1SQPD 1DIQC 3TSIA 2JQRA 3PH2B 1CTJA 4IFMA 3Q5SA 5AW6B 1NKZB 2E74B 1AQ5A 4EIEA 3ZOWA 2O1JA 1SQBE 4GEDB 3NTNA 4RKUJ 3MP7B 1T3JA 1P84H 3CMAP 4PD4D 1FDIA 2CE1A 1VDFA 3AEAC 4L75A 2ZJSE 4H0JA 1GU2A 1JUNA 3F5HA 3CWBD 2GUSA 1WMKA 1KB9D 2O3JA 3HQ9A 2A45H 4JYBA 3WFEC 1NTMG 1Q2NA 3L75E 1OW7A 1BGYG 2DVHA 1BCCD 4B86A 3L73G 5E79E 1YIQA 1ZLLA 1PFIA 1L9BC 3R2PA 1X8YA 2W6BA 4EIDA 4Y99C 5H2FV 3D6YA 2BPBB 4Y99B 1LT9B 2E42A 1KC8Q 3H1KE 2W6AA 1LP1B 2E76D 3H1ID 4IL6V 1N9CA 3NWVA 2QEXP 1BGYE 4DT0A 2FYUJ 3VP8A 1YQ4C 3A0BH 4L3GA 1RAQA 1CZQA 1H33A 1LTGC 4LGDE 1FZCA 4PD4E 2E5YA 1SQQJ 3CCMP 2O01J 3FXDA 2JKVA 1EDJA 3CX5W 3HD7D 2WPQA 1CI6B 4PWAA 1SQVJ 2QJPC 1KB9E 1JB0J 1NHLA 1KV9A 2AEFA 1EDKA 2FYNC 1IZL0 1SQVG 3H1HG 1S1CX 3CCJP 3L71G 1YTZI 3CXHW 1DIPA 1CIFA 5APSA 5GTHH 1DD4A 3ZDMA 1IFJA 1NNOA 3L75D 3JC22 1CTZA 5AVZB 3RBXA 2K37A 1VQOP 1IFIA 1NIRA 1HH0A 1EZVG 2BLFB 2BCNB 1GMJA 1N7LA 2C1DB 1L0LE 1W5CE 4WQBA 3M9HA 1HTLC 2W6JH 1HBWA 4WY4A 4YE1A 1N8RQ 2FWLA 3DMIA 4PW9B 2BH5X 2I8FA 2KSJA 2PP6A 2B87B 3L70E 3L72G 2E74D 2N9BA 4N78E 5CIDB 2R3CA 1KILE 2P58A 5KLVD 3L36A 3CX5D 1LT9C 2AIUA 2N9JA 2YO2A 1OCDA 2J5UA 4DZOA 3RL0B 2WQYC 2WT7B 1FI3A 5M1BA 1PGQA 3L73J 1BGYJ 2J58A 2QSIA 1K3HA 1YTZT 1CHHA 1LTJA 2IFNA 1EZVI 4GOFA 1GDVA 1J1DC 1RE4A 1IFNA 3OA8A 3F89A 1C2NA 5APVA 5AVTB 4V2KA 3VTPC 3U1CA 3E1RA 2V7QJ 5AW1B 3AEGC 1YI2P 1OXZA 4KT0J 2WVRA 2C1UA 3L71D 3RK2C 2YIUB 4PV1D 1FJKA 1OIPA 4WQ8A 1BE3J 1QL1A 2FYUD 5BU5A 1VL2A 2QG4A 1J2JB 1KQFB 2POHA 2R32A 1VQ5P 1L0LK 4MN4C 1Q86Q 1S5LX 3EFFK 4AANA 2M8RA 4OH8B 1SQXD 2OZ1A 2R5DA 1NJIQ 1N7SD 1JDLA 5DJUB 2R44A 3U1AA 5AW7B 3UIAA 2XTSB 1H0TA 4XA4A 2HV4A 4WBAA 3AE3C 5C39A 2P7JA 1MZ4A 2G8YA 3KQGA 5CIGB 1E2RA 5BVZA 2V4HA 1IC2A 5B5EH 3GHGC 3D70A 3CP5A 3M9QA 1YEAA 5IY51 2DGEA 3HD7C 3ZOYA 2JTIB 3RMZA 4YXDC 2QVAA 1G1JA 1SQBJ 1IFDA 4W7ZA 2K9JA 4KMGA 2BEQD 1L4AB 1P84I 4D6TD 4PD4H 2XZRA 2QE7H 1NAFA 1SQVK 1BCCG 4WVZA 1Q82Q 2BCCD 1OWAA 3HRNA 1RHZB 3B5NA 2LXBA 2R3SA 4WY4D 2IBZG 1DVHA 1LC1A 2E75B 1YEBA 1CO6A 3BVHA 3H1HD 2WPVB 1AQTA 1EZVE 5B5EE 1FAVA 1X79B 2NPSB 3CCRP 4P4QB 1H31A 4O1QA 1SQPE 5KAFV 1CW5A 2FYZA 1Q81Q 1XTGB 4NFGB 1F1CA 2WSEH 3HQ8A 3O6QB 3JCUH 2H7HA 3RK3D 3KHUA 3RL0C 1C52A 1MV8A 4WQDA 3RN1A 1AA0A 2AXCA 1MFZA 1GK6A 1NTZK 1IJDB 1HCMA 5AVVB 4TLFA 1JO5A 2AXTV 2D0WA 1RE3A 5CCGA 1K05A 4O1WA 1SLQA 1E79H 5KLVK 1CI6A 3CC7P 3O5CA 1C7MA 2H88C 1KYOI 2O01N 4LC1A 2VRSA 1NTMK 1SQVE 4HJGH 2PCBB 2JWDA 5CMZA 3KZIE 2ORLA 1S72P 1KB0A 3AE8C 4H13C 5B66V 1CSVA 3RLMA 3WFBC 3CXHE 1JMMA 1A02F 4TT3H 4GIFA 1GK4A 5GTHV 1KYOE 2B11B 3M06A 2WPRA 2MKVA 1HJ0A 5KAFE 2ZVOB 3TF5A 2QJYC 1I8PA 3AEEC 2OARA 3TNUB 1CIGA 1GL2D 1URQD 4IOIH 3K5BA 4KJMA 5KAFH 3H1HJ 1YJ9P 1RF0A 2E76C 5CCHD 4HKZH 2KZJA 1L0LJ 2RKLA 3ZIYA 2ZYGA 1KFNA 2NZ2A 4I2LC 1USEA 1OZHA 1PPJE 1HGVA 1SQQG 1IRVA 1G2CA 1L9JC 1U7JA 4JF7A 1SFCD 1NMIA 3O8ZA 1N7SC 2Q3EA 2FYUG 3KZIV 1HRCA 1HUCA 3A7OA 1C75A 3CX5H 3CXHD 1YQ3C 2JJLA 3BCCE 2FYUE 2J59M 1JY2O 1KMIZ 1LTJB 2XV5A 1VQ4P 3S4RA 1GZLA 1DW2A 1QN2A 2R5BA 4I1LA 4FANA 3V2RA 4N0KA 1VPCA 2N1TC 4LJIA 4OGQC 2WMMA 1NTKE 1CC5A 1M56D 2Y9YA 2Q9IA 1WT6A 3MTUE 1PZQA 3D6ZA 1MKMA 2FXMA 1W2BO 4RO0A 4OWFA 1IQCA 1AV1A 3HQ7A 2XU6A 3RK2B 3H1JJ 1SS1A 3CI9A 2FRCA 1FI7A 1Q90D 2O01H 1JOCA 3SFDC 3NBSA 3A2AA 2YKOA 1NU1J 3H1LJ 4DJGA 1L2PA 1OVVA 3DR0A 3DP5A 1QL3A 3B5NB 2V08A 5AVSB 1OFCX 351CA 1D7MA 1HJ3A 1NTZJ 1S5LV 4WQ7A 1FDMA 3IAOA 3MHVA 4NPDA 3KPEA 3S1KA 3WMM0 1LTIC 5CIFB 2K9JB 1L0NG 5CIHB 5KLIB 3IFMA 2YCCA 1IFMA 3WC8A 5DJQB 1ZP0C 3H1IE 2YO3A 5DF5A 1CRIA 3GLMA 3L73D 1KILC 2N3BA 1NO4A 2B89A 4JCGA 2ZYDA 2Q1KA 1BCCE 3W67A 3VN0A 1KD1Q 3BCCJ 1RZ6A 4D6TG 1LS9A 4H0LB 2Z5IA 1N86A 1PPJG 1C2RA 2OYIA 1U57A 2C9XB 3V2QA 1JTHB 4H13D 2OTLP 4PJ0V 3JBTB 3V4QA 1NTKK 2N18C 1HH7A 5AW9B 1RF1B 2HR3A 2KK7A 451CA 4U3FJ 2ZXXA 4ASVA 2Y0DA 1RH5B 1M60A 4RESB 1KYOD 1YBKA 2LXCB 3CC4P 4UB8V 2IYPA 4AAMA 2H8PD 1CIEA 1JCDA 3I55P 1LMSA 1H9XA 3H1JE 3LIEA 2AXTE 2GIWA 1E29A 2YQBA 3L74G 3M0DA 5AVXB 5AVUB 1YJWP 3L4FA 1X9VA 2HODB 3CL3D 1AYGA 3QWOC 4QAOA 1LJ2A 3P8MC 3VRDA 3U59A 1M7LA 3VP9A 2YXQB 1K04A 1H89A 4YTPC 1PPJD 3PXTA 4H0KA 1ZMEC 1VQ8P 1SFCC 5CCGC 1RY3A 1NU1G 3H1LG 1L0LD 1FE6A 2ZXYA 3C1LA 3VNWA 5H2FE 5GTIE 1KYOH 3Q5PA 2WSFH 4U3FE 1GW4A 3SXTA 1HGZA 2KSEA 1GJQA 3L74E 4C46A 2XNDH 4D6TE 1K9MQ 3Q3DA 1NMLA 5AW4B 3L72J 4R4MA 1QEXA 3T97A 1FBMA 2IBZD 3HE5A 1MUUA 1GIWA 1AVOA 1RF1C 1AJYA 4ASWA 4L73A 3IN6A 3HUSC 3AECC 1QL4A 5KJ7D 1NTKJ 2Q6QA 3NMDA 3CX5I 1VYDA 4L74A 1FI9A 155CA 1W2LA 2A45G 1EC5A 2LR2A 3EQ2A 2KLVA 1KIBA 1GQ1A 3L70J 3L72E 2OYHB 2AXTH 2ZT9C 1T2KC 1GU4A 1FZEA 3TYYA 1S6VB 3L74D 2CK3H 1PL5A 2M5AB 1LNQA 4I6MC 2FXPA 2WWWA 4WQ9A 1FOSF 1KQGB 3Q5RA 1R8EA 3TGUE 3FWNA 1IO3A 1CSWA 4PJ0E 1FZFA 5AVYB 4PJ0H 1SQPJ 2FXOA 5CBOA 1BE3E 5KAIV 1FS0E 2L5GB 2WZ7A 1KORA 1PP9D 1WVEC 4Q5PA 1X22A 4U7JA 2Y0CA 1SQXG 1ZZHA 2Z4EA 5CCHC 2XKMA 3JCUE 3T97B 1FZAA 2I1KA 2VHDA 1M1JC 1CHJA 1VQLP 1YITP 1LP1A 3ITKA 3RN0A 1GL2A 1URQA 3HD7B 1N15A 2IDBA 1OW8A 1QL2A 1HJ5A 3IR9A 1BSNA 3H1JG 1CSBA 4I7ZB 1CRYA 1NTZE 4ZNCA 1A2SA 1CYIA 2D2CC 2KNCA 2N9YB 4WY4B 1ZRTD 4HB1A 3NBTA 3HUSB 3BATA 1LWUB 1NAYA 1JY2P 1LTJC 4K3AA 1N2DC 4H44C 2GC4D 2LIRA 1NTMJ 3AE9C 2ZFCA 3B71A 1S9KE 3H25A 1NTME 3L75G 2HG5D 2UWJE 3V2NA 3AE2C 3RGUA 5DJTB 3SWYA 1CCRA 3MK7B 2OYIC 1N90A 3A0BV 1IK7A 2C0WA 1HJBA 1M1JB 3TNUA 1PGOA 3HTKA 3O0RC 5CCGD 1RAPA 1QX8A 2CPBA 2QM8A 5KLIC 1M6ZA 1FHBA 5KAIH 2BCCG 1H0TB 2JP3A 1CYJA 4OGQD 3H1KD 1T8ZA 4WB4A 2B12B 3WUUA 3LW5J 3TDKA 3E1IA 1SP4A 2WSCH 4HYTB 1NTKD 1ZR4A 1SQBK 1JY3P 1S5LH 1JM0A 1M70A 2IFMA 3OCDA 1R5LA 1XTCC 1AFOA 3WUTA 2PACA 5TISV 1VQNP 1PGPA 3PH0A 1SQBG 4GDOA 4AX3A 2OYIB 2B4ZA 1HVVA 2DW3A 5GTHE 2C9NY 4H13B 1MZ9A 2YMKA 4OGQB 1LTTC 3ORVA 1RF0C 1FZCB 1DEEG 1CEDA 1KFMA 1I8OA 3MUDA 1LGHB 3A0HE 2ZT9B 4FA9A 2C8SA 3CCUP 4L76A 3TGUG 5AW3B 2ZT9D 2AI5A 1UIXA 1EQ7A 2K1AA 1QKSA 1KX7A 1DD3A 5APYA 3L4MA 4EICA 1IRWA 3GG2A 2WPSA 1LWUC 4EDFA 1NOHA 1SQPK 2NRGA 1GW3A 1EDIA 2KS1B 1N73C 1A02J 3HE5B 2KI7B 1H1OA 2LITA 3CYTI 1L4AA 1N7SB 1Y9BA 1LWUA 1GTWA 1NVOA 2M0BA 1QYZA 3CD6P 1AOFA 3I5CA 1YICA 1JCCA 1HJ4A 4M3LA 1KB9H 2C1DA 5DFSA 2WITA 1ZR2A 1X0TA 2PRRA 5H2FH 1BDDA 4RSZA 1DIIC 3L70D 3P7KA 3E7KA 3PHLA 3ZOXA 2KLUA 2FKWB 1SQXK 3OA8B 3GF3A 4AUWA 3L37A 1I6EA 4PV1B 3RK3E 1KQLA 2RH0A 1SQQD 1KZUB 2GC7D 1YYCA 2NPSD 1PP9G 1CRJA 3CXHI 3IF4A 5AVWB 3PLNA 2D2CD 1Y47A 2HYNA 2YKPA 2BH4X 1KQSO 5AW5B 1K3GA 3VMYA 1M90Q 1SVFA 2B87A 2A06G 4EOTA 3M9BA 3Q1MA 1S9KD 2ITAA 3TGUJ 3SLEA 2KS1A 4FA1A 1S2EA 4H44B 5APWA 3V4WA 3KDPB 1NTZD 1EXIA 1KV4A 3KYQA 4AYCA 2XDJA 1FJ0A 4WY4C 3R4YA 4AAOA 4U3FG 2RN0A 2OTKE 1NU1D 3H1LD 1LC2A 2K9YA 1N7SA 4R4LA 1DH3A 2Z5HA 2E43A 1W5CT 1SQXE 1BL9A 4RJTA 1A56A 3WFCC 1KX2A 5CJ0A 4O9BA 1B7VA 3FWLA 3AEDC 4JBZA 1CNOA 3H32A 2E74C 1LT9A 2KUBA 3CCQP 4H0LD 1M1JA 1Y8AA 1C6OA 2FYNB 4Y5RA 2CA3B 1H32B 4NPEA 1VF5B 5APUA 1BE3G 1T2KD 1ZOYC 3VMXA 2IX7C 2FBWC 2IPPA 4N3YB 1P84E 4DY9A 2BASA 3H1KG 2FY8A 3B5NC 3OCDB 1KILA 5B66H 1U74B 2Y9ZA 2WSFJ 1AKKA 2JEEA 1JEKA 3RK3B 4CPGA 3N4XA 3PP5A 3SWKA 1R0QA 4N78D 5AVRB 1NU1K 3CMEP 1T3UA 1FZGA 1W2EA 4YPCA 4Z1MH 1N73A 3TGUD 3VYMA 2PFXA 1JY3N 1VQ6P 3O6QA 2JWAA 1HROA 4OVNF 1HF9A 3SSUA 2B9BA 1IO4A 1RE3C 1J1EB 1S5LE 1J1EC 1NKNA 1QVGO 4DCKA 1YNRA 1MG3D 4IFFA 4ZKPA 4GYDA 3GF7A 1NH4A 1P84D 1SQXJ 2P1JA 1JTHA 2BEZF 3WU2H 3CCEP 4U3FD 5DJQC 2B10B 1FOCA 4W7YA 1KILB 1ZRTE 2KB7P 1A8CA 1RZ5A 3ZOOA 2I8DA 3WU2E 4UB6E 4FA5A 4XXLA 1L4AD 2A06E 1AVYA 3OJAB 3G6EP 1VF5C 3FXEA 4AALA 2D0SA 4BRYA 1H8AA 1U75B 1CSXA 5AW8B 3M97X 3BASA 3G4SP 4JPZB 2M3EA 3L71J 3FX0A 4IL6E 1J1DB 2ZONG 1IFPA 5APTA 2CE0A 4EI2A 1SQPG 3HD7A 1KB9I 1KN7A 1DX7A 2FFDB 3VMAA 1H88A 2I1JA 4PD4I 1CRCA 3AEFC 5EFWB 4BXLA 1RQUA 5CIBB 3M0DC 2P67A 4BRYB 3X39A 3SWSA 4IL6X 2OZ1B 3W68A 3AE7C 5E79H 3RK2D 3HE4B 1CXAA 2BGVX 2KOGA 1ETPA 2Q5UA 1MG2D 3L70G 1USDA 5KLVE 2ZOOA 3WU2V 1SFCA 3GHGB 2B0ZB 2C2CA 2H43A 4BWNA 4H0LC 3MIWA 3O20A 4ZKUA 2YXRB 1OMIA 2CXBA 4GKGA 2P2UA 4WQCA 1GDTA 1PP9E 4XFJA 1PP9J 1HZVA 3II6A 5CBNA 1FZCC 1J3SA 3KXDA 3P8CD 3PJSK 2MHMA 2KIKA 4JYCA 2W90A 1H31B 5E79V 4LLHA 3B5ND 3S9OA 2M3BA 1ZW0A 3G3ZA 3LW5H 2ZVNB 2WSCJ 2QIWA 4WQEA 1SFCB 1EB7A 1GL2C 1URQC 1I54A 1DW0A 4J20A 2WT7A 2ZYAA 3VYIA 2E75C 4NPFX 1SQVD 3MD0A 5CCHA 3JSVC 1NTMD 4WWIA 1GU5A 3L4OA 2QRXA 3A3YB 2IBZE 1ZN5A 1KYOW 3PXWA 1OVRA 3O1YA 5KTBA 3MUDC 1K8AQ 5TISE 3WFDC 3H32B 2AEMA 2MJZA 3A5TA 4C7NB 3HE4A 3Q2YA 2OYHC 1FJPA 1CRHA 1MFTA 3VMZA 3A0HV 3BCCG 4XE5B 1LTAC 2ZXEB 1M1KQ 3AE4C 3RBZA 2B88A 2PAJA 2P10A 5EXQA 1QLED 3TK1A 1I6DA 3AEBC 1ZXGA 3CC2P 4L1QA 3CXHH 3MGNA 4QMAA 5KLVG 2RMZA 5CHXA 1I55A 4D6TJ 2GB8B 1I5TA 3HUSA 1M57D 2HLOA 3A0HH 3CWBE 4UB8E 2ZBOA 1NTZG 3SVWA 3C2CA 1FZBA 3CWBG 3BCCD 1OAEA 2BCCE 2PGDA 1CIHA 3A9FA 1GL2B 1URQB 1SQBD 3EFGA 2A06D 2C1VA 1KILD 1E8EA 2QJYB 4FB1A 3MZWB 3WUVA 1COTA 3G9RA 5C9MA 5AW2B 1CRGA 1CHIA 1N50A 1EZVD 5CIEB 2JR8A 3L35A 4DOJA 3OA7A 4KHXA 3USSA 3L71E 1NYHA 1R5SA 2HFED 3A0BE 3P32A 5KJ7C 2FFDA 1VQMP 2N1TA 3VOPA 1G1IA 1YIJP 2KZIA 2HPCB 1CYCA 4N6JA 3L75J 1TU3F 3QH9A 4UB8H 3V2PA 3AE5C 3G71P 3AE1C 1YTCA 4UB6V 4MU8A 3CCVP 5GTIH 1H9YA 1CORA 5K5GB 3ZBMA 1PIXA 1JMBA 1FOSE 4EIJA 3ABVC 1JNMA 1OX3A 2W8ZA 4I7ZC 2MTAC 3BRTB 4XYDB 1LFMA 3H6PA 4L3HA 1IK9A 3CU4A 3ZCFA 1U7MA 4C7RA 4FA4A 2KYVA 2HPCA 4GOEA 5KJ7A 1NWQA 5TISH 3L73E 1L0NE 1RQVA 2N1TD 1C6RA 3M0AA 3OW2O 1VQ7P 2YKQA 5B6QA 1F1FA 2V7QH 2L4DA 1NGMB 1EXJA 1L0LG 3CWBJ 2H89C 2KP8A 1EDLA 3L72D 3D71A 1G2CB 2EXVA 3FGAD 5APXA 5KLVJ 2W83C 3GMAA 4A7PA 5B66E 2YK3A 1BE3D 4FAVA 1UIIA 1H33B 1DEBA 1CXCA 2JDIH 1L4AC 1WEJF 1Z56A 2Q3IA 1M8OB 1PV3A 1VF5D 3CLQA 5AVQB 1RF1A 2OYHA 2IYOA 5CJ4A 1DVVA 1AOQA 1NU1E 3H1LE 1FDOA 3CX5E 2IZ0A 2N1TB 1YJNP 2K88A 1FCDC 3TYIA 1NTKG 3CPWO 2W27A 3SWFA 2N18B 3D0WA 2XNXA 1OVUA 4UB6H 1JY3O 5BU8B 1K73Q 1Q7YQ 2O1KA 3RL0g 2YNYA 2HODA 1BGYD 1GD2E 2K3RA 2AEJA 5APQA 5GTIV 1BSHA 2IZ1A 4JQ0D 1HZUA 5AURA 2CPSA 2CA4B 4C7NA 2WSSH 2GA1A 2KXPB 1CTYA 1LT1A 1L0NK 1YFCA 3HTKB 1BDCA 2KNCB 2QJKB 1VQ9P 1S3JA 4YXWH 1DW3A 2N3YA 4Y28J 4AQRD 5CICB 4W80A 1L0ND 4PV1C 1RE4C 3CCLP 4IFDK 4K3IA 2NPSA 3LIDA 1VQKP 4GT1A 3V6IA 3SJLA 3M91A 4ZMDA 3V5BA 3P8CE 3I56P 2WTYA 1S4XA 2YMYA 2YIUC 1SQQE 1T6AA 2ZAEB 1LTSC 3BRVB 2G3AA 3OAKA 2OGUA 3NXSA 1H32A 4HH2A 2LKMA 3H1KJ 2L91A 2E5TA 2Q7CA 2PCCB 2GUVA 2QM7A 3L74J 5L8RJ 1YHQP 2WSEJ 1E5WA 1JY2N 2QJKC 3SFEC 2QJPB 1DT1A 2E76B 3N7NA 2C9LY 1BCCJ 3PXSA 5KKZC 3GW6A 4H44D 2V07A 3WUIA 1VQPP 5CYTR 2E75D 3B8EB 1N73B 3H1IG 3MK7C 3CCSP 5TJHA 2OYOA 1IZNB 3AE6C 1PGJA 2M5AA 4EYYQ 3H1JD 2A45I 2QA4P 3GHGA 1CCHA 1LTBC 3KZIH 4IL6H 2Y0EA 2OTJP 1YCCA 1DW1A 1FC2C 2FYUK 1FU1A 2D2CB 2JO1A
chains in the Genus database with same CATH topology
2CXBA 1CCRA 3MK7B 1N90A 3PTZA 4WQCA 3A0BV 5GTHV 2B11B 1GKSA 1HZVA 1CSUA 3O0RC 5B5EV 3PRJA 5C0ZA 1RAPA 1J3SA 3TF5A 1I8PA 5KKZB 1M6ZA 2MHMA 1CIGA 1FHBA 2N9IA 1H31B 5E79V 2ZZS1 4WQAA 1CYJA 3H1KD 1C6SA 3ZIYA 2B12B 4EIFA 3TDKA 3HQ6A 1SQPD 1NTKD 1DIQC 2JQRA 3PH2B 1CTJA 4WQEA 1EB7A 1M70A 1I54A 1IRVA 1DW0A 4J20A 4EIEA 3OCDA 3ZOWA 1L9JC 2PACA 5TISV 4GEDB 1SQVD 1NMIA 1NTMD 4AX3A 4PD4D 3L4OA 2Q3EA 2CE1A 2B4ZA 3KZIV 4H0JA 1GU2A 1HRCA 1C75A 3CWBD 2O3JA 1KB9D 3CXHD 1KYOW 3HQ9A 3ORVA 3PXWA 3WFEC 1CEDA 1I8OA 3O1YA 3WFDC 2DVHA 1BCCD 4FA9A 1YIQA 2C8SA 1L9BC 1DW2A 1QN2A 4EIDA 5H2FV 2BPBB 1CRHA 4FANA 2AI5A 4N0KA 3A0HV 1QKSA 1KX7A 4LJIA 3H1ID 4IL6V 3L4MA 4EICA 1IRWA 1N9CA 3NWVA 3GG2A 4EDFA 5EXQA 1CC5A 1I6DA 4L3GA 1IQCA 1RAQA 1H1OA 2LITA 3CYTI 3HQ7A 4L1QA 1H33A 2FRCA 2RMZA 1I55A 2GB8B 1FI7A 1I5TA 1QYZA 3NBSA 3CX5W 1AOFA 1YICA 1HJ4A 2ZBOA 4PWAA 3SVWA 2C1DA 3C2CA 3DR0A 5DFSA 3BCCD 1KV9A 3DP5A 1QL3A 4RSZA 1DIIC 1IZL0 1OAEA 2V08A 3L70D 3PHLA 1CIHA 351CA 3ZOXA 1HJ3A 3A9FA 1S5LV 1SQBD 3OA8B 2A06D 2C1VA 4WQ7A 1I6EA 1E8EA 2QJYB 4FB1A 3CXHW 1SQQD 1CIFA 1COTA 2GC7D 5CIFB 5C9MA 2K9JB 1CRGA 1CHIA 1N50A 1EZVD 5CIEB 5CIHB 5KLIB 1NNOA 1CRJA 2YCCA 3WC8A 5DJQB 3PLNA 5DF5A 1CRIA 3L73D 3L75D 1CTZA 2N3BA 4JCGA 1NIRA 2BH4X 1CYCA 2BLFB 1K3GA 2BCNB 1RZ6A 1LS9A 1C2RA 2C1DB 2C9XB 4WQBA 1YTCA 4UB6V 4MU8A 3SLEA 4PJ0V 3JBTB 4YE1A 2KS1A 2N18C 4FA1A 1HH7A 2FWLA 3DMIA 4PW9B 451CA 1NTZD 2BH5X 2I8FA 2Y0DA 1M60A 1H9YA 1KYOD 1CORA 3ZBMA 1FJ0A 4AAOA 5CIDB 4UB8V 5KLVD 2RN0A 4AAMA 1CIEA 1NU1D 3H1LD 3CX5D 1LMSA 1H9XA 1LC2A 2AIUA 2MTAC 1W5CT 2N9JA 2GIWA 1BL9A 4XYDB 1E29A 4RJTA 1LFMA 1A56A 4L3HA 1KX2A 1OCDA 3WFCC 2YQBA 3CU4A 1B7VA 3FWLA 1FI3A 3ZCFA 1K3HA 4FA4A 1CNOA 1AYGA 4QAOA 1CHHA 3VRDA 1GDVA 1C6OA 1C6RA 2FYNB 3OA8A 1PPJD 4Y5RA 2CA3B 3PXTA 1H32B 4H0KA 1C2NA 4V2KA 5B6QA 1F1FA 2L4DA 1L0LD 2ZXYA 3VNWA 3L72D 4DY9A 2C1UA 3OCDB 2EXVA 3L71D 2YIUB 1U74B 1AKKA 4A7PA 2YK3A 1BE3D 4FAVA 1H33B 4WQ8A 1CXCA 3SXTA 2FYUD 1GJQA 2QG4A 1R0QA 1WEJF 1NMLA 1DVVA 1AOQA 3TGUD 4AANA 3VYMA 1SQXD 1FCDC 3TYIA 2OZ1A 2JWAA 2IBZD 1JDLA 1HROA 2N18B 1GIWA 2XTSB 2HV4A 1MZ4A 1QL4A 1BGYD 5CIGB 1E2RA 1VYDA 5GTIV 1FI9A 155CA 1W2LA 1YNRA 1MG3D 1HZUA 3CP5A 1YEAA 5IY51 5AURA 4GYDA 2CA4B 1KIBA 2DGEA 3ZOYA 2JTIB 3RMZA 1CTYA 1GQ1A 1P84D 1YFCA 2KNCB 2QJKB 1S6VB 4KMGA 1DW3A 2N3YA 3L74D 4U3FD 5CICB 5DJQC 1L0ND 2B10B 4D6TD 1FOCA 4WQ9A 1A8CA 4K3IA 1RZ5A 3ZOOA 2BCCD 4FA5A 4XXLA 3SJLA 1DVHA 1LC1A 1YEBA 4AALA 2D0SA 1CO6A 3H1HD 1IO3A 1CSWA 1U75B 1CSXA 1H32A 3M97X 4P4QB 1H31A 5KAIV 2L91A 4O1QA 2PCCB 5KAFV 2ZONG 1PP9D 4NFGB 2CE0A 1WVEC 4Q5PA 1F1CA 2Y0CA 1ZZHA 3HQ8A 3KHUA 1C52A 2VHDA 2QJPB 1DT1A 1CHJA 3VMAA 4WQDA 3RN1A 1CRCA 3ITKA 3RN0A 1N15A 3PXSA 5CIBB 1HCMA 1HJ5A 3GW6A 2AXTV 2D0WA 2V07A 3X39A 3SWSA 2OZ1B 3WUIA 1CRYA 4O1WA 1A2SA 1CYIA 1CXAA 2BGVX 5CYTR 1ETPA 2N9YB 1MG2D 1ZRTD 3MK7C 3NBTA 3O5CA 1C7MA 5TJHA 2ZOOA 3H1JD 3WU2V 2PCBB 2B0ZB 2GC4D 2LIRA 2C2CA 2ORLA 1CCHA 2Y0EA 1KB0A 1YCCA 1DW1A 3O20A 1CSVA 3RLMA 3WFBC 5B66V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXB A;  1CCR A;  3MK7 B;  1N90 A;  3PTZ A;  4WQC A;  3A0B V;  5GTH V;  2B11 B;  1GKS A;  1HZV A;  1CSU A;  3O0R C;  5B5E V;  3PRJ A;  5C0Z A;  1RAP A;  1J3S A;  3TF5 A;  1I8P A;  5KKZ B;  1M6Z A;  2MHM A;  1CIG A;  1FHB A;  2N9I A;  1H31 B;  5E79 V;  2ZZS 1;  4WQA A;  1CYJ A;  3H1K D;  1C6S A;  3ZIY A;  2B12 B;  4EIF A;  3TDK A;  3HQ6 A;  1SQP D;  1NTK D;  1DIQ C;  2JQR A;  3PH2 B;  1CTJ A;  4WQE A;  1EB7 A;  1M70 A;  1I54 A;  1IRV A;  1DW0 A;  4J20 A;  4EIE A;  3OCD A;  3ZOW A;  1L9J C;  2PAC A;  5TIS V;  4GED B;  1SQV D;  1NMI A;  1NTM D;  4AX3 A;  4PD4 D;  3L4O A;  2Q3E A;  2CE1 A;  2B4Z A;  3KZI V;  4H0J A;  1GU2 A;  1HRC A;  1C75 A;  3CWB D;  2O3J A;  1KB9 D;  3CXH D;  1KYO W;  3HQ9 A;  3ORV A;  3PXW A;  3WFE C;  1CED A;  1I8O A;  3O1Y A;  3WFD C;  2DVH A;  1BCC D;  4FA9 A;  1YIQ A;  2C8S A;  1L9B C;  1DW2 A;  1QN2 A;  4EID A;  5H2F V;  2BPB B;  1CRH A;  4FAN A;  2AI5 A;  4N0K A;  3A0H V;  1QKS A;  1KX7 A;  4LJI A;  3H1I D;  4IL6 V;  3L4M A;  4EIC A;  1IRW A;  1N9C A;  3NWV A;  3GG2 A;  4EDF A;  5EXQ A;  1CC5 A;  1I6D A;  4L3G A;  1IQC A;  1RAQ A;  1H1O A;  2LIT A;  3CYT I;  3HQ7 A;  4L1Q A;  1H33 A;  2FRC A;  2RMZ A;  1I55 A;  2GB8 B;  1FI7 A;  1I5T A;  1QYZ A;  3NBS A;  3CX5 W;  1AOF A;  1YIC A;  1HJ4 A;  2ZBO A;  4PWA A;  3SVW A;  2C1D A;  3C2C A;  3DR0 A;  5DFS A;  3BCC D;  1KV9 A;  3DP5 A;  1QL3 A;  4RSZ A;  1DII C;  1IZL 0;  1OAE A;  2V08 A;  3L70 D;  3PHL A;  1CIH A;  351C A;  3ZOX A;  1HJ3 A;  3A9F A;  1S5L V;  1SQB D;  3OA8 B;  2A06 D;  2C1V A;  4WQ7 A;  1I6E A;  1E8E A;  2QJY B;  4FB1 A;  3CXH W;  1SQQ D;  1CIF A;  1COT A;  2GC7 D;  5CIF B;  5C9M A;  2K9J B;  1CRG A;  1CHI A;  1N50 A;  1EZV D;  5CIE B;  5CIH B;  5KLI B;  1NNO A;  1CRJ A;  2YCC A;  3WC8 A;  5DJQ B;  3PLN A;  5DF5 A;  1CRI A;  3L73 D;  3L75 D;  1CTZ A;  2N3B A;  4JCG A;  1NIR A;  2BH4 X;  1CYC A;  2BLF B;  1K3G A;  2BCN B;  1RZ6 A;  1LS9 A;  1C2R A;  2C1D B;  2C9X B;  4WQB A;  1YTC A;  4UB6 V;  4MU8 A;  3SLE A;  4PJ0 V;  3JBT B;  4YE1 A;  2KS1 A;  2N18 C;  4FA1 A;  1HH7 A;  2FWL A;  3DMI A;  4PW9 B;  451C A;  1NTZ D;  2BH5 X;  2I8F A;  2Y0D A;  1M60 A;  1H9Y A;  1KYO D;  1COR A;  3ZBM A;  1FJ0 A;  4AAO A;  5CID B;  4UB8 V;  5KLV D;  2RN0 A;  4AAM A;  1CIE A;  1NU1 D;  3H1L D;  3CX5 D;  1LMS A;  1H9X A;  1LC2 A;  2AIU A;  2MTA C;  1W5C T;  2N9J A;  2GIW A;  1BL9 A;  4XYD B;  1E29 A;  4RJT A;  1LFM A;  1A56 A;  4L3H A;  1KX2 A;  1OCD A;  3WFC C;  2YQB A;  3CU4 A;  1B7V A;  3FWL A;  1FI3 A;  3ZCF A;  1K3H A;  4FA4 A;  1CNO A;  1AYG A;  4QAO A;  1CHH A;  3VRD A;  1GDV A;  1C6O A;  1C6R A;  2FYN B;  3OA8 A;  1PPJ D;  4Y5R A;  2CA3 B;  3PXT A;  1H32 B;  4H0K A;  1C2N A;  4V2K A;  5B6Q A;  1F1F A;  2L4D A;  1L0L D;  2ZXY A;  3VNW A;  3L72 D;  4DY9 A;  2C1U A;  3OCD B;  2EXV A;  3L71 D;  2YIU B;  1U74 B;  1AKK A;  4A7P A;  2YK3 A;  1BE3 D;  4FAV A;  1H33 B;  4WQ8 A;  1CXC A;  3SXT A;  2FYU D;  1GJQ A;  2QG4 A;  1R0Q A;  1WEJ F;  1NML A;  1DVV A;  1AOQ A;  3TGU D;  4AAN A;  3VYM A;  1SQX D;  1FCD C;  3TYI A;  2OZ1 A;  2JWA A;  2IBZ D;  1JDL A;  1HRO A;  2N18 B;  1GIW A;  2XTS B;  2HV4 A;  1MZ4 A;  1QL4 A;  1BGY D;  5CIG B;  1E2R A;  1VYD A;  5GTI V;  1FI9 A;  155C A;  1W2L A;  1YNR A;  1MG3 D;  1HZU A;  3CP5 A;  1YEA A;  5IY5 1;  5AUR A;  4GYD A;  2CA4 B;  1KIB A;  2DGE A;  3ZOY A;  2JTI B;  3RMZ A;  1CTY A;  1GQ1 A;  1P84 D;  1YFC A;  2KNC B;  2QJK B;  1S6V B;  4KMG A;  1DW3 A;  2N3Y A;  3L74 D;  4U3F D;  5CIC B;  5DJQ C;  1L0N D;  2B10 B;  4D6T D;  1FOC A;  4WQ9 A;  1A8C A;  4K3I A;  1RZ5 A;  3ZOO A;  2BCC D;  4FA5 A;  4XXL A;  3SJL A;  1DVH A;  1LC1 A;  1YEB A;  4AAL A;  2D0S A;  1CO6 A;  3H1H D;  1IO3 A;  1CSW A;  1U75 B;  1CSX A;  1H32 A;  3M97 X;  4P4Q B;  1H31 A;  5KAI V;  2L91 A;  4O1Q A;  2PCC B;  5KAF V;  2ZON G;  1PP9 D;  4NFG B;  2CE0 A;  1WVE C;  4Q5P A;  1F1C A;  2Y0C A;  1ZZH A;  3HQ8 A;  3KHU A;  1C52 A;  2VHD A;  2QJP B;  1DT1 A;  1CHJ A;  3VMA A;  4WQD A;  3RN1 A;  1CRC A;  3ITK A;  3RN0 A;  1N15 A;  3PXS A;  5CIB B;  1HCM A;  1HJ5 A;  3GW6 A;  2AXT V;  2D0W A;  2V07 A;  3X39 A;  3SWS A;  2OZ1 B;  3WUI A;  1CRY A;  4O1W A;  1A2S A;  1CYI A;  1CXA A;  2BGV X;  5CYT R;  1ETP A;  2N9Y B;  1MG2 D;  1ZRT D;  3MK7 C;  3NBT A;  3O5C A;  1C7M A;  5TJH A;  2ZOO A;  3H1J D;  3WU2 V;  2PCB B;  2B0Z B;  2GC4 D;  2LIR A;  2C2C A;  2ORL A;  1CCH A;  2Y0E A;  1KB0 A;  1YCC A;  1DW1 A;  3O20 A;  1CSV A;  3RLM A;  3WFB C;  5B66 V; 
#chains in the Genus database with same CATH topology
 2GM4 A;  3NFQ A;  3H1I J;  3C8V A;  1OW6 A;  3PTZ A;  1GKS A;  4GOD A;  2SPZ A;  1CSU A;  1L0N J;  5B5E V;  3PRJ A;  5C0Z A;  2C0X A;  1SQQ K;  5AW0 B;  5KAI E;  1KTM A;  5KKZ B;  2FFD C;  1HWT C;  2OQQ A;  2N9I A;  2IBZ I;  2NPS C;  3H1H E;  1QGK B;  2ZZS 1;  4WQA A;  3EWK A;  3RK3 C;  1QVF O;  4K35 A;  3C9I A;  1C6S A;  3B4S A;  3RL0 D;  4EIF A;  1ZV8 A;  1WRG A;  3HQ6 A;  2BCC J;  1SQP D;  1DIQ C;  3TSI A;  2JQR A;  3PH2 B;  1CTJ A;  4IFM A;  3Q5S A;  5AW6 B;  1NKZ B;  2E74 B;  1AQ5 A;  4EIE A;  3ZOW A;  2O1J A;  1SQB E;  4GED B;  3NTN A;  4RKU J;  3MP7 B;  1T3J A;  1P84 H;  3CMA P;  4PD4 D;  1FDI A;  2CE1 A;  1VDF A;  3AEA C;  4L75 A;  2ZJS E;  4H0J A;  1GU2 A;  1JUN A;  3F5H A;  3CWB D;  2GUS A;  1WMK A;  1KB9 D;  2O3J A;  3HQ9 A;  2A45 H;  4JYB A;  3WFE C;  1NTM G;  1Q2N A;  3L75 E;  1OW7 A;  1BGY G;  2DVH A;  1BCC D;  4B86 A;  3L73 G;  5E79 E;  1YIQ A;  1ZLL A;  1PFI A;  1L9B C;  3R2P A;  1X8Y A;  2W6B A;  4EID A;  4Y99 C;  5H2F V;  3D6Y A;  2BPB B;  4Y99 B;  1LT9 B;  2E42 A;  1KC8 Q;  3H1K E;  2W6A A;  1LP1 B;  2E76 D;  3H1I D;  4IL6 V;  1N9C A;  3NWV A;  2QEX P;  1BGY E;  4DT0 A;  2FYU J;  3VP8 A;  1YQ4 C;  3A0B H;  4L3G A;  1RAQ A;  1CZQ A;  1H33 A;  1LTG C;  4LGD E;  1FZC A;  4PD4 E;  2E5Y A;  1SQQ J;  3CCM P;  2O01 J;  3FXD A;  2JKV A;  1EDJ A;  3CX5 W;  3HD7 D;  2WPQ A;  1CI6 B;  4PWA A;  1SQV J;  2QJP C;  1KB9 E;  1JB0 J;  1NHL A;  1KV9 A;  2AEF A;  1EDK A;  2FYN C;  1IZL 0;  1SQV G;  3H1H G;  1S1C X;  3CCJ P;  3L71 G;  1YTZ I;  3CXH W;  1DIP A;  1CIF A;  5APS A;  5GTH H;  1DD4 A;  3ZDM A;  1IFJ A;  1NNO A;  3L75 D;  3JC2 2;  1CTZ A;  5AVZ B;  3RBX A;  2K37 A;  1VQO P;  1IFI A;  1NIR A;  1HH0 A;  1EZV G;  2BLF B;  2BCN B;  1GMJ A;  1N7L A;  2C1D B;  1L0L E;  1W5C E;  4WQB A;  3M9H A;  1HTL C;  2W6J H;  1HBW A;  4WY4 A;  4YE1 A;  1N8R Q;  2FWL A;  3DMI A;  4PW9 B;  2BH5 X;  2I8F A;  2KSJ A;  2PP6 A;  2B87 B;  3L70 E;  3L72 G;  2E74 D;  2N9B A;  4N78 E;  5CID B;  2R3C A;  1KIL E;  2P58 A;  5KLV D;  3L36 A;  3CX5 D;  1LT9 C;  2AIU A;  2N9J A;  2YO2 A;  1OCD A;  2J5U A;  4DZO A;  3RL0 B;  2WQY C;  2WT7 B;  1FI3 A;  5M1B A;  1PGQ A;  3L73 J;  1BGY J;  2J58 A;  2QSI A;  1K3H A;  1YTZ T;  1CHH A;  1LTJ A;  2IFN A;  1EZV I;  4GOF A;  1GDV A;  1J1D C;  1RE4 A;  1IFN A;  3OA8 A;  3F89 A;  1C2N A;  5APV A;  5AVT B;  4V2K A;  3VTP C;  3U1C A;  3E1R A;  2V7Q J;  5AW1 B;  3AEG C;  1YI2 P;  1OXZ A;  4KT0 J;  2WVR A;  2C1U A;  3L71 D;  3RK2 C;  2YIU B;  4PV1 D;  1FJK A;  1OIP A;  4WQ8 A;  1BE3 J;  1QL1 A;  2FYU D;  5BU5 A;  1VL2 A;  2QG4 A;  1J2J B;  1KQF B;  2POH A;  2R32 A;  1VQ5 P;  1L0L K;  4MN4 C;  1Q86 Q;  1S5L X;  3EFF K;  4AAN A;  2M8R A;  4OH8 B;  1SQX D;  2OZ1 A;  2R5D A;  1NJI Q;  1N7S D;  1JDL A;  5DJU B;  2R44 A;  3U1A A;  5AW7 B;  3UIA A;  2XTS B;  1H0T A;  4XA4 A;  2HV4 A;  4WBA A;  3AE3 C;  5C39 A;  2P7J A;  1MZ4 A;  2G8Y A;  3KQG A;  5CIG B;  1E2R A;  5BVZ A;  2V4H A;  1IC2 A;  5B5E H;  3GHG C;  3D70 A;  3CP5 A;  3M9Q A;  1YEA A;  5IY5 1;  2DGE A;  3HD7 C;  3ZOY A;  2JTI B;  3RMZ A;  4YXD C;  2QVA A;  1G1J A;  1SQB J;  1IFD A;  4W7Z A;  2K9J A;  4KMG A;  2BEQ D;  1L4A B;  1P84 I;  4D6T D;  4PD4 H;  2XZR A;  2QE7 H;  1NAF A;  1SQV K;  1BCC G;  4WVZ A;  1Q82 Q;  2BCC D;  1OWA A;  3HRN A;  1RHZ B;  3B5N A;  2LXB A;  2R3S A;  4WY4 D;  2IBZ G;  1DVH A;  1LC1 A;  2E75 B;  1YEB A;  1CO6 A;  3BVH A;  3H1H D;  2WPV B;  1AQT A;  1EZV E;  5B5E E;  1FAV A;  1X79 B;  2NPS B;  3CCR P;  4P4Q B;  1H31 A;  4O1Q A;  1SQP E;  5KAF V;  1CW5 A;  2FYZ A;  1Q81 Q;  1XTG B;  4NFG B;  1F1C A;  2WSE H;  3HQ8 A;  3O6Q B;  3JCU H;  2H7H A;  3RK3 D;  3KHU A;  3RL0 C;  1C52 A;  1MV8 A;  4WQD A;  3RN1 A;  1AA0 A;  2AXC A;  1MFZ A;  1GK6 A;  1NTZ K;  1IJD B;  1HCM A;  5AVV B;  4TLF A;  1JO5 A;  2AXT V;  2D0W A;  1RE3 A;  5CCG A;  1K05 A;  4O1W A;  1SLQ A;  1E79 H;  5KLV K;  1CI6 A;  3CC7 P;  3O5C A;  1C7M A;  2H88 C;  1KYO I;  2O01 N;  4LC1 A;  2VRS A;  1NTM K;  1SQV E;  4HJG H;  2PCB B;  2JWD A;  5CMZ A;  3KZI E;  2ORL A;  1S72 P;  1KB0 A;  3AE8 C;  4H13 C;  5B66 V;  1CSV A;  3RLM A;  3WFB C;  3CXH E;  1JMM A;  1A02 F;  4TT3 H;  4GIF A;  1GK4 A;  5GTH V;  1KYO E;  2B11 B;  3M06 A;  2WPR A;  2MKV A;  1HJ0 A;  5KAF E;  2ZVO B;  3TF5 A;  2QJY C;  1I8P A;  3AEE C;  2OAR A;  3TNU B;  1CIG A;  1GL2 D;  1URQ D;  4IOI H;  3K5B A;  4KJM A;  5KAF H;  3H1H J;  1YJ9 P;  1RF0 A;  2E76 C;  5CCH D;  4HKZ H;  2KZJ A;  1L0L J;  2RKL A;  3ZIY A;  2ZYG A;  1KFN A;  2NZ2 A;  4I2L C;  1USE A;  1OZH A;  1PPJ E;  1HGV A;  1SQQ G;  1IRV A;  1G2C A;  1L9J C;  1U7J A;  4JF7 A;  1SFC D;  1NMI A;  3O8Z A;  1N7S C;  2Q3E A;  2FYU G;  3KZI V;  1HRC A;  1HUC A;  3A7O A;  1C75 A;  3CX5 H;  3CXH D;  1YQ3 C;  2JJL A;  3BCC E;  2FYU E;  2J59 M;  1JY2 O;  1KMI Z;  1LTJ B;  2XV5 A;  1VQ4 P;  3S4R A;  1GZL A;  1DW2 A;  1QN2 A;  2R5B A;  4I1L A;  4FAN A;  3V2R A;  4N0K A;  1VPC A;  2N1T C;  4LJI A;  4OGQ C;  2WMM A;  1NTK E;  1CC5 A;  1M56 D;  2Y9Y A;  2Q9I A;  1WT6 A;  3MTU E;  1PZQ A;  3D6Z A;  1MKM A;  2FXM A;  1W2B O;  4RO0 A;  4OWF A;  1IQC A;  1AV1 A;  3HQ7 A;  2XU6 A;  3RK2 B;  3H1J J;  1SS1 A;  3CI9 A;  2FRC A;  1FI7 A;  1Q90 D;  2O01 H;  1JOC A;  3SFD C;  3NBS A;  3A2A A;  2YKO A;  1NU1 J;  3H1L J;  4DJG A;  1L2P A;  1OVV A;  3DR0 A;  3DP5 A;  1QL3 A;  3B5N B;  2V08 A;  5AVS B;  1OFC X;  351C A;  1D7M A;  1HJ3 A;  1NTZ J;  1S5L V;  4WQ7 A;  1FDM A;  3IAO A;  3MHV A;  4NPD A;  3KPE A;  3S1K A;  3WMM 0;  1LTI C;  5CIF B;  2K9J B;  1L0N G;  5CIH B;  5KLI B;  3IFM A;  2YCC A;  1IFM A;  3WC8 A;  5DJQ B;  1ZP0 C;  3H1I E;  2YO3 A;  5DF5 A;  1CRI A;  3GLM A;  3L73 D;  1KIL C;  2N3B A;  1NO4 A;  2B89 A;  4JCG A;  2ZYD A;  2Q1K A;  1BCC E;  3W67 A;  3VN0 A;  1KD1 Q;  3BCC J;  1RZ6 A;  4D6T G;  1LS9 A;  4H0L B;  2Z5I A;  1N86 A;  1PPJ G;  1C2R A;  2OYI A;  1U57 A;  2C9X B;  3V2Q A;  1JTH B;  4H13 D;  2OTL P;  4PJ0 V;  3JBT B;  3V4Q A;  1NTK K;  2N18 C;  1HH7 A;  5AW9 B;  1RF1 B;  2HR3 A;  2KK7 A;  451C A;  4U3F J;  2ZXX A;  4ASV A;  2Y0D A;  1RH5 B;  1M60 A;  4RES B;  1KYO D;  1YBK A;  2LXC B;  3CC4 P;  4UB8 V;  2IYP A;  4AAM A;  2H8P D;  1CIE A;  1JCD A;  3I55 P;  1LMS A;  1H9X A;  3H1J E;  3LIE A;  2AXT E;  2GIW A;  1E29 A;  2YQB A;  3L74 G;  3M0D A;  5AVX B;  5AVU B;  1YJW P;  3L4F A;  1X9V A;  2HOD B;  3CL3 D;  1AYG A;  3QWO C;  4QAO A;  1LJ2 A;  3P8M C;  3VRD A;  3U59 A;  1M7L A;  3VP9 A;  2YXQ B;  1K04 A;  1H89 A;  4YTP C;  1PPJ D;  3PXT A;  4H0K A;  1ZME C;  1VQ8 P;  1SFC C;  5CCG C;  1RY3 A;  1NU1 G;  3H1L G;  1L0L D;  1FE6 A;  2ZXY A;  3C1L A;  3VNW A;  5H2F E;  5GTI E;  1KYO H;  3Q5P A;  2WSF H;  4U3F E;  1GW4 A;  3SXT A;  1HGZ A;  2KSE A;  1GJQ A;  3L74 E;  4C46 A;  2XND H;  4D6T E;  1K9M Q;  3Q3D A;  1NML A;  5AW4 B;  3L72 J;  4R4M A;  1QEX A;  3T97 A;  1FBM A;  2IBZ D;  3HE5 A;  1MUU A;  1GIW A;  1AVO A;  1RF1 C;  1AJY A;  4ASW A;  4L73 A;  3IN6 A;  3HUS C;  3AEC C;  1QL4 A;  5KJ7 D;  1NTK J;  2Q6Q A;  3NMD A;  3CX5 I;  1VYD A;  4L74 A;  1FI9 A;  155C A;  1W2L A;  2A45 G;  1EC5 A;  2LR2 A;  3EQ2 A;  2KLV A;  1KIB A;  1GQ1 A;  3L70 J;  3L72 E;  2OYH B;  2AXT H;  2ZT9 C;  1T2K C;  1GU4 A;  1FZE A;  3TYY A;  1S6V B;  3L74 D;  2CK3 H;  1PL5 A;  2M5A B;  1LNQ A;  4I6M C;  2FXP A;  2WWW A;  4WQ9 A;  1FOS F;  1KQG B;  3Q5R A;  1R8E A;  3TGU E;  3FWN A;  1IO3 A;  1CSW A;  4PJ0 E;  1FZF A;  5AVY B;  4PJ0 H;  1SQP J;  2FXO A;  5CBO A;  1BE3 E;  5KAI V;  1FS0 E;  2L5G B;  2WZ7 A;  1KOR A;  1PP9 D;  1WVE C;  4Q5P A;  1X22 A;  4U7J A;  2Y0C A;  1SQX G;  1ZZH A;  2Z4E A;  5CCH C;  2XKM A;  3JCU E;  3T97 B;  1FZA A;  2I1K A;  2VHD A;  1M1J C;  1CHJ A;  1VQL P;  1YIT P;  1LP1 A;  3ITK A;  3RN0 A;  1GL2 A;  1URQ A;  3HD7 B;  1N15 A;  2IDB A;  1OW8 A;  1QL2 A;  1HJ5 A;  3IR9 A;  1BSN A;  3H1J G;  1CSB A;  4I7Z B;  1CRY A;  1NTZ E;  4ZNC A;  1A2S A;  1CYI A;  2D2C C;  2KNC A;  2N9Y B;  4WY4 B;  1ZRT D;  4HB1 A;  3NBT A;  3HUS B;  3BAT A;  1LWU B;  1NAY A;  1JY2 P;  1LTJ C;  4K3A A;  1N2D C;  4H44 C;  2GC4 D;  2LIR A;  1NTM J;  3AE9 C;  2ZFC A;  3B71 A;  1S9K E;  3H25 A;  1NTM E;  3L75 G;  2HG5 D;  2UWJ E;  3V2N A;  3AE2 C;  3RGU A;  5DJT B;  3SWY A;  1CCR A;  3MK7 B;  2OYI C;  1N90 A;  3A0B V;  1IK7 A;  2C0W A;  1HJB A;  1M1J B;  3TNU A;  1PGO A;  3HTK A;  3O0R C;  5CCG D;  1RAP A;  1QX8 A;  2CPB A;  2QM8 A;  5KLI C;  1M6Z A;  1FHB A;  5KAI H;  2BCC G;  1H0T B;  2JP3 A;  1CYJ A;  4OGQ D;  3H1K D;  1T8Z A;  4WB4 A;  2B12 B;  3WUU A;  3LW5 J;  3TDK A;  3E1I A;  1SP4 A;  2WSC H;  4HYT B;  1NTK D;  1ZR4 A;  1SQB K;  1JY3 P;  1S5L H;  1JM0 A;  1M70 A;  2IFM A;  3OCD A;  1R5L A;  1XTC C;  1AFO A;  3WUT A;  2PAC A;  5TIS V;  1VQN P;  1PGP A;  3PH0 A;  1SQB G;  4GDO A;  4AX3 A;  2OYI B;  2B4Z A;  1HVV A;  2DW3 A;  5GTH E;  2C9N Y;  4H13 B;  1MZ9 A;  2YMK A;  4OGQ B;  1LTT C;  3ORV A;  1RF0 C;  1FZC B;  1DEE G;  1CED A;  1KFM A;  1I8O A;  3MUD A;  1LGH B;  3A0H E;  2ZT9 B;  4FA9 A;  2C8S A;  3CCU P;  4L76 A;  3TGU G;  5AW3 B;  2ZT9 D;  2AI5 A;  1UIX A;  1EQ7 A;  2K1A A;  1QKS A;  1KX7 A;  1DD3 A;  5APY A;  3L4M A;  4EIC A;  1IRW A;  3GG2 A;  2WPS A;  1LWU C;  4EDF A;  1NOH A;  1SQP K;  2NRG A;  1GW3 A;  1EDI A;  2KS1 B;  1N73 C;  1A02 J;  3HE5 B;  2KI7 B;  1H1O A;  2LIT A;  3CYT I;  1L4A A;  1N7S B;  1Y9B A;  1LWU A;  1GTW A;  1NVO A;  2M0B A;  1QYZ A;  3CD6 P;  1AOF A;  3I5C A;  1YIC A;  1JCC A;  1HJ4 A;  4M3L A;  1KB9 H;  2C1D A;  5DFS A;  2WIT A;  1ZR2 A;  1X0T A;  2PRR A;  5H2F H;  1BDD A;  4RSZ A;  1DII C;  3L70 D;  3P7K A;  3E7K A;  3PHL A;  3ZOX A;  2KLU A;  2FKW B;  1SQX K;  3OA8 B;  3GF3 A;  4AUW A;  3L37 A;  1I6E A;  4PV1 B;  3RK3 E;  1KQL A;  2RH0 A;  1SQQ D;  1KZU B;  2GC7 D;  1YYC A;  2NPS D;  1PP9 G;  1CRJ A;  3CXH I;  3IF4 A;  5AVW B;  3PLN A;  2D2C D;  1Y47 A;  2HYN A;  2YKP A;  2BH4 X;  1KQS O;  5AW5 B;  1K3G A;  3VMY A;  1M90 Q;  1SVF A;  2B87 A;  2A06 G;  4EOT A;  3M9B A;  3Q1M A;  1S9K D;  2ITA A;  3TGU J;  3SLE A;  2KS1 A;  4FA1 A;  1S2E A;  4H44 B;  5APW A;  3V4W A;  3KDP B;  1NTZ D;  1EXI A;  1KV4 A;  3KYQ A;  4AYC A;  2XDJ A;  1FJ0 A;  4WY4 C;  3R4Y A;  4AAO A;  4U3F G;  2RN0 A;  2OTK E;  1NU1 D;  3H1L D;  1LC2 A;  2K9Y A;  1N7S A;  4R4L A;  1DH3 A;  2Z5H A;  2E43 A;  1W5C T;  1SQX E;  1BL9 A;  4RJT A;  1A56 A;  3WFC C;  1KX2 A;  5CJ0 A;  4O9B A;  1B7V A;  3FWL A;  3AED C;  4JBZ A;  1CNO A;  3H32 A;  2E74 C;  1LT9 A;  2KUB A;  3CCQ P;  4H0L D;  1M1J A;  1Y8A A;  1C6O A;  2FYN B;  4Y5R A;  2CA3 B;  1H32 B;  4NPE A;  1VF5 B;  5APU A;  1BE3 G;  1T2K D;  1ZOY C;  3VMX A;  2IX7 C;  2FBW C;  2IPP A;  4N3Y B;  1P84 E;  4DY9 A;  2BAS A;  3H1K G;  2FY8 A;  3B5N C;  3OCD B;  1KIL A;  5B66 H;  1U74 B;  2Y9Z A;  2WSF J;  1AKK A;  2JEE A;  1JEK A;  3RK3 B;  4CPG A;  3N4X A;  3PP5 A;  3SWK A;  1R0Q A;  4N78 D;  5AVR B;  1NU1 K;  3CME P;  1T3U A;  1FZG A;  1W2E A;  4YPC A;  4Z1M H;  1N73 A;  3TGU D;  3VYM A;  2PFX A;  1JY3 N;  1VQ6 P;  3O6Q A;  2JWA A;  1HRO A;  4OVN F;  1HF9 A;  3SSU A;  2B9B A;  1IO4 A;  1RE3 C;  1J1E B;  1S5L E;  1J1E C;  1NKN A;  1QVG O;  4DCK A;  1YNR A;  1MG3 D;  4IFF A;  4ZKP A;  4GYD A;  3GF7 A;  1NH4 A;  1P84 D;  1SQX J;  2P1J A;  1JTH A;  2BEZ F;  3WU2 H;  3CCE P;  4U3F D;  5DJQ C;  2B10 B;  1FOC A;  4W7Y A;  1KIL B;  1ZRT E;  2KB7 P;  1A8C A;  1RZ5 A;  3ZOO A;  2I8D A;  3WU2 E;  4UB6 E;  4FA5 A;  4XXL A;  1L4A D;  2A06 E;  1AVY A;  3OJA B;  3G6E P;  1VF5 C;  3FXE A;  4AAL A;  2D0S A;  4BRY A;  1H8A A;  1U75 B;  1CSX A;  5AW8 B;  3M97 X;  3BAS A;  3G4S P;  4JPZ B;  2M3E A;  3L71 J;  3FX0 A;  4IL6 E;  1J1D B;  2ZON G;  1IFP A;  5APT A;  2CE0 A;  4EI2 A;  1SQP G;  3HD7 A;  1KB9 I;  1KN7 A;  1DX7 A;  2FFD B;  3VMA A;  1H88 A;  2I1J A;  4PD4 I;  1CRC A;  3AEF C;  5EFW B;  4BXL A;  1RQU A;  5CIB B;  3M0D C;  2P67 A;  4BRY B;  3X39 A;  3SWS A;  4IL6 X;  2OZ1 B;  3W68 A;  3AE7 C;  5E79 H;  3RK2 D;  3HE4 B;  1CXA A;  2BGV X;  2KOG A;  1ETP A;  2Q5U A;  1MG2 D;  3L70 G;  1USD A;  5KLV E;  2ZOO A;  3WU2 V;  1SFC A;  3GHG B;  2B0Z B;  2C2C A;  2H43 A;  4BWN A;  4H0L C;  3MIW A;  3O20 A;  4ZKU A;  2YXR B;  1OMI A;  2CXB A;  4GKG A;  2P2U A;  4WQC A;  1GDT A;  1PP9 E;  4XFJ A;  1PP9 J;  1HZV A;  3II6 A;  5CBN A;  1FZC C;  1J3S A;  3KXD A;  3P8C D;  3PJS K;  2MHM A;  2KIK A;  4JYC A;  2W90 A;  1H31 B;  5E79 V;  4LLH A;  3B5N D;  3S9O A;  2M3B A;  1ZW0 A;  3G3Z A;  3LW5 H;  2ZVN B;  2WSC J;  2QIW A;  4WQE A;  1SFC B;  1EB7 A;  1GL2 C;  1URQ C;  1I54 A;  1DW0 A;  4J20 A;  2WT7 A;  2ZYA A;  3VYI A;  2E75 C;  4NPF X;  1SQV D;  3MD0 A;  5CCH A;  3JSV C;  1NTM D;  4WWI A;  1GU5 A;  3L4O A;  2QRX A;  3A3Y B;  2IBZ E;  1ZN5 A;  1KYO W;  3PXW A;  1OVR A;  3O1Y A;  5KTB A;  3MUD C;  1K8A Q;  5TIS E;  3WFD C;  3H32 B;  2AEM A;  2MJZ A;  3A5T A;  4C7N B;  3HE4 A;  3Q2Y A;  2OYH C;  1FJP A;  1CRH A;  1MFT A;  3VMZ A;  3A0H V;  3BCC G;  4XE5 B;  1LTA C;  2ZXE B;  1M1K Q;  3AE4 C;  3RBZ A;  2B88 A;  2PAJ A;  2P10 A;  5EXQ A;  1QLE D;  3TK1 A;  1I6D A;  3AEB C;  1ZXG A;  3CC2 P;  4L1Q A;  3CXH H;  3MGN A;  4QMA A;  5KLV G;  2RMZ A;  5CHX A;  1I55 A;  4D6T J;  2GB8 B;  1I5T A;  3HUS A;  1M57 D;  2HLO A;  3A0H H;  3CWB E;  4UB8 E;  2ZBO A;  1NTZ G;  3SVW A;  3C2C A;  1FZB A;  3CWB G;  3BCC D;  1OAE A;  2BCC E;  2PGD A;  1CIH A;  3A9F A;  1GL2 B;  1URQ B;  1SQB D;  3EFG A;  2A06 D;  2C1V A;  1KIL D;  1E8E A;  2QJY B;  4FB1 A;  3MZW B;  3WUV A;  1COT A;  3G9R A;  5C9M A;  5AW2 B;  1CRG A;  1CHI A;  1N50 A;  1EZV D;  5CIE B;  2JR8 A;  3L35 A;  4DOJ A;  3OA7 A;  4KHX A;  3USS A;  3L71 E;  1NYH A;  1R5S A;  2HFE D;  3A0B E;  3P32 A;  5KJ7 C;  2FFD A;  1VQM P;  2N1T A;  3VOP A;  1G1I A;  1YIJ P;  2KZI A;  2HPC B;  1CYC A;  4N6J A;  3L75 J;  1TU3 F;  3QH9 A;  4UB8 H;  3V2P A;  3AE5 C;  3G71 P;  3AE1 C;  1YTC A;  4UB6 V;  4MU8 A;  3CCV P;  5GTI H;  1H9Y A;  1COR A;  5K5G B;  3ZBM A;  1PIX A;  1JMB A;  1FOS E;  4EIJ A;  3ABV C;  1JNM A;  1OX3 A;  2W8Z A;  4I7Z C;  2MTA C;  3BRT B;  4XYD B;  1LFM A;  3H6P A;  4L3H A;  1IK9 A;  3CU4 A;  3ZCF A;  1U7M A;  4C7R A;  4FA4 A;  2KYV A;  2HPC A;  4GOE A;  5KJ7 A;  1NWQ A;  5TIS H;  3L73 E;  1L0N E;  1RQV A;  2N1T D;  1C6R A;  3M0A A;  3OW2 O;  1VQ7 P;  2YKQ A;  5B6Q A;  1F1F A;  2V7Q H;  2L4D A;  1NGM B;  1EXJ A;  1L0L G;  3CWB J;  2H89 C;  2KP8 A;  1EDL A;  3L72 D;  3D71 A;  1G2C B;  2EXV A;  3FGA D;  5APX A;  5KLV J;  2W83 C;  3GMA A;  4A7P A;  5B66 E;  2YK3 A;  1BE3 D;  4FAV A;  1UII A;  1H33 B;  1DEB A;  1CXC A;  2JDI H;  1L4A C;  1WEJ F;  1Z56 A;  2Q3I A;  1M8O B;  1PV3 A;  1VF5 D;  3CLQ A;  5AVQ B;  1RF1 A;  2OYH A;  2IYO A;  5CJ4 A;  1DVV A;  1AOQ A;  1NU1 E;  3H1L E;  1FDO A;  3CX5 E;  2IZ0 A;  2N1T B;  1YJN P;  2K88 A;  1FCD C;  3TYI A;  1NTK G;  3CPW O;  2W27 A;  3SWF A;  2N18 B;  3D0W A;  2XNX A;  1OVU A;  4UB6 H;  1JY3 O;  5BU8 B;  1K73 Q;  1Q7Y Q;  2O1K A;  3RL0 g;  2YNY A;  2HOD A;  1BGY D;  1GD2 E;  2K3R A;  2AEJ A;  5APQ A;  5GTI V;  1BSH A;  2IZ1 A;  4JQ0 D;  1HZU A;  5AUR A;  2CPS A;  2CA4 B;  4C7N A;  2WSS H;  2GA1 A;  2KXP B;  1CTY A;  1LT1 A;  1L0N K;  1YFC A;  3HTK B;  1BDC A;  2KNC B;  2QJK B;  1VQ9 P;  1S3J A;  4YXW H;  1DW3 A;  2N3Y A;  4Y28 J;  4AQR D;  5CIC B;  4W80 A;  1L0N D;  4PV1 C;  1RE4 C;  3CCL P;  4IFD K;  4K3I A;  2NPS A;  3LID A;  1VQK P;  4GT1 A;  3V6I A;  3SJL A;  3M91 A;  4ZMD A;  3V5B A;  3P8C E;  3I56 P;  2WTY A;  1S4X A;  2YMY A;  2YIU C;  1SQQ E;  1T6A A;  2ZAE B;  1LTS C;  3BRV B;  2G3A A;  3OAK A;  2OGU A;  3NXS A;  1H32 A;  4HH2 A;  2LKM A;  3H1K J;  2L91 A;  2E5T A;  2Q7C A;  2PCC B;  2GUV A;  2QM7 A;  3L74 J;  5L8R J;  1YHQ P;  2WSE J;  1E5W A;  1JY2 N;  2QJK C;  3SFE C;  2QJP B;  1DT1 A;  2E76 B;  3N7N A;  2C9L Y;  1BCC J;  3PXS A;  5KKZ C;  3GW6 A;  4H44 D;  2V07 A;  3WUI A;  1VQP P;  5CYT R;  2E75 D;  3B8E B;  1N73 B;  3H1I G;  3MK7 C;  3CCS P;  5TJH A;  2OYO A;  1IZN B;  3AE6 C;  1PGJ A;  2M5A A;  4EYY Q;  3H1J D;  2A45 I;  2QA4 P;  3GHG A;  1CCH A;  1LTB C;  3KZI H;  4IL6 H;  2Y0E A;  2OTJ P;  1YCC A;  1DW1 A;  1FC2 C;  2FYU K;  1FU1 A;  2D2C B;  2JO1 A; 
#chains in the Genus database with same CATH homology
 2CXB A;  1CCR A;  3MK7 B;  1N90 A;  3PTZ A;  4WQC A;  3A0B V;  5GTH V;  2B11 B;  1GKS A;  1HZV A;  1CSU A;  3O0R C;  5B5E V;  3PRJ A;  5C0Z A;  1RAP A;  1J3S A;  3TF5 A;  1I8P A;  5KKZ B;  1M6Z A;  2MHM A;  1CIG A;  1FHB A;  2N9I A;  1H31 B;  5E79 V;  2ZZS 1;  4WQA A;  1CYJ A;  3H1K D;  1C6S A;  3ZIY A;  2B12 B;  4EIF A;  3TDK A;  3HQ6 A;  1SQP D;  1NTK D;  1DIQ C;  2JQR A;  3PH2 B;  1CTJ A;  4WQE A;  1EB7 A;  1M70 A;  1I54 A;  1IRV A;  1DW0 A;  4J20 A;  4EIE A;  3OCD A;  3ZOW A;  1L9J C;  2PAC A;  5TIS V;  4GED B;  1SQV D;  1NMI A;  1NTM D;  4AX3 A;  4PD4 D;  3L4O A;  2Q3E A;  2CE1 A;  2B4Z A;  3KZI V;  4H0J A;  1GU2 A;  1HRC A;  1C75 A;  3CWB D;  2O3J A;  1KB9 D;  3CXH D;  1KYO W;  3HQ9 A;  3ORV A;  3PXW A;  3WFE C;  1CED A;  1I8O A;  3O1Y A;  3WFD C;  2DVH A;  1BCC D;  4FA9 A;  1YIQ A;  2C8S A;  1L9B C;  1DW2 A;  1QN2 A;  4EID A;  5H2F V;  2BPB B;  1CRH A;  4FAN A;  2AI5 A;  4N0K A;  3A0H V;  1QKS A;  1KX7 A;  4LJI A;  3H1I D;  4IL6 V;  3L4M A;  4EIC A;  1IRW A;  1N9C A;  3NWV A;  3GG2 A;  4EDF A;  5EXQ A;  1CC5 A;  1I6D A;  4L3G A;  1IQC A;  1RAQ A;  1H1O A;  2LIT A;  3CYT I;  3HQ7 A;  4L1Q A;  1H33 A;  2FRC A;  2RMZ A;  1I55 A;  2GB8 B;  1FI7 A;  1I5T A;  1QYZ A;  3NBS A;  3CX5 W;  1AOF A;  1YIC A;  1HJ4 A;  2ZBO A;  4PWA A;  3SVW A;  2C1D A;  3C2C A;  3DR0 A;  5DFS A;  3BCC D;  1KV9 A;  3DP5 A;  1QL3 A;  4RSZ A;  1DII C;  1IZL 0;  1OAE A;  2V08 A;  3L70 D;  3PHL A;  1CIH A;  351C A;  3ZOX A;  1HJ3 A;  3A9F A;  1S5L V;  1SQB D;  3OA8 B;  2A06 D;  2C1V A;  4WQ7 A;  1I6E A;  1E8E A;  2QJY B;  4FB1 A;  3CXH W;  1SQQ D;  1CIF A;  1COT A;  2GC7 D;  5CIF B;  5C9M A;  2K9J B;  1CRG A;  1CHI A;  1N50 A;  1EZV D;  5CIE B;  5CIH B;  5KLI B;  1NNO A;  1CRJ A;  2YCC A;  3WC8 A;  5DJQ B;  3PLN A;  5DF5 A;  1CRI A;  3L73 D;  3L75 D;  1CTZ A;  2N3B A;  4JCG A;  1NIR A;  2BH4 X;  1CYC A;  2BLF B;  1K3G A;  2BCN B;  1RZ6 A;  1LS9 A;  1C2R A;  2C1D B;  2C9X B;  4WQB A;  1YTC A;  4UB6 V;  4MU8 A;  3SLE A;  4PJ0 V;  3JBT B;  4YE1 A;  2KS1 A;  2N18 C;  4FA1 A;  1HH7 A;  2FWL A;  3DMI A;  4PW9 B;  451C A;  1NTZ D;  2BH5 X;  2I8F A;  2Y0D A;  1M60 A;  1H9Y A;  1KYO D;  1COR A;  3ZBM A;  1FJ0 A;  4AAO A;  5CID B;  4UB8 V;  5KLV D;  2RN0 A;  4AAM A;  1CIE A;  1NU1 D;  3H1L D;  3CX5 D;  1LMS A;  1H9X A;  1LC2 A;  2AIU A;  2MTA C;  1W5C T;  2N9J A;  2GIW A;  1BL9 A;  4XYD B;  1E29 A;  4RJT A;  1LFM A;  1A56 A;  4L3H A;  1KX2 A;  1OCD A;  3WFC C;  2YQB A;  3CU4 A;  1B7V A;  3FWL A;  1FI3 A;  3ZCF A;  1K3H A;  4FA4 A;  1CNO A;  1AYG A;  4QAO A;  1CHH A;  3VRD A;  1GDV A;  1C6O A;  1C6R A;  2FYN B;  3OA8 A;  1PPJ D;  4Y5R A;  2CA3 B;  3PXT A;  1H32 B;  4H0K A;  1C2N A;  4V2K A;  5B6Q A;  1F1F A;  2L4D A;  1L0L D;  2ZXY A;  3VNW A;  3L72 D;  4DY9 A;  2C1U A;  3OCD B;  2EXV A;  3L71 D;  2YIU B;  1U74 B;  1AKK A;  4A7P A;  2YK3 A;  1BE3 D;  4FAV A;  1H33 B;  4WQ8 A;  1CXC A;  3SXT A;  2FYU D;  1GJQ A;  2QG4 A;  1R0Q A;  1WEJ F;  1NML A;  1DVV A;  1AOQ A;  3TGU D;  4AAN A;  3VYM A;  1SQX D;  1FCD C;  3TYI A;  2OZ1 A;  2JWA A;  2IBZ D;  1JDL A;  1HRO A;  2N18 B;  1GIW A;  2XTS B;  2HV4 A;  1MZ4 A;  1QL4 A;  1BGY D;  5CIG B;  1E2R A;  1VYD A;  5GTI V;  1FI9 A;  155C A;  1W2L A;  1YNR A;  1MG3 D;  1HZU A;  3CP5 A;  1YEA A;  5IY5 1;  5AUR A;  4GYD A;  2CA4 B;  1KIB A;  2DGE A;  3ZOY A;  2JTI B;  3RMZ A;  1CTY A;  1GQ1 A;  1P84 D;  1YFC A;  2KNC B;  2QJK B;  1S6V B;  4KMG A;  1DW3 A;  2N3Y A;  3L74 D;  4U3F D;  5CIC B;  5DJQ C;  1L0N D;  2B10 B;  4D6T D;  1FOC A;  4WQ9 A;  1A8C A;  4K3I A;  1RZ5 A;  3ZOO A;  2BCC D;  4FA5 A;  4XXL A;  3SJL A;  1DVH A;  1LC1 A;  1YEB A;  4AAL A;  2D0S A;  1CO6 A;  3H1H D;  1IO3 A;  1CSW A;  1U75 B;  1CSX A;  1H32 A;  3M97 X;  4P4Q B;  1H31 A;  5KAI V;  2L91 A;  4O1Q A;  2PCC B;  5KAF V;  2ZON G;  1PP9 D;  4NFG B;  2CE0 A;  1WVE C;  4Q5P A;  1F1C A;  2Y0C A;  1ZZH A;  3HQ8 A;  3KHU A;  1C52 A;  2VHD A;  2QJP B;  1DT1 A;  1CHJ A;  3VMA A;  4WQD A;  3RN1 A;  1CRC A;  3ITK A;  3RN0 A;  1N15 A;  3PXS A;  5CIB B;  1HCM A;  1HJ5 A;  3GW6 A;  2AXT V;  2D0W A;  2V07 A;  3X39 A;  3SWS A;  2OZ1 B;  3WUI A;  1CRY A;  4O1W A;  1A2S A;  1CYI A;  1CXA A;  2BGV X;  5CYT R;  1ETP A;  2N9Y B;  1MG2 D;  1ZRT D;  3MK7 C;  3NBT A;  3O5C A;  1C7M A;  5TJH A;  2ZOO A;  3H1J D;  3WU2 V;  2PCB B;  2B0Z B;  2GC4 D;  2LIR A;  2C2C A;  2ORL A;  1CCH A;  2Y0E A;  1KB0 A;  1YCC A;  1DW1 A;  3O20 A;  1CSV A;  3RLM A;  3WFB C;  5B66 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...