3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
2BPBB 1HZUA 3DR0A 4JCGA 2YCCA 1H9YA 1SQBD 2CE1A 1PP9D 4KMGA 2BGVX 1AOQA 2L91A 1U74B 4H0JA 3O1YA 4WQAA 3DMIA 1CRGA 2VHDA 2XTSB 2ZONG 1COTA 3L74D 3VMAA 5E79V 4U3FD 1EB7A 2Y0CA 2GIWA 3HQ7A 1KB9D 2N9JA 4FB1A 1SQPD 1YCCA 1SQQD 1OAEA 3O20A 2ZXYA 5CIFB 3X39A 3CXHW 1N15A 2FRCA 3HQ9A 2LIRA 1H31A 2PCCB 5GTIV 3ZIYA 4O1QA 3L75D 2N9YB 1FI7A 2QJKB 2QJPB 1B7VA 2PACA 4IL6V 2C9XB 1HZVA 1CHHA 2AXTV 2C8SA 2DVHA 1M60A 1ZZHA 3ZOXA 1CIEA 3GW6A 3TYIA 3CX5W 1CTYA 2N9IA 3CU4A 4UB6V 1NMLA 1RZ6A 1CNOA 2FWLA 3DP5A 1C6SA 3GG2A 1I5TA 3KZIV 1DIQC 1DW1A 5DJQB 2IBZD 3PRJA 1NNOA 4N0KA 1K3GA 3RLMA 2Y0EA 1KYOW 4WQBA 4PD4D 3PXSA 2KS1A 1N90A 1CORA 1HJ3A 2JQRA 3O0RC 4H0KA 3L4OA 2YIUB 4K3IA 3NWVA 1CCRA 2O3JA 3RN0A 1CSWA 4EDFA 1A2SA 5KLIB 1PPJD 4AX3A 2HV4A 1AYGA 1RAPA 3L72D 2GC4D 1KX7A 1NMIA 5CYTR 1DVVA 4FA4A 1QN2A 1CHJA 3MK7B 2LITA 1CYJA 1YNRA 3VNWA 2AI5A 1FI3A 4Y5RA 2L4DA 1I54A 4J20A 1C52A 4WQDA 2N3BA 1CRCA 1IRWA 2QJYB 1HJ4A 4EIEA 1DT1A 1CTJA 3NBTA 4WQCA 2Q3EA 3PTZA 2C1DB 3WFBC 3VYMA 5CIDB 1ZRTD 4A7PA 155CA 4UB8V 3WC8A 1L0ND 1YEBA 1A56A 3HQ8A 1C2NA 3NBSA 3H1KD 5TJHA 3C2CA 4PW9B 1E29A 3M97X 3TF5A 1BE3D 2FYNB 2N18B 4RSZA 2C1DA 2ZOOA 1LC2A 2CE0A 1W2LA 2CA4B 3TGUD 3ZOWA 4FA5A 5C0ZA 1CC5A 5CIBB 1L0LD 3ORVA 2BLFB 5CIGB 1IZL0 4EIDA 5EXQA 1GIWA 1IQCA 1YICA 1SQVD 1L9BC 3WFEC 1GDVA 1HH7A 1RZ5A 3PH2B 1WEJF 1WVEC 1LFMA 1DIIC 1E8EA 1H1OA 3SVWA 3CWBD 1C7MA 3FWLA 3SLEA 3CYTI 1C6OA 1MG3D 1QL4A 4P4QB 1S6VB 1QKSA 2B4ZA 2BCNB 5KAIV 5KKZB 1CHIA 5DJQC 1YIQA 1E2RA 5C9MA 1J3SA 1NU1D 1HROA 5AURA 2RN0A 2V08A 4D6TD 4L3GA 1SQXD 4GYDA 5CIHB 3L71D 1NIRA 4RJTA 4PWAA 4L3HA 4YE1A 3WU2V 2OZ1B 1GQ1A 2C1UA 351CA 3O5CA 1LC1A 3ZCFA 1RAQA 2B10B 3WFCC 1MZ4A 1I8OA 1C75A 1U75B 4L1QA 1S5LV 2EXVA 1KB0A 1ETPA 3MK7C 4FANA 1CIFA 1FI9A 5B6QA 1FHBA 1CRYA 1QYZA 1NTZD 3H1JD 2BH5X 3H1LD 2BCCD 451CA 1I6DA 4WQ8A 4AAOA 2MTAC 1KV9A 2B0ZB 2MHMA 1CIGA 1K3HA 1NTKD 1CYCA 4DY9A 1C2RA 3RMZA 1OCDA 3ITKA 2CA3B 2DGEA 1CXCA 3RN1A 1R0QA 3BCCD 2YQBA 3WFDC 2D0SA 1CO6A 4EIFA 5B66V 1IRVA 3PHLA 2V07A 1I55A 5GTHV 1NTMD 1BCCD 4NFGB 4FA9A 3VRDA 1YFCA 2B12B 5KLVD 4AALA 2CXBA 2FYUD 1EZVD 1CSVA 2AIUA 1HRCA 1IO3A 2GB8B 5CIEB 1GJQA 2N18C 3OA8B 1H31B 1I8PA 4WQ9A 3ZBMA 3L73D 3A0BV 1JDLA 1GU2A 2GC7D 1CEDA 3PLNA 3CX5D 2Y0DA 5TISV 4XXLA 1VYDA 3OCDB 3KHUA 1I6EA 3A0HV 5H2FV 3H1HD 1H9XA 1LS9A 2PCBB 2YK3A 1KYOD 1YTCA 4AANA 1DW2A 3OA8A 1CIHA 1FCDC 1C6RA 1A8CA 3JBTB 1P84D 2D0WA 1AKKA 2RMZA 2KNCB 4FAVA 4WQ7A 3WUIA 1CTZA 1H32B 2K9JB 1CRIA 2ORLA 2ZZS1 3OCDA 3L70D 3PXTA 4FA1A 4XYDB 1CXAA 5DF5A 3SXTA 1CSUA 5KAFV 1M6ZA 4WQEA 1N50A 1KIBA 4V2KA 1BL9A 3SWSA 1CCHA 3H1ID 5CICB 1H32A 2N3YA 2JWAA 4LJIA 1GKSA 1FJ0A 1N9CA 2C1VA 1H33B 5B5EV 2ZBOA 3TDKA 1F1CA 5DFSA 2QG4A 2A06D 3A9FA 1M70A 1CSXA 4Q5PA 1FOCA 5IY51 1QL3A 1HCMA 3ZOOA 3HQ6A 3SJLA 1CRHA 3PXWA 1DW3A 2OZ1A 4GEDB 1MG2D 2I8FA 4AAMA 2B11B 1KX2A 1DVHA 2BH4X 3CP5A 1H33A 1DW0A 4PJ0V 1LMSA 1W5CT 3ZOYA 1AOFA 1CYIA 2JTIB 4EICA 3CXHD 1F1FA 1CRJA 1BGYD 3L4MA 4MU8A 4QAOA 1HJ5A 1YEAA 1L9JC 4O1WA 2C2CA
chains in the Genus database with same CATH superfamily
3AE7C 2BCCE 2L5GB 3F89A 4KMGA 1U74B 1SQXK 1XTGB 2P10A 1S9KE 2O1KA 3BCCJ 4WQAA 3KPEA 1Q82Q 1CRGA 2VHDA 2ZONG 2WQYC 4UB8H 3L74D 5GTHH 3C8VA 3N4XA 1BCCJ 4U3FD 1EB7A 1HVVA 2Y0CA 2GIWA 2WT7A 1H88A 1OVVA 1CI6A 2Q6QA 1OZHA 1FOSE 1SQQD 1VQNP 1NGMB 3X39A 2KIKA 5AW5B 2D2CB 1BE3E 2FRCA 5GTIV 3ZIYA 5CMZA 4EIJA 1EXIA 2ZAEB 1T3UA 4W7ZA 3V2RA 2XV5A 2QJKB 1KORA 4B86A 3P32A 1NTZG 2BCCG 4IL6V 2OYHB 1YJNP 1HZVA 1L4AB 2KS1B 2OTLP 1CHHA 2AXTV 1NH4A 4OGQB 1ZZHA 3CU4A 1NMLA 3DP5A 1C6SA 3GG2A 1I5TA 4PD4H 1ZN5A 5DJQB 2IBZD 2Z4EA 1LTGC 3CD6P 1PGOA 1AVYA 1K3GA 2Y0EA 4WQBA 1AQTA 3AECC 1X8YA 2KXPB 2JQRA 4H0KA 3L4OA 2C0XA 4K3IA 3NWVA 1NU1J 4JYBA 4WWIA 2WWWA 2IYPA 3GMAA 2N1TA 1VQLP 5KLIB 1SQXE 1RAPA 3L72D 3GHGC 1DVVA 1CHJA 3H1IJ 3MK7B 1YNRA 5B5EH 3AE2C 1FZEA 2L4DA 1C52A 5AVXB 4N6JA 1VQMP 2Q3EA 4WQCA 4Y99C 2Z5IA 3M06A 3NFQA 3B4SA 3LW5H 3OAKA 3MGNA 155CA 2QM8A 1VPCA 1VQKP 4UB8V 1L0ND 2W6JH 4ZNCA 1LWUC 1FAVA 1SQXG 3ZDMA 3HUSB 1JUNA 2J58A 1JB0J 1VF5D 1JTHA 4RSZA 1J1EC 5APUA 3TGUD 3WUUA 1OVRA 3NXSA 3VOPA 3L36A 3CPWO 5CCGD 4KT0J 3L73J 1W5CE 2BLFB 1SFCA 3L74J 3TNUB 5E79H 5TISH 5EXQA 4U3FJ 3A0HH 5H2FH 4H0LD 2QJPC 3PH2B 1WVEC 1SQQJ 3H1HJ 2QRXA 1H1OA 1OIPA 3CWBD 1C7MA 3CYTI 2JKVA 2B4ZA 3VMZA 5AW9B 3V2NA 1NO4A 1E2RA 2V4HA 1M1KQ 1YJ9P 2OYHA 2Z5HA 4BWNA 1L4AA 1VQ6P 5AURA 1VDFA 2V08A 4D6TD 2K88A 5CIHB 2YKPA 3L71D 1NIRA 1H8AA 2YIUC 1LTJB 2BEQD 4PV1D 4NPDA 2P7JA 3ZCFA 3WFCC 1MZ4A 1C75A 2IZ1A 2HYNA 1WRGA 1RQVA 1K05A 1CIFA 1FI9A 1FHBA 3SWFA 3H1JD 2RH0A 3GF3A 1I6DA 2OTKE 3HTKB 4AAOA 2Q7CA 2M8RA 1CYCA 5KAIE 2QJYC 3RMZA 1PL5A 1OCDA 1N73B 1FDMA 3WFDC 1R5SA 1WT6A 2YKQA 4OWFA 5B66V 3CCRP 3Q5SA 1RF1B 1I55A 1Y8AA 1FJPA 3IFMA 1SP4A 3CMAP 5KLVD 3CCQP 3PH0A 2CXBA 2FYUD 1EZVD 1CSVA 3I5CA 2R3CA 3E1IA 1AA0A 1SFCC 1IO3A 3CX5H 1KQSO 2IBZI 1OW8A 1HGVA 1OMIA 1PP9E 1HTLC 1JDLA 2WSEH 1GU2A 1CEDA 1L0NJ 5APYA 1KYOH 4AUWA 5TISV 4XXLA 3JC22 1VF5C 3Q3DA 1I6EA 3A0HV 2WSFJ 5H2FV 4MN4C 5AW2B 2YO2A 3AE8C 1N86A 1AV1A 2NZ2A 2LXCB 2ITAA 1YTCA 3S9OA 4AANA 1DW2A 2ZFCA 3M9HA 1CIHA 3TGUJ 5AVWB 1DD4A 3JBTB 2K3RA 1P84D 5KJ7A 4DOJA 4UB8E 4RO0A 5GTHE 4WQ7A 3IN6A 5CJ4A 1H32B 2K9JB 3L4FA 1RF0A 2ZXEB 2YXQB 3L70D 1BDDA 2K1AA 2R5BA 4XYDB 4IOIH 4IFFA 5BU8B 3P8CE 1LNQA 1PP9G 5AVUB 1NOHA 5KTBA 1CSUA 4U7JA 3FX0A 5AW4B 2HLOA 2Q3IA 3CWBJ 1ZW0A 2PP6A 2M0BA 1GKSA 1KC8Q 5APSA 4DCKA 1CZQA 4OVNF 3WMM0 3MTUE 2A06D 1YIJP 1M70A 1CSXA 1KZUB 1N7SD 1QL3A 4PD4E 2O01N 3U1AA 1DD3A 1FZAA 3L71J 1GMJA 3HQ6A 3GHGB 1KILE 1DW3A 1MG2D 2I8FA 4AAMA 4N3YB 2IX7C 3CP5A 1H33A 1CSBA 3CXHH 1PPJE 4GIFA 2B9BA 2Y9YA 4WY4D 3HE5B 3R4YA 3HD7D 3ZOYA 4Y99B 1VQ7P 1CYIA 2JTIB 2E42A 4QAOA 1M8OB 2XNDH 1IK7A 1RE4C 1HJBA 2P2UA 3CI9A 1HZUA 1H89A 2YCCA 1H9YA 1SQBD 1KFNA 1YJWP 1NU1K 2WSFH 1N73A 5B5EE 3BRTB 1LWUB 1AOQA 2E43A 1KB9H 2PAJA 5BU5A 2HPCA 1FZCA 1COTA 1JY3N 3BCCE 1RF1A 1KTMA 1J1EB 1LT9C 1YI2P 2J5UA 4HYTB 5KJ7C 2E5TA 1PPJG 5KLVJ 4GODA 3H1KE 1LTBC 1SQPD 1YCCA 2C0WA 3MIWA 3O20A 4WY4A 4YXDC 1RF0C 5CIFB 3CXHW 3FXDA 1FZBA 2LIRA 1JCDA 1T3JA 2WPRA 1BSHA 1N8RQ 4O1QA 3L75D 2I1KA 1IZNB 1LTSC 2OTJP 1MUUA 2KK7A 2QJPB 2KYVA 1B7VA 5AVSB 4DZOA 2Y9ZA 2H7HA 1AFOA 3TYIA 1CTYA 2FWLA 1AJYA 3BCCG 1DIQC 1HBWA 2YXRB 2OARA 2FBWC 2GA1A 3RLMA 1GL2D 5E79E 2K9JA 2WSCH 3L70J 3A0HE 5H2FE 2KUBA 2YIUB 1M1JA 3RL0g 3A3YB 3V4QA 1W2BO 1GTWA 1CCRA 2O3JA 1DIPA 3RK3C 1EZVI 1NU1E 4EDFA 1A2SA 2HV4A 4CPGA 5CYTR 3E1RA 2WSSH 1QN2A 1SQQK 2LITA 1CYJA 2AXCA 1EDIA 2KLUA 2W6BA 5AVRB 5AW6B 1FI3A 3II6A 1NAYA 5APQA 1N7SC 3E7KA 4Y5RA 4JBZA 1I54A 3B5NA 2N3BA 1CRCA 1IRWA 2QJYB 2CPSA 1FZCC 4EIEA 3L35A 1DT1A 1CTJA 3NBTA 3H1LJ 1S9KD 3WFBC 1NTZE 1ZR2A 2E75D 2C9NY 3AE4C 1NTKJ 1P84I 1ZV8A 4WY4C 3HD7C 3WC8A 1NU1G 3HE5A 2M3BA 2K37A 1E29A 1SFCB 1T2KD 3TF5A 1BE3D 1DEEG 4HKZH 4LLHA 1XTCC 1NVOA 2CE0A 3H1IG 1QX8A 2CA4B 1SQBJ 3D6ZA 2PFXA 3RK2D 3H6PA 3UIAA 1LWUA 1KD1Q 3N7NA 5C0ZA 1VF5B 1JY3P 1IFPA 4I1LA 3EWKA 3MHVA 1URQD 1JCCA 4EIDA 3L73E 1GIWA 1IQCA 3P7KA 1HH7A 3CX5E 1AQ5A 1SQPJ 3KYQA 1Y47A 3LIDA 1DIIC 1E8EA 5BVZA 1M1JC 1SQQE 3H1HE 3SLEA 1FDIA 3C1LA 4GDOA 1KYOE 1QL4A 3MZWB 3L75J 3MD0A 4P4QB 4IL6X 5KAIV 5AVYB 3V2PA 5C9MA 2JDIH 2NPSD 1SQXD 2Q9IA 2M5AA 3VN0A 4GYDA 1NYHA 1L0NK 1VQ8P 5CBOA 4RJTA 4PWAA 1URQA 3KZIH 1G2CB 1PIXA 2W27A 3B5NC 3CCLP 3L73G 351CA 1RAQA 2B10B 2IBZE 1I8OA 4W7YA 1GW4A 3BRVB 2EXVA 4TLFA 2R3SA 4M3LA 2FXMA 1SQQG 3H1HG 5B6QA 5M1BA 1IFDA 1YTZT 3FGAD 4WQ8A 4O9BA 3JSVC 3G71P 1K3HA 2JEEA 2B88A 2O1JA 4OH8B 3ITKA 2DGEA 3RN1A 2YQBA 2O01J 3S4RA 1PGJA 1JNMA 3PHLA 5GTHV 1JM0A 1NTMD 1L2PA 4R4LA 1LT1A 2KLVA 2B12B 3RBZA 4AALA 5AVTB 2IBZG 1HRCA 2E75C 4ZKUA 5CIEB 3CXHE 1H31B 1JY2N 1LT9B 3ZBMA 3F5HA 3AE1C 2D2CD 1YYCA 1OWAA 2XU6A 1T2KC 1VYDA 3AEEC 1L0NE 1CW5A 1BE3J 1OXZA 2H88C 2R44A 4NPFX 5C39A 2CK3H 2GM4A 3RK2C 1IK9A 2OYOA 3OA8A 2H43A 1G1JA 1KB9E 2G8YA 1C6RA 1A8CA 3M9BA 2RMZA 1T6AA 1CTZA 2KP8A 1MFTA 4EI2A 1URQC 1CRIA 4JYCA 1YQ4C 3U59A 5KKZC 1QGKB 5CCGA 2VRSA 3SXTA 2E76D 2PGDA 4ASWA 1GD2E 3P8MC 1D7MA 3CCSP 2KNCA 3B8EB 1L0NG 1CCHA 5KLVK 4TT3H 2JWAA 1FJ0A 4L74A 1N9CA 3AEBC 1H33B 5B5EV 3TDKA 1F1CA 1FBMA 2QG4A 3RK3B 4WVZA 1QLED 1FOCA 3CCEP 5IY51 4L76A 3TGUG 3VMXA 1QL2A 1CRHA 1G2CA 2FY8A 3WU2H 2BASA 2B11B 1HGZA 3SWYA 1K9MQ 5AVVB 1DVHA 1N7SB 3HE4B 3L72J 1DW0A 1LMSA 1W5CT 1WMKA 3SFEC 2KZIA 2HPCB 1FZCB 3T97A 1TU3F 2YO3A 3L4MA 1BGYD 4MU8A 2HG5D 3OW2O 1L9JC 5APVA 4BRYA 1RY3A 1EXJA 2BPBB 3DR0A 4JCGA 3BASA 4WBAA 3SWKA 4XFJA 4WY4B 2CE1A 1PP9D 3CCUP 3HD7B 2ZVNB 2BGVX 1Y9BA 5CBNA 4H0JA 3O1YA 3DMIA 1Q90D 3W68A 1EC5A 1RE4A 1U7JA 3L71G 5E79V 1ZRTE 1NTMJ 1IO4A 1N7LA 1R8EA 4L73A 3HQ7A 2ZYAA 1M7LA 3R2PA 4FB1A 5AW0B 3D71A 2ZXYA 2A45I 5KLVE 1JY2P 3RL0D 3HQ9A 2M3EA 1FZGA 1H31A 2PCCB 1LT9A 1RQUA 5CCGC 3C9IA 2N9YB 2JWDA 3P8CD 1RHZB 2W8ZA 2PACA 1NTKK 1H0TA 3SFDC 3OA7A 5CCHD 1KQFB 1M90Q 1M60A 2C9LY 1M1JB 2KSJA 2FYZA 2AEFA 4H0LC 3GW6A 3CX5W 2N9IA 4K3AA 1CNOA 2QSIA 4GOEA 2KZJA 1NNOA 3IR9A 1AVOA 4N0KA 2A45H 1KYOW 5AW3B 4PD4D 5AW8B 3KDPB 4GOFA 1N90A 5KLVG 2WVRA 1VL2A 1HJ3A 1EZVG 1HF9A 1KILD 3D6YA 1GW3A 3L70E 2E76C 3B5NB 4HH2A 4D6TJ 5KAFH 1CSWA 1T8ZA 2DW3A 3ABVC 1EQ7A 4PV1C 1PPJD 4AX3A 2GUVA 3BATA 1X22A 5CJ0A 1KX7A 1GDTA 2POHA 1IJDB 1NMIA 3RK3E 1N2DC 1SQPK 1MFZA 2AI5A 1S5LH 2R32A 2XKMA 2K9YA 2IDBA 1FDOA 2W90A 4J20A 3VP9A 3A7OA 3KZIE 2LKMA 4N78E 5EFWB 4I2LC 1HJ4A 1OVUA 1BDCA 3H1JJ 3PTZA 4JQ0D 4GKGA 2E5YA 3H1LE 3M91A 1N7SA 3HE4A 3L70G 3LIEA 4A7PA 4PJ0H 1GZLA 1W2EA 1BSNA 1NTKE 1YEBA 1A56A 1C2NA 3H1KD 3AEDC 5TJHA 2QA4P 4PW9B 3M97X 2E75B 3V5BA 1MZ9A 1OW6A 1BGYJ 2C1DA 2ZOOA 2GUSA 2WMMA 1BCCE 2FYUJ 1W2LA 2KB7P 3HD7A 3ZOWA 1PP9J 1PZQA 3EFFK 1J1DC 1NKZB 1YBKA 4IFMA 1FOSF 1CC5A 5CIBB 2E74D 2A06G 4W80A 4C46A 3A0BH 1L0LD 3V4WA 3KQGA 3D0WA 2QE7H 1M57D 5CIGB 4C7NA 1IZL0 3H1LG 3RK2B 1YICA 1SQVD 3WFEC 1GDVA 4ZKPA 1WEJF 2M5AB 3RL0C 1QVGO 1NTKG 1LFMA 1URQB 3GLMA 2WPQA 5CHXA 2SPZA 5GTIH 3FWLA 1NHLA 1C6OA 1VQPP 1MG3D 1QL1A 1S6VB 1QKSA 5KKZB 1CHIA 1BCCG 5CCHC 3H32A 1JOCA 2YNYA 1NU1D 2AXTH 2RN0A 3NMDA 1Z56A 1NKNA 3AEAC 1PFIA 1S1CX 2OZ1B 3O6QB 2C1UA 4JF7A 3O5CA 1LC1A 1ZXGA 1K04A 1GK6A 4BXLA 2WITA 2FFDA 1GU4A 1S5LV 1KILC 1KB0A 3H1IE 1SQPG 4FANA 4ASVA 1CRYA 1QYZA 1NTZD 1GL2A 2BH5X 3EFGA 3QH9A 2BCCD 1OX3A 4QMAA 4R4MA 3L75G 2MHMA 5L8RJ 4DY9A 4LC1A 3VYIA 1C2RA 1LP1B 1S3JA 1R0QA 4EIFA 1SVFA 1S4XA 5AW7B 4YTPC 2I8DA 3Q5RA 4NFGB 4FA9A 2IFNA 3FXEA 3WU2E 2OYIC 2PRRA 2ZT9D 3HRNA 2B87B 1NAFA 2GB8B 1GJQA 2FKWB 2FYNC 2KI7B 2N18C 1GU5A 3OA8B 3JCUH 3G6EP 1DX7A 1JMMA 3L73D 1Q81Q 3A0BV 1RE3A 3WUTA 2GC7D 3OJAB 3PLNA 3CX5D 1KQLA 3H1KJ 4PD4I 3Q5PA 1K8AQ 2N9BA 3LW5J 3CCVP 1P84H 4H44D 3H1HD 3L74E 2LXBA 2WPSA 1PGPA 1MKMA 2YK3A 1KYOD 4NPEA 4U3FE 5K5GB 1VQOP 2P58A 1RH5B 2E74C 4ZMDA 1IFNA 2LR2A 2D0WA 3CCJP 2ZXXA 2IZ0A 1ZOYC 2KNCB 3WUIA 2N1TD 1L0LJ 3OCDA 2ZZS1 4H0LB 3SSUA 1KFMA 2G3AA 4FA1A 4YPCA 1VQ4P 1SQVJ 2FFDC 3M0DC 1GK4A 2XZRA 4UB6H 1M6ZA 4WQEA 1KIBA 1NTMK 4V2KA 1BL9A 3SWSA 3CCMP 1Q86Q 1GL2C 3L74G 4LJIA 2OQQA 2E76B 1BE3G 3O8ZA 4U3FG 1NJIQ 2WZ7A 2HFED 1FS0E 4PV1B 4RESB 2JJLA 3FWNA 3L37A 1EDJA 2Q5UA 3T97B 1HCMA 3CMEP 3ZOOA 3PXWA 4H13D 2OZ1A 1FC2C 4BRYB 3O6QA 1E79H 1KX2A 5APXA 2NPSA 1JY3O 3NTNA 1MV8A 3Q1MA 1G1IA 3QWOC 4GT1A 2QVAA 1VQ5P 2KOGA 3L72E 1AOFA 5KAFE 3K5BA 4Z1MH 3CXHD 1CRJA 1HJ5A 1NTZJ 1RE3C 3AEFC 2BCCJ 1Q2NA 1SFCD 1OW7A 3AE5C 1LP1A 2L91A 1KQGB 1S5LE 2RKLA 3A2AA 5B66H 2QEXP 1SLQA 2XTSB 3VMAA 3AE3C 2I1JA 2A45G 5AW1B 1DEBA 3TSIA 3G9RA 2ZT9C 1KB9D 1H0TB 2XDJA 1A02F 2N9JA 1J1DB 1NTME 1U7MA 1OAEA 2B87A 3L72G 2QM7A 3RBXA 3MP7B 2JP3A 1N15A 4PJ0E 1L4AD 4OGQD 1M56D 2B89A 4JPZB 3TGUE 1FI7A 2P67A 3D70A 3RL0B 1IFJA 2C9XB 4H44C 2DVHA 2C8SA 3ZOXA 1LTIC 3VMYA 1CIEA 5DJUB 1JEKA 1LTTC 2WSEJ 4UB6V 1RZ6A 3M9QA 3AEGC 4WB4A 1PGQA 1USEA 3KZIV 3A5TA 4I7ZC 1DW1A 3EQ2A 3PRJA 3CC7P 3A0BE 3GF7A 2N1TC 1NTMG 2FYUK 3Q2YA 5AVZB 3PXSA 2KS1A 3CWBE 1CORA 3O0RC 1IFMA 1YTZI 2NPSC 1X0TA 3RN0A 1SQXJ 2O01H 1YITP 5GTIE 4D6TE 3H25A 1AYGA 3V2QA 2GC4D 1KILB 3L71E 4FA4A 3MUDA 2IYOA 4IL6E 1NWQA 4EOTA 3VNWA 2AXTE 2YMKA 2WPVB 2JR8A 3CX5I 2FXOA 3I55P 2CPBA 2WTYA 4WQDA 1EDLA 3I56P 4H13C 4XE5B 3CC4P 3PP5A 2C1DB 3CWBG 1KYOI 3VYMA 3H1JE 1QEXA 2V7QJ 2Q1KA 2HODB 5CIDB 1ZRTD 1JMBA 1HWTC 1OFCX 1ZP0C 2OYIB 3HQ8A 3CL3D 3NBSA 4D6TG 1DH3A 3C2CA 3PJSK 1LTAC 4C7NB 5KJ7D 2FYNB 2JO1A 2N18B 1S2EA 1S72P 1LC2A 1BGYE 5APWA 2KSEA 2FYUE 1EZVE 1ZMEC 3AE6C 4FA5A 4DJGA 3G3ZA 2D2CC 4RKUJ 3CLQA 3HUSA 3ORVA 2H8PD 5APTA 4KJMA 4XA4A 3W67A 1HUCA 3H1JG 3S1KA 3H32B 2QJKC 1L9BC 2MJZA 3U1CA 2E74B 1RZ5A 2ZYDA 2OYHC 1L4AC 3JCUE 4IFDK 3SVWA 4OGQC 1VQ9P 2AEJA 1IC2A 2YKOA 3CC2P 3TNUA 3VP8A 2BCNB 5DJQC 1YIQA 1FU1A 1P84E 3TYYA 1LJ2A 1BGYG 2FFDB 1SQBK 1J3SA 1HROA 4L3GA 2FYUG 3MUDC 3CXHI 4LGDE 1GL2B 3RK3D 4L3HA 4YE1A 3WU2V 1GQ1A 5CCHA 3G4SP 1X79B 5KLIC 1KV4A 1R5LA 1PV3A 1U75B 4L1QA 2QIWA 4N78D 2V7QH 2R5DA 1ETPA 3MK7C 4UB6E 5DJTB 3H1LD 1L0LK 1KB9I 1LTJA 451CA 1JY2O 2A06E 2WSCJ 2MTAC 1KV9A 2B0ZB 1CIGA 3B71A 1NTKD 1KILA 1SQVK 5AVQB 2CA3B 4HJGH 1CXCA 3BCCD 2D0SA 2ZYGA 1CO6A 3V6IA 1IRVA 2IPPA 2V07A 4L75A 1BCCD 4K35A 1U57A 3VRDA 2BEZF 3IAOA 1YFCA 2WT7B 3HTKA 1QVFO 1CI6B 2AIUA 1X9VA 3HUSC 2FXPA 1SS1A 2HODA 1YQ3C 1I8PA 4WQ9A 1A02J 1SQBE 2OYIA 2ZT9B 1IFIA 2Y0DA 1E5WA 4KHXA 3OCDB 1UIXA 3KHUA 1H9XA 1LS9A 2PCBB 2ZVOB 1K73Q 3RGUA 3BVHA 1FCDC 5B66E 2P1JA 1SQPE 1AKKA 1NTZK 2W6AA 1YHQP 4H44B 4FAVA 4AQRD 3USSA 2ORLA 1Q7YQ 1FE6A 3PXTA 1FJKA 3L75E 1L0LE 3TK1A 4IL6H 4EYYQ 4I7ZB 1CXAA 3IF4A 2AEMA 5DF5A 1UIIA 1KN7A 2H89C 1SQBG 2W83C 2ZJSE 2N1TB 1ZLLA 5KAFV 4AYCA 1SQVE 1N50A 1ZR4A 2UWJE 3B5ND 4DT0A 3H1KG 5TISE 3H1ID 5CICB 1H32A 1LTJC 2IFMA 2N3YA 1USDA 2NPSB 3WUVA 5KAIH 2C1VA 2ZBOA 5DFSA 4YXWH 3M0DA 1KMIZ 2YMYA 1JO5A 3A9FA 4Q5PA 2MKVA 3KXDA 3SJLA 2NRGA 2J59M 4GEDB 2OGUA 1HJ0A 1L0LG 1J2JB 2XNXA 4HB1A 1S5LX 2BH4X 1EDKA 3VTPC 4I6MC 1FZFA 4PJ0V 2HR3A 1SQVG 3AE9C 1N73C 4H13B 4Y28J 1HH0A 4EICA 3GHGA 1F1FA 4C7RA 3M0AA 1YEAA 1JTHB 1RF1C 1LGHB 4O1WA 2C2CA
chains in the Genus database with same CATH topology
2BPBB 1HZUA 3DR0A 4JCGA 2YCCA 1H9YA 1SQBD 2CE1A 1PP9D 4KMGA 2BGVX 1AOQA 2L91A 1U74B 4H0JA 3O1YA 4WQAA 3DMIA 1CRGA 2VHDA 2XTSB 2ZONG 1COTA 3L74D 3VMAA 5E79V 4U3FD 1EB7A 2Y0CA 2GIWA 3HQ7A 1KB9D 2N9JA 4FB1A 1SQPD 1YCCA 1SQQD 1OAEA 3O20A 2ZXYA 5CIFB 3X39A 3CXHW 1N15A 2FRCA 3HQ9A 2LIRA 1H31A 2PCCB 5GTIV 3ZIYA 4O1QA 3L75D 2N9YB 1FI7A 2QJKB 2QJPB 1B7VA 2PACA 4IL6V 2C9XB 1HZVA 1CHHA 2AXTV 2C8SA 2DVHA 1M60A 1ZZHA 3ZOXA 1CIEA 3GW6A 3TYIA 3CX5W 1CTYA 2N9IA 3CU4A 4UB6V 1NMLA 1RZ6A 1CNOA 2FWLA 3DP5A 1C6SA 3GG2A 1I5TA 3KZIV 1DIQC 1DW1A 5DJQB 2IBZD 3PRJA 1NNOA 4N0KA 1K3GA 3RLMA 2Y0EA 1KYOW 4WQBA 4PD4D 3PXSA 2KS1A 1N90A 1CORA 1HJ3A 2JQRA 3O0RC 4H0KA 3L4OA 2YIUB 4K3IA 3NWVA 1CCRA 2O3JA 3RN0A 1CSWA 4EDFA 1A2SA 5KLIB 1PPJD 4AX3A 2HV4A 1AYGA 1RAPA 3L72D 2GC4D 1KX7A 1NMIA 5CYTR 1DVVA 4FA4A 1QN2A 1CHJA 3MK7B 2LITA 1CYJA 1YNRA 3VNWA 2AI5A 1FI3A 4Y5RA 2L4DA 1I54A 4J20A 1C52A 4WQDA 2N3BA 1CRCA 1IRWA 2QJYB 1HJ4A 4EIEA 1DT1A 1CTJA 3NBTA 4WQCA 2Q3EA 3PTZA 2C1DB 3WFBC 3VYMA 5CIDB 1ZRTD 4A7PA 155CA 4UB8V 3WC8A 1L0ND 1YEBA 1A56A 3HQ8A 1C2NA 3NBSA 3H1KD 5TJHA 3C2CA 4PW9B 1E29A 3M97X 3TF5A 1BE3D 2FYNB 2N18B 4RSZA 2C1DA 2ZOOA 1LC2A 2CE0A 1W2LA 2CA4B 3TGUD 3ZOWA 4FA5A 5C0ZA 1CC5A 5CIBB 1L0LD 3ORVA 2BLFB 5CIGB 1IZL0 4EIDA 5EXQA 1GIWA 1IQCA 1YICA 1SQVD 1L9BC 3WFEC 1GDVA 1HH7A 1RZ5A 3PH2B 1WEJF 1WVEC 1LFMA 1DIIC 1E8EA 1H1OA 3SVWA 3CWBD 1C7MA 3FWLA 3SLEA 3CYTI 1C6OA 1MG3D 1QL4A 4P4QB 1S6VB 1QKSA 2B4ZA 2BCNB 5KAIV 5KKZB 1CHIA 5DJQC 1YIQA 1E2RA 5C9MA 1J3SA 1NU1D 1HROA 5AURA 2RN0A 2V08A 4D6TD 4L3GA 1SQXD 4GYDA 5CIHB 3L71D 1NIRA 4RJTA 4PWAA 4L3HA 4YE1A 3WU2V 2OZ1B 1GQ1A 2C1UA 351CA 3O5CA 1LC1A 3ZCFA 1RAQA 2B10B 3WFCC 1MZ4A 1I8OA 1C75A 1U75B 4L1QA 1S5LV 2EXVA 1KB0A 1ETPA 3MK7C 4FANA 1CIFA 1FI9A 5B6QA 1FHBA 1CRYA 1QYZA 1NTZD 3H1JD 2BH5X 3H1LD 2BCCD 451CA 1I6DA 4WQ8A 4AAOA 2MTAC 1KV9A 2B0ZB 2MHMA 1CIGA 1K3HA 1NTKD 1CYCA 4DY9A 1C2RA 3RMZA 1OCDA 3ITKA 2CA3B 2DGEA 1CXCA 3RN1A 1R0QA 3BCCD 2YQBA 3WFDC 2D0SA 1CO6A 4EIFA 5B66V 1IRVA 3PHLA 2V07A 1I55A 5GTHV 1NTMD 1BCCD 4NFGB 4FA9A 3VRDA 1YFCA 2B12B 5KLVD 4AALA 2CXBA 2FYUD 1EZVD 1CSVA 2AIUA 1HRCA 1IO3A 2GB8B 5CIEB 1GJQA 2N18C 3OA8B 1H31B 1I8PA 4WQ9A 3ZBMA 3L73D 3A0BV 1JDLA 1GU2A 2GC7D 1CEDA 3PLNA 3CX5D 2Y0DA 5TISV 4XXLA 1VYDA 3OCDB 3KHUA 1I6EA 3A0HV 5H2FV 3H1HD 1H9XA 1LS9A 2PCBB 2YK3A 1KYOD 1YTCA 4AANA 1DW2A 3OA8A 1CIHA 1FCDC 1C6RA 1A8CA 3JBTB 1P84D 2D0WA 1AKKA 2RMZA 2KNCB 4FAVA 4WQ7A 3WUIA 1CTZA 1H32B 2K9JB 1CRIA 2ORLA 2ZZS1 3OCDA 3L70D 3PXTA 4FA1A 4XYDB 1CXAA 5DF5A 3SXTA 1CSUA 5KAFV 1M6ZA 4WQEA 1N50A 1KIBA 4V2KA 1BL9A 3SWSA 1CCHA 3H1ID 5CICB 1H32A 2N3YA 2JWAA 4LJIA 1GKSA 1FJ0A 1N9CA 2C1VA 1H33B 5B5EV 2ZBOA 3TDKA 1F1CA 5DFSA 2QG4A 2A06D 3A9FA 1M70A 1CSXA 4Q5PA 1FOCA 5IY51 1QL3A 1HCMA 3ZOOA 3HQ6A 3SJLA 1CRHA 3PXWA 1DW3A 2OZ1A 4GEDB 1MG2D 2I8FA 4AAMA 2B11B 1KX2A 1DVHA 2BH4X 3CP5A 1H33A 1DW0A 4PJ0V 1LMSA 1W5CT 3ZOYA 1AOFA 1CYIA 2JTIB 4EICA 3CXHD 1F1FA 1CRJA 1BGYD 3L4MA 4MU8A 4QAOA 1HJ5A 1YEAA 1L9JC 4O1WA 2C2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPB B;  1HZU A;  3DR0 A;  4JCG A;  2YCC A;  1H9Y A;  1SQB D;  2CE1 A;  1PP9 D;  4KMG A;  2BGV X;  1AOQ A;  2L91 A;  1U74 B;  4H0J A;  3O1Y A;  4WQA A;  3DMI A;  1CRG A;  2VHD A;  2XTS B;  2ZON G;  1COT A;  3L74 D;  3VMA A;  5E79 V;  4U3F D;  1EB7 A;  2Y0C A;  2GIW A;  3HQ7 A;  1KB9 D;  2N9J A;  4FB1 A;  1SQP D;  1YCC A;  1SQQ D;  1OAE A;  3O20 A;  2ZXY A;  5CIF B;  3X39 A;  3CXH W;  1N15 A;  2FRC A;  3HQ9 A;  2LIR A;  1H31 A;  2PCC B;  5GTI V;  3ZIY A;  4O1Q A;  3L75 D;  2N9Y B;  1FI7 A;  2QJK B;  2QJP B;  1B7V A;  2PAC A;  4IL6 V;  2C9X B;  1HZV A;  1CHH A;  2AXT V;  2C8S A;  2DVH A;  1M60 A;  1ZZH A;  3ZOX A;  1CIE A;  3GW6 A;  3TYI A;  3CX5 W;  1CTY A;  2N9I A;  3CU4 A;  4UB6 V;  1NML A;  1RZ6 A;  1CNO A;  2FWL A;  3DP5 A;  1C6S A;  3GG2 A;  1I5T A;  3KZI V;  1DIQ C;  1DW1 A;  5DJQ B;  2IBZ D;  3PRJ A;  1NNO A;  4N0K A;  1K3G A;  3RLM A;  2Y0E A;  1KYO W;  4WQB A;  4PD4 D;  3PXS A;  2KS1 A;  1N90 A;  1COR A;  1HJ3 A;  2JQR A;  3O0R C;  4H0K A;  3L4O A;  2YIU B;  4K3I A;  3NWV A;  1CCR A;  2O3J A;  3RN0 A;  1CSW A;  4EDF A;  1A2S A;  5KLI B;  1PPJ D;  4AX3 A;  2HV4 A;  1AYG A;  1RAP A;  3L72 D;  2GC4 D;  1KX7 A;  1NMI A;  5CYT R;  1DVV A;  4FA4 A;  1QN2 A;  1CHJ A;  3MK7 B;  2LIT A;  1CYJ A;  1YNR A;  3VNW A;  2AI5 A;  1FI3 A;  4Y5R A;  2L4D A;  1I54 A;  4J20 A;  1C52 A;  4WQD A;  2N3B A;  1CRC A;  1IRW A;  2QJY B;  1HJ4 A;  4EIE A;  1DT1 A;  1CTJ A;  3NBT A;  4WQC A;  2Q3E A;  3PTZ A;  2C1D B;  3WFB C;  3VYM A;  5CID B;  1ZRT D;  4A7P A;  155C A;  4UB8 V;  3WC8 A;  1L0N D;  1YEB A;  1A56 A;  3HQ8 A;  1C2N A;  3NBS A;  3H1K D;  5TJH A;  3C2C A;  4PW9 B;  1E29 A;  3M97 X;  3TF5 A;  1BE3 D;  2FYN B;  2N18 B;  4RSZ A;  2C1D A;  2ZOO A;  1LC2 A;  2CE0 A;  1W2L A;  2CA4 B;  3TGU D;  3ZOW A;  4FA5 A;  5C0Z A;  1CC5 A;  5CIB B;  1L0L D;  3ORV A;  2BLF B;  5CIG B;  1IZL 0;  4EID A;  5EXQ A;  1GIW A;  1IQC A;  1YIC A;  1SQV D;  1L9B C;  3WFE C;  1GDV A;  1HH7 A;  1RZ5 A;  3PH2 B;  1WEJ F;  1WVE C;  1LFM A;  1DII C;  1E8E A;  1H1O A;  3SVW A;  3CWB D;  1C7M A;  3FWL A;  3SLE A;  3CYT I;  1C6O A;  1MG3 D;  1QL4 A;  4P4Q B;  1S6V B;  1QKS A;  2B4Z A;  2BCN B;  5KAI V;  5KKZ B;  1CHI A;  5DJQ C;  1YIQ A;  1E2R A;  5C9M A;  1J3S A;  1NU1 D;  1HRO A;  5AUR A;  2RN0 A;  2V08 A;  4D6T D;  4L3G A;  1SQX D;  4GYD A;  5CIH B;  3L71 D;  1NIR A;  4RJT A;  4PWA A;  4L3H A;  4YE1 A;  3WU2 V;  2OZ1 B;  1GQ1 A;  2C1U A;  351C A;  3O5C A;  1LC1 A;  3ZCF A;  1RAQ A;  2B10 B;  3WFC C;  1MZ4 A;  1I8O A;  1C75 A;  1U75 B;  4L1Q A;  1S5L V;  2EXV A;  1KB0 A;  1ETP A;  3MK7 C;  4FAN A;  1CIF A;  1FI9 A;  5B6Q A;  1FHB A;  1CRY A;  1QYZ A;  1NTZ D;  3H1J D;  2BH5 X;  3H1L D;  2BCC D;  451C A;  1I6D A;  4WQ8 A;  4AAO A;  2MTA C;  1KV9 A;  2B0Z B;  2MHM A;  1CIG A;  1K3H A;  1NTK D;  1CYC A;  4DY9 A;  1C2R A;  3RMZ A;  1OCD A;  3ITK A;  2CA3 B;  2DGE A;  1CXC A;  3RN1 A;  1R0Q A;  3BCC D;  2YQB A;  3WFD C;  2D0S A;  1CO6 A;  4EIF A;  5B66 V;  1IRV A;  3PHL A;  2V07 A;  1I55 A;  5GTH V;  1NTM D;  1BCC D;  4NFG B;  4FA9 A;  3VRD A;  1YFC A;  2B12 B;  5KLV D;  4AAL A;  2CXB A;  2FYU D;  1EZV D;  1CSV A;  2AIU A;  1HRC A;  1IO3 A;  2GB8 B;  5CIE B;  1GJQ A;  2N18 C;  3OA8 B;  1H31 B;  1I8P A;  4WQ9 A;  3ZBM A;  3L73 D;  3A0B V;  1JDL A;  1GU2 A;  2GC7 D;  1CED A;  3PLN A;  3CX5 D;  2Y0D A;  5TIS V;  4XXL A;  1VYD A;  3OCD B;  3KHU A;  1I6E A;  3A0H V;  5H2F V;  3H1H D;  1H9X A;  1LS9 A;  2PCB B;  2YK3 A;  1KYO D;  1YTC A;  4AAN A;  1DW2 A;  3OA8 A;  1CIH A;  1FCD C;  1C6R A;  1A8C A;  3JBT B;  1P84 D;  2D0W A;  1AKK A;  2RMZ A;  2KNC B;  4FAV A;  4WQ7 A;  3WUI A;  1CTZ A;  1H32 B;  2K9J B;  1CRI A;  2ORL A;  2ZZS 1;  3OCD A;  3L70 D;  3PXT A;  4FA1 A;  4XYD B;  1CXA A;  5DF5 A;  3SXT A;  1CSU A;  5KAF V;  1M6Z A;  4WQE A;  1N50 A;  1KIB A;  4V2K A;  1BL9 A;  3SWS A;  1CCH A;  3H1I D;  5CIC B;  1H32 A;  2N3Y A;  2JWA A;  4LJI A;  1GKS A;  1FJ0 A;  1N9C A;  2C1V A;  1H33 B;  5B5E V;  2ZBO A;  3TDK A;  1F1C A;  5DFS A;  2QG4 A;  2A06 D;  3A9F A;  1M70 A;  1CSX A;  4Q5P A;  1FOC A;  5IY5 1;  1QL3 A;  1HCM A;  3ZOO A;  3HQ6 A;  3SJL A;  1CRH A;  3PXW A;  1DW3 A;  2OZ1 A;  4GED B;  1MG2 D;  2I8F A;  4AAM A;  2B11 B;  1KX2 A;  1DVH A;  2BH4 X;  3CP5 A;  1H33 A;  1DW0 A;  4PJ0 V;  1LMS A;  1W5C T;  3ZOY A;  1AOF A;  1CYI A;  2JTI B;  4EIC A;  3CXH D;  1F1F A;  1CRJ A;  1BGY D;  3L4M A;  4MU8 A;  4QAO A;  1HJ5 A;  1YEA A;  1L9J C;  4O1W A;  2C2C A; 
#chains in the Genus database with same CATH topology
 3AE7 C;  2BCC E;  2L5G B;  3F89 A;  4KMG A;  1U74 B;  1SQX K;  1XTG B;  2P10 A;  1S9K E;  2O1K A;  3BCC J;  4WQA A;  3KPE A;  1Q82 Q;  1CRG A;  2VHD A;  2ZON G;  2WQY C;  4UB8 H;  3L74 D;  5GTH H;  3C8V A;  3N4X A;  1BCC J;  4U3F D;  1EB7 A;  1HVV A;  2Y0C A;  2GIW A;  2WT7 A;  1H88 A;  1OVV A;  1CI6 A;  2Q6Q A;  1OZH A;  1FOS E;  1SQQ D;  1VQN P;  1NGM B;  3X39 A;  2KIK A;  5AW5 B;  2D2C B;  1BE3 E;  2FRC A;  5GTI V;  3ZIY A;  5CMZ A;  4EIJ A;  1EXI A;  2ZAE B;  1T3U A;  4W7Z A;  3V2R A;  2XV5 A;  2QJK B;  1KOR A;  4B86 A;  3P32 A;  1NTZ G;  2BCC G;  4IL6 V;  2OYH B;  1YJN P;  1HZV A;  1L4A B;  2KS1 B;  2OTL P;  1CHH A;  2AXT V;  1NH4 A;  4OGQ B;  1ZZH A;  3CU4 A;  1NML A;  3DP5 A;  1C6S A;  3GG2 A;  1I5T A;  4PD4 H;  1ZN5 A;  5DJQ B;  2IBZ D;  2Z4E A;  1LTG C;  3CD6 P;  1PGO A;  1AVY A;  1K3G A;  2Y0E A;  4WQB A;  1AQT A;  3AEC C;  1X8Y A;  2KXP B;  2JQR A;  4H0K A;  3L4O A;  2C0X A;  4K3I A;  3NWV A;  1NU1 J;  4JYB A;  4WWI A;  2WWW A;  2IYP A;  3GMA A;  2N1T A;  1VQL P;  5KLI B;  1SQX E;  1RAP A;  3L72 D;  3GHG C;  1DVV A;  1CHJ A;  3H1I J;  3MK7 B;  1YNR A;  5B5E H;  3AE2 C;  1FZE A;  2L4D A;  1C52 A;  5AVX B;  4N6J A;  1VQM P;  2Q3E A;  4WQC A;  4Y99 C;  2Z5I A;  3M06 A;  3NFQ A;  3B4S A;  3LW5 H;  3OAK A;  3MGN A;  155C A;  2QM8 A;  1VPC A;  1VQK P;  4UB8 V;  1L0N D;  2W6J H;  4ZNC A;  1LWU C;  1FAV A;  1SQX G;  3ZDM A;  3HUS B;  1JUN A;  2J58 A;  1JB0 J;  1VF5 D;  1JTH A;  4RSZ A;  1J1E C;  5APU A;  3TGU D;  3WUU A;  1OVR A;  3NXS A;  3VOP A;  3L36 A;  3CPW O;  5CCG D;  4KT0 J;  3L73 J;  1W5C E;  2BLF B;  1SFC A;  3L74 J;  3TNU B;  5E79 H;  5TIS H;  5EXQ A;  4U3F J;  3A0H H;  5H2F H;  4H0L D;  2QJP C;  3PH2 B;  1WVE C;  1SQQ J;  3H1H J;  2QRX A;  1H1O A;  1OIP A;  3CWB D;  1C7M A;  3CYT I;  2JKV A;  2B4Z A;  3VMZ A;  5AW9 B;  3V2N A;  1NO4 A;  1E2R A;  2V4H A;  1M1K Q;  1YJ9 P;  2OYH A;  2Z5H A;  4BWN A;  1L4A A;  1VQ6 P;  5AUR A;  1VDF A;  2V08 A;  4D6T D;  2K88 A;  5CIH B;  2YKP A;  3L71 D;  1NIR A;  1H8A A;  2YIU C;  1LTJ B;  2BEQ D;  4PV1 D;  4NPD A;  2P7J A;  3ZCF A;  3WFC C;  1MZ4 A;  1C75 A;  2IZ1 A;  2HYN A;  1WRG A;  1RQV A;  1K05 A;  1CIF A;  1FI9 A;  1FHB A;  3SWF A;  3H1J D;  2RH0 A;  3GF3 A;  1I6D A;  2OTK E;  3HTK B;  4AAO A;  2Q7C A;  2M8R A;  1CYC A;  5KAI E;  2QJY C;  3RMZ A;  1PL5 A;  1OCD A;  1N73 B;  1FDM A;  3WFD C;  1R5S A;  1WT6 A;  2YKQ A;  4OWF A;  5B66 V;  3CCR P;  3Q5S A;  1RF1 B;  1I55 A;  1Y8A A;  1FJP A;  3IFM A;  1SP4 A;  3CMA P;  5KLV D;  3CCQ P;  3PH0 A;  2CXB A;  2FYU D;  1EZV D;  1CSV A;  3I5C A;  2R3C A;  3E1I A;  1AA0 A;  1SFC C;  1IO3 A;  3CX5 H;  1KQS O;  2IBZ I;  1OW8 A;  1HGV A;  1OMI A;  1PP9 E;  1HTL C;  1JDL A;  2WSE H;  1GU2 A;  1CED A;  1L0N J;  5APY A;  1KYO H;  4AUW A;  5TIS V;  4XXL A;  3JC2 2;  1VF5 C;  3Q3D A;  1I6E A;  3A0H V;  2WSF J;  5H2F V;  4MN4 C;  5AW2 B;  2YO2 A;  3AE8 C;  1N86 A;  1AV1 A;  2NZ2 A;  2LXC B;  2ITA A;  1YTC A;  3S9O A;  4AAN A;  1DW2 A;  2ZFC A;  3M9H A;  1CIH A;  3TGU J;  5AVW B;  1DD4 A;  3JBT B;  2K3R A;  1P84 D;  5KJ7 A;  4DOJ A;  4UB8 E;  4RO0 A;  5GTH E;  4WQ7 A;  3IN6 A;  5CJ4 A;  1H32 B;  2K9J B;  3L4F A;  1RF0 A;  2ZXE B;  2YXQ B;  3L70 D;  1BDD A;  2K1A A;  2R5B A;  4XYD B;  4IOI H;  4IFF A;  5BU8 B;  3P8C E;  1LNQ A;  1PP9 G;  5AVU B;  1NOH A;  5KTB A;  1CSU A;  4U7J A;  3FX0 A;  5AW4 B;  2HLO A;  2Q3I A;  3CWB J;  1ZW0 A;  2PP6 A;  2M0B A;  1GKS A;  1KC8 Q;  5APS A;  4DCK A;  1CZQ A;  4OVN F;  3WMM 0;  3MTU E;  2A06 D;  1YIJ P;  1M70 A;  1CSX A;  1KZU B;  1N7S D;  1QL3 A;  4PD4 E;  2O01 N;  3U1A A;  1DD3 A;  1FZA A;  3L71 J;  1GMJ A;  3HQ6 A;  3GHG B;  1KIL E;  1DW3 A;  1MG2 D;  2I8F A;  4AAM A;  4N3Y B;  2IX7 C;  3CP5 A;  1H33 A;  1CSB A;  3CXH H;  1PPJ E;  4GIF A;  2B9B A;  2Y9Y A;  4WY4 D;  3HE5 B;  3R4Y A;  3HD7 D;  3ZOY A;  4Y99 B;  1VQ7 P;  1CYI A;  2JTI B;  2E42 A;  4QAO A;  1M8O B;  2XND H;  1IK7 A;  1RE4 C;  1HJB A;  2P2U A;  3CI9 A;  1HZU A;  1H89 A;  2YCC A;  1H9Y A;  1SQB D;  1KFN A;  1YJW P;  1NU1 K;  2WSF H;  1N73 A;  5B5E E;  3BRT B;  1LWU B;  1AOQ A;  2E43 A;  1KB9 H;  2PAJ A;  5BU5 A;  2HPC A;  1FZC A;  1COT A;  1JY3 N;  3BCC E;  1RF1 A;  1KTM A;  1J1E B;  1LT9 C;  1YI2 P;  2J5U A;  4HYT B;  5KJ7 C;  2E5T A;  1PPJ G;  5KLV J;  4GOD A;  3H1K E;  1LTB C;  1SQP D;  1YCC A;  2C0W A;  3MIW A;  3O20 A;  4WY4 A;  4YXD C;  1RF0 C;  5CIF B;  3CXH W;  3FXD A;  1FZB A;  2LIR A;  1JCD A;  1T3J A;  2WPR A;  1BSH A;  1N8R Q;  4O1Q A;  3L75 D;  2I1K A;  1IZN B;  1LTS C;  2OTJ P;  1MUU A;  2KK7 A;  2QJP B;  2KYV A;  1B7V A;  5AVS B;  4DZO A;  2Y9Z A;  2H7H A;  1AFO A;  3TYI A;  1CTY A;  2FWL A;  1AJY A;  3BCC G;  1DIQ C;  1HBW A;  2YXR B;  2OAR A;  2FBW C;  2GA1 A;  3RLM A;  1GL2 D;  5E79 E;  2K9J A;  2WSC H;  3L70 J;  3A0H E;  5H2F E;  2KUB A;  2YIU B;  1M1J A;  3RL0 g;  3A3Y B;  3V4Q A;  1W2B O;  1GTW A;  1CCR A;  2O3J A;  1DIP A;  3RK3 C;  1EZV I;  1NU1 E;  4EDF A;  1A2S A;  2HV4 A;  4CPG A;  5CYT R;  3E1R A;  2WSS H;  1QN2 A;  1SQQ K;  2LIT A;  1CYJ A;  2AXC A;  1EDI A;  2KLU A;  2W6B A;  5AVR B;  5AW6 B;  1FI3 A;  3II6 A;  1NAY A;  5APQ A;  1N7S C;  3E7K A;  4Y5R A;  4JBZ A;  1I54 A;  3B5N A;  2N3B A;  1CRC A;  1IRW A;  2QJY B;  2CPS A;  1FZC C;  4EIE A;  3L35 A;  1DT1 A;  1CTJ A;  3NBT A;  3H1L J;  1S9K D;  3WFB C;  1NTZ E;  1ZR2 A;  2E75 D;  2C9N Y;  3AE4 C;  1NTK J;  1P84 I;  1ZV8 A;  4WY4 C;  3HD7 C;  3WC8 A;  1NU1 G;  3HE5 A;  2M3B A;  2K37 A;  1E29 A;  1SFC B;  1T2K D;  3TF5 A;  1BE3 D;  1DEE G;  4HKZ H;  4LLH A;  1XTC C;  1NVO A;  2CE0 A;  3H1I G;  1QX8 A;  2CA4 B;  1SQB J;  3D6Z A;  2PFX A;  3RK2 D;  3H6P A;  3UIA A;  1LWU A;  1KD1 Q;  3N7N A;  5C0Z A;  1VF5 B;  1JY3 P;  1IFP A;  4I1L A;  3EWK A;  3MHV A;  1URQ D;  1JCC A;  4EID A;  3L73 E;  1GIW A;  1IQC A;  3P7K A;  1HH7 A;  3CX5 E;  1AQ5 A;  1SQP J;  3KYQ A;  1Y47 A;  3LID A;  1DII C;  1E8E A;  5BVZ A;  1M1J C;  1SQQ E;  3H1H E;  3SLE A;  1FDI A;  3C1L A;  4GDO A;  1KYO E;  1QL4 A;  3MZW B;  3L75 J;  3MD0 A;  4P4Q B;  4IL6 X;  5KAI V;  5AVY B;  3V2P A;  5C9M A;  2JDI H;  2NPS D;  1SQX D;  2Q9I A;  2M5A A;  3VN0 A;  4GYD A;  1NYH A;  1L0N K;  1VQ8 P;  5CBO A;  4RJT A;  4PWA A;  1URQ A;  3KZI H;  1G2C B;  1PIX A;  2W27 A;  3B5N C;  3CCL P;  3L73 G;  351C A;  1RAQ A;  2B10 B;  2IBZ E;  1I8O A;  4W7Y A;  1GW4 A;  3BRV B;  2EXV A;  4TLF A;  2R3S A;  4M3L A;  2FXM A;  1SQQ G;  3H1H G;  5B6Q A;  5M1B A;  1IFD A;  1YTZ T;  3FGA D;  4WQ8 A;  4O9B A;  3JSV C;  3G71 P;  1K3H A;  2JEE A;  2B88 A;  2O1J A;  4OH8 B;  3ITK A;  2DGE A;  3RN1 A;  2YQB A;  2O01 J;  3S4R A;  1PGJ A;  1JNM A;  3PHL A;  5GTH V;  1JM0 A;  1NTM D;  1L2P A;  4R4L A;  1LT1 A;  2KLV A;  2B12 B;  3RBZ A;  4AAL A;  5AVT B;  2IBZ G;  1HRC A;  2E75 C;  4ZKU A;  5CIE B;  3CXH E;  1H31 B;  1JY2 N;  1LT9 B;  3ZBM A;  3F5H A;  3AE1 C;  2D2C D;  1YYC A;  1OWA A;  2XU6 A;  1T2K C;  1VYD A;  3AEE C;  1L0N E;  1CW5 A;  1BE3 J;  1OXZ A;  2H88 C;  2R44 A;  4NPF X;  5C39 A;  2CK3 H;  2GM4 A;  3RK2 C;  1IK9 A;  2OYO A;  3OA8 A;  2H43 A;  1G1J A;  1KB9 E;  2G8Y A;  1C6R A;  1A8C A;  3M9B A;  2RMZ A;  1T6A A;  1CTZ A;  2KP8 A;  1MFT A;  4EI2 A;  1URQ C;  1CRI A;  4JYC A;  1YQ4 C;  3U59 A;  5KKZ C;  1QGK B;  5CCG A;  2VRS A;  3SXT A;  2E76 D;  2PGD A;  4ASW A;  1GD2 E;  3P8M C;  1D7M A;  3CCS P;  2KNC A;  3B8E B;  1L0N G;  1CCH A;  5KLV K;  4TT3 H;  2JWA A;  1FJ0 A;  4L74 A;  1N9C A;  3AEB C;  1H33 B;  5B5E V;  3TDK A;  1F1C A;  1FBM A;  2QG4 A;  3RK3 B;  4WVZ A;  1QLE D;  1FOC A;  3CCE P;  5IY5 1;  4L76 A;  3TGU G;  3VMX A;  1QL2 A;  1CRH A;  1G2C A;  2FY8 A;  3WU2 H;  2BAS A;  2B11 B;  1HGZ A;  3SWY A;  1K9M Q;  5AVV B;  1DVH A;  1N7S B;  3HE4 B;  3L72 J;  1DW0 A;  1LMS A;  1W5C T;  1WMK A;  3SFE C;  2KZI A;  2HPC B;  1FZC B;  3T97 A;  1TU3 F;  2YO3 A;  3L4M A;  1BGY D;  4MU8 A;  2HG5 D;  3OW2 O;  1L9J C;  5APV A;  4BRY A;  1RY3 A;  1EXJ A;  2BPB B;  3DR0 A;  4JCG A;  3BAS A;  4WBA A;  3SWK A;  4XFJ A;  4WY4 B;  2CE1 A;  1PP9 D;  3CCU P;  3HD7 B;  2ZVN B;  2BGV X;  1Y9B A;  5CBN A;  4H0J A;  3O1Y A;  3DMI A;  1Q90 D;  3W68 A;  1EC5 A;  1RE4 A;  1U7J A;  3L71 G;  5E79 V;  1ZRT E;  1NTM J;  1IO4 A;  1N7L A;  1R8E A;  4L73 A;  3HQ7 A;  2ZYA A;  1M7L A;  3R2P A;  4FB1 A;  5AW0 B;  3D71 A;  2ZXY A;  2A45 I;  5KLV E;  1JY2 P;  3RL0 D;  3HQ9 A;  2M3E A;  1FZG A;  1H31 A;  2PCC B;  1LT9 A;  1RQU A;  5CCG C;  3C9I A;  2N9Y B;  2JWD A;  3P8C D;  1RHZ B;  2W8Z A;  2PAC A;  1NTK K;  1H0T A;  3SFD C;  3OA7 A;  5CCH D;  1KQF B;  1M90 Q;  1M60 A;  2C9L Y;  1M1J B;  2KSJ A;  2FYZ A;  2AEF A;  4H0L C;  3GW6 A;  3CX5 W;  2N9I A;  4K3A A;  1CNO A;  2QSI A;  4GOE A;  2KZJ A;  1NNO A;  3IR9 A;  1AVO A;  4N0K A;  2A45 H;  1KYO W;  5AW3 B;  4PD4 D;  5AW8 B;  3KDP B;  4GOF A;  1N90 A;  5KLV G;  2WVR A;  1VL2 A;  1HJ3 A;  1EZV G;  1HF9 A;  1KIL D;  3D6Y A;  1GW3 A;  3L70 E;  2E76 C;  3B5N B;  4HH2 A;  4D6T J;  5KAF H;  1CSW A;  1T8Z A;  2DW3 A;  3ABV C;  1EQ7 A;  4PV1 C;  1PPJ D;  4AX3 A;  2GUV A;  3BAT A;  1X22 A;  5CJ0 A;  1KX7 A;  1GDT A;  2POH A;  1IJD B;  1NMI A;  3RK3 E;  1N2D C;  1SQP K;  1MFZ A;  2AI5 A;  1S5L H;  2R32 A;  2XKM A;  2K9Y A;  2IDB A;  1FDO A;  2W90 A;  4J20 A;  3VP9 A;  3A7O A;  3KZI E;  2LKM A;  4N78 E;  5EFW B;  4I2L C;  1HJ4 A;  1OVU A;  1BDC A;  3H1J J;  3PTZ A;  4JQ0 D;  4GKG A;  2E5Y A;  3H1L E;  3M91 A;  1N7S A;  3HE4 A;  3L70 G;  3LIE A;  4A7P A;  4PJ0 H;  1GZL A;  1W2E A;  1BSN A;  1NTK E;  1YEB A;  1A56 A;  1C2N A;  3H1K D;  3AED C;  5TJH A;  2QA4 P;  4PW9 B;  3M97 X;  2E75 B;  3V5B A;  1MZ9 A;  1OW6 A;  1BGY J;  2C1D A;  2ZOO A;  2GUS A;  2WMM A;  1BCC E;  2FYU J;  1W2L A;  2KB7 P;  3HD7 A;  3ZOW A;  1PP9 J;  1PZQ A;  3EFF K;  1J1D C;  1NKZ B;  1YBK A;  4IFM A;  1FOS F;  1CC5 A;  5CIB B;  2E74 D;  2A06 G;  4W80 A;  4C46 A;  3A0B H;  1L0L D;  3V4W A;  3KQG A;  3D0W A;  2QE7 H;  1M57 D;  5CIG B;  4C7N A;  1IZL 0;  3H1L G;  3RK2 B;  1YIC A;  1SQV D;  3WFE C;  1GDV A;  4ZKP A;  1WEJ F;  2M5A B;  3RL0 C;  1QVG O;  1NTK G;  1LFM A;  1URQ B;  3GLM A;  2WPQ A;  5CHX A;  2SPZ A;  5GTI H;  3FWL A;  1NHL A;  1C6O A;  1VQP P;  1MG3 D;  1QL1 A;  1S6V B;  1QKS A;  5KKZ B;  1CHI A;  1BCC G;  5CCH C;  3H32 A;  1JOC A;  2YNY A;  1NU1 D;  2AXT H;  2RN0 A;  3NMD A;  1Z56 A;  1NKN A;  3AEA C;  1PFI A;  1S1C X;  2OZ1 B;  3O6Q B;  2C1U A;  4JF7 A;  3O5C A;  1LC1 A;  1ZXG A;  1K04 A;  1GK6 A;  4BXL A;  2WIT A;  2FFD A;  1GU4 A;  1S5L V;  1KIL C;  1KB0 A;  3H1I E;  1SQP G;  4FAN A;  4ASV A;  1CRY A;  1QYZ A;  1NTZ D;  1GL2 A;  2BH5 X;  3EFG A;  3QH9 A;  2BCC D;  1OX3 A;  4QMA A;  4R4M A;  3L75 G;  2MHM A;  5L8R J;  4DY9 A;  4LC1 A;  3VYI A;  1C2R A;  1LP1 B;  1S3J A;  1R0Q A;  4EIF A;  1SVF A;  1S4X A;  5AW7 B;  4YTP C;  2I8D A;  3Q5R A;  4NFG B;  4FA9 A;  2IFN A;  3FXE A;  3WU2 E;  2OYI C;  2PRR A;  2ZT9 D;  3HRN A;  2B87 B;  1NAF A;  2GB8 B;  1GJQ A;  2FKW B;  2FYN C;  2KI7 B;  2N18 C;  1GU5 A;  3OA8 B;  3JCU H;  3G6E P;  1DX7 A;  1JMM A;  3L73 D;  1Q81 Q;  3A0B V;  1RE3 A;  3WUT A;  2GC7 D;  3OJA B;  3PLN A;  3CX5 D;  1KQL A;  3H1K J;  4PD4 I;  3Q5P A;  1K8A Q;  2N9B A;  3LW5 J;  3CCV P;  1P84 H;  4H44 D;  3H1H D;  3L74 E;  2LXB A;  2WPS A;  1PGP A;  1MKM A;  2YK3 A;  1KYO D;  4NPE A;  4U3F E;  5K5G B;  1VQO P;  2P58 A;  1RH5 B;  2E74 C;  4ZMD A;  1IFN A;  2LR2 A;  2D0W A;  3CCJ P;  2ZXX A;  2IZ0 A;  1ZOY C;  2KNC B;  3WUI A;  2N1T D;  1L0L J;  3OCD A;  2ZZS 1;  4H0L B;  3SSU A;  1KFM A;  2G3A A;  4FA1 A;  4YPC A;  1VQ4 P;  1SQV J;  2FFD C;  3M0D C;  1GK4 A;  2XZR A;  4UB6 H;  1M6Z A;  4WQE A;  1KIB A;  1NTM K;  4V2K A;  1BL9 A;  3SWS A;  3CCM P;  1Q86 Q;  1GL2 C;  3L74 G;  4LJI A;  2OQQ A;  2E76 B;  1BE3 G;  3O8Z A;  4U3F G;  1NJI Q;  2WZ7 A;  2HFE D;  1FS0 E;  4PV1 B;  4RES B;  2JJL A;  3FWN A;  3L37 A;  1EDJ A;  2Q5U A;  3T97 B;  1HCM A;  3CME P;  3ZOO A;  3PXW A;  4H13 D;  2OZ1 A;  1FC2 C;  4BRY B;  3O6Q A;  1E79 H;  1KX2 A;  5APX A;  2NPS A;  1JY3 O;  3NTN A;  1MV8 A;  3Q1M A;  1G1I A;  3QWO C;  4GT1 A;  2QVA A;  1VQ5 P;  2KOG A;  3L72 E;  1AOF A;  5KAF E;  3K5B A;  4Z1M H;  3CXH D;  1CRJ A;  1HJ5 A;  1NTZ J;  1RE3 C;  3AEF C;  2BCC J;  1Q2N A;  1SFC D;  1OW7 A;  3AE5 C;  1LP1 A;  2L91 A;  1KQG B;  1S5L E;  2RKL A;  3A2A A;  5B66 H;  2QEX P;  1SLQ A;  2XTS B;  3VMA A;  3AE3 C;  2I1J A;  2A45 G;  5AW1 B;  1DEB A;  3TSI A;  3G9R A;  2ZT9 C;  1KB9 D;  1H0T B;  2XDJ A;  1A02 F;  2N9J A;  1J1D B;  1NTM E;  1U7M A;  1OAE A;  2B87 A;  3L72 G;  2QM7 A;  3RBX A;  3MP7 B;  2JP3 A;  1N15 A;  4PJ0 E;  1L4A D;  4OGQ D;  1M56 D;  2B89 A;  4JPZ B;  3TGU E;  1FI7 A;  2P67 A;  3D70 A;  3RL0 B;  1IFJ A;  2C9X B;  4H44 C;  2DVH A;  2C8S A;  3ZOX A;  1LTI C;  3VMY A;  1CIE A;  5DJU B;  1JEK A;  1LTT C;  2WSE J;  4UB6 V;  1RZ6 A;  3M9Q A;  3AEG C;  4WB4 A;  1PGQ A;  1USE A;  3KZI V;  3A5T A;  4I7Z C;  1DW1 A;  3EQ2 A;  3PRJ A;  3CC7 P;  3A0B E;  3GF7 A;  2N1T C;  1NTM G;  2FYU K;  3Q2Y A;  5AVZ B;  3PXS A;  2KS1 A;  3CWB E;  1COR A;  3O0R C;  1IFM A;  1YTZ I;  2NPS C;  1X0T A;  3RN0 A;  1SQX J;  2O01 H;  1YIT P;  5GTI E;  4D6T E;  3H25 A;  1AYG A;  3V2Q A;  2GC4 D;  1KIL B;  3L71 E;  4FA4 A;  3MUD A;  2IYO A;  4IL6 E;  1NWQ A;  4EOT A;  3VNW A;  2AXT E;  2YMK A;  2WPV B;  2JR8 A;  3CX5 I;  2FXO A;  3I55 P;  2CPB A;  2WTY A;  4WQD A;  1EDL A;  3I56 P;  4H13 C;  4XE5 B;  3CC4 P;  3PP5 A;  2C1D B;  3CWB G;  1KYO I;  3VYM A;  3H1J E;  1QEX A;  2V7Q J;  2Q1K A;  2HOD B;  5CID B;  1ZRT D;  1JMB A;  1HWT C;  1OFC X;  1ZP0 C;  2OYI B;  3HQ8 A;  3CL3 D;  3NBS A;  4D6T G;  1DH3 A;  3C2C A;  3PJS K;  1LTA C;  4C7N B;  5KJ7 D;  2FYN B;  2JO1 A;  2N18 B;  1S2E A;  1S72 P;  1LC2 A;  1BGY E;  5APW A;  2KSE A;  2FYU E;  1EZV E;  1ZME C;  3AE6 C;  4FA5 A;  4DJG A;  3G3Z A;  2D2C C;  4RKU J;  3CLQ A;  3HUS A;  3ORV A;  2H8P D;  5APT A;  4KJM A;  4XA4 A;  3W67 A;  1HUC A;  3H1J G;  3S1K A;  3H32 B;  2QJK C;  1L9B C;  2MJZ A;  3U1C A;  2E74 B;  1RZ5 A;  2ZYD A;  2OYH C;  1L4A C;  3JCU E;  4IFD K;  3SVW A;  4OGQ C;  1VQ9 P;  2AEJ A;  1IC2 A;  2YKO A;  3CC2 P;  3TNU A;  3VP8 A;  2BCN B;  5DJQ C;  1YIQ A;  1FU1 A;  1P84 E;  3TYY A;  1LJ2 A;  1BGY G;  2FFD B;  1SQB K;  1J3S A;  1HRO A;  4L3G A;  2FYU G;  3MUD C;  3CXH I;  4LGD E;  1GL2 B;  3RK3 D;  4L3H A;  4YE1 A;  3WU2 V;  1GQ1 A;  5CCH A;  3G4S P;  1X79 B;  5KLI C;  1KV4 A;  1R5L A;  1PV3 A;  1U75 B;  4L1Q A;  2QIW A;  4N78 D;  2V7Q H;  2R5D A;  1ETP A;  3MK7 C;  4UB6 E;  5DJT B;  3H1L D;  1L0L K;  1KB9 I;  1LTJ A;  451C A;  1JY2 O;  2A06 E;  2WSC J;  2MTA C;  1KV9 A;  2B0Z B;  1CIG A;  3B71 A;  1NTK D;  1KIL A;  1SQV K;  5AVQ B;  2CA3 B;  4HJG H;  1CXC A;  3BCC D;  2D0S A;  2ZYG A;  1CO6 A;  3V6I A;  1IRV A;  2IPP A;  2V07 A;  4L75 A;  1BCC D;  4K35 A;  1U57 A;  3VRD A;  2BEZ F;  3IAO A;  1YFC A;  2WT7 B;  3HTK A;  1QVF O;  1CI6 B;  2AIU A;  1X9V A;  3HUS C;  2FXP A;  1SS1 A;  2HOD A;  1YQ3 C;  1I8P A;  4WQ9 A;  1A02 J;  1SQB E;  2OYI A;  2ZT9 B;  1IFI A;  2Y0D A;  1E5W A;  4KHX A;  3OCD B;  1UIX A;  3KHU A;  1H9X A;  1LS9 A;  2PCB B;  2ZVO B;  1K73 Q;  3RGU A;  3BVH A;  1FCD C;  5B66 E;  2P1J A;  1SQP E;  1AKK A;  1NTZ K;  2W6A A;  1YHQ P;  4H44 B;  4FAV A;  4AQR D;  3USS A;  2ORL A;  1Q7Y Q;  1FE6 A;  3PXT A;  1FJK A;  3L75 E;  1L0L E;  3TK1 A;  4IL6 H;  4EYY Q;  4I7Z B;  1CXA A;  3IF4 A;  2AEM A;  5DF5 A;  1UII A;  1KN7 A;  2H89 C;  1SQB G;  2W83 C;  2ZJS E;  2N1T B;  1ZLL A;  5KAF V;  4AYC A;  1SQV E;  1N50 A;  1ZR4 A;  2UWJ E;  3B5N D;  4DT0 A;  3H1K G;  5TIS E;  3H1I D;  5CIC B;  1H32 A;  1LTJ C;  2IFM A;  2N3Y A;  1USD A;  2NPS B;  3WUV A;  5KAI H;  2C1V A;  2ZBO A;  5DFS A;  4YXW H;  3M0D A;  1KMI Z;  2YMY A;  1JO5 A;  3A9F A;  4Q5P A;  2MKV A;  3KXD A;  3SJL A;  2NRG A;  2J59 M;  4GED B;  2OGU A;  1HJ0 A;  1L0L G;  1J2J B;  2XNX A;  4HB1 A;  1S5L X;  2BH4 X;  1EDK A;  3VTP C;  4I6M C;  1FZF A;  4PJ0 V;  2HR3 A;  1SQV G;  3AE9 C;  1N73 C;  4H13 B;  4Y28 J;  1HH0 A;  4EIC A;  3GHG A;  1F1F A;  4C7R A;  3M0A A;  1YEA A;  1JTH B;  1RF1 C;  1LGH B;  4O1W A;  2C2C A; 
#chains in the Genus database with same CATH homology
 2BPB B;  1HZU A;  3DR0 A;  4JCG A;  2YCC A;  1H9Y A;  1SQB D;  2CE1 A;  1PP9 D;  4KMG A;  2BGV X;  1AOQ A;  2L91 A;  1U74 B;  4H0J A;  3O1Y A;  4WQA A;  3DMI A;  1CRG A;  2VHD A;  2XTS B;  2ZON G;  1COT A;  3L74 D;  3VMA A;  5E79 V;  4U3F D;  1EB7 A;  2Y0C A;  2GIW A;  3HQ7 A;  1KB9 D;  2N9J A;  4FB1 A;  1SQP D;  1YCC A;  1SQQ D;  1OAE A;  3O20 A;  2ZXY A;  5CIF B;  3X39 A;  3CXH W;  1N15 A;  2FRC A;  3HQ9 A;  2LIR A;  1H31 A;  2PCC B;  5GTI V;  3ZIY A;  4O1Q A;  3L75 D;  2N9Y B;  1FI7 A;  2QJK B;  2QJP B;  1B7V A;  2PAC A;  4IL6 V;  2C9X B;  1HZV A;  1CHH A;  2AXT V;  2C8S A;  2DVH A;  1M60 A;  1ZZH A;  3ZOX A;  1CIE A;  3GW6 A;  3TYI A;  3CX5 W;  1CTY A;  2N9I A;  3CU4 A;  4UB6 V;  1NML A;  1RZ6 A;  1CNO A;  2FWL A;  3DP5 A;  1C6S A;  3GG2 A;  1I5T A;  3KZI V;  1DIQ C;  1DW1 A;  5DJQ B;  2IBZ D;  3PRJ A;  1NNO A;  4N0K A;  1K3G A;  3RLM A;  2Y0E A;  1KYO W;  4WQB A;  4PD4 D;  3PXS A;  2KS1 A;  1N90 A;  1COR A;  1HJ3 A;  2JQR A;  3O0R C;  4H0K A;  3L4O A;  2YIU B;  4K3I A;  3NWV A;  1CCR A;  2O3J A;  3RN0 A;  1CSW A;  4EDF A;  1A2S A;  5KLI B;  1PPJ D;  4AX3 A;  2HV4 A;  1AYG A;  1RAP A;  3L72 D;  2GC4 D;  1KX7 A;  1NMI A;  5CYT R;  1DVV A;  4FA4 A;  1QN2 A;  1CHJ A;  3MK7 B;  2LIT A;  1CYJ A;  1YNR A;  3VNW A;  2AI5 A;  1FI3 A;  4Y5R A;  2L4D A;  1I54 A;  4J20 A;  1C52 A;  4WQD A;  2N3B A;  1CRC A;  1IRW A;  2QJY B;  1HJ4 A;  4EIE A;  1DT1 A;  1CTJ A;  3NBT A;  4WQC A;  2Q3E A;  3PTZ A;  2C1D B;  3WFB C;  3VYM A;  5CID B;  1ZRT D;  4A7P A;  155C A;  4UB8 V;  3WC8 A;  1L0N D;  1YEB A;  1A56 A;  3HQ8 A;  1C2N A;  3NBS A;  3H1K D;  5TJH A;  3C2C A;  4PW9 B;  1E29 A;  3M97 X;  3TF5 A;  1BE3 D;  2FYN B;  2N18 B;  4RSZ A;  2C1D A;  2ZOO A;  1LC2 A;  2CE0 A;  1W2L A;  2CA4 B;  3TGU D;  3ZOW A;  4FA5 A;  5C0Z A;  1CC5 A;  5CIB B;  1L0L D;  3ORV A;  2BLF B;  5CIG B;  1IZL 0;  4EID A;  5EXQ A;  1GIW A;  1IQC A;  1YIC A;  1SQV D;  1L9B C;  3WFE C;  1GDV A;  1HH7 A;  1RZ5 A;  3PH2 B;  1WEJ F;  1WVE C;  1LFM A;  1DII C;  1E8E A;  1H1O A;  3SVW A;  3CWB D;  1C7M A;  3FWL A;  3SLE A;  3CYT I;  1C6O A;  1MG3 D;  1QL4 A;  4P4Q B;  1S6V B;  1QKS A;  2B4Z A;  2BCN B;  5KAI V;  5KKZ B;  1CHI A;  5DJQ C;  1YIQ A;  1E2R A;  5C9M A;  1J3S A;  1NU1 D;  1HRO A;  5AUR A;  2RN0 A;  2V08 A;  4D6T D;  4L3G A;  1SQX D;  4GYD A;  5CIH B;  3L71 D;  1NIR A;  4RJT A;  4PWA A;  4L3H A;  4YE1 A;  3WU2 V;  2OZ1 B;  1GQ1 A;  2C1U A;  351C A;  3O5C A;  1LC1 A;  3ZCF A;  1RAQ A;  2B10 B;  3WFC C;  1MZ4 A;  1I8O A;  1C75 A;  1U75 B;  4L1Q A;  1S5L V;  2EXV A;  1KB0 A;  1ETP A;  3MK7 C;  4FAN A;  1CIF A;  1FI9 A;  5B6Q A;  1FHB A;  1CRY A;  1QYZ A;  1NTZ D;  3H1J D;  2BH5 X;  3H1L D;  2BCC D;  451C A;  1I6D A;  4WQ8 A;  4AAO A;  2MTA C;  1KV9 A;  2B0Z B;  2MHM A;  1CIG A;  1K3H A;  1NTK D;  1CYC A;  4DY9 A;  1C2R A;  3RMZ A;  1OCD A;  3ITK A;  2CA3 B;  2DGE A;  1CXC A;  3RN1 A;  1R0Q A;  3BCC D;  2YQB A;  3WFD C;  2D0S A;  1CO6 A;  4EIF A;  5B66 V;  1IRV A;  3PHL A;  2V07 A;  1I55 A;  5GTH V;  1NTM D;  1BCC D;  4NFG B;  4FA9 A;  3VRD A;  1YFC A;  2B12 B;  5KLV D;  4AAL A;  2CXB A;  2FYU D;  1EZV D;  1CSV A;  2AIU A;  1HRC A;  1IO3 A;  2GB8 B;  5CIE B;  1GJQ A;  2N18 C;  3OA8 B;  1H31 B;  1I8P A;  4WQ9 A;  3ZBM A;  3L73 D;  3A0B V;  1JDL A;  1GU2 A;  2GC7 D;  1CED A;  3PLN A;  3CX5 D;  2Y0D A;  5TIS V;  4XXL A;  1VYD A;  3OCD B;  3KHU A;  1I6E A;  3A0H V;  5H2F V;  3H1H D;  1H9X A;  1LS9 A;  2PCB B;  2YK3 A;  1KYO D;  1YTC A;  4AAN A;  1DW2 A;  3OA8 A;  1CIH A;  1FCD C;  1C6R A;  1A8C A;  3JBT B;  1P84 D;  2D0W A;  1AKK A;  2RMZ A;  2KNC B;  4FAV A;  4WQ7 A;  3WUI A;  1CTZ A;  1H32 B;  2K9J B;  1CRI A;  2ORL A;  2ZZS 1;  3OCD A;  3L70 D;  3PXT A;  4FA1 A;  4XYD B;  1CXA A;  5DF5 A;  3SXT A;  1CSU A;  5KAF V;  1M6Z A;  4WQE A;  1N50 A;  1KIB A;  4V2K A;  1BL9 A;  3SWS A;  1CCH A;  3H1I D;  5CIC B;  1H32 A;  2N3Y A;  2JWA A;  4LJI A;  1GKS A;  1FJ0 A;  1N9C A;  2C1V A;  1H33 B;  5B5E V;  2ZBO A;  3TDK A;  1F1C A;  5DFS A;  2QG4 A;  2A06 D;  3A9F A;  1M70 A;  1CSX A;  4Q5P A;  1FOC A;  5IY5 1;  1QL3 A;  1HCM A;  3ZOO A;  3HQ6 A;  3SJL A;  1CRH A;  3PXW A;  1DW3 A;  2OZ1 A;  4GED B;  1MG2 D;  2I8F A;  4AAM A;  2B11 B;  1KX2 A;  1DVH A;  2BH4 X;  3CP5 A;  1H33 A;  1DW0 A;  4PJ0 V;  1LMS A;  1W5C T;  3ZOY A;  1AOF A;  1CYI A;  2JTI B;  4EIC A;  3CXH D;  1F1F A;  1CRJ A;  1BGY D;  3L4M A;  4MU8 A;  4QAO A;  1HJ5 A;  1YEA A;  1L9J C;  4O1W A;  2C2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...