3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
3WFDC 3KZIV 1N15A 3CX5W 5B6QA 1A2SA 1H32A 1BGYD 1QL3A 3H1JD 1E2RA 1K3GA 3OCDA 5B5EV 1NNOA 4P4QB 2BCCD 1YCCA 4MU8A 2V08A 2BH5X 1CNOA 4WQ8A 3O20A 2FWLA 1F1FA 3NWVA 3ZCFA 1GKSA 2XTSB 3RN0A 1DW0A 5CIDB 3L75D 2N3YA 1PP9D 1DVVA 1RAQA 4FA5A 2ZOOA 3SWSA 1LMSA 1CCRA 2QJKB 1DW1A 4UB6V 3CWBD 4FA4A 2DGEA 3TDKA 4WQ9A 3H1LD 1BCCD 2AXTV 3O0RC 1GDVA 3CXHD 1B7VA 3L70D 4DY9A 4Q5PA 3L4MA 5DJQC 1L9JC 1NU1D 1W5CT 4AAOA 1H9XA 4LJIA 3O1YA 1HJ4A 5C0ZA 1CC5A 1LC1A 4PW9B 2ZZS1 1CTJA 3ZBMA 3L71D 5IY51 451CA 1SQBD 4WQDA 2N3BA 4H0KA 2LITA 1NTMD 5KLIB 3PLNA 1CIFA 3NBTA 4Y5RA 4EIDA 2C1UA 4WQEA 3PH2B 3A0BV 4XXLA 1W2LA 2V07A 1I5TA 3TGUD 2PCBB 1YIQA 4V2KA 3VMAA 2EXVA 3SJLA 4NFGB 4A7PA 1LS9A 1CORA 1DIIC 1OCDA 5CIBB 1CIGA 2N18B 5KAIV 1GIWA 1N90A 1COTA 2N18C 4WQCA 2O3JA 2KS1A 1CIHA 4AALA 1CRIA 1CRCA 1U74B 1YEAA 2AIUA 1CHJA 1CXCA 3VRDA 1FI3A 1SQXD 1RAPA 1DW2A 1IRVA 2MHMA 1R0QA 3L73D 3KHUA 1YEBA 2Y0CA 1H32B 1H33A 3A9FA 5H2FV 4GEDB 4O1QA 4L3GA 2QJPB 1HZVA 5CYTR 2JTIB 3A0HV 2VHDA 1NMLA 2N9JA 1CSUA 4K3IA 2K9JB 1KB9D 1AOFA 4WQ7A 1MG3D 4RSZA 155CA 1OAEA 1CYJA 4EICA 3WFCC 1L0ND 3L4OA 5CICB 1FCDC 1JDLA 3MK7C 1SQPD 1N9CA 1CRJA 1QKSA 1IQCA 2PCCB 3MK7B 3HQ7A 1CSWA 1AYGA 4KMGA 1M60A 2D0WA 1CIEA 1YNRA 1S5LV 3OA8A 1FHBA 2CXBA 1AOQA 5AURA 3L72D 2BPBB 1FOCA 2ZONG 1KX7A 1KYOD 1CSVA 2N9YB 4IL6V 5CIHB 1HH7A 3DP5A 1RZ5A 2FYNB 1NMIA 4J20A 2CA4B 3ZOOA 4EIEA 4U3FD 1GU2A 1CHIA 2C8SA 1CCHA 1I6DA 1I6EA 2JWAA 2QG4A 1N50A 3C2CA 1CHHA 4GYDA 1CRGA 2KNCB 1NTKD 4L1QA 3PXWA 1FJ0A 3PXSA 4WQAA 1DVHA 2PACA 3RN1A 1QYZA 3HQ9A 2C2CA 1C75A 2YIUB 1YFCA 1DW3A 2OZ1A 3H1HD 1A8CA 2B4ZA 1IZL0 3M97X 1KV9A 2RMZA 3H1KD 1IO3A 1CYCA 2LIRA 1U75B 1CSXA 1HRCA 1H31B 2GC7D 2L91A 3BCCD 4PWAA 2BCNB 3WUIA 1HJ5A 1HCMA 4PJ0V 2A06D 3PRJA 1BL9A 4FA1A 3VYMA 1WEJF 3L74D 4AANA 3OCDB 1KIBA 5KLVD 4FANA 1CRHA 1H9YA 3SLEA 5GTIV 1ETPA 4JCGA 2C1DA 1A56A 3ZIYA 2Y0EA 5B66V 1FI9A 1C2RA 2RN0A 1ZZHA 5CIFB 1GJQA 2B12B 3CYTI 4N0KA 1VYDA 1C52A 3WU2V 1J3SA 1SQQD 3PTZA 2MTAC 1C6SA 1P84D 2ORLA 3ORVA 3SVWA 3HQ6A 1MZ4A 1ZRTD 4O1WA 2BLFB 1C6OA 1DT1A 3RLMA 3CX5D 3TF5A 1QN2A 1M6ZA 2C9XB 5C9MA 1CYIA 5DJQB 1I8PA 351CA 3ZOXA 3DR0A 3ITKA 3ZOYA 1E8EA 3GG2A 3WFBC 1L0LD 1KB0A 1YICA 1CEDA 4AAMA 3FWLA 4QAOA 5TJHA 1F1CA 5CIEB 2ZBOA 1CTYA 3PHLA 5DFSA 2YCCA 1C6RA 1NTZD 1C2NA 5KKZB 1MG2D 3H1ID 3O5CA 1WVEC 4FA9A 5KAFV 3PXTA 1BE3D 1EB7A 1QL4A 4XYDB 2N9IA 2ZXYA 1L9BC 2B11B 1S6VB 2Y0DA 3JBTB 1YTCA 4H0JA 2QJYB 5EXQA 1CO6A 1I55A 2FRCA 1CXAA 3TYIA 5GTHV 4EDFA 1DIQC 1GQ1A 1LC2A 2CE1A 3OA8B 4FB1A 1SQVD 2CA3B 1PPJD 4WQBA 3VNWA 1IRWA 1H33B 1CTZA 1FI7A 3WFEC 1H1OA 1NIRA 1K3HA 3CP5A 4AX3A 1HROA 5CIGB 2B10B 1C7MA 1KYOW 2DVHA 5E79V 2JQRA 4L3HA 1LFMA 2GB8B 2C1DB 3CU4A 2CE0A 2BGVX 2C1VA 2HV4A 2AI5A 4FAVA 3GW6A 1I8OA 2BH4X 5TISV 3WC8A 2YK3A 3SXTA 1KX2A 1HZUA 2D0SA 4D6TD 2L4DA 1HJ3A 3X39A 4EIFA 4UB8V 1E29A 4YE1A 4RJTA 5DF5A 1M70A 2OZ1B 3ZOWA 4PD4D 2B0ZB 2FYUD 2IBZD 3CXHW 1EZVD 3RMZA 1AKKA 1CRYA 3HQ8A 1RZ6A 2YQBA 1H31A 1I54A 3DMIA 2Q3EA 3NBSA 2GIWA 2I8FA 2GC4D
chains in the Genus database with same CATH superfamily
3WFDC 1YI2P 3CX5W 2IBZE 2YKQA 1S5LE 1E2RA 4I2LC 5B5EV 5GTHH 1VF5B 2XZRA 4P4QB 1IZNB 1S5LH 1S72P 2V08A 3Q5PA 4WQ8A 1S4XA 2KXPB 1F1FA 4JYCA 5KJ7A 3B8EB 2K3RA 2J59M 3V2QA 2V7QJ 4FA5A 4U7JA 4H0LB 1LMSA 2E75B 3L4FA 1JM0A 4JQ0D 1JUNA 5KAIE 1YBKA 3AEFC 1BCCD 1X8YA 3CMEP 3L70D 1OWAA 3L4MA 2MKVA 1KFMA 3TK1A 1NTKK 4HJGH 4W7YA 2ZZS1 1FOSE 3GLMA 4WQDA 2N3BA 4PV1D 1HTLC 4XFJA 4PD4I 2WSFH 4EYYQ 3NMDA 3N7NA 1Q7YQ 3HE5A 2C1UA 3A0BV 1USDA 1LTTC 3L75J 3BCCE 3TGUD 3L36A 4LLHA 4IL6X 1YIQA 4V2KA 1DEBA 2B89A 1DIIC 3CWBJ 2HODB 5DJUB 3P8CE 3BRVB 1KB9I 4WQCA 1R8EA 5AW8B 1EXJA 3MUDA 1KYOI 3HUSB 1U74B 1NU1G 1U57A 3RK3B 1CHJA 2QM7A 1JO5A 1ZMEC 2G3AA 3M9BA 4U3FE 4Y28J 1IRVA 2E76C 1R0QA 2LXCB 2P58A 1RF1A 1FZGA 2JWDA 1NHLA 1H88A 2GA1A 3P8CD 1Q90D 2PRRA 2QJPB 3CD6P 2JTIB 5BU5A 3D6ZA 2VHDA 3L73E 5E79E 3HD7C 3TNUB 5AVWB 1CSUA 2BCCG 1X9VA 2KK7A 2E76B 3HTKB 2ZT9D 1OAEA 2CPSA 1SQVK 4DCKA 3WFCC 2QSIA 1SQBE 3EQ2A 3CCQP 1N73B 2E75C 1CRJA 1SQVJ 1IQCA 2KI7B 3MK7B 3AEEC 3HQ7A 1AYGA 2E43A 2D0WA 1YNRA 2KSEA 5GTIE 1PP9J 5APYA 3I56P 1AOQA 1Q81Q 3USSA 3L72D 3K5BA 2ZONG 1JY3N 1KYOD 1NYHA 2WVRA 1CSVA 1MFTA 1BGYG 3CX5H 2FXOA 1PP9G 1HH7A 2Z5IA 4RESB 1NMIA 4J20A 2KS1B 1SQBG 4EIEA 3L71E 4U3FD 2W6BA 1CCHA 2ITAA 3VMYA 3C2CA 2WPRA 2KNCB 1NTKD 3N4XA 1SQPJ 5TISE 3CI9A 1PFIA 1FJ0A 3H1KG 2LR2A 1JY2N 5CCHD 4JF7A 4GIFA 2H43A 1L2PA 2ZVNB 2C2CA 2Z5HA 1RF0A 2YIUB 1DW3A 2KUBA 2B4ZA 1L0LG 4GODA 1JCDA 2XV5A 1ZOYC 1M1JA 2P7JA 2ZAEB 3MGNA 2H89C 2NPSD 3VMZA 1NAYA 2LIRA 1U75B 1ZXGA 1USEA 1LP1A 1X79B 3AEAC 3WUIA 1KC8Q 1URQB 4HH2A 1WEJF 2JJLA 4C7NB 3A2AA 3AEGC 5KLVD 1EXIA 3SLEA 1VF5C 3L71J 1PPJE 1YTZI 1LTIC 5KJ7D 3P7KA 3GHGB 1H8AA 5KJ7C 1JY2O 2FFDC 1SQVG 1LT9A 1GL2B 2WT7B 3VOPA 1VYDA 3V2PA 1FC2C 3PTZA 3IAOA 2MTAC 5AW1B 1PP9E 1ZRTD 4O1WA 2C9LY 5B5EE 4ASVA 3V4QA 3L70G 1DT1A 2NRGA 3TF5A 2Y9ZA 1PL5A 1BCCG 2IZ0A 1FZEA 2QA4P 3O6QB 4GOFA 2WSCJ 1GK6A 3GG2A 1L0LD 1SS1A 2GUVA 1SQXJ 2BASA 2N1TA 2JDIH 4OWFA 5AVQB 1S2EA 4IFDK 1FAVA 1M1JC 2HG5D 1C2NA 1GD2E 4HYTB 1BSNA 1JY2P 3H1ID 3O5CA 4L75A 2B87B 3LIDA 2BCCE 1NTZE 1BGYJ 2K9YA 1YYCA 1ZRTE 3H1IG 2POHA 3JBTB 2CK3H 4OGQD 1S3JA 1CO6A 4NPEA 5AVVB 1CI6B 2E5YA 3WUUA 1NJIQ 5GTHV 4EDFA 5B5EH 2AEMA 2XKMA 2PP6A 1EZVI 4CPGA 1Q82Q 3FXEA 1L0NK 1NOHA 3TGUG 4NPDA 1H1OA 1NIRA 4D6TJ 1LTJB 4AX3A 1VQKP 1VQ8P 5E79V 2Y9YA 2YXRB 2WMMA 3B71A 1FDMA 2BGVX 1GK4A 2V7QH 2YK3A 4ZKPA 1JEKA 1WRGA 3F89A 3AE1C 1ZW0A 1Q86Q 1N86A 2I8DA 1PGQA 2A45I 2KP8A 1A02J 4UB8V 3BCCG 1S9KD 1M70A 2J5UA 2PGDA 1BSHA 5KLVE 2FYUD 2B0ZB 3HD7D 1IK9A 1HVVA 1AKKA 1FJKA 1H31A 1VPCA 3A5TA 3NBSA 2FY8A 1SLQA 2R44A 2I8FA 1C6RA 1NU1K 2K1AA 1E79H 3CC7P 3KZIV 4GKGA 2FYUG 3GF3A 1FBMA 2FYUE 5B6QA 4MN4C 3HUSA 3VP9A 1H32A 2R3CA 3NXSA 2ZYDA 2ZXXA 1K3GA 3OCDA 1NNOA 1JOCA 1YCCA 5CCGC 1OZHA 2YO2A 4AYCA 2BH5X 4QMAA 3V4WA 3H1LG 1GKSA 1D7MA 4D6TE 3RN0A 2B9BA 5CIDB 1DVVA 4C7NA 2AXCA 2ZOOA 1CCRA 1Z56A 2QJKB 5EFWB 1SFCA 2AXTV 3L74J 1CSBA 5TISH 3KPEA 4DY9A 4Q5PA 2B88A 2HFED 1L9JC 1NTMG 5C0ZA 1DD3A 2RKLA 1M1JB 4PJ0E 5KTBA 4L76A 4NPFX 3L71D 1EDKA 1SQBD 1AJYA 4BRYB 1X0TA 2IBZI 1MFZA 5KLIB 3PLNA 1CIFA 4EIDA 2FXPA 4WQEA 4XXLA 5AW7B 3MHVA 2V07A 1PPJG 2PCBB 2G8YA 5CMZA 1NTME 2OARA 4OH8B 3V2RA 3D71A 3H1IE 4DZOA 2OYHB 3H1KE 5CIBB 1CIGA 1URQD 3RL0D 2KSJA 1SQPE 1BE3J 3H32B 2O3JA 2KS1A 3CLQA 5AW5B 3C1LA 1SQQG 1CRIA 1K8AQ 2N9BA 1Y47A 2R5BA 1KILA 1RE4C 3HE5B 1W5CE 2O01N 1DW2A 3OW2O 2WSCH 4YXDC 3NTNA 1N7SC 4K35A 3H1KJ 1YEBA 2HODA 4PV1B 1H32B 3A9FA 1S1CX 5H2FV 3HTKA 1M1KQ 2J58A 2WQYC 5KAFH 3L73J 3BVHA 3A0HV 1P84H 1NMLA 3SFDC 2Q6QA 1HBWA 4YTPC 3LIEA 1AOFA 1KMIZ 5BU8B 5E79H 4WQ7A 1VL2A 4RSZA 3Q5SA 3G4SP 2LKMA 2P2UA 5KLVG 1UIIA 3D0WA 1FCDC 5APTA 4Y99C 1MV8A 1QKSA 3C9IA 3GF7A 3MP7B 5C39A 4WB4A 2B87A 2WPQA 1CSWA 1QL2A 3JC22 4H0LD 1CIEA 3T97B 3CXHH 4H13B 3OA8A 2HYNA 1VF5D 2ZXEB 2BPBB 1Y9BA 1KX7A 3H6PA 4R4MA 1K05A 2K88A 5M1BA 2R3SA 1OIPA 1RZ5A 2M5AB 2VRSA 3AE8C 3BCCJ 2O1JA 3WU2E 3ZDMA 1T8ZA 4I1LA 4OGQC 3I5CA 1RH5B 1YJWP 1I6EA 3RL0g 2QG4A 1HF9A 3FGAD 1T2KC 1N50A 4GYDA 4H13D 3H1JE 3VN0A 1PGJA 1N7SA 2SPZA 2ZVOB 1FDIA 5AW3B 4L1QA 1H0TB 1FDOA 3PXSA 1GDTA 3B5NB 1L4AD 2PACA 4JPZB 3KQGA 1N73C 3HQ9A 1GL2D 1IO4A 1G1JA 2BCCJ 1OMIA 2I1KA 2YKPA 4UB6E 3IN6A 1C75A 1RHZB 2CPBA 1AVYA 2IFMA 3M97X 1KV9A 3AE2C 1J1EB 1G2CB 1CI6A 2JEEA 1CSXA 1HRCA 1SQXE 1KQLA 1DEEG 4PWAA 2BCNB 3CCMP 4IFMA 2P10A 3CXHI 2A06D 3PRJA 1BL9A 4Z1MH 2O01H 4AANA 3B4SA 4BWNA 2JR8A 3OCDB 4ZKUA 3W67A 1M7LA 5H2FE 2FBWC 3CCVP 1CRHA 2ZFCA 1FS0E 1ETPA 2C1DA 4WY4D 1T3UA 3A3YB 2OYIC 1FI9A 3H25A 2RN0A 3IR9A 1ZZHA 5CIFB 2O1KA 3R2PA 3NFQA 5AW6B 2UWJE 4N0KA 1JTHB 2PAJA 1LWUC 1C6SA 1BCCJ 3Q5RA 1IFIA 1MZ4A 3MZWB 1OVRA 1GTWA 3RLMA 1CZQA 1IFNA 4H13C 4GOEA 2N1TB 1VQNP 1M6ZA 1BE3G 3A0HE 5DJQB 2M5AA 351CA 2YXQB 3ITKA 2XU6A 2NPSC 2E74C 2D2CD 1PZQA 3ZOYA 3H1LJ 1KB0A 1MUUA 1Y8AA 4QAOA 4OGQB 5CIEB 4KHXA 2ZBOA 2QVAA 3L75E 3PHLA 1AVOA 4RO0A 1YITP 4GT1A 3RL0B 2HPCB 1QL1A 2C9NY 1JMMA 2H88C 4H44D 1BE3E 1LTBC 1BE3D 1QL4A 1RE3A 1L9BC 1RQVA 3RK2D 1YTCA 2QJYB 5B66H 3A0HH 3RL0C 3TYIA 2IYOA 4EI2A 1FJPA 1FU1A 4I6MC 3PH0A 1N7SD 5AVRB 1ZV8A 2WPVB 3WFEC 1LT9B 1HWTC 4UB6H 3LW5J 5CIGB 1NKZB 1ZN5A 2IDBA 2YMYA 2DVHA 2JQRA 2KNCA 2YO3A 1LFMA 2C1DB 3L72J 2C1VA 3CX5I 3GHGA 1SQQJ 5TISV 1KX2A 1KYOE 1KD1Q 2WTYA 5APSA 1VDFA 4YE1A 3RK3C 4PJ0H 3WUTA 1H0TA 5B66E 4UB8E 1SQBK 5CBOA 3HQ8A 3IF4A 1QVGO 3DMIA 1URQC 3G71P 2OTJP 1SFCB 2IBZG 1AV1A 4WY4A 1A2SA 3ABVC 1BGYD 2D2CB 1QL3A 3H1JD 3KDPB 2NPSB 3SWYA 3VTPC 1YJ9P 1IFMA 4RKUJ 2DW3A 3H1JG 1SVFA 2JKVA 4MU8A 3CX5E 4U3FG 3MIWA 4U3FJ 2FFDB 2YIUC 2FXMA 3ZCFA 2XTSB 3TGUJ 3L75D 2N3YA 1RAQA 2PFXA 2H8PD 2I1JA 1L0NG 1DW1A 4FA4A 2DGEA 1SQQE 5APVA 2YNYA 3L72E 3OAKA 4WQ9A 3O0RC 1GDVA 3CXHD 2OTLP 1B7VA 1OVUA 2XNXA 1W2BO 5APQA 1NTKE 1KN7A 2OYHA 3KZIH 3S9OA 1CC5A 3FX0A 3MUDC 3L74E 1CTJA 3ZBMA 5CJ4A 2KZIA 451CA 2A06G 1EDLA 1OW7A 3MTUE 4H0KA 4GDOA 2LITA 2QM8A 1VQ6P 5L8RJ 1P84I 1RF1C 1W2LA 1I5TA 2QEXP 5GTHE 3SJLA 1MZ9A 3M0AA 1CORA 1OCDA 1LT9C 1RE4A 5KAIV 1KILB 3HD7A 1N90A 1N7LA 1COTA 5CCHA 1CIHA 3HE4B 4OVNF 2IPPA 2W8ZA 1FOSF 3EFGA 3BATA 1BDDA 3A0BE 5K5GB 3M91A 3VMXA 2QE7H 2WWWA 3VRDA 1FI3A 1SQXD 3H1LE 4D6TG 3U1CA 1SP4A 3CCUP 2A45H 3B5NA 2MHMA 1LJ2A 1OXZA 3L73D 3SFEC 2Y0CA 3H1HE 4GEDB 4O1QA 1TU3F 2M0BA 2QJYC 3AEDC 3T97A 5CYTR 2D2CC 4L74A 3RK2C 2N9JA 3H1HJ 4K3IA 2K9JB 1M56D 3RK3D 1VQLP 2ZYGA 1CYJA 4EICA 3E1RA 2N1TD 1L0ND 3L4OA 5CICB 1HGVA 1JDLA 3B5ND 3V5BA 4BRYA 2PCCB 4N6JA 4ASWA 1M60A 3AECC 1S5LV 3TSIA 1FHBA 2CXBA 1GMJA 3CL3D 1NTZJ 3F5HA 4LC1A 1VQOP 3W68A 1J1DB 1NTMJ 4IL6V 3Q3DA 1WT6A 3ZOOA 3E1IA 4JYBA 2WSEJ 1CHIA 2C8SA 1FZCC 5CBNA 2E74D 2JWAA 1KYOH 1K9MQ 1PGPA 2W27A 4H44B 1AFOA 3H32A 1CRGA 4TLFA 2OGUA 2E5TA 1KQSO 4H44C 3PXWA 1DVHA 1VQ5P 4UB8H 2AEJA 2W90A 3RGUA 2LXBA 1YFCA 2KLVA 1IZL0 2BEZF 1IO3A 2WSFJ 1DX7A 1T2KD 2WSEH 1OFCX 2L91A 2GC7D 5KAIH 4BXLA 1IC2A 2W6JH 1BGYE 3I55P 1JY3O 1HJ5A 1HCMA 5CCGA 3AE4C 5KLVK 4DT0A 1SFCC 3A0BH 1FZAA 2R5DA 1GW3A 1KTMA 1S5LX 5GTIV 2JP3A 1LTAC 3CXHE 4JCGA 2Y0EA 1NAFA 5B66V 3OA7A 3AE9C 1LT1A 2WZ7A 2C0XA 1PIXA 1GJQA 2ZYAA 3CYTI 3WU2V 1P84D 2ORLA 3AE3C 3ORVA 3SVWA 2IX7C 3HQ6A 1KORA 2RH0A 2H7HA 2N1TC 1L4AC 1YQ3C 3S4RA 2Q3IA 1C6OA 4AUWA 5C9MA 1QGKB 1JMBA 1E8EA 3WFBC 4ZMDA 3SWFA 4AAMA 1QVFO 4WBAA 1EDIA 2E75D 3U59A 2E42A 4W7ZA 5DFSA 1QX8A 1VQPP 3P32A 5AVYB 2W6AA 2IZ1A 5CCHC 1WVEC 5CHXA 4IL6E 1YQ4C 5KAFV 2Q1KA 3PXTA 2QIWA 4XYDB 2N9IA 2OYIB 4KT0J 1S6VB 5APXA 1CW5A 3HRNA 3G9RA 4H0JA 1NTZG 3P8MC 3SWKA 1DD4A 1I55A 1FZBA 1LWUB 3B5NC 1NTMK 4M3LA 1E5WA 3M0DC 1NH4A 1FZFA 1DIQC 2Q7CA 3CCLP 1GQ1A 3AEBC 1EZVE 1KILD 2ZT9C 1HGZA 1LC2A 4DOJA 1JB0J 1JY3P 3C8VA 4R4LA 2CA3B 3VNWA 2M3BA 1ZP0C 1IRWA 1K3HA 4KJMA 1HROA 2B10B 1JTHA 4W80A 1KYOW 1P84E 4L3HA 1N7SB 2GB8B 2CE0A 3H1HG 2AI5A 2E76D 2BH4X 3AE7C 3WC8A 2D0SA 1HZUA 1X22A 4JBZA 1J2JB 1L4AB 2KIKA 1R5SA 1VQ9P 1SQQK 4RJTA 2OZ1B 3HE4A 1N8RQ 1KQGB 4I7ZB 3II6A 4PD4D 3CXHW 2AEFA 2JO1A 1EZVD 1KILE 1OW6A 1L0LK 1RE3C 5AW9B 1NTKJ 5AVTB 3L70J 4TT3H 2YQBA 4WWIA 2A06E 1I54A 1LGHB 2Q3EA 1T3JA 3L35A 3H1JJ 2GC4D 3L73G 3L74G 1M8OB 1N15A 2HPCA 1K04A 4PD4E 4LGDE 1U7MA 1GU5A 1NTKG 2AXTE 2BCCD 2ZT9B 4N78E 2O01J 1CNOA 4PV1C 1U7JA 3O20A 2FWLA 3QWOC 3NWVA 2YKOA 1DW0A 1NWQA 1PP9D 1T6AA 2OYOA 5APWA 3U1AA 3SWSA 4UB6V 3CWBD 1IFPA 3TDKA 1L0LE 3H1LD 1G2CA 2M3EA 3CCSP 1PV3A 1YHQP 5DJQC 1NU1D 1W5CT 4AAOA 1H9XA 1GL2A 4LJIA 3O1YA 1HJ4A 5AW0B 2WT7A 1LC1A 2FFDA 4PW9B 3MD0A 5GTIH 5IY51 2QJPC 3VP8A 5BVZA 3D6YA 1NO4A 4XE5B 3RK2B 1NTMD 2HLOA 3TYYA 5CCGD 3QH9A 3NBTA 4Y5RA 2YMKA 3S1KA 3JSVC 3PH2B 1H89A 5KKZC 3HD7B 5CJ0A 2GUSA 1IJDB 3VMAA 2EXVA 1KILC 4NFGB 3G3ZA 3G6EP 1HJBA 2IYPA 4A7PA 1LS9A 1R5LA 4HB1A 1DH3A 4ZNCA 2N18B 1GIWA 2IFNA 2N18C 2KZJA 5AVSB 3LW5H 5AVXB 2FYUJ 4AALA 1CRCA 3EFFK 4IL6H 1YEAA 2NPSA 3RBXA 2AIUA 1CXCA 1FZCB 1LTGC 1RAPA 1KB9H 1HH0A 3SSUA 3BASA 3KHUA 5KLIC 2Z4EA 1H33A 3VYIA 1RY3A 3CC4P 3OJAB 4L3GA 3O6QA 1HZVA 4Y99B 4EOTA 1YJNP 1KB9D 2P1JA 1MG3D 4XA4A 3V2NA 1HJ0A 155CA 3CC2P 1RF0C 3MK7C 3L75G 1KV4A 2K37A 1SQPD 2KYVA 2QJKC 1N9CA 4L73A 1GW4A 4C7RA 1NU1E 4KMGA 3RK3E 2BEQD 1KB9E 1N73A 1VQMP 5AURA 1BCCE 3CCEP 3H1IJ 4HKZH 1KZUB 1FOCA 2M8RA 3CWBE 4K3AA 2N9YB 5CIHB 3PP5A 1SFCD 2NZ2A 3DP5A 3IFMA 1LTJC 1RQUA 2FYNB 2ZJSE 2CA4B 3CMAP 1J1DC 2MJZA 1NKNA 3WMM0 2FYNC 1GU2A 3BRTB 4PD4H 5AW2B 3L37A 1I6DA 1OVVA 3M06A 1CHHA 1KFNA 2R32A 2WITA 2P67A 1LP1B 3L70E 4WQAA 3PJSK 1RF1B 3RN1A 1M57D 1QYZA 2XNDH 4WVZA 2GM4A 2OZ1A 3H1HD 1A8CA 2RMZA 1EDJA 4WY4B 3FXDA 3H1KD 1K73Q 1SQXG 1URQA 4EIJA 4WY4C 1LWUA 1CYCA 3AE5C 1NTZK 1H31B 3BCCD 1NVOA 1GZLA 1M90Q 2OYIA 1SQXK 1IFJA 4PJ0V 3TNUA 4FA1A 4IOIH 3VYMA 2Q9IA 1Q2NA 2K9JA 3L74D 1OW8A 3A7OA 1KIBA 2KB7P 3CCJP 4FANA 2OTKE 1H9YA 5KAFE 1L0NE 4AQRD 4N3YB 1A56A 3ZIYA 1SQBJ 3UIAA 3TGUE 1C2RA 3D70A 3Q1MA 1YIJP 1JCCA 2B12B 1LTJA 5H2FH 1C52A 1MKMA 1J3SA 3GMAA 3L71G 1SQQD 1VQ7P 3FWNA 2HR3A 1GL2C 3AE6C 2OYHC 2A45G 3HUSC 4B86A 1JNMA 1QLED 2Q5UA 2BLFB 3CPWO 1L0NJ 1OX3A 1NU1J 1W2EA 3KXDA 1XTGB 3CX5D 2OQQA 1QN2A 2C9XB 2KLUA 1CYIA 4N78D 2FKWB 2XDJA 4YXWH 1I8PA 1ZLLA 3ZOXA 3KZIE 3DR0A 2L5GB 3L72G 1EC5A 1GU4A 3E7KA 1IK7A 2KOGA 4IFFA 1YICA 1LTSC 1CEDA 2FYUK 3JCUH 3FWLA 4C46A 5TJHA 1F1CA 1A02F 1BDCA 1EQ7A 1L0LJ 1CTYA 2YCCA 5AW4B 1NTZD 3CCRP 5KKZB 1S9KE 1AQ5A 2QRXA 1MG2D 4DJGA 5AVUB 1HUCA 3M0DA 4FA9A 5DJTB 1J1EC 3WUVA 1EB7A 2ZXYA 3GHGC 2B11B 2FYZA 2Y0DA 5EXQA 1VQ4P 2FRCA 2W83C 4YPCA 3M9HA 1CXAA 4O9BA 1AA0A 1EZVG 1PGOA 3JCUE 2CE1A 3WU2H 1SQVE 3OA8B 2WPSA 4FB1A 1SQVD 1PPJD 4WQBA 1H33B 1CTZA 1FI7A 2V4HA 1IFDA 3CP5A 1QEXA 1WMKA 1ZR4A 5KLVJ 3CWBG 1C7MA 2WSSH 4H0LC 2E74B 1UIXA 3CU4A 2AXTH 5APUA 2HV4A 1G1IA 3Q2YA 3RBZA 4FAVA 3GW6A 1I8OA 1N2DC 2C0WA 3SXTA 3R4YA 4D6TD 3EWKA 3KYQA 1ZR2A 2L4DA 1HJ3A 1DIPA 3X39A 3O8ZA 4EIFA 1E29A 3V6IA 5DF5A 3ZOWA 3M9QA 2IBZD 1L4AA 1SQPK 5AVZB 1NGMB 3RMZA 1XTCC 1AQTA 1FE6A 1CRYA 1RZ6A 1FZCA 4I7ZC 1LNQA 1SQPG 2GIWA 1KQFB 1YTZT
chains in the Genus database with same CATH topology
3WFDC 3KZIV 1N15A 3CX5W 5B6QA 1A2SA 1H32A 1BGYD 1QL3A 3H1JD 1E2RA 1K3GA 3OCDA 5B5EV 1NNOA 4P4QB 2BCCD 1YCCA 4MU8A 2V08A 2BH5X 1CNOA 4WQ8A 3O20A 2FWLA 1F1FA 3NWVA 3ZCFA 1GKSA 2XTSB 3RN0A 1DW0A 5CIDB 3L75D 2N3YA 1PP9D 1DVVA 1RAQA 4FA5A 2ZOOA 3SWSA 1LMSA 1CCRA 2QJKB 1DW1A 4UB6V 3CWBD 4FA4A 2DGEA 3TDKA 4WQ9A 3H1LD 1BCCD 2AXTV 3O0RC 1GDVA 3CXHD 1B7VA 3L70D 4DY9A 4Q5PA 3L4MA 5DJQC 1L9JC 1NU1D 1W5CT 4AAOA 1H9XA 4LJIA 3O1YA 1HJ4A 5C0ZA 1CC5A 1LC1A 4PW9B 2ZZS1 1CTJA 3ZBMA 3L71D 5IY51 451CA 1SQBD 4WQDA 2N3BA 4H0KA 2LITA 1NTMD 5KLIB 3PLNA 1CIFA 3NBTA 4Y5RA 4EIDA 2C1UA 4WQEA 3PH2B 3A0BV 4XXLA 1W2LA 2V07A 1I5TA 3TGUD 2PCBB 1YIQA 4V2KA 3VMAA 2EXVA 3SJLA 4NFGB 4A7PA 1LS9A 1CORA 1DIIC 1OCDA 5CIBB 1CIGA 2N18B 5KAIV 1GIWA 1N90A 1COTA 2N18C 4WQCA 2O3JA 2KS1A 1CIHA 4AALA 1CRIA 1CRCA 1U74B 1YEAA 2AIUA 1CHJA 1CXCA 3VRDA 1FI3A 1SQXD 1RAPA 1DW2A 1IRVA 2MHMA 1R0QA 3L73D 3KHUA 1YEBA 2Y0CA 1H32B 1H33A 3A9FA 5H2FV 4GEDB 4O1QA 4L3GA 2QJPB 1HZVA 5CYTR 2JTIB 3A0HV 2VHDA 1NMLA 2N9JA 1CSUA 4K3IA 2K9JB 1KB9D 1AOFA 4WQ7A 1MG3D 4RSZA 155CA 1OAEA 1CYJA 4EICA 3WFCC 1L0ND 3L4OA 5CICB 1FCDC 1JDLA 3MK7C 1SQPD 1N9CA 1CRJA 1QKSA 1IQCA 2PCCB 3MK7B 3HQ7A 1CSWA 1AYGA 4KMGA 1M60A 2D0WA 1CIEA 1YNRA 1S5LV 3OA8A 1FHBA 2CXBA 1AOQA 5AURA 3L72D 2BPBB 1FOCA 2ZONG 1KX7A 1KYOD 1CSVA 2N9YB 4IL6V 5CIHB 1HH7A 3DP5A 1RZ5A 2FYNB 1NMIA 4J20A 2CA4B 3ZOOA 4EIEA 4U3FD 1GU2A 1CHIA 2C8SA 1CCHA 1I6DA 1I6EA 2JWAA 2QG4A 1N50A 3C2CA 1CHHA 4GYDA 1CRGA 2KNCB 1NTKD 4L1QA 3PXWA 1FJ0A 3PXSA 4WQAA 1DVHA 2PACA 3RN1A 1QYZA 3HQ9A 2C2CA 1C75A 2YIUB 1YFCA 1DW3A 2OZ1A 3H1HD 1A8CA 2B4ZA 1IZL0 3M97X 1KV9A 2RMZA 3H1KD 1IO3A 1CYCA 2LIRA 1U75B 1CSXA 1HRCA 1H31B 2GC7D 2L91A 3BCCD 4PWAA 2BCNB 3WUIA 1HJ5A 1HCMA 4PJ0V 2A06D 3PRJA 1BL9A 4FA1A 3VYMA 1WEJF 3L74D 4AANA 3OCDB 1KIBA 5KLVD 4FANA 1CRHA 1H9YA 3SLEA 5GTIV 1ETPA 4JCGA 2C1DA 1A56A 3ZIYA 2Y0EA 5B66V 1FI9A 1C2RA 2RN0A 1ZZHA 5CIFB 1GJQA 2B12B 3CYTI 4N0KA 1VYDA 1C52A 3WU2V 1J3SA 1SQQD 3PTZA 2MTAC 1C6SA 1P84D 2ORLA 3ORVA 3SVWA 3HQ6A 1MZ4A 1ZRTD 4O1WA 2BLFB 1C6OA 1DT1A 3RLMA 3CX5D 3TF5A 1QN2A 1M6ZA 2C9XB 5C9MA 1CYIA 5DJQB 1I8PA 351CA 3ZOXA 3DR0A 3ITKA 3ZOYA 1E8EA 3GG2A 3WFBC 1L0LD 1KB0A 1YICA 1CEDA 4AAMA 3FWLA 4QAOA 5TJHA 1F1CA 5CIEB 2ZBOA 1CTYA 3PHLA 5DFSA 2YCCA 1C6RA 1NTZD 1C2NA 5KKZB 1MG2D 3H1ID 3O5CA 1WVEC 4FA9A 5KAFV 3PXTA 1BE3D 1EB7A 1QL4A 4XYDB 2N9IA 2ZXYA 1L9BC 2B11B 1S6VB 2Y0DA 3JBTB 1YTCA 4H0JA 2QJYB 5EXQA 1CO6A 1I55A 2FRCA 1CXAA 3TYIA 5GTHV 4EDFA 1DIQC 1GQ1A 1LC2A 2CE1A 3OA8B 4FB1A 1SQVD 2CA3B 1PPJD 4WQBA 3VNWA 1IRWA 1H33B 1CTZA 1FI7A 3WFEC 1H1OA 1NIRA 1K3HA 3CP5A 4AX3A 1HROA 5CIGB 2B10B 1C7MA 1KYOW 2DVHA 5E79V 2JQRA 4L3HA 1LFMA 2GB8B 2C1DB 3CU4A 2CE0A 2BGVX 2C1VA 2HV4A 2AI5A 4FAVA 3GW6A 1I8OA 2BH4X 5TISV 3WC8A 2YK3A 3SXTA 1KX2A 1HZUA 2D0SA 4D6TD 2L4DA 1HJ3A 3X39A 4EIFA 4UB8V 1E29A 4YE1A 4RJTA 5DF5A 1M70A 2OZ1B 3ZOWA 4PD4D 2B0ZB 2FYUD 2IBZD 3CXHW 1EZVD 3RMZA 1AKKA 1CRYA 3HQ8A 1RZ6A 2YQBA 1H31A 1I54A 3DMIA 2Q3EA 3NBSA 2GIWA 2I8FA 2GC4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WFD C;  3KZI V;  1N15 A;  3CX5 W;  5B6Q A;  1A2S A;  1H32 A;  1BGY D;  1QL3 A;  3H1J D;  1E2R A;  1K3G A;  3OCD A;  5B5E V;  1NNO A;  4P4Q B;  2BCC D;  1YCC A;  4MU8 A;  2V08 A;  2BH5 X;  1CNO A;  4WQ8 A;  3O20 A;  2FWL A;  1F1F A;  3NWV A;  3ZCF A;  1GKS A;  2XTS B;  3RN0 A;  1DW0 A;  5CID B;  3L75 D;  2N3Y A;  1PP9 D;  1DVV A;  1RAQ A;  4FA5 A;  2ZOO A;  3SWS A;  1LMS A;  1CCR A;  2QJK B;  1DW1 A;  4UB6 V;  3CWB D;  4FA4 A;  2DGE A;  3TDK A;  4WQ9 A;  3H1L D;  1BCC D;  2AXT V;  3O0R C;  1GDV A;  3CXH D;  1B7V A;  3L70 D;  4DY9 A;  4Q5P A;  3L4M A;  5DJQ C;  1L9J C;  1NU1 D;  1W5C T;  4AAO A;  1H9X A;  4LJI A;  3O1Y A;  1HJ4 A;  5C0Z A;  1CC5 A;  1LC1 A;  4PW9 B;  2ZZS 1;  1CTJ A;  3ZBM A;  3L71 D;  5IY5 1;  451C A;  1SQB D;  4WQD A;  2N3B A;  4H0K A;  2LIT A;  1NTM D;  5KLI B;  3PLN A;  1CIF A;  3NBT A;  4Y5R A;  4EID A;  2C1U A;  4WQE A;  3PH2 B;  3A0B V;  4XXL A;  1W2L A;  2V07 A;  1I5T A;  3TGU D;  2PCB B;  1YIQ A;  4V2K A;  3VMA A;  2EXV A;  3SJL A;  4NFG B;  4A7P A;  1LS9 A;  1COR A;  1DII C;  1OCD A;  5CIB B;  1CIG A;  2N18 B;  5KAI V;  1GIW A;  1N90 A;  1COT A;  2N18 C;  4WQC A;  2O3J A;  2KS1 A;  1CIH A;  4AAL A;  1CRI A;  1CRC A;  1U74 B;  1YEA A;  2AIU A;  1CHJ A;  1CXC A;  3VRD A;  1FI3 A;  1SQX D;  1RAP A;  1DW2 A;  1IRV A;  2MHM A;  1R0Q A;  3L73 D;  3KHU A;  1YEB A;  2Y0C A;  1H32 B;  1H33 A;  3A9F A;  5H2F V;  4GED B;  4O1Q A;  4L3G A;  2QJP B;  1HZV A;  5CYT R;  2JTI B;  3A0H V;  2VHD A;  1NML A;  2N9J A;  1CSU A;  4K3I A;  2K9J B;  1KB9 D;  1AOF A;  4WQ7 A;  1MG3 D;  4RSZ A;  155C A;  1OAE A;  1CYJ A;  4EIC A;  3WFC C;  1L0N D;  3L4O A;  5CIC B;  1FCD C;  1JDL A;  3MK7 C;  1SQP D;  1N9C A;  1CRJ A;  1QKS A;  1IQC A;  2PCC B;  3MK7 B;  3HQ7 A;  1CSW A;  1AYG A;  4KMG A;  1M60 A;  2D0W A;  1CIE A;  1YNR A;  1S5L V;  3OA8 A;  1FHB A;  2CXB A;  1AOQ A;  5AUR A;  3L72 D;  2BPB B;  1FOC A;  2ZON G;  1KX7 A;  1KYO D;  1CSV A;  2N9Y B;  4IL6 V;  5CIH B;  1HH7 A;  3DP5 A;  1RZ5 A;  2FYN B;  1NMI A;  4J20 A;  2CA4 B;  3ZOO A;  4EIE A;  4U3F D;  1GU2 A;  1CHI A;  2C8S A;  1CCH A;  1I6D A;  1I6E A;  2JWA A;  2QG4 A;  1N50 A;  3C2C A;  1CHH A;  4GYD A;  1CRG A;  2KNC B;  1NTK D;  4L1Q A;  3PXW A;  1FJ0 A;  3PXS A;  4WQA A;  1DVH A;  2PAC A;  3RN1 A;  1QYZ A;  3HQ9 A;  2C2C A;  1C75 A;  2YIU B;  1YFC A;  1DW3 A;  2OZ1 A;  3H1H D;  1A8C A;  2B4Z A;  1IZL 0;  3M97 X;  1KV9 A;  2RMZ A;  3H1K D;  1IO3 A;  1CYC A;  2LIR A;  1U75 B;  1CSX A;  1HRC A;  1H31 B;  2GC7 D;  2L91 A;  3BCC D;  4PWA A;  2BCN B;  3WUI A;  1HJ5 A;  1HCM A;  4PJ0 V;  2A06 D;  3PRJ A;  1BL9 A;  4FA1 A;  3VYM A;  1WEJ F;  3L74 D;  4AAN A;  3OCD B;  1KIB A;  5KLV D;  4FAN A;  1CRH A;  1H9Y A;  3SLE A;  5GTI V;  1ETP A;  4JCG A;  2C1D A;  1A56 A;  3ZIY A;  2Y0E A;  5B66 V;  1FI9 A;  1C2R A;  2RN0 A;  1ZZH A;  5CIF B;  1GJQ A;  2B12 B;  3CYT I;  4N0K A;  1VYD A;  1C52 A;  3WU2 V;  1J3S A;  1SQQ D;  3PTZ A;  2MTA C;  1C6S A;  1P84 D;  2ORL A;  3ORV A;  3SVW A;  3HQ6 A;  1MZ4 A;  1ZRT D;  4O1W A;  2BLF B;  1C6O A;  1DT1 A;  3RLM A;  3CX5 D;  3TF5 A;  1QN2 A;  1M6Z A;  2C9X B;  5C9M A;  1CYI A;  5DJQ B;  1I8P A;  351C A;  3ZOX A;  3DR0 A;  3ITK A;  3ZOY A;  1E8E A;  3GG2 A;  3WFB C;  1L0L D;  1KB0 A;  1YIC A;  1CED A;  4AAM A;  3FWL A;  4QAO A;  5TJH A;  1F1C A;  5CIE B;  2ZBO A;  1CTY A;  3PHL A;  5DFS A;  2YCC A;  1C6R A;  1NTZ D;  1C2N A;  5KKZ B;  1MG2 D;  3H1I D;  3O5C A;  1WVE C;  4FA9 A;  5KAF V;  3PXT A;  1BE3 D;  1EB7 A;  1QL4 A;  4XYD B;  2N9I A;  2ZXY A;  1L9B C;  2B11 B;  1S6V B;  2Y0D A;  3JBT B;  1YTC A;  4H0J A;  2QJY B;  5EXQ A;  1CO6 A;  1I55 A;  2FRC A;  1CXA A;  3TYI A;  5GTH V;  4EDF A;  1DIQ C;  1GQ1 A;  1LC2 A;  2CE1 A;  3OA8 B;  4FB1 A;  1SQV D;  2CA3 B;  1PPJ D;  4WQB A;  3VNW A;  1IRW A;  1H33 B;  1CTZ A;  1FI7 A;  3WFE C;  1H1O A;  1NIR A;  1K3H A;  3CP5 A;  4AX3 A;  1HRO A;  5CIG B;  2B10 B;  1C7M A;  1KYO W;  2DVH A;  5E79 V;  2JQR A;  4L3H A;  1LFM A;  2GB8 B;  2C1D B;  3CU4 A;  2CE0 A;  2BGV X;  2C1V A;  2HV4 A;  2AI5 A;  4FAV A;  3GW6 A;  1I8O A;  2BH4 X;  5TIS V;  3WC8 A;  2YK3 A;  3SXT A;  1KX2 A;  1HZU A;  2D0S A;  4D6T D;  2L4D A;  1HJ3 A;  3X39 A;  4EIF A;  4UB8 V;  1E29 A;  4YE1 A;  4RJT A;  5DF5 A;  1M70 A;  2OZ1 B;  3ZOW A;  4PD4 D;  2B0Z B;  2FYU D;  2IBZ D;  3CXH W;  1EZV D;  3RMZ A;  1AKK A;  1CRY A;  3HQ8 A;  1RZ6 A;  2YQB A;  1H31 A;  1I54 A;  3DMI A;  2Q3E A;  3NBS A;  2GIW A;  2I8F A;  2GC4 D; 
#chains in the Genus database with same CATH topology
 3WFD C;  1YI2 P;  3CX5 W;  2IBZ E;  2YKQ A;  1S5L E;  1E2R A;  4I2L C;  5B5E V;  5GTH H;  1VF5 B;  2XZR A;  4P4Q B;  1IZN B;  1S5L H;  1S72 P;  2V08 A;  3Q5P A;  4WQ8 A;  1S4X A;  2KXP B;  1F1F A;  4JYC A;  5KJ7 A;  3B8E B;  2K3R A;  2J59 M;  3V2Q A;  2V7Q J;  4FA5 A;  4U7J A;  4H0L B;  1LMS A;  2E75 B;  3L4F A;  1JM0 A;  4JQ0 D;  1JUN A;  5KAI E;  1YBK A;  3AEF C;  1BCC D;  1X8Y A;  3CME P;  3L70 D;  1OWA A;  3L4M A;  2MKV A;  1KFM A;  3TK1 A;  1NTK K;  4HJG H;  4W7Y A;  2ZZS 1;  1FOS E;  3GLM A;  4WQD A;  2N3B A;  4PV1 D;  1HTL C;  4XFJ A;  4PD4 I;  2WSF H;  4EYY Q;  3NMD A;  3N7N A;  1Q7Y Q;  3HE5 A;  2C1U A;  3A0B V;  1USD A;  1LTT C;  3L75 J;  3BCC E;  3TGU D;  3L36 A;  4LLH A;  4IL6 X;  1YIQ A;  4V2K A;  1DEB A;  2B89 A;  1DII C;  3CWB J;  2HOD B;  5DJU B;  3P8C E;  3BRV B;  1KB9 I;  4WQC A;  1R8E A;  5AW8 B;  1EXJ A;  3MUD A;  1KYO I;  3HUS B;  1U74 B;  1NU1 G;  1U57 A;  3RK3 B;  1CHJ A;  2QM7 A;  1JO5 A;  1ZME C;  2G3A A;  3M9B A;  4U3F E;  4Y28 J;  1IRV A;  2E76 C;  1R0Q A;  2LXC B;  2P58 A;  1RF1 A;  1FZG A;  2JWD A;  1NHL A;  1H88 A;  2GA1 A;  3P8C D;  1Q90 D;  2PRR A;  2QJP B;  3CD6 P;  2JTI B;  5BU5 A;  3D6Z A;  2VHD A;  3L73 E;  5E79 E;  3HD7 C;  3TNU B;  5AVW B;  1CSU A;  2BCC G;  1X9V A;  2KK7 A;  2E76 B;  3HTK B;  2ZT9 D;  1OAE A;  2CPS A;  1SQV K;  4DCK A;  3WFC C;  2QSI A;  1SQB E;  3EQ2 A;  3CCQ P;  1N73 B;  2E75 C;  1CRJ A;  1SQV J;  1IQC A;  2KI7 B;  3MK7 B;  3AEE C;  3HQ7 A;  1AYG A;  2E43 A;  2D0W A;  1YNR A;  2KSE A;  5GTI E;  1PP9 J;  5APY A;  3I56 P;  1AOQ A;  1Q81 Q;  3USS A;  3L72 D;  3K5B A;  2ZON G;  1JY3 N;  1KYO D;  1NYH A;  2WVR A;  1CSV A;  1MFT A;  1BGY G;  3CX5 H;  2FXO A;  1PP9 G;  1HH7 A;  2Z5I A;  4RES B;  1NMI A;  4J20 A;  2KS1 B;  1SQB G;  4EIE A;  3L71 E;  4U3F D;  2W6B A;  1CCH A;  2ITA A;  3VMY A;  3C2C A;  2WPR A;  2KNC B;  1NTK D;  3N4X A;  1SQP J;  5TIS E;  3CI9 A;  1PFI A;  1FJ0 A;  3H1K G;  2LR2 A;  1JY2 N;  5CCH D;  4JF7 A;  4GIF A;  2H43 A;  1L2P A;  2ZVN B;  2C2C A;  2Z5H A;  1RF0 A;  2YIU B;  1DW3 A;  2KUB A;  2B4Z A;  1L0L G;  4GOD A;  1JCD A;  2XV5 A;  1ZOY C;  1M1J A;  2P7J A;  2ZAE B;  3MGN A;  2H89 C;  2NPS D;  3VMZ A;  1NAY A;  2LIR A;  1U75 B;  1ZXG A;  1USE A;  1LP1 A;  1X79 B;  3AEA C;  3WUI A;  1KC8 Q;  1URQ B;  4HH2 A;  1WEJ F;  2JJL A;  4C7N B;  3A2A A;  3AEG C;  5KLV D;  1EXI A;  3SLE A;  1VF5 C;  3L71 J;  1PPJ E;  1YTZ I;  1LTI C;  5KJ7 D;  3P7K A;  3GHG B;  1H8A A;  5KJ7 C;  1JY2 O;  2FFD C;  1SQV G;  1LT9 A;  1GL2 B;  2WT7 B;  3VOP A;  1VYD A;  3V2P A;  1FC2 C;  3PTZ A;  3IAO A;  2MTA C;  5AW1 B;  1PP9 E;  1ZRT D;  4O1W A;  2C9L Y;  5B5E E;  4ASV A;  3V4Q A;  3L70 G;  1DT1 A;  2NRG A;  3TF5 A;  2Y9Z A;  1PL5 A;  1BCC G;  2IZ0 A;  1FZE A;  2QA4 P;  3O6Q B;  4GOF A;  2WSC J;  1GK6 A;  3GG2 A;  1L0L D;  1SS1 A;  2GUV A;  1SQX J;  2BAS A;  2N1T A;  2JDI H;  4OWF A;  5AVQ B;  1S2E A;  4IFD K;  1FAV A;  1M1J C;  2HG5 D;  1C2N A;  1GD2 E;  4HYT B;  1BSN A;  1JY2 P;  3H1I D;  3O5C A;  4L75 A;  2B87 B;  3LID A;  2BCC E;  1NTZ E;  1BGY J;  2K9Y A;  1YYC A;  1ZRT E;  3H1I G;  2POH A;  3JBT B;  2CK3 H;  4OGQ D;  1S3J A;  1CO6 A;  4NPE A;  5AVV B;  1CI6 B;  2E5Y A;  3WUU A;  1NJI Q;  5GTH V;  4EDF A;  5B5E H;  2AEM A;  2XKM A;  2PP6 A;  1EZV I;  4CPG A;  1Q82 Q;  3FXE A;  1L0N K;  1NOH A;  3TGU G;  4NPD A;  1H1O A;  1NIR A;  4D6T J;  1LTJ B;  4AX3 A;  1VQK P;  1VQ8 P;  5E79 V;  2Y9Y A;  2YXR B;  2WMM A;  3B71 A;  1FDM A;  2BGV X;  1GK4 A;  2V7Q H;  2YK3 A;  4ZKP A;  1JEK A;  1WRG A;  3F89 A;  3AE1 C;  1ZW0 A;  1Q86 Q;  1N86 A;  2I8D A;  1PGQ A;  2A45 I;  2KP8 A;  1A02 J;  4UB8 V;  3BCC G;  1S9K D;  1M70 A;  2J5U A;  2PGD A;  1BSH A;  5KLV E;  2FYU D;  2B0Z B;  3HD7 D;  1IK9 A;  1HVV A;  1AKK A;  1FJK A;  1H31 A;  1VPC A;  3A5T A;  3NBS A;  2FY8 A;  1SLQ A;  2R44 A;  2I8F A;  1C6R A;  1NU1 K;  2K1A A;  1E79 H;  3CC7 P;  3KZI V;  4GKG A;  2FYU G;  3GF3 A;  1FBM A;  2FYU E;  5B6Q A;  4MN4 C;  3HUS A;  3VP9 A;  1H32 A;  2R3C A;  3NXS A;  2ZYD A;  2ZXX A;  1K3G A;  3OCD A;  1NNO A;  1JOC A;  1YCC A;  5CCG C;  1OZH A;  2YO2 A;  4AYC A;  2BH5 X;  4QMA A;  3V4W A;  3H1L G;  1GKS A;  1D7M A;  4D6T E;  3RN0 A;  2B9B A;  5CID B;  1DVV A;  4C7N A;  2AXC A;  2ZOO A;  1CCR A;  1Z56 A;  2QJK B;  5EFW B;  1SFC A;  2AXT V;  3L74 J;  1CSB A;  5TIS H;  3KPE A;  4DY9 A;  4Q5P A;  2B88 A;  2HFE D;  1L9J C;  1NTM G;  5C0Z A;  1DD3 A;  2RKL A;  1M1J B;  4PJ0 E;  5KTB A;  4L76 A;  4NPF X;  3L71 D;  1EDK A;  1SQB D;  1AJY A;  4BRY B;  1X0T A;  2IBZ I;  1MFZ A;  5KLI B;  3PLN A;  1CIF A;  4EID A;  2FXP A;  4WQE A;  4XXL A;  5AW7 B;  3MHV A;  2V07 A;  1PPJ G;  2PCB B;  2G8Y A;  5CMZ A;  1NTM E;  2OAR A;  4OH8 B;  3V2R A;  3D71 A;  3H1I E;  4DZO A;  2OYH B;  3H1K E;  5CIB B;  1CIG A;  1URQ D;  3RL0 D;  2KSJ A;  1SQP E;  1BE3 J;  3H32 B;  2O3J A;  2KS1 A;  3CLQ A;  5AW5 B;  3C1L A;  1SQQ G;  1CRI A;  1K8A Q;  2N9B A;  1Y47 A;  2R5B A;  1KIL A;  1RE4 C;  3HE5 B;  1W5C E;  2O01 N;  1DW2 A;  3OW2 O;  2WSC H;  4YXD C;  3NTN A;  1N7S C;  4K35 A;  3H1K J;  1YEB A;  2HOD A;  4PV1 B;  1H32 B;  3A9F A;  1S1C X;  5H2F V;  3HTK A;  1M1K Q;  2J58 A;  2WQY C;  5KAF H;  3L73 J;  3BVH A;  3A0H V;  1P84 H;  1NML A;  3SFD C;  2Q6Q A;  1HBW A;  4YTP C;  3LIE A;  1AOF A;  1KMI Z;  5BU8 B;  5E79 H;  4WQ7 A;  1VL2 A;  4RSZ A;  3Q5S A;  3G4S P;  2LKM A;  2P2U A;  5KLV G;  1UII A;  3D0W A;  1FCD C;  5APT A;  4Y99 C;  1MV8 A;  1QKS A;  3C9I A;  3GF7 A;  3MP7 B;  5C39 A;  4WB4 A;  2B87 A;  2WPQ A;  1CSW A;  1QL2 A;  3JC2 2;  4H0L D;  1CIE A;  3T97 B;  3CXH H;  4H13 B;  3OA8 A;  2HYN A;  1VF5 D;  2ZXE B;  2BPB B;  1Y9B A;  1KX7 A;  3H6P A;  4R4M A;  1K05 A;  2K88 A;  5M1B A;  2R3S A;  1OIP A;  1RZ5 A;  2M5A B;  2VRS A;  3AE8 C;  3BCC J;  2O1J A;  3WU2 E;  3ZDM A;  1T8Z A;  4I1L A;  4OGQ C;  3I5C A;  1RH5 B;  1YJW P;  1I6E A;  3RL0 g;  2QG4 A;  1HF9 A;  3FGA D;  1T2K C;  1N50 A;  4GYD A;  4H13 D;  3H1J E;  3VN0 A;  1PGJ A;  1N7S A;  2SPZ A;  2ZVO B;  1FDI A;  5AW3 B;  4L1Q A;  1H0T B;  1FDO A;  3PXS A;  1GDT A;  3B5N B;  1L4A D;  2PAC A;  4JPZ B;  3KQG A;  1N73 C;  3HQ9 A;  1GL2 D;  1IO4 A;  1G1J A;  2BCC J;  1OMI A;  2I1K A;  2YKP A;  4UB6 E;  3IN6 A;  1C75 A;  1RHZ B;  2CPB A;  1AVY A;  2IFM A;  3M97 X;  1KV9 A;  3AE2 C;  1J1E B;  1G2C B;  1CI6 A;  2JEE A;  1CSX A;  1HRC A;  1SQX E;  1KQL A;  1DEE G;  4PWA A;  2BCN B;  3CCM P;  4IFM A;  2P10 A;  3CXH I;  2A06 D;  3PRJ A;  1BL9 A;  4Z1M H;  2O01 H;  4AAN A;  3B4S A;  4BWN A;  2JR8 A;  3OCD B;  4ZKU A;  3W67 A;  1M7L A;  5H2F E;  2FBW C;  3CCV P;  1CRH A;  2ZFC A;  1FS0 E;  1ETP A;  2C1D A;  4WY4 D;  1T3U A;  3A3Y B;  2OYI C;  1FI9 A;  3H25 A;  2RN0 A;  3IR9 A;  1ZZH A;  5CIF B;  2O1K A;  3R2P A;  3NFQ A;  5AW6 B;  2UWJ E;  4N0K A;  1JTH B;  2PAJ A;  1LWU C;  1C6S A;  1BCC J;  3Q5R A;  1IFI A;  1MZ4 A;  3MZW B;  1OVR A;  1GTW A;  3RLM A;  1CZQ A;  1IFN A;  4H13 C;  4GOE A;  2N1T B;  1VQN P;  1M6Z A;  1BE3 G;  3A0H E;  5DJQ B;  2M5A A;  351C A;  2YXQ B;  3ITK A;  2XU6 A;  2NPS C;  2E74 C;  2D2C D;  1PZQ A;  3ZOY A;  3H1L J;  1KB0 A;  1MUU A;  1Y8A A;  4QAO A;  4OGQ B;  5CIE B;  4KHX A;  2ZBO A;  2QVA A;  3L75 E;  3PHL A;  1AVO A;  4RO0 A;  1YIT P;  4GT1 A;  3RL0 B;  2HPC B;  1QL1 A;  2C9N Y;  1JMM A;  2H88 C;  4H44 D;  1BE3 E;  1LTB C;  1BE3 D;  1QL4 A;  1RE3 A;  1L9B C;  1RQV A;  3RK2 D;  1YTC A;  2QJY B;  5B66 H;  3A0H H;  3RL0 C;  3TYI A;  2IYO A;  4EI2 A;  1FJP A;  1FU1 A;  4I6M C;  3PH0 A;  1N7S D;  5AVR B;  1ZV8 A;  2WPV B;  3WFE C;  1LT9 B;  1HWT C;  4UB6 H;  3LW5 J;  5CIG B;  1NKZ B;  1ZN5 A;  2IDB A;  2YMY A;  2DVH A;  2JQR A;  2KNC A;  2YO3 A;  1LFM A;  2C1D B;  3L72 J;  2C1V A;  3CX5 I;  3GHG A;  1SQQ J;  5TIS V;  1KX2 A;  1KYO E;  1KD1 Q;  2WTY A;  5APS A;  1VDF A;  4YE1 A;  3RK3 C;  4PJ0 H;  3WUT A;  1H0T A;  5B66 E;  4UB8 E;  1SQB K;  5CBO A;  3HQ8 A;  3IF4 A;  1QVG O;  3DMI A;  1URQ C;  3G71 P;  2OTJ P;  1SFC B;  2IBZ G;  1AV1 A;  4WY4 A;  1A2S A;  3ABV C;  1BGY D;  2D2C B;  1QL3 A;  3H1J D;  3KDP B;  2NPS B;  3SWY A;  3VTP C;  1YJ9 P;  1IFM A;  4RKU J;  2DW3 A;  3H1J G;  1SVF A;  2JKV A;  4MU8 A;  3CX5 E;  4U3F G;  3MIW A;  4U3F J;  2FFD B;  2YIU C;  2FXM A;  3ZCF A;  2XTS B;  3TGU J;  3L75 D;  2N3Y A;  1RAQ A;  2PFX A;  2H8P D;  2I1J A;  1L0N G;  1DW1 A;  4FA4 A;  2DGE A;  1SQQ E;  5APV A;  2YNY A;  3L72 E;  3OAK A;  4WQ9 A;  3O0R C;  1GDV A;  3CXH D;  2OTL P;  1B7V A;  1OVU A;  2XNX A;  1W2B O;  5APQ A;  1NTK E;  1KN7 A;  2OYH A;  3KZI H;  3S9O A;  1CC5 A;  3FX0 A;  3MUD C;  3L74 E;  1CTJ A;  3ZBM A;  5CJ4 A;  2KZI A;  451C A;  2A06 G;  1EDL A;  1OW7 A;  3MTU E;  4H0K A;  4GDO A;  2LIT A;  2QM8 A;  1VQ6 P;  5L8R J;  1P84 I;  1RF1 C;  1W2L A;  1I5T A;  2QEX P;  5GTH E;  3SJL A;  1MZ9 A;  3M0A A;  1COR A;  1OCD A;  1LT9 C;  1RE4 A;  5KAI V;  1KIL B;  3HD7 A;  1N90 A;  1N7L A;  1COT A;  5CCH A;  1CIH A;  3HE4 B;  4OVN F;  2IPP A;  2W8Z A;  1FOS F;  3EFG A;  3BAT A;  1BDD A;  3A0B E;  5K5G B;  3M91 A;  3VMX A;  2QE7 H;  2WWW A;  3VRD A;  1FI3 A;  1SQX D;  3H1L E;  4D6T G;  3U1C A;  1SP4 A;  3CCU P;  2A45 H;  3B5N A;  2MHM A;  1LJ2 A;  1OXZ A;  3L73 D;  3SFE C;  2Y0C A;  3H1H E;  4GED B;  4O1Q A;  1TU3 F;  2M0B A;  2QJY C;  3AED C;  3T97 A;  5CYT R;  2D2C C;  4L74 A;  3RK2 C;  2N9J A;  3H1H J;  4K3I A;  2K9J B;  1M56 D;  3RK3 D;  1VQL P;  2ZYG A;  1CYJ A;  4EIC A;  3E1R A;  2N1T D;  1L0N D;  3L4O A;  5CIC B;  1HGV A;  1JDL A;  3B5N D;  3V5B A;  4BRY A;  2PCC B;  4N6J A;  4ASW A;  1M60 A;  3AEC C;  1S5L V;  3TSI A;  1FHB A;  2CXB A;  1GMJ A;  3CL3 D;  1NTZ J;  3F5H A;  4LC1 A;  1VQO P;  3W68 A;  1J1D B;  1NTM J;  4IL6 V;  3Q3D A;  1WT6 A;  3ZOO A;  3E1I A;  4JYB A;  2WSE J;  1CHI A;  2C8S A;  1FZC C;  5CBN A;  2E74 D;  2JWA A;  1KYO H;  1K9M Q;  1PGP A;  2W27 A;  4H44 B;  1AFO A;  3H32 A;  1CRG A;  4TLF A;  2OGU A;  2E5T A;  1KQS O;  4H44 C;  3PXW A;  1DVH A;  1VQ5 P;  4UB8 H;  2AEJ A;  2W90 A;  3RGU A;  2LXB A;  1YFC A;  2KLV A;  1IZL 0;  2BEZ F;  1IO3 A;  2WSF J;  1DX7 A;  1T2K D;  2WSE H;  1OFC X;  2L91 A;  2GC7 D;  5KAI H;  4BXL A;  1IC2 A;  2W6J H;  1BGY E;  3I55 P;  1JY3 O;  1HJ5 A;  1HCM A;  5CCG A;  3AE4 C;  5KLV K;  4DT0 A;  1SFC C;  3A0B H;  1FZA A;  2R5D A;  1GW3 A;  1KTM A;  1S5L X;  5GTI V;  2JP3 A;  1LTA C;  3CXH E;  4JCG A;  2Y0E A;  1NAF A;  5B66 V;  3OA7 A;  3AE9 C;  1LT1 A;  2WZ7 A;  2C0X A;  1PIX A;  1GJQ A;  2ZYA A;  3CYT I;  3WU2 V;  1P84 D;  2ORL A;  3AE3 C;  3ORV A;  3SVW A;  2IX7 C;  3HQ6 A;  1KOR A;  2RH0 A;  2H7H A;  2N1T C;  1L4A C;  1YQ3 C;  3S4R A;  2Q3I A;  1C6O A;  4AUW A;  5C9M A;  1QGK B;  1JMB A;  1E8E A;  3WFB C;  4ZMD A;  3SWF A;  4AAM A;  1QVF O;  4WBA A;  1EDI A;  2E75 D;  3U59 A;  2E42 A;  4W7Z A;  5DFS A;  1QX8 A;  1VQP P;  3P32 A;  5AVY B;  2W6A A;  2IZ1 A;  5CCH C;  1WVE C;  5CHX A;  4IL6 E;  1YQ4 C;  5KAF V;  2Q1K A;  3PXT A;  2QIW A;  4XYD B;  2N9I A;  2OYI B;  4KT0 J;  1S6V B;  5APX A;  1CW5 A;  3HRN A;  3G9R A;  4H0J A;  1NTZ G;  3P8M C;  3SWK A;  1DD4 A;  1I55 A;  1FZB A;  1LWU B;  3B5N C;  1NTM K;  4M3L A;  1E5W A;  3M0D C;  1NH4 A;  1FZF A;  1DIQ C;  2Q7C A;  3CCL P;  1GQ1 A;  3AEB C;  1EZV E;  1KIL D;  2ZT9 C;  1HGZ A;  1LC2 A;  4DOJ A;  1JB0 J;  1JY3 P;  3C8V A;  4R4L A;  2CA3 B;  3VNW A;  2M3B A;  1ZP0 C;  1IRW A;  1K3H A;  4KJM A;  1HRO A;  2B10 B;  1JTH A;  4W80 A;  1KYO W;  1P84 E;  4L3H A;  1N7S B;  2GB8 B;  2CE0 A;  3H1H G;  2AI5 A;  2E76 D;  2BH4 X;  3AE7 C;  3WC8 A;  2D0S A;  1HZU A;  1X22 A;  4JBZ A;  1J2J B;  1L4A B;  2KIK A;  1R5S A;  1VQ9 P;  1SQQ K;  4RJT A;  2OZ1 B;  3HE4 A;  1N8R Q;  1KQG B;  4I7Z B;  3II6 A;  4PD4 D;  3CXH W;  2AEF A;  2JO1 A;  1EZV D;  1KIL E;  1OW6 A;  1L0L K;  1RE3 C;  5AW9 B;  1NTK J;  5AVT B;  3L70 J;  4TT3 H;  2YQB A;  4WWI A;  2A06 E;  1I54 A;  1LGH B;  2Q3E A;  1T3J A;  3L35 A;  3H1J J;  2GC4 D;  3L73 G;  3L74 G;  1M8O B;  1N15 A;  2HPC A;  1K04 A;  4PD4 E;  4LGD E;  1U7M A;  1GU5 A;  1NTK G;  2AXT E;  2BCC D;  2ZT9 B;  4N78 E;  2O01 J;  1CNO A;  4PV1 C;  1U7J A;  3O20 A;  2FWL A;  3QWO C;  3NWV A;  2YKO A;  1DW0 A;  1NWQ A;  1PP9 D;  1T6A A;  2OYO A;  5APW A;  3U1A A;  3SWS A;  4UB6 V;  3CWB D;  1IFP A;  3TDK A;  1L0L E;  3H1L D;  1G2C A;  2M3E A;  3CCS P;  1PV3 A;  1YHQ P;  5DJQ C;  1NU1 D;  1W5C T;  4AAO A;  1H9X A;  1GL2 A;  4LJI A;  3O1Y A;  1HJ4 A;  5AW0 B;  2WT7 A;  1LC1 A;  2FFD A;  4PW9 B;  3MD0 A;  5GTI H;  5IY5 1;  2QJP C;  3VP8 A;  5BVZ A;  3D6Y A;  1NO4 A;  4XE5 B;  3RK2 B;  1NTM D;  2HLO A;  3TYY A;  5CCG D;  3QH9 A;  3NBT A;  4Y5R A;  2YMK A;  3S1K A;  3JSV C;  3PH2 B;  1H89 A;  5KKZ C;  3HD7 B;  5CJ0 A;  2GUS A;  1IJD B;  3VMA A;  2EXV A;  1KIL C;  4NFG B;  3G3Z A;  3G6E P;  1HJB A;  2IYP A;  4A7P A;  1LS9 A;  1R5L A;  4HB1 A;  1DH3 A;  4ZNC A;  2N18 B;  1GIW A;  2IFN A;  2N18 C;  2KZJ A;  5AVS B;  3LW5 H;  5AVX B;  2FYU J;  4AAL A;  1CRC A;  3EFF K;  4IL6 H;  1YEA A;  2NPS A;  3RBX A;  2AIU A;  1CXC A;  1FZC B;  1LTG C;  1RAP A;  1KB9 H;  1HH0 A;  3SSU A;  3BAS A;  3KHU A;  5KLI C;  2Z4E A;  1H33 A;  3VYI A;  1RY3 A;  3CC4 P;  3OJA B;  4L3G A;  3O6Q A;  1HZV A;  4Y99 B;  4EOT A;  1YJN P;  1KB9 D;  2P1J A;  1MG3 D;  4XA4 A;  3V2N A;  1HJ0 A;  155C A;  3CC2 P;  1RF0 C;  3MK7 C;  3L75 G;  1KV4 A;  2K37 A;  1SQP D;  2KYV A;  2QJK C;  1N9C A;  4L73 A;  1GW4 A;  4C7R A;  1NU1 E;  4KMG A;  3RK3 E;  2BEQ D;  1KB9 E;  1N73 A;  1VQM P;  5AUR A;  1BCC E;  3CCE P;  3H1I J;  4HKZ H;  1KZU B;  1FOC A;  2M8R A;  3CWB E;  4K3A A;  2N9Y B;  5CIH B;  3PP5 A;  1SFC D;  2NZ2 A;  3DP5 A;  3IFM A;  1LTJ C;  1RQU A;  2FYN B;  2ZJS E;  2CA4 B;  3CMA P;  1J1D C;  2MJZ A;  1NKN A;  3WMM 0;  2FYN C;  1GU2 A;  3BRT B;  4PD4 H;  5AW2 B;  3L37 A;  1I6D A;  1OVV A;  3M06 A;  1CHH A;  1KFN A;  2R32 A;  2WIT A;  2P67 A;  1LP1 B;  3L70 E;  4WQA A;  3PJS K;  1RF1 B;  3RN1 A;  1M57 D;  1QYZ A;  2XND H;  4WVZ A;  2GM4 A;  2OZ1 A;  3H1H D;  1A8C A;  2RMZ A;  1EDJ A;  4WY4 B;  3FXD A;  3H1K D;  1K73 Q;  1SQX G;  1URQ A;  4EIJ A;  4WY4 C;  1LWU A;  1CYC A;  3AE5 C;  1NTZ K;  1H31 B;  3BCC D;  1NVO A;  1GZL A;  1M90 Q;  2OYI A;  1SQX K;  1IFJ A;  4PJ0 V;  3TNU A;  4FA1 A;  4IOI H;  3VYM A;  2Q9I A;  1Q2N A;  2K9J A;  3L74 D;  1OW8 A;  3A7O A;  1KIB A;  2KB7 P;  3CCJ P;  4FAN A;  2OTK E;  1H9Y A;  5KAF E;  1L0N E;  4AQR D;  4N3Y B;  1A56 A;  3ZIY A;  1SQB J;  3UIA A;  3TGU E;  1C2R A;  3D70 A;  3Q1M A;  1YIJ P;  1JCC A;  2B12 B;  1LTJ A;  5H2F H;  1C52 A;  1MKM A;  1J3S A;  3GMA A;  3L71 G;  1SQQ D;  1VQ7 P;  3FWN A;  2HR3 A;  1GL2 C;  3AE6 C;  2OYH C;  2A45 G;  3HUS C;  4B86 A;  1JNM A;  1QLE D;  2Q5U A;  2BLF B;  3CPW O;  1L0N J;  1OX3 A;  1NU1 J;  1W2E A;  3KXD A;  1XTG B;  3CX5 D;  2OQQ A;  1QN2 A;  2C9X B;  2KLU A;  1CYI A;  4N78 D;  2FKW B;  2XDJ A;  4YXW H;  1I8P A;  1ZLL A;  3ZOX A;  3KZI E;  3DR0 A;  2L5G B;  3L72 G;  1EC5 A;  1GU4 A;  3E7K A;  1IK7 A;  2KOG A;  4IFF A;  1YIC A;  1LTS C;  1CED A;  2FYU K;  3JCU H;  3FWL A;  4C46 A;  5TJH A;  1F1C A;  1A02 F;  1BDC A;  1EQ7 A;  1L0L J;  1CTY A;  2YCC A;  5AW4 B;  1NTZ D;  3CCR P;  5KKZ B;  1S9K E;  1AQ5 A;  2QRX A;  1MG2 D;  4DJG A;  5AVU B;  1HUC A;  3M0D A;  4FA9 A;  5DJT B;  1J1E C;  3WUV A;  1EB7 A;  2ZXY A;  3GHG C;  2B11 B;  2FYZ A;  2Y0D A;  5EXQ A;  1VQ4 P;  2FRC A;  2W83 C;  4YPC A;  3M9H A;  1CXA A;  4O9B A;  1AA0 A;  1EZV G;  1PGO A;  3JCU E;  2CE1 A;  3WU2 H;  1SQV E;  3OA8 B;  2WPS A;  4FB1 A;  1SQV D;  1PPJ D;  4WQB A;  1H33 B;  1CTZ A;  1FI7 A;  2V4H A;  1IFD A;  3CP5 A;  1QEX A;  1WMK A;  1ZR4 A;  5KLV J;  3CWB G;  1C7M A;  2WSS H;  4H0L C;  2E74 B;  1UIX A;  3CU4 A;  2AXT H;  5APU A;  2HV4 A;  1G1I A;  3Q2Y A;  3RBZ A;  4FAV A;  3GW6 A;  1I8O A;  1N2D C;  2C0W A;  3SXT A;  3R4Y A;  4D6T D;  3EWK A;  3KYQ A;  1ZR2 A;  2L4D A;  1HJ3 A;  1DIP A;  3X39 A;  3O8Z A;  4EIF A;  1E29 A;  3V6I A;  5DF5 A;  3ZOW A;  3M9Q A;  2IBZ D;  1L4A A;  1SQP K;  5AVZ B;  1NGM B;  3RMZ A;  1XTC C;  1AQT A;  1FE6 A;  1CRY A;  1RZ6 A;  1FZC A;  4I7Z C;  1LNQ A;  1SQP G;  2GIW A;  1KQF B;  1YTZ T; 
#chains in the Genus database with same CATH homology
 3WFD C;  3KZI V;  1N15 A;  3CX5 W;  5B6Q A;  1A2S A;  1H32 A;  1BGY D;  1QL3 A;  3H1J D;  1E2R A;  1K3G A;  3OCD A;  5B5E V;  1NNO A;  4P4Q B;  2BCC D;  1YCC A;  4MU8 A;  2V08 A;  2BH5 X;  1CNO A;  4WQ8 A;  3O20 A;  2FWL A;  1F1F A;  3NWV A;  3ZCF A;  1GKS A;  2XTS B;  3RN0 A;  1DW0 A;  5CID B;  3L75 D;  2N3Y A;  1PP9 D;  1DVV A;  1RAQ A;  4FA5 A;  2ZOO A;  3SWS A;  1LMS A;  1CCR A;  2QJK B;  1DW1 A;  4UB6 V;  3CWB D;  4FA4 A;  2DGE A;  3TDK A;  4WQ9 A;  3H1L D;  1BCC D;  2AXT V;  3O0R C;  1GDV A;  3CXH D;  1B7V A;  3L70 D;  4DY9 A;  4Q5P A;  3L4M A;  5DJQ C;  1L9J C;  1NU1 D;  1W5C T;  4AAO A;  1H9X A;  4LJI A;  3O1Y A;  1HJ4 A;  5C0Z A;  1CC5 A;  1LC1 A;  4PW9 B;  2ZZS 1;  1CTJ A;  3ZBM A;  3L71 D;  5IY5 1;  451C A;  1SQB D;  4WQD A;  2N3B A;  4H0K A;  2LIT A;  1NTM D;  5KLI B;  3PLN A;  1CIF A;  3NBT A;  4Y5R A;  4EID A;  2C1U A;  4WQE A;  3PH2 B;  3A0B V;  4XXL A;  1W2L A;  2V07 A;  1I5T A;  3TGU D;  2PCB B;  1YIQ A;  4V2K A;  3VMA A;  2EXV A;  3SJL A;  4NFG B;  4A7P A;  1LS9 A;  1COR A;  1DII C;  1OCD A;  5CIB B;  1CIG A;  2N18 B;  5KAI V;  1GIW A;  1N90 A;  1COT A;  2N18 C;  4WQC A;  2O3J A;  2KS1 A;  1CIH A;  4AAL A;  1CRI A;  1CRC A;  1U74 B;  1YEA A;  2AIU A;  1CHJ A;  1CXC A;  3VRD A;  1FI3 A;  1SQX D;  1RAP A;  1DW2 A;  1IRV A;  2MHM A;  1R0Q A;  3L73 D;  3KHU A;  1YEB A;  2Y0C A;  1H32 B;  1H33 A;  3A9F A;  5H2F V;  4GED B;  4O1Q A;  4L3G A;  2QJP B;  1HZV A;  5CYT R;  2JTI B;  3A0H V;  2VHD A;  1NML A;  2N9J A;  1CSU A;  4K3I A;  2K9J B;  1KB9 D;  1AOF A;  4WQ7 A;  1MG3 D;  4RSZ A;  155C A;  1OAE A;  1CYJ A;  4EIC A;  3WFC C;  1L0N D;  3L4O A;  5CIC B;  1FCD C;  1JDL A;  3MK7 C;  1SQP D;  1N9C A;  1CRJ A;  1QKS A;  1IQC A;  2PCC B;  3MK7 B;  3HQ7 A;  1CSW A;  1AYG A;  4KMG A;  1M60 A;  2D0W A;  1CIE A;  1YNR A;  1S5L V;  3OA8 A;  1FHB A;  2CXB A;  1AOQ A;  5AUR A;  3L72 D;  2BPB B;  1FOC A;  2ZON G;  1KX7 A;  1KYO D;  1CSV A;  2N9Y B;  4IL6 V;  5CIH B;  1HH7 A;  3DP5 A;  1RZ5 A;  2FYN B;  1NMI A;  4J20 A;  2CA4 B;  3ZOO A;  4EIE A;  4U3F D;  1GU2 A;  1CHI A;  2C8S A;  1CCH A;  1I6D A;  1I6E A;  2JWA A;  2QG4 A;  1N50 A;  3C2C A;  1CHH A;  4GYD A;  1CRG A;  2KNC B;  1NTK D;  4L1Q A;  3PXW A;  1FJ0 A;  3PXS A;  4WQA A;  1DVH A;  2PAC A;  3RN1 A;  1QYZ A;  3HQ9 A;  2C2C A;  1C75 A;  2YIU B;  1YFC A;  1DW3 A;  2OZ1 A;  3H1H D;  1A8C A;  2B4Z A;  1IZL 0;  3M97 X;  1KV9 A;  2RMZ A;  3H1K D;  1IO3 A;  1CYC A;  2LIR A;  1U75 B;  1CSX A;  1HRC A;  1H31 B;  2GC7 D;  2L91 A;  3BCC D;  4PWA A;  2BCN B;  3WUI A;  1HJ5 A;  1HCM A;  4PJ0 V;  2A06 D;  3PRJ A;  1BL9 A;  4FA1 A;  3VYM A;  1WEJ F;  3L74 D;  4AAN A;  3OCD B;  1KIB A;  5KLV D;  4FAN A;  1CRH A;  1H9Y A;  3SLE A;  5GTI V;  1ETP A;  4JCG A;  2C1D A;  1A56 A;  3ZIY A;  2Y0E A;  5B66 V;  1FI9 A;  1C2R A;  2RN0 A;  1ZZH A;  5CIF B;  1GJQ A;  2B12 B;  3CYT I;  4N0K A;  1VYD A;  1C52 A;  3WU2 V;  1J3S A;  1SQQ D;  3PTZ A;  2MTA C;  1C6S A;  1P84 D;  2ORL A;  3ORV A;  3SVW A;  3HQ6 A;  1MZ4 A;  1ZRT D;  4O1W A;  2BLF B;  1C6O A;  1DT1 A;  3RLM A;  3CX5 D;  3TF5 A;  1QN2 A;  1M6Z A;  2C9X B;  5C9M A;  1CYI A;  5DJQ B;  1I8P A;  351C A;  3ZOX A;  3DR0 A;  3ITK A;  3ZOY A;  1E8E A;  3GG2 A;  3WFB C;  1L0L D;  1KB0 A;  1YIC A;  1CED A;  4AAM A;  3FWL A;  4QAO A;  5TJH A;  1F1C A;  5CIE B;  2ZBO A;  1CTY A;  3PHL A;  5DFS A;  2YCC A;  1C6R A;  1NTZ D;  1C2N A;  5KKZ B;  1MG2 D;  3H1I D;  3O5C A;  1WVE C;  4FA9 A;  5KAF V;  3PXT A;  1BE3 D;  1EB7 A;  1QL4 A;  4XYD B;  2N9I A;  2ZXY A;  1L9B C;  2B11 B;  1S6V B;  2Y0D A;  3JBT B;  1YTC A;  4H0J A;  2QJY B;  5EXQ A;  1CO6 A;  1I55 A;  2FRC A;  1CXA A;  3TYI A;  5GTH V;  4EDF A;  1DIQ C;  1GQ1 A;  1LC2 A;  2CE1 A;  3OA8 B;  4FB1 A;  1SQV D;  2CA3 B;  1PPJ D;  4WQB A;  3VNW A;  1IRW A;  1H33 B;  1CTZ A;  1FI7 A;  3WFE C;  1H1O A;  1NIR A;  1K3H A;  3CP5 A;  4AX3 A;  1HRO A;  5CIG B;  2B10 B;  1C7M A;  1KYO W;  2DVH A;  5E79 V;  2JQR A;  4L3H A;  1LFM A;  2GB8 B;  2C1D B;  3CU4 A;  2CE0 A;  2BGV X;  2C1V A;  2HV4 A;  2AI5 A;  4FAV A;  3GW6 A;  1I8O A;  2BH4 X;  5TIS V;  3WC8 A;  2YK3 A;  3SXT A;  1KX2 A;  1HZU A;  2D0S A;  4D6T D;  2L4D A;  1HJ3 A;  3X39 A;  4EIF A;  4UB8 V;  1E29 A;  4YE1 A;  4RJT A;  5DF5 A;  1M70 A;  2OZ1 B;  3ZOW A;  4PD4 D;  2B0Z B;  2FYU D;  2IBZ D;  3CXH W;  1EZV D;  3RMZ A;  1AKK A;  1CRY A;  3HQ8 A;  1RZ6 A;  2YQB A;  1H31 A;  1I54 A;  3DMI A;  2Q3E A;  3NBS A;  2GIW A;  2I8F A;  2GC4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...