3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
1A2SA 5KAFV 5DJQB 5KKZB 2N3BA 1LFMA 2OZ1B 3ORVA 1SQXD 2MTAC 1HJ5A 5C9MA 2N9YB 1YCCA 5CYTR 1HZUA 2PACA 1H31B 1OCDA 1B7VA 1YICA 3M97X 1EZVD 1CCHA 5CICB 1BE3D 1N50A 1C2RA 2KNCB 4AAMA 2Y0EA 2EXVA 1LC1A 5DJQC 2V07A 2ZONG 3ITKA 5CIFB 1I55A 4AX3A 2PCCB 1GDVA 1C75A 1I8OA 1A8CA 1KX7A 1CTZA 4U3FD 1S6VB 2QJYB 2GIWA 3ZOWA 5B5EV 1MZ4A 1QN2A 3L75D 1AKKA 1CCRA 3ZBMA 3O1YA 4EIDA 1F1FA 3NWVA 2VHDA 3KZIV 2HV4A 2C1VA 4L1QA 1NMIA 5E79V 2MHMA 4K3IA 3CP5A 5C0ZA 3NBSA 3VMAA 3PTZA 1HH7A 3HQ7A 4IL6V 5AURA 4EDFA 2K9JB 3A9FA 4NFGB 4RSZA 3MK7C 1H33B 2QG4A 1C52A 5H2FV 2L4DA 2B11B 1CHHA 2C1DB 3L74D 3OA8A 4V2KA 1H1OA 2OZ1A 1ZZHA 2N9JA 1BL9A 1IRWA 1DIQC 5CIBB 1I5TA 2YCCA 5CIGB 1DW3A 1DIIC 3RMZA 3H1LD 3WU2V 1LC2A 1HZVA 2CA3B 4Y5RA 1H31A 1E29A 3SJLA 4AALA 1CRGA 5KLVD 1BGYD 1CYCA 1CRJA 1GJQA 1CO6A 1R0QA 3ZOYA 1E2RA 1GIWA 5TJHA 1CYIA 1CHIA 2ZBOA 1MG2D 3PH2B 3H1KD 4FA1A 1S5LV 1CORA 3BCCD 4RJTA 1L9BC 1KIBA 2N18B 5KLIB 1AOQA 1U75B 2FWLA 1FI7A 3NBTA 3DR0A 1IQCA 4WQDA 4AANA 3H1HD 3KHUA 2O3JA 1C7MA 3TDKA 1M6ZA 3OCDA 1WEJF 2YQBA 1H33A 1QL4A 1YFCA 1CSVA 1HROA 1RZ6A 1NTZD 1AOFA 2AIUA 2C8SA 1C6OA 2BH4X 1NMLA 1ETPA 2FYUD 3JBTB 1CYJA 4PWAA 3CXHD 3PLNA 5KAIV 2Y0CA 2BH5X 1U74B 1CSUA 3FWLA 1GKSA 3CYTI 1E8EA 1FCDC 1FI3A 3MK7B 1C2NA 1YIQA 1M60A 4FA5A 1RZ5A 2A06D 1CNOA 4WQ9A 4EIFA 1DW2A 2LIRA 3L71D 4H0JA 4XXLA 3PXSA 1CTJA 2PCBB 4PD4D 1SQQD 1H32B 4GEDB 1LMSA 2KS1A 2N9IA 3L70D 3PHLA 3CX5D 1CIFA 4UB8V 2BCCD 1P84D 2QJKB 1CHJA 1CXAA 3C2CA 3TYIA 1C6SA 1FOCA 2L91A 1CRIA 3DP5A 3WUIA 2XTSB 4WQCA 4FANA 4MU8A 2YK3A 2C1DA 2JQRA 3OA8B 1YNRA 1CEDA 1CRHA 1M70A 2D0WA 1L0ND 3CU4A 3O20A 1A56A 1I54A 3CX5W 5DFSA 1PP9D 1NNOA 3X39A 2B4ZA 4WQ8A 4JCGA 3H1ID 3L73D 1KB0A 4O1WA 1K3HA 3ZOXA 1CIHA 451CA 4UB6V 3ZCFA 1NTMD 4EIEA 1VYDA 4FB1A 3ZIYA 4AAOA 1DVHA 4Q5PA 5B66V 2AXTV 3WFDC 2B12B 2CXBA 1CIGA 2LITA 1HRCA 4FA4A 2N18C 2QJPB 3WFEC 2C9XB 4FAVA 3VNWA 1IO3A 3HQ6A 2CE1A 1DW0A 2DVHA 2CE0A 3TF5A 1N9CA 1FJ0A 2BCNB 1AYGA 2AI5A 1WVEC 4LJIA 1I6EA 1IZL0 1GU2A 1BCCD 1W5CT 1HJ4A 1PPJD 1I8PA 5CIEB 3GG2A 1W2LA 1YTCA 3PXWA 1KB9D 5CIHB 4N0KA 1N90A 2V08A 3O5CA 1IRVA 4P4QB 4WQAA 3RN0A 1L0LD 4J20A 2I8FA 4YE1A 1YEBA 1NTKD 2N3YA 4PW9B 1EB7A 1ZRTD 3VRDA 4WQBA 1QYZA 2ZXYA 2BLFB 1FHBA 3A0BV 4EICA 1MG3D 1HCMA 2CA4B 2Y0DA 1H9XA 1OAEA 1KV9A 1F1CA 1DVVA 1CRCA 1FI9A 5EXQA 1CRYA 1COTA 2RN0A 1KYOW 5TISV 3DMIA 5GTIV 1HJ3A 3PRJA 4WQ7A 2BGVX 4WQEA 3HQ8A 1K3GA 1DT1A 3SLEA 2DGEA 5CIDB 2GB8B 2ZOOA 3WFCC 2JWAA 5IY51 3CWBD 2FRCA 3WC8A 1RAPA 1CSWA 1CC5A 3L4OA 3VYMA 4H0KA 2ZZS1 351CA 2D0SA 1H9YA 4XYDB 1LS9A 1NIRA 3TGUD 1L9JC 1YEAA 3SVWA 1JDLA 2Q3EA 4A7PA 1RAQA 4L3GA 3WFBC 2JTIB 1KYOD 4O1QA 1SQVD 3RLMA 3H1JD 2BPBB 4PJ0V 1GQ1A 1CIEA 5DF5A 2GC7D 1QKSA 1C6RA 3SXTA 4GYDA 3A0HV 1CSXA 1H32A 1DW1A 2C2CA 2B10B 1SQPD 4D6TD 2C1UA 3L4MA 2B0ZB 3GW6A 2FYNB 2IBZD 1KX2A 1N15A 4QAOA 1I6DA 4FA9A 3HQ9A 2GC4D 4L3HA 3O0RC 3L72D 4KMGA 5GTHV 3OCDB 1CTYA 2RMZA 3ZOOA 1QL3A 1CXCA 155CA 2YIUB 3SWSA 3PXTA 2ORLA 3RN1A 5B6QA 1NU1D 1J3SA 3CXHW 1SQBD 4DY9A
chains in the Genus database with same CATH superfamily
3L70J 5DJQB 3MD0A 2ZYAA 5KKZB 4W7ZA 1GK6A 1JTHA 4BXLA 2IBZG 5C9MA 1URQB 2N9YB 3NFQA 2N1TC 3B5ND 2ZYGA 2PACA 1H31B 4C7RA 2J5UA 1EZVD 1LGHB 1CCHA 5CICB 1U57A 1BE3D 1N50A 1YJNP 2KNCB 3H1JE 2Y0EA 1SQPJ 4D6TJ 4PD4H 1GL2C 1L0NJ 1T8ZA 4Y99B 3SFDC 2V07A 5AW2B 5CIFB 3E1RA 1H88A 4CPGA 3SWKA 2QJYB 2QM8A 2M0BA 1OW8A 1KB9I 5CCGA 1BCCE 1S5LH 1KILD 3B8EB 3GHGB 3ZBMA 3O1YA 3NTNA 4H0LD 1AQ5A 1X79B 4K3IA 2A06E 1L0NK 5C0ZA 4GOEA 3NBSA 1JUNA 3M9QA 1NWQA 1G2CA 1HJ0A 1H8AA 1NKZB 3V6IA 1BDDA 1EC5A 2KZJA 4HKZH 3L70E 3B4SA 3HD7B 2C0WA 2WVRA 3G3ZA 4RSZA 1EZVI 3IF4A 4O9BA 2SPZA 1Q7YQ 2KLUA 2O01H 1FDIA 2CPBA 4R4MA 3T97B 4V2KA 2QIWA 1H1OA 1OXZA 1K04A 1DW3A 3VYIA 2FXPA 3A5TA 1VQKP 1IFNA 1BGYD 3BVHA 3P7KA 1R0QA 1DX7A 3B5NB 4NPEA 1CHIA 1X9VA 1GW4A 2OARA 2ZYDA 5AVVB 2R32A 5GTIE 2IFMA 3H1KE 1GW3A 3H1KD 2E76C 2KLVA 2FFDA 1KIBA 4U3FE 2N18B 2FXOA 2WSSH 5KLIB 2FYUK 4Y99C 1UIXA 2FWLA 2OYIA 1OIPA 1VF5B 2BEQD 1VQMP 4WQDA 2OYIB 3JC22 3NMDA 3AEEC 3H1HD 3KHUA 1QEXA 5DJTB 2GM4A 1YI2P 1EDLA 3B5NA 4DZOA 1LP1A 4DT0A 2OYOA 3EWKA 4Z1MH 1AOFA 3RL0g 2AIUA 2KK7A 1JMMA 3R4YA 2BH4X 3JBTB 1CYJA 4PWAA 3CXHD 1SQQJ 2XZRA 2BH5X 1CSUA 1NTZK 3K5BA 3S9OA 1FZGA 1PGQA 1RY3A 2WSFJ 1M60A 2LR2A 3CCQP 1Z56A 1DW2A 1QGKB 2YXQB 1M1JC 4H0JA 1T2KC 4XXLA 2GUSA 3CWBE 1VF5C 3L73J 4XE5B 3CX5D 1CIFA 1H0TA 1WT6A 2YIUC 5AVQB 2E76D 2E76B 2N1TB 1AJYA 3C2CA 3V2RA 1M1KQ 3HE5A 3WUIA 3CWBG 3G6EP 1YBKA 4MU8A 1ZN5A 1IK9A 2K1AA 2C1DA 3OA8B 3L71G 3FX0A 1CRHA 2D0WA 1L0ND 3CU4A 3V2PA 1L4AB 4GIFA 1PP9E 4JCGA 1MUUA 3OAKA 1N7SC 1CIHA 1PP9G 2LKMA 4RO0A 1N7SA 451CA 2HYNA 2Q3IA 2IYOA 2B89A 2M5AA 2B9BA 2IX7C 4EI2A 2YKPA 1ZRTE 1NTMD 4EIEA 1KMIZ 4FB1A 2BEZF 1QL1A 4AAOA 1DVHA 1MKMA 1FOSE 2AXTV 3SWFA 5GTIH 3KZIE 1Y8AA 2N9BA 3EFGA 3W68A 2QJPB 1WRGA 4ASVA 2Q6QA 3WFEC 1OW7A 2N1TD 4L76A 2DVHA 3CXHH 1HH0A 3AE5C 2E5TA 2KUBA 2NPSB 3L75J 3D71A 4LJIA 4C46A 1GU2A 3KYQA 2GUVA 1NKNA 5CIEB 2P58A 3KQGA 3CC2P 1VDFA 2BCCJ 5CCHC 3L4FA 5KAIH 4I6MC 2PAJA 1W2EA 1YTCA 1KB9D 5H2FE 1YTZI 3O5CA 4WQAA 1N7SB 1N7SD 1SQVJ 2ZJSE 1YEBA 2N3YA 4PW9B 1EB7A 1ZRTD 3VRDA 4WQBA 3HUSC 4H0LC 3R2PA 1HJBA 3A0BV 4EICA 1G1IA 1KV9A 1CRYA 1HGVA 3G4SP 2RN0A 1KYOW 1SQBJ 1YTZT 3M9BA 1SQPG 4D6TG 1RH5B 1HJ3A 2NRGA 3PRJA 1BSNA 1N8RQ 1K3GA 2ZAEB 1SFCA 2K9JA 1NGMB 2DGEA 3Q5SA 2WZ7A 5IY51 4PD4E 3WC8A 1CSWA 3L4OA 2POHA 3L72G 4TT3H 2OYIC 1LTIC 1YQ3C 4U7JA 1KYOE 5DJUB 4TLFA 2FFDC 1LS9A 3H1HJ 1SVFA 2ZT9C 1KILB 3NXSA 1LWUB 2Q3EA 4A7PA 1SQXG 2JTIB 4GODA 1CIEA 5DF5A 2GC7D 3SSUA 3TNUA 1RF0A 3FWNA 3A0HV 3G9RA 2P10A 3HTKA 3VMXA 1DW1A 2C2CA 2B10B 1SQPD 4D6TD 2KOGA 2WTYA 2O01J 3MZWB 4QAOA 3UIAA 4FA9A 1N7LA 2GC4D 4IL6H 4KJMA 1LJ2A 1NU1K 3OCDB 1QLED 3Q1MA 2RMZA 3OJAB 2RH0A 155CA 1GD2E 3V5BA 1VQ8P 1NU1D 2KS1B 1NU1E 2CPSA 4DY9A 2R3SA 1A2SA 5KAFV 2JP3A 1SQPK 4XFJA 2Q5UA 5AW7B 2N3BA 2QVAA 2OZ1B 3ORVA 3PP5A 3VP8A 1SQXD 3CCMP 2I1KA 2ZT9D 5CYTR 2WWWA 1WMKA 2IZ1A 2RKLA 1B7VA 3RBZA 1KC8Q 1K73Q 1ZP0C 2NPSA 2IFNA 2NZ2A 3AE9C 3FXEA 2K3RA 1JOCA 2ZXEB 1GL2A 3LW5J 1LTAC 1LC1A 2XNXA 1LT9B 2G3AA 1ZOYC 3KPEA 1I8OA 1A8CA 1BE3G 4N78D 1CTZA 5CJ0A 3USSA 3ZOWA 3CC4P 1BE3E 1MZ4A 1M56D 1QN2A 1GK4A 4L75A 1IFPA 3MUDA 1AV1A 5APSA 5APQA 2H8PD 1F1FA 1QL2A 2J58A 2HV4A 2C1VA 1AQTA 2KB7P 1RE4A 4W7YA 2ZVNB 1VQ6P 1SQVE 3VMAA 1USEA 1OZHA 3GF7A 4IL6V 3HQ7A 2AXTH 3HE4A 3Q5RA 2AEMA 2P67A 5KJ7C 1J1DB 4IFDK 3Q3DA 1M57D 3LIDA 2QJKC 2Q7CA 1S9KE 2QG4A 3HRNA 1KQSO 1ZR4A 3H1JG 2PP6A 3H32B 3L75E 1CI6B 3L74D 2WSCJ 1ZZHA 3ZDMA 2AXTE 2Q1KA 2N9JA 1BL9A 5CIBB 1DIQC 2YCCA 5CIGB 3M06A 1LTGC 1FZAA 2CA3B 3VMYA 1E29A 4AALA 4AYCA 5KLVD 1CYCA 1CRJA 3RK3D 2XNDH 5TJHA 3KZIH 2ZBOA 3TGUG 3H1HG 3PH2B 3AE6C 3T97A 3L71E 4RJTA 2QE7H 5KKZC 1JY2N 1L0LJ 2WSEJ 1AOQA 1Q82Q 1JY2P 2M3EA 3OA7A 1FDOA 1ZR2A 1FI7A 2E75C 1FS0E 1HUCA 2C9NY 1IFMA 2B87B 4DOJA 3TDKA 1R8EA 1Q81Q 1M6ZA 3L74E 2WSCH 3D70A 5BVZA 1YFCA 1HROA 2M8RA 2C8SA 5AW5B 3VOPA 2H88C 1ETPA 2FYUD 2JEEA 1KILA 1BGYE 2Y0CA 1U74B 3CCRP 3LIEA 1VQNP 2IBZI 3F5HA 4LC1A 2OYHB 3CYTI 2O01N 1FCDC 1FI3A 3AEBC 5KJ7D 3A7OA 2R44A 2KP8A 1VQOP 1RZ5A 3O6QA 4GT1A 1NTMJ 4H13C 4EIFA 3L71D 3CXHI 1BCCG 2PCBB 1SQQD 4GEDB 2KS1A 3H1IG 3L70D 3PHLA 2WMMA 1EDIA 1KD1Q 1XTCC 2IPPA 1IFJA 1JO5A 1FOCA 2L91A 1CRIA 1M90Q 2XTSB 3P8MC 2FYUE 3H1LG 4WQCA 1NU1J 2WSFH 5APYA 1HWTC 2J59M 1SQVG 5AVRB 1PGPA 5APUA 3A2AA 2ZT9B 5CBNA 1FJKA 2K37A 2JQRA 1YNRA 1CEDA 1N2DC 3GHGC 4WY4A 2L5GB 2PFXA 4I2LC 1FOSF 2O1JA 2OQQA 1I54A 3F89A 1NNOA 2B4ZA 2FYUG 4WQ8A 3H1LE 3L73D 1ZXGA 1K3HA 3ZOXA 2KZIA 3A3YB 1J1DC 5AVXB 1YIJP 1MV8A 1GL2B 1KZUB 3II6A 5KAFE 4XA4A 3H1KG 1KQGB 3BCCG 1DD4A 1HBWA 3B71A 5B66V 3IN6A 1KFMA 2OYHA 5KLVK 3VNWA 3AEFC 1PIXA 2CE1A 1Q2NA 1DW0A 1AYGA 2V7QH 5H2FH 3AE7C 4H13D 1RQVA 1WVEC 2D2CC 1LTBC 5KAIE 1H0TB 1YQ4C 4BRYB 1RQUA 3H1IJ 3GG2A 1M1JA 1G1JA 1PPJG 2JDIH 2W6JH 2IDBA 3PXWA 3TYYA 5CIHB 4L74A 1AVOA 3CXHE 4P4QB 2I8FA 4YE1A 1AVYA 1NTKD 1T6AA 2Z4EA 3WUUA 4GOFA 1QYZA 2ZXYA 2ITAA 1MG3D 1H9XA 1F1CA 1ZLLA 1CRCA 1FI9A 2OGUA 3MGNA 1S5LE 2HFED 1YITP 2K9YA 1N86A 1KQFB 5TISV 3DMIA 2YMYA 2BCCE 4WQ7A 1KQLA 3B5NC 2BGVX 5AW3B 1SS1A 3SLEA 3M0AA 2GB8B 2W83C 2ZOOA 1NH4A 1M7LA 3WFCC 4OGQD 2JWAA 4DJGA 3CWBD 1IO4A 1L0LE 3H25A 3U1AA 3D6YA 2P2UA 2AEFA 3V4WA 1USDA 2ZZS1 3LW5H 1NIRA 1XTGB 4BRYA 1E5WA 1N73A 1L0LK 1SQQG 1NTKK 4L3GA 3WFBC 3BATA 3HE4B 1SP4A 1SFCD 1KYOD 1PPJE 3RLMA 3H1JD 1IZNB 4PJ0V 2H7HA 1GQ1A 1LP1B 1QKSA 1SQXK 2JJLA 2A45H 3SXTA 3FGAD 1H32A 3GMAA 1K05A 3AE2C 2YMKA 3GW6A 1N15A 1I6DA 3L73E 5L8RJ 1S2EA 1G2CB 2JKVA 3IFMA 1CTYA 3H1JJ 3A0BE 2QEXP 1QL3A 1NTME 3RK2B 3RN1A 1URQD 1J3SA 2CK3H 2OTKE 3CXHW 3VN0A 1FAVA 4JQ0D 1M8OB 1HF9A 1KB9E 3A0HH 1RE4C 1T3UA 4OGQB 2WT7B 1LFMA 5AW8B 3MUDC 5M1BA 3S4RA 5CCGC 1RF1B 1HZUA 1BDCA 1YICA 3M97X 1S1CX 1BE3J 4I7ZC 5AW1B 1C2RA 4AAMA 2KI7B 2EXVA 3C8VA 4UB8E 5TISE 4IFFA 1RF1A 3ITKA 2NPSC 4IOIH 2R3CA 5BU5A 5CCHD 2H89C 4AX3A 1C75A 1KX7A 4U3FD 1S6VB 5APVA 4AUWA 1QVFO 2QA4P 3L75D 1AKKA 4WVZA 2M3BA 3P8CD 4EIDA 3NWVA 3KZIV 4C7NB 4YXDC 1P84H 4L1QA 1NMIA 3IAOA 1NTKG 2HR3A 1JTHB 1A02F 4EIJA 3C9IA 1GZLA 5AURA 3V4QA 1SQXJ 4EDFA 3Q5PA 3PJSK 1VQLP 1LWUA 4PJ0E 1FZCA 5AW9B 1EDJA 1L0NE 1YYCA 3CMEP 2HPCA 1NTKE 1Y9BA 2B11B 1KV4A 3M0DC 2HODA 2E75B 1FZBA 2D2CD 5AVZB 3MP7B 2G8YA 2OZ1A 4W80A 4N78E 5AVUB 1RF0C 5AW4B 1PV3A 3D0WA 3WU2V 3H1LD 1LC2A 3HD7A 1HZVA 1P84E 1L4AA 1H31A 3SJLA 1GJQA 1CO6A 3ZOYA 4OWFA 1E2RA 1GIWA 1CYIA 3CCLP 4RKUJ 1LT1A 1N73C 4FA1A 3H32A 3TNUB 1NTKJ 2Z5IA 1CORA 3BCCD 1L9BC 4IL6X 4ZNCA 3V2QA 1U75B 3CL3D 3RL0D 4NPFX 1AA0A 4OH8B 3DR0A 1IQCA 4UB8H 4AANA 3L72J 4PV1C 4YPCA 4N6JA 2A06G 2KIKA 5KTBA 3CX5I 3E1IA 1C7MA 5CBOA 1EXIA 1CSBA 1D7MA 1WEJF 2YQBA 1H33A 4PD4I 4AQRD 4ASWA 1NTZE 1NTZD 1KFNA 2FYUJ 4NPDA 2WSEH 1UIIA 4KT0J 2B87A 3JSVC 5AVWB 2JR8A 1JNMA 1M1JB 2P7JA 1E8EA 1URQA 3MK7B 3AE8C 1C2NA 1R5SA 4GKGA 1YIQA 3AECC 1NU1G 2A06D 2UWJE 4WQ9A 1NTZJ 5CCHA 3MHVA 2WPVB 1CTJA 5AVSB 1LMSA 2N9IA 1CZQA 1PP9J 1JCCA 3JCUH 2OTJP 1LT9A 2BCCD 1P84D 1S5LX 3AEDC 2QJKB 3L74G 3AEAC 2IZ0A 2XDJA 1CHJA 2C9LY 3GLMA 2HG5D 3TYIA 3BRTB 2LXBA 3L71J 4FANA 4UB6H 2YK3A 1VQ5P 4HJGH 1DEBA 4JPZB 1JY3O 1FE6A 5AVYB 1EZVG 1JEKA 2W6AA 1LTJC 1Y47A 5AW0B 2Y9YA 2KSEA 1KYOH 3CX5W 3RBXA 3X39A 1KN7A 1KTMA 1KB0A 1RE3C 1N73B 1FU1A 1JY3N 2PRRA 3L73G 1HGZA 2E74B 1VL2A 1Q86Q 4UB6V 3ZCFA 1U7MA 2W90A 3AE1C 2Q9IA 1DH3A 2Y9ZA 1EXJA 4I1LA 1LTJA 2YNYA 2B12B 2CXBA 1CIGA 3N4XA 3FXDA 3KDPB 4R4LA 1T3JA 3S1KA 2C9XB 4FAVA 3BRVB 5E79E 1IFIA 2QJPC 3CCUP 1N9CA 1FJ0A 2BCNB 2KSJA 1IZL0 1HJ4A 2I1JA 1PPJD 1DIPA 1I8PA 3I56P 1SQBK 4K35A 3TSIA 3CPWO 1CW5A 4I7ZB 4KHXA 2NPSD 4N0KA 2M5AB 2HPCB 3RK3C 1BGYJ 1IRVA 3RN0A 2DW3A 1L0LD 4J20A 5APWA 4EYYQ 3O6QB 1GU4A 4H44D 2BLFB 1FHBA 3AEGC 2OTLP 2CA4B 1HCMA 2W27A 2FFDB 1OAEA 3MTUE 2P1JA 3CLQA 1KILC 1DVVA 3G71P 1LTJB 5EXQA 4OVNF 1SQQK 1COTA 2QM7A 4H0LB 4BWNA 1DT1A 3VP9A 5CIDB 1FZCB 5B5EE 3AE3C 3QWOC 5B66E 2ZFCA 2FRCA 4ZKUA 2D2CB 1GTWA 1RAPA 3VYMA 1QX8A 351CA 1FBMA 2D0SA 4XYDB 4YTPC 3WU2H 3TGUD 2XV5A 1YEAA 3CX5H 4HB1A 2MKVA 1IFDA 2A45I 1HTLC 3QH9A 3RK3B 3RK2C 4UB6E 2WPQA 2KXPB 4EOTA 4JF7A 2ZXXA 1L4AD 1C6RA 1VQPP 1NTZG 4GYDA 1E79H 2WT7A 3L4MA 2IBZD 1KX2A 3H1LJ 3HQ9A 4L3HA 4ZMDA 2FXMA 4MN4C 3L72D 3U59A 5APTA 1JY2O 5GTHV 3TGUE 3L35A 4L73A 5GTHH 1LTSC 3ZOOA 1CXCA 5KJ7A 3PXTA 1X0TA 1X8YA 3SWYA 2R5BA 5B6QA 4YXWH 1W5CE 1SQBD 3RK3E 2MJZA 1EZVE 3BASA 1BCCJ 3V2NA 4IFMA 5AVTB 2MTAC 1HJ5A 3M91A 2W6BA 1YCCA 3WUTA 3CX5E 5APXA 1OCDA 3HE5B 3WU2E 3L70G 3L37A 1RF1C 1VQ4P 1GMJA 2V4HA 3OW2O 1NOHA 2K88A 1RHZB 5B66H 1NVOA 1T2KD 1ZMEC 1KYOI 4Y28J 5DJQC 2ZONG 2I8DA 1I55A 4H44B 2PCCB 2E5YA 1GDVA 3EQ2A 1X22A 1SQQE 1IJDB 1P84I 2GIWA 1SQBE 2N1TA 2AEJA 5B5EV 1K9MQ 3RK2D 1CCRA 1JB0J 2FKWB 2VHDA 2XKMA 5E79V 1CI6A 1QVGO 1L0LG 2MHMA 2FYNC 3CP5A 2C0XA 1OWAA 4WB4A 3PTZA 1SQBG 1HH7A 3TGUJ 3WMM0 4N3YB 3H6PA 4RESB 2QSIA 1SFCB 2K9JB 3VTPC 3A9FA 4NFGB 1OW6A 3MK7C 1H33B 1C52A 5H2FV 2L4DA 2O1KA 1MZ9A 1PGJA 1CHHA 2C1DB 3OA8A 3P32A 3N7NA 4B86A 2E43A 1IRWA 5E79H 1I5TA 2Z5HA 1DIIC 3RMZA 2JO1A 4Y5RA 2KYVA 2W8ZA 3ABVC 4JYBA 1CRGA 3AE4C 1MG2D 1S5LV 4OGQC 5AW6B 4C7NA 4M3LA 5KAFH 3C1LA 2B88A 4QMAA 3NBTA 5TISH 2E74D 3I5CA 2YO2A 2YKQA 2O3JA 1SQPE 4D6TE 3CCEP 1ZW0A 1SFCC 1MFTA 3OCDA 2WPRA 4HH2A 2QRXA 1QL4A 1CSVA 1RZ6A 5CHXA 1C6OA 1NMLA 3HTKB 5CMZA 1H89A 1J1EC 5KLIC 3IR9A 1Q90D 3PLNA 4WY4D 3RL0C 5KAIV 1NO4A 3I55P 3E7KA 1IK7A 3HUSA 1NAFA 3A0HE 3FWLA 1GKSA 4LLHA 1DD3A 1AFOA 5EFWB 4H13B 5KLVJ 1YHQP 4U3FG 4FA5A 1NYHA 2KNCA 1CNOA 1ZV8A 3A0BH 5GTHE 1R5LA 3CWBJ 2LIRA 5C39A 3CCSP 1JMBA 1LTTC 1OVVA 1OVRA 2E42A 3PXSA 4PD4D 1H32B 1U7JA 3HUSB 3M9HA 1L2PA 1VF5D 1FJPA 3H1IE 1S72P 4UB8V 3L72E 2FY8A 1EQ7A 4JYCA 5BU8B 2WITA 1S4XA 3Q2YA 1SQVK 1CXAA 2ZVOB 1C6SA 2OYHC 3DP5A 2PGDA 1IC2A 5K5GB 1BGYG 2R5DA 2HODB 3CCVP 3CCJP 1M70A 3W67A 1A02J 3O20A 1GDTA 1A56A 1HVVA 3L36A 2E74C 5DFSA 1PP9D 3H1ID 4O1WA 1FZFA 2QJYC 1W2BO 1RE3A 5B5EH 1VYDA 4WY4C 3WUVA 3U1CA 3ZIYA 3GHGA 5KLVE 4Q5PA 1OFCX 5KLVG 3WFDC 2A45G 3CMAP 2LXCB 2LITA 1NTMK 1HRCA 4FA4A 2N18C 1JCDA 1NJIQ 3H1HE 1JY3P 1KORA 1IO3A 3HQ6A 1J2JB 2CE0A 1KILE 3BCCE 5CJ4A 3TF5A 3CC7P 2HLOA 4PV1B 1LT9C 4ZKPA 2V7QJ 2WQYC 2AI5A 1GU5A 1FZEA 3HD7D 1I6EA 1BCCD 2BASA 1W5CT 4WY4B 1W2LA 1FC2C 4GDOA 3EFFK 4PJ0H 1PZQA 2WPSA 1N90A 2V08A 4U3FJ 1URQC 2BCCG 3BCCJ 3H1KJ 2VRSA 2Y0DA 4HYTB 4H44C 1JM0A 1YJWP 3L75G 3CI9A 3O8ZA 1YJ9P 3L74J 3CD6P 1SLQA 2H43A 4PV1D 5GTIV 1PGOA 1PL5A 4WQEA 3RGUA 3HQ8A 1OX3A 1VPCA 3PH0A 1TU3F 3P8CE 2FYZA 1BSHA 4DCKA 2XU6A 1GL2D 4JBZA 1PFIA 1CC5A 1NHLA 4H0KA 1J1EB 1S9KD 1S3JA 2FBWC 1H9YA 4LGDE 1SQXE 1L9JC 3SVWA 5CCGD 3KXDA 2AXCA 1EDKA 1JDLA 1RAQA 1L0NG 2YO3A 4O1QA 1VQ7P 1SQVD 1VQ9P 3D6ZA 2BPBB 4WWIA 3MIWA 1LNQA 1L4AC 1K8AQ 3HD7C 1KB9H 1MFZA 2YKOA 4K3AA 1NTMG 1CSXA 3RL0B 3SFEC 1DEEG 1FDMA 2C1UA 3JCUE 2GA1A 2B0ZB 2FYNB 3M0DA 1NAYA 4WBAA 3VMZA 3O0RC 1OMIA 4KMGA 2E75D 2IYPA 2JWDA 2YXRB 4IL6E 2IBZE 1FZCC 2YIUB 3GF3A 3SWSA 1LWUC 3TK1A 2ORLA 1OVUA
chains in the Genus database with same CATH topology
1A2SA 5KAFV 5DJQB 5KKZB 2N3BA 1LFMA 2OZ1B 3ORVA 1SQXD 2MTAC 1HJ5A 5C9MA 2N9YB 1YCCA 5CYTR 1HZUA 2PACA 1H31B 1OCDA 1B7VA 1YICA 3M97X 1EZVD 1CCHA 5CICB 1BE3D 1N50A 1C2RA 2KNCB 4AAMA 2Y0EA 2EXVA 1LC1A 5DJQC 2V07A 2ZONG 3ITKA 5CIFB 1I55A 4AX3A 2PCCB 1GDVA 1C75A 1I8OA 1A8CA 1KX7A 1CTZA 4U3FD 1S6VB 2QJYB 2GIWA 3ZOWA 5B5EV 1MZ4A 1QN2A 3L75D 1AKKA 1CCRA 3ZBMA 3O1YA 4EIDA 1F1FA 3NWVA 2VHDA 3KZIV 2HV4A 2C1VA 4L1QA 1NMIA 5E79V 2MHMA 4K3IA 3CP5A 5C0ZA 3NBSA 3VMAA 3PTZA 1HH7A 3HQ7A 4IL6V 5AURA 4EDFA 2K9JB 3A9FA 4NFGB 4RSZA 3MK7C 1H33B 2QG4A 1C52A 5H2FV 2L4DA 2B11B 1CHHA 2C1DB 3L74D 3OA8A 4V2KA 1H1OA 2OZ1A 1ZZHA 2N9JA 1BL9A 1IRWA 1DIQC 5CIBB 1I5TA 2YCCA 5CIGB 1DW3A 1DIIC 3RMZA 3H1LD 3WU2V 1LC2A 1HZVA 2CA3B 4Y5RA 1H31A 1E29A 3SJLA 4AALA 1CRGA 5KLVD 1BGYD 1CYCA 1CRJA 1GJQA 1CO6A 1R0QA 3ZOYA 1E2RA 1GIWA 5TJHA 1CYIA 1CHIA 2ZBOA 1MG2D 3PH2B 3H1KD 4FA1A 1S5LV 1CORA 3BCCD 4RJTA 1L9BC 1KIBA 2N18B 5KLIB 1AOQA 1U75B 2FWLA 1FI7A 3NBTA 3DR0A 1IQCA 4WQDA 4AANA 3H1HD 3KHUA 2O3JA 1C7MA 3TDKA 1M6ZA 3OCDA 1WEJF 2YQBA 1H33A 1QL4A 1YFCA 1CSVA 1HROA 1RZ6A 1NTZD 1AOFA 2AIUA 2C8SA 1C6OA 2BH4X 1NMLA 1ETPA 2FYUD 3JBTB 1CYJA 4PWAA 3CXHD 3PLNA 5KAIV 2Y0CA 2BH5X 1U74B 1CSUA 3FWLA 1GKSA 3CYTI 1E8EA 1FCDC 1FI3A 3MK7B 1C2NA 1YIQA 1M60A 4FA5A 1RZ5A 2A06D 1CNOA 4WQ9A 4EIFA 1DW2A 2LIRA 3L71D 4H0JA 4XXLA 3PXSA 1CTJA 2PCBB 4PD4D 1SQQD 1H32B 4GEDB 1LMSA 2KS1A 2N9IA 3L70D 3PHLA 3CX5D 1CIFA 4UB8V 2BCCD 1P84D 2QJKB 1CHJA 1CXAA 3C2CA 3TYIA 1C6SA 1FOCA 2L91A 1CRIA 3DP5A 3WUIA 2XTSB 4WQCA 4FANA 4MU8A 2YK3A 2C1DA 2JQRA 3OA8B 1YNRA 1CEDA 1CRHA 1M70A 2D0WA 1L0ND 3CU4A 3O20A 1A56A 1I54A 3CX5W 5DFSA 1PP9D 1NNOA 3X39A 2B4ZA 4WQ8A 4JCGA 3H1ID 3L73D 1KB0A 4O1WA 1K3HA 3ZOXA 1CIHA 451CA 4UB6V 3ZCFA 1NTMD 4EIEA 1VYDA 4FB1A 3ZIYA 4AAOA 1DVHA 4Q5PA 5B66V 2AXTV 3WFDC 2B12B 2CXBA 1CIGA 2LITA 1HRCA 4FA4A 2N18C 2QJPB 3WFEC 2C9XB 4FAVA 3VNWA 1IO3A 3HQ6A 2CE1A 1DW0A 2DVHA 2CE0A 3TF5A 1N9CA 1FJ0A 2BCNB 1AYGA 2AI5A 1WVEC 4LJIA 1I6EA 1IZL0 1GU2A 1BCCD 1W5CT 1HJ4A 1PPJD 1I8PA 5CIEB 3GG2A 1W2LA 1YTCA 3PXWA 1KB9D 5CIHB 4N0KA 1N90A 2V08A 3O5CA 1IRVA 4P4QB 4WQAA 3RN0A 1L0LD 4J20A 2I8FA 4YE1A 1YEBA 1NTKD 2N3YA 4PW9B 1EB7A 1ZRTD 3VRDA 4WQBA 1QYZA 2ZXYA 2BLFB 1FHBA 3A0BV 4EICA 1MG3D 1HCMA 2CA4B 2Y0DA 1H9XA 1OAEA 1KV9A 1F1CA 1DVVA 1CRCA 1FI9A 5EXQA 1CRYA 1COTA 2RN0A 1KYOW 5TISV 3DMIA 5GTIV 1HJ3A 3PRJA 4WQ7A 2BGVX 4WQEA 3HQ8A 1K3GA 1DT1A 3SLEA 2DGEA 5CIDB 2GB8B 2ZOOA 3WFCC 2JWAA 5IY51 3CWBD 2FRCA 3WC8A 1RAPA 1CSWA 1CC5A 3L4OA 3VYMA 4H0KA 2ZZS1 351CA 2D0SA 1H9YA 4XYDB 1LS9A 1NIRA 3TGUD 1L9JC 1YEAA 3SVWA 1JDLA 2Q3EA 4A7PA 1RAQA 4L3GA 3WFBC 2JTIB 1KYOD 4O1QA 1SQVD 3RLMA 3H1JD 2BPBB 4PJ0V 1GQ1A 1CIEA 5DF5A 2GC7D 1QKSA 1C6RA 3SXTA 4GYDA 3A0HV 1CSXA 1H32A 1DW1A 2C2CA 2B10B 1SQPD 4D6TD 2C1UA 3L4MA 2B0ZB 3GW6A 2FYNB 2IBZD 1KX2A 1N15A 4QAOA 1I6DA 4FA9A 3HQ9A 2GC4D 4L3HA 3O0RC 3L72D 4KMGA 5GTHV 3OCDB 1CTYA 2RMZA 3ZOOA 1QL3A 1CXCA 155CA 2YIUB 3SWSA 3PXTA 2ORLA 3RN1A 5B6QA 1NU1D 1J3SA 3CXHW 1SQBD 4DY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2S A;  5KAF V;  5DJQ B;  5KKZ B;  2N3B A;  1LFM A;  2OZ1 B;  3ORV A;  1SQX D;  2MTA C;  1HJ5 A;  5C9M A;  2N9Y B;  1YCC A;  5CYT R;  1HZU A;  2PAC A;  1H31 B;  1OCD A;  1B7V A;  1YIC A;  3M97 X;  1EZV D;  1CCH A;  5CIC B;  1BE3 D;  1N50 A;  1C2R A;  2KNC B;  4AAM A;  2Y0E A;  2EXV A;  1LC1 A;  5DJQ C;  2V07 A;  2ZON G;  3ITK A;  5CIF B;  1I55 A;  4AX3 A;  2PCC B;  1GDV A;  1C75 A;  1I8O A;  1A8C A;  1KX7 A;  1CTZ A;  4U3F D;  1S6V B;  2QJY B;  2GIW A;  3ZOW A;  5B5E V;  1MZ4 A;  1QN2 A;  3L75 D;  1AKK A;  1CCR A;  3ZBM A;  3O1Y A;  4EID A;  1F1F A;  3NWV A;  2VHD A;  3KZI V;  2HV4 A;  2C1V A;  4L1Q A;  1NMI A;  5E79 V;  2MHM A;  4K3I A;  3CP5 A;  5C0Z A;  3NBS A;  3VMA A;  3PTZ A;  1HH7 A;  3HQ7 A;  4IL6 V;  5AUR A;  4EDF A;  2K9J B;  3A9F A;  4NFG B;  4RSZ A;  3MK7 C;  1H33 B;  2QG4 A;  1C52 A;  5H2F V;  2L4D A;  2B11 B;  1CHH A;  2C1D B;  3L74 D;  3OA8 A;  4V2K A;  1H1O A;  2OZ1 A;  1ZZH A;  2N9J A;  1BL9 A;  1IRW A;  1DIQ C;  5CIB B;  1I5T A;  2YCC A;  5CIG B;  1DW3 A;  1DII C;  3RMZ A;  3H1L D;  3WU2 V;  1LC2 A;  1HZV A;  2CA3 B;  4Y5R A;  1H31 A;  1E29 A;  3SJL A;  4AAL A;  1CRG A;  5KLV D;  1BGY D;  1CYC A;  1CRJ A;  1GJQ A;  1CO6 A;  1R0Q A;  3ZOY A;  1E2R A;  1GIW A;  5TJH A;  1CYI A;  1CHI A;  2ZBO A;  1MG2 D;  3PH2 B;  3H1K D;  4FA1 A;  1S5L V;  1COR A;  3BCC D;  4RJT A;  1L9B C;  1KIB A;  2N18 B;  5KLI B;  1AOQ A;  1U75 B;  2FWL A;  1FI7 A;  3NBT A;  3DR0 A;  1IQC A;  4WQD A;  4AAN A;  3H1H D;  3KHU A;  2O3J A;  1C7M A;  3TDK A;  1M6Z A;  3OCD A;  1WEJ F;  2YQB A;  1H33 A;  1QL4 A;  1YFC A;  1CSV A;  1HRO A;  1RZ6 A;  1NTZ D;  1AOF A;  2AIU A;  2C8S A;  1C6O A;  2BH4 X;  1NML A;  1ETP A;  2FYU D;  3JBT B;  1CYJ A;  4PWA A;  3CXH D;  3PLN A;  5KAI V;  2Y0C A;  2BH5 X;  1U74 B;  1CSU A;  3FWL A;  1GKS A;  3CYT I;  1E8E A;  1FCD C;  1FI3 A;  3MK7 B;  1C2N A;  1YIQ A;  1M60 A;  4FA5 A;  1RZ5 A;  2A06 D;  1CNO A;  4WQ9 A;  4EIF A;  1DW2 A;  2LIR A;  3L71 D;  4H0J A;  4XXL A;  3PXS A;  1CTJ A;  2PCB B;  4PD4 D;  1SQQ D;  1H32 B;  4GED B;  1LMS A;  2KS1 A;  2N9I A;  3L70 D;  3PHL A;  3CX5 D;  1CIF A;  4UB8 V;  2BCC D;  1P84 D;  2QJK B;  1CHJ A;  1CXA A;  3C2C A;  3TYI A;  1C6S A;  1FOC A;  2L91 A;  1CRI A;  3DP5 A;  3WUI A;  2XTS B;  4WQC A;  4FAN A;  4MU8 A;  2YK3 A;  2C1D A;  2JQR A;  3OA8 B;  1YNR A;  1CED A;  1CRH A;  1M70 A;  2D0W A;  1L0N D;  3CU4 A;  3O20 A;  1A56 A;  1I54 A;  3CX5 W;  5DFS A;  1PP9 D;  1NNO A;  3X39 A;  2B4Z A;  4WQ8 A;  4JCG A;  3H1I D;  3L73 D;  1KB0 A;  4O1W A;  1K3H A;  3ZOX A;  1CIH A;  451C A;  4UB6 V;  3ZCF A;  1NTM D;  4EIE A;  1VYD A;  4FB1 A;  3ZIY A;  4AAO A;  1DVH A;  4Q5P A;  5B66 V;  2AXT V;  3WFD C;  2B12 B;  2CXB A;  1CIG A;  2LIT A;  1HRC A;  4FA4 A;  2N18 C;  2QJP B;  3WFE C;  2C9X B;  4FAV A;  3VNW A;  1IO3 A;  3HQ6 A;  2CE1 A;  1DW0 A;  2DVH A;  2CE0 A;  3TF5 A;  1N9C A;  1FJ0 A;  2BCN B;  1AYG A;  2AI5 A;  1WVE C;  4LJI A;  1I6E A;  1IZL 0;  1GU2 A;  1BCC D;  1W5C T;  1HJ4 A;  1PPJ D;  1I8P A;  5CIE B;  3GG2 A;  1W2L A;  1YTC A;  3PXW A;  1KB9 D;  5CIH B;  4N0K A;  1N90 A;  2V08 A;  3O5C A;  1IRV A;  4P4Q B;  4WQA A;  3RN0 A;  1L0L D;  4J20 A;  2I8F A;  4YE1 A;  1YEB A;  1NTK D;  2N3Y A;  4PW9 B;  1EB7 A;  1ZRT D;  3VRD A;  4WQB A;  1QYZ A;  2ZXY A;  2BLF B;  1FHB A;  3A0B V;  4EIC A;  1MG3 D;  1HCM A;  2CA4 B;  2Y0D A;  1H9X A;  1OAE A;  1KV9 A;  1F1C A;  1DVV A;  1CRC A;  1FI9 A;  5EXQ A;  1CRY A;  1COT A;  2RN0 A;  1KYO W;  5TIS V;  3DMI A;  5GTI V;  1HJ3 A;  3PRJ A;  4WQ7 A;  2BGV X;  4WQE A;  3HQ8 A;  1K3G A;  1DT1 A;  3SLE A;  2DGE A;  5CID B;  2GB8 B;  2ZOO A;  3WFC C;  2JWA A;  5IY5 1;  3CWB D;  2FRC A;  3WC8 A;  1RAP A;  1CSW A;  1CC5 A;  3L4O A;  3VYM A;  4H0K A;  2ZZS 1;  351C A;  2D0S A;  1H9Y A;  4XYD B;  1LS9 A;  1NIR A;  3TGU D;  1L9J C;  1YEA A;  3SVW A;  1JDL A;  2Q3E A;  4A7P A;  1RAQ A;  4L3G A;  3WFB C;  2JTI B;  1KYO D;  4O1Q A;  1SQV D;  3RLM A;  3H1J D;  2BPB B;  4PJ0 V;  1GQ1 A;  1CIE A;  5DF5 A;  2GC7 D;  1QKS A;  1C6R A;  3SXT A;  4GYD A;  3A0H V;  1CSX A;  1H32 A;  1DW1 A;  2C2C A;  2B10 B;  1SQP D;  4D6T D;  2C1U A;  3L4M A;  2B0Z B;  3GW6 A;  2FYN B;  2IBZ D;  1KX2 A;  1N15 A;  4QAO A;  1I6D A;  4FA9 A;  3HQ9 A;  2GC4 D;  4L3H A;  3O0R C;  3L72 D;  4KMG A;  5GTH V;  3OCD B;  1CTY A;  2RMZ A;  3ZOO A;  1QL3 A;  1CXC A;  155C A;  2YIU B;  3SWS A;  3PXT A;  2ORL A;  3RN1 A;  5B6Q A;  1NU1 D;  1J3S A;  3CXH W;  1SQB D;  4DY9 A; 
#chains in the Genus database with same CATH topology
 3L70 J;  5DJQ B;  3MD0 A;  2ZYA A;  5KKZ B;  4W7Z A;  1GK6 A;  1JTH A;  4BXL A;  2IBZ G;  5C9M A;  1URQ B;  2N9Y B;  3NFQ A;  2N1T C;  3B5N D;  2ZYG A;  2PAC A;  1H31 B;  4C7R A;  2J5U A;  1EZV D;  1LGH B;  1CCH A;  5CIC B;  1U57 A;  1BE3 D;  1N50 A;  1YJN P;  2KNC B;  3H1J E;  2Y0E A;  1SQP J;  4D6T J;  4PD4 H;  1GL2 C;  1L0N J;  1T8Z A;  4Y99 B;  3SFD C;  2V07 A;  5AW2 B;  5CIF B;  3E1R A;  1H88 A;  4CPG A;  3SWK A;  2QJY B;  2QM8 A;  2M0B A;  1OW8 A;  1KB9 I;  5CCG A;  1BCC E;  1S5L H;  1KIL D;  3B8E B;  3GHG B;  3ZBM A;  3O1Y A;  3NTN A;  4H0L D;  1AQ5 A;  1X79 B;  4K3I A;  2A06 E;  1L0N K;  5C0Z A;  4GOE A;  3NBS A;  1JUN A;  3M9Q A;  1NWQ A;  1G2C A;  1HJ0 A;  1H8A A;  1NKZ B;  3V6I A;  1BDD A;  1EC5 A;  2KZJ A;  4HKZ H;  3L70 E;  3B4S A;  3HD7 B;  2C0W A;  2WVR A;  3G3Z A;  4RSZ A;  1EZV I;  3IF4 A;  4O9B A;  2SPZ A;  1Q7Y Q;  2KLU A;  2O01 H;  1FDI A;  2CPB A;  4R4M A;  3T97 B;  4V2K A;  2QIW A;  1H1O A;  1OXZ A;  1K04 A;  1DW3 A;  3VYI A;  2FXP A;  3A5T A;  1VQK P;  1IFN A;  1BGY D;  3BVH A;  3P7K A;  1R0Q A;  1DX7 A;  3B5N B;  4NPE A;  1CHI A;  1X9V A;  1GW4 A;  2OAR A;  2ZYD A;  5AVV B;  2R32 A;  5GTI E;  2IFM A;  3H1K E;  1GW3 A;  3H1K D;  2E76 C;  2KLV A;  2FFD A;  1KIB A;  4U3F E;  2N18 B;  2FXO A;  2WSS H;  5KLI B;  2FYU K;  4Y99 C;  1UIX A;  2FWL A;  2OYI A;  1OIP A;  1VF5 B;  2BEQ D;  1VQM P;  4WQD A;  2OYI B;  3JC2 2;  3NMD A;  3AEE C;  3H1H D;  3KHU A;  1QEX A;  5DJT B;  2GM4 A;  1YI2 P;  1EDL A;  3B5N A;  4DZO A;  1LP1 A;  4DT0 A;  2OYO A;  3EWK A;  4Z1M H;  1AOF A;  3RL0 g;  2AIU A;  2KK7 A;  1JMM A;  3R4Y A;  2BH4 X;  3JBT B;  1CYJ A;  4PWA A;  3CXH D;  1SQQ J;  2XZR A;  2BH5 X;  1CSU A;  1NTZ K;  3K5B A;  3S9O A;  1FZG A;  1PGQ A;  1RY3 A;  2WSF J;  1M60 A;  2LR2 A;  3CCQ P;  1Z56 A;  1DW2 A;  1QGK B;  2YXQ B;  1M1J C;  4H0J A;  1T2K C;  4XXL A;  2GUS A;  3CWB E;  1VF5 C;  3L73 J;  4XE5 B;  3CX5 D;  1CIF A;  1H0T A;  1WT6 A;  2YIU C;  5AVQ B;  2E76 D;  2E76 B;  2N1T B;  1AJY A;  3C2C A;  3V2R A;  1M1K Q;  3HE5 A;  3WUI A;  3CWB G;  3G6E P;  1YBK A;  4MU8 A;  1ZN5 A;  1IK9 A;  2K1A A;  2C1D A;  3OA8 B;  3L71 G;  3FX0 A;  1CRH A;  2D0W A;  1L0N D;  3CU4 A;  3V2P A;  1L4A B;  4GIF A;  1PP9 E;  4JCG A;  1MUU A;  3OAK A;  1N7S C;  1CIH A;  1PP9 G;  2LKM A;  4RO0 A;  1N7S A;  451C A;  2HYN A;  2Q3I A;  2IYO A;  2B89 A;  2M5A A;  2B9B A;  2IX7 C;  4EI2 A;  2YKP A;  1ZRT E;  1NTM D;  4EIE A;  1KMI Z;  4FB1 A;  2BEZ F;  1QL1 A;  4AAO A;  1DVH A;  1MKM A;  1FOS E;  2AXT V;  3SWF A;  5GTI H;  3KZI E;  1Y8A A;  2N9B A;  3EFG A;  3W68 A;  2QJP B;  1WRG A;  4ASV A;  2Q6Q A;  3WFE C;  1OW7 A;  2N1T D;  4L76 A;  2DVH A;  3CXH H;  1HH0 A;  3AE5 C;  2E5T A;  2KUB A;  2NPS B;  3L75 J;  3D71 A;  4LJI A;  4C46 A;  1GU2 A;  3KYQ A;  2GUV A;  1NKN A;  5CIE B;  2P58 A;  3KQG A;  3CC2 P;  1VDF A;  2BCC J;  5CCH C;  3L4F A;  5KAI H;  4I6M C;  2PAJ A;  1W2E A;  1YTC A;  1KB9 D;  5H2F E;  1YTZ I;  3O5C A;  4WQA A;  1N7S B;  1N7S D;  1SQV J;  2ZJS E;  1YEB A;  2N3Y A;  4PW9 B;  1EB7 A;  1ZRT D;  3VRD A;  4WQB A;  3HUS C;  4H0L C;  3R2P A;  1HJB A;  3A0B V;  4EIC A;  1G1I A;  1KV9 A;  1CRY A;  1HGV A;  3G4S P;  2RN0 A;  1KYO W;  1SQB J;  1YTZ T;  3M9B A;  1SQP G;  4D6T G;  1RH5 B;  1HJ3 A;  2NRG A;  3PRJ A;  1BSN A;  1N8R Q;  1K3G A;  2ZAE B;  1SFC A;  2K9J A;  1NGM B;  2DGE A;  3Q5S A;  2WZ7 A;  5IY5 1;  4PD4 E;  3WC8 A;  1CSW A;  3L4O A;  2POH A;  3L72 G;  4TT3 H;  2OYI C;  1LTI C;  1YQ3 C;  4U7J A;  1KYO E;  5DJU B;  4TLF A;  2FFD C;  1LS9 A;  3H1H J;  1SVF A;  2ZT9 C;  1KIL B;  3NXS A;  1LWU B;  2Q3E A;  4A7P A;  1SQX G;  2JTI B;  4GOD A;  1CIE A;  5DF5 A;  2GC7 D;  3SSU A;  3TNU A;  1RF0 A;  3FWN A;  3A0H V;  3G9R A;  2P10 A;  3HTK A;  3VMX A;  1DW1 A;  2C2C A;  2B10 B;  1SQP D;  4D6T D;  2KOG A;  2WTY A;  2O01 J;  3MZW B;  4QAO A;  3UIA A;  4FA9 A;  1N7L A;  2GC4 D;  4IL6 H;  4KJM A;  1LJ2 A;  1NU1 K;  3OCD B;  1QLE D;  3Q1M A;  2RMZ A;  3OJA B;  2RH0 A;  155C A;  1GD2 E;  3V5B A;  1VQ8 P;  1NU1 D;  2KS1 B;  1NU1 E;  2CPS A;  4DY9 A;  2R3S A;  1A2S A;  5KAF V;  2JP3 A;  1SQP K;  4XFJ A;  2Q5U A;  5AW7 B;  2N3B A;  2QVA A;  2OZ1 B;  3ORV A;  3PP5 A;  3VP8 A;  1SQX D;  3CCM P;  2I1K A;  2ZT9 D;  5CYT R;  2WWW A;  1WMK A;  2IZ1 A;  2RKL A;  1B7V A;  3RBZ A;  1KC8 Q;  1K73 Q;  1ZP0 C;  2NPS A;  2IFN A;  2NZ2 A;  3AE9 C;  3FXE A;  2K3R A;  1JOC A;  2ZXE B;  1GL2 A;  3LW5 J;  1LTA C;  1LC1 A;  2XNX A;  1LT9 B;  2G3A A;  1ZOY C;  3KPE A;  1I8O A;  1A8C A;  1BE3 G;  4N78 D;  1CTZ A;  5CJ0 A;  3USS A;  3ZOW A;  3CC4 P;  1BE3 E;  1MZ4 A;  1M56 D;  1QN2 A;  1GK4 A;  4L75 A;  1IFP A;  3MUD A;  1AV1 A;  5APS A;  5APQ A;  2H8P D;  1F1F A;  1QL2 A;  2J58 A;  2HV4 A;  2C1V A;  1AQT A;  2KB7 P;  1RE4 A;  4W7Y A;  2ZVN B;  1VQ6 P;  1SQV E;  3VMA A;  1USE A;  1OZH A;  3GF7 A;  4IL6 V;  3HQ7 A;  2AXT H;  3HE4 A;  3Q5R A;  2AEM A;  2P67 A;  5KJ7 C;  1J1D B;  4IFD K;  3Q3D A;  1M57 D;  3LID A;  2QJK C;  2Q7C A;  1S9K E;  2QG4 A;  3HRN A;  1KQS O;  1ZR4 A;  3H1J G;  2PP6 A;  3H32 B;  3L75 E;  1CI6 B;  3L74 D;  2WSC J;  1ZZH A;  3ZDM A;  2AXT E;  2Q1K A;  2N9J A;  1BL9 A;  5CIB B;  1DIQ C;  2YCC A;  5CIG B;  3M06 A;  1LTG C;  1FZA A;  2CA3 B;  3VMY A;  1E29 A;  4AAL A;  4AYC A;  5KLV D;  1CYC A;  1CRJ A;  3RK3 D;  2XND H;  5TJH A;  3KZI H;  2ZBO A;  3TGU G;  3H1H G;  3PH2 B;  3AE6 C;  3T97 A;  3L71 E;  4RJT A;  2QE7 H;  5KKZ C;  1JY2 N;  1L0L J;  2WSE J;  1AOQ A;  1Q82 Q;  1JY2 P;  2M3E A;  3OA7 A;  1FDO A;  1ZR2 A;  1FI7 A;  2E75 C;  1FS0 E;  1HUC A;  2C9N Y;  1IFM A;  2B87 B;  4DOJ A;  3TDK A;  1R8E A;  1Q81 Q;  1M6Z A;  3L74 E;  2WSC H;  3D70 A;  5BVZ A;  1YFC A;  1HRO A;  2M8R A;  2C8S A;  5AW5 B;  3VOP A;  2H88 C;  1ETP A;  2FYU D;  2JEE A;  1KIL A;  1BGY E;  2Y0C A;  1U74 B;  3CCR P;  3LIE A;  1VQN P;  2IBZ I;  3F5H A;  4LC1 A;  2OYH B;  3CYT I;  2O01 N;  1FCD C;  1FI3 A;  3AEB C;  5KJ7 D;  3A7O A;  2R44 A;  2KP8 A;  1VQO P;  1RZ5 A;  3O6Q A;  4GT1 A;  1NTM J;  4H13 C;  4EIF A;  3L71 D;  3CXH I;  1BCC G;  2PCB B;  1SQQ D;  4GED B;  2KS1 A;  3H1I G;  3L70 D;  3PHL A;  2WMM A;  1EDI A;  1KD1 Q;  1XTC C;  2IPP A;  1IFJ A;  1JO5 A;  1FOC A;  2L91 A;  1CRI A;  1M90 Q;  2XTS B;  3P8M C;  2FYU E;  3H1L G;  4WQC A;  1NU1 J;  2WSF H;  5APY A;  1HWT C;  2J59 M;  1SQV G;  5AVR B;  1PGP A;  5APU A;  3A2A A;  2ZT9 B;  5CBN A;  1FJK A;  2K37 A;  2JQR A;  1YNR A;  1CED A;  1N2D C;  3GHG C;  4WY4 A;  2L5G B;  2PFX A;  4I2L C;  1FOS F;  2O1J A;  2OQQ A;  1I54 A;  3F89 A;  1NNO A;  2B4Z A;  2FYU G;  4WQ8 A;  3H1L E;  3L73 D;  1ZXG A;  1K3H A;  3ZOX A;  2KZI A;  3A3Y B;  1J1D C;  5AVX B;  1YIJ P;  1MV8 A;  1GL2 B;  1KZU B;  3II6 A;  5KAF E;  4XA4 A;  3H1K G;  1KQG B;  3BCC G;  1DD4 A;  1HBW A;  3B71 A;  5B66 V;  3IN6 A;  1KFM A;  2OYH A;  5KLV K;  3VNW A;  3AEF C;  1PIX A;  2CE1 A;  1Q2N A;  1DW0 A;  1AYG A;  2V7Q H;  5H2F H;  3AE7 C;  4H13 D;  1RQV A;  1WVE C;  2D2C C;  1LTB C;  5KAI E;  1H0T B;  1YQ4 C;  4BRY B;  1RQU A;  3H1I J;  3GG2 A;  1M1J A;  1G1J A;  1PPJ G;  2JDI H;  2W6J H;  2IDB A;  3PXW A;  3TYY A;  5CIH B;  4L74 A;  1AVO A;  3CXH E;  4P4Q B;  2I8F A;  4YE1 A;  1AVY A;  1NTK D;  1T6A A;  2Z4E A;  3WUU A;  4GOF A;  1QYZ A;  2ZXY A;  2ITA A;  1MG3 D;  1H9X A;  1F1C A;  1ZLL A;  1CRC A;  1FI9 A;  2OGU A;  3MGN A;  1S5L E;  2HFE D;  1YIT P;  2K9Y A;  1N86 A;  1KQF B;  5TIS V;  3DMI A;  2YMY A;  2BCC E;  4WQ7 A;  1KQL A;  3B5N C;  2BGV X;  5AW3 B;  1SS1 A;  3SLE A;  3M0A A;  2GB8 B;  2W83 C;  2ZOO A;  1NH4 A;  1M7L A;  3WFC C;  4OGQ D;  2JWA A;  4DJG A;  3CWB D;  1IO4 A;  1L0L E;  3H25 A;  3U1A A;  3D6Y A;  2P2U A;  2AEF A;  3V4W A;  1USD A;  2ZZS 1;  3LW5 H;  1NIR A;  1XTG B;  4BRY A;  1E5W A;  1N73 A;  1L0L K;  1SQQ G;  1NTK K;  4L3G A;  3WFB C;  3BAT A;  3HE4 B;  1SP4 A;  1SFC D;  1KYO D;  1PPJ E;  3RLM A;  3H1J D;  1IZN B;  4PJ0 V;  2H7H A;  1GQ1 A;  1LP1 B;  1QKS A;  1SQX K;  2JJL A;  2A45 H;  3SXT A;  3FGA D;  1H32 A;  3GMA A;  1K05 A;  3AE2 C;  2YMK A;  3GW6 A;  1N15 A;  1I6D A;  3L73 E;  5L8R J;  1S2E A;  1G2C B;  2JKV A;  3IFM A;  1CTY A;  3H1J J;  3A0B E;  2QEX P;  1QL3 A;  1NTM E;  3RK2 B;  3RN1 A;  1URQ D;  1J3S A;  2CK3 H;  2OTK E;  3CXH W;  3VN0 A;  1FAV A;  4JQ0 D;  1M8O B;  1HF9 A;  1KB9 E;  3A0H H;  1RE4 C;  1T3U A;  4OGQ B;  2WT7 B;  1LFM A;  5AW8 B;  3MUD C;  5M1B A;  3S4R A;  5CCG C;  1RF1 B;  1HZU A;  1BDC A;  1YIC A;  3M97 X;  1S1C X;  1BE3 J;  4I7Z C;  5AW1 B;  1C2R A;  4AAM A;  2KI7 B;  2EXV A;  3C8V A;  4UB8 E;  5TIS E;  4IFF A;  1RF1 A;  3ITK A;  2NPS C;  4IOI H;  2R3C A;  5BU5 A;  5CCH D;  2H89 C;  4AX3 A;  1C75 A;  1KX7 A;  4U3F D;  1S6V B;  5APV A;  4AUW A;  1QVF O;  2QA4 P;  3L75 D;  1AKK A;  4WVZ A;  2M3B A;  3P8C D;  4EID A;  3NWV A;  3KZI V;  4C7N B;  4YXD C;  1P84 H;  4L1Q A;  1NMI A;  3IAO A;  1NTK G;  2HR3 A;  1JTH B;  1A02 F;  4EIJ A;  3C9I A;  1GZL A;  5AUR A;  3V4Q A;  1SQX J;  4EDF A;  3Q5P A;  3PJS K;  1VQL P;  1LWU A;  4PJ0 E;  1FZC A;  5AW9 B;  1EDJ A;  1L0N E;  1YYC A;  3CME P;  2HPC A;  1NTK E;  1Y9B A;  2B11 B;  1KV4 A;  3M0D C;  2HOD A;  2E75 B;  1FZB A;  2D2C D;  5AVZ B;  3MP7 B;  2G8Y A;  2OZ1 A;  4W80 A;  4N78 E;  5AVU B;  1RF0 C;  5AW4 B;  1PV3 A;  3D0W A;  3WU2 V;  3H1L D;  1LC2 A;  3HD7 A;  1HZV A;  1P84 E;  1L4A A;  1H31 A;  3SJL A;  1GJQ A;  1CO6 A;  3ZOY A;  4OWF A;  1E2R A;  1GIW A;  1CYI A;  3CCL P;  4RKU J;  1LT1 A;  1N73 C;  4FA1 A;  3H32 A;  3TNU B;  1NTK J;  2Z5I A;  1COR A;  3BCC D;  1L9B C;  4IL6 X;  4ZNC A;  3V2Q A;  1U75 B;  3CL3 D;  3RL0 D;  4NPF X;  1AA0 A;  4OH8 B;  3DR0 A;  1IQC A;  4UB8 H;  4AAN A;  3L72 J;  4PV1 C;  4YPC A;  4N6J A;  2A06 G;  2KIK A;  5KTB A;  3CX5 I;  3E1I A;  1C7M A;  5CBO A;  1EXI A;  1CSB A;  1D7M A;  1WEJ F;  2YQB A;  1H33 A;  4PD4 I;  4AQR D;  4ASW A;  1NTZ E;  1NTZ D;  1KFN A;  2FYU J;  4NPD A;  2WSE H;  1UII A;  4KT0 J;  2B87 A;  3JSV C;  5AVW B;  2JR8 A;  1JNM A;  1M1J B;  2P7J A;  1E8E A;  1URQ A;  3MK7 B;  3AE8 C;  1C2N A;  1R5S A;  4GKG A;  1YIQ A;  3AEC C;  1NU1 G;  2A06 D;  2UWJ E;  4WQ9 A;  1NTZ J;  5CCH A;  3MHV A;  2WPV B;  1CTJ A;  5AVS B;  1LMS A;  2N9I A;  1CZQ A;  1PP9 J;  1JCC A;  3JCU H;  2OTJ P;  1LT9 A;  2BCC D;  1P84 D;  1S5L X;  3AED C;  2QJK B;  3L74 G;  3AEA C;  2IZ0 A;  2XDJ A;  1CHJ A;  2C9L Y;  3GLM A;  2HG5 D;  3TYI A;  3BRT B;  2LXB A;  3L71 J;  4FAN A;  4UB6 H;  2YK3 A;  1VQ5 P;  4HJG H;  1DEB A;  4JPZ B;  1JY3 O;  1FE6 A;  5AVY B;  1EZV G;  1JEK A;  2W6A A;  1LTJ C;  1Y47 A;  5AW0 B;  2Y9Y A;  2KSE A;  1KYO H;  3CX5 W;  3RBX A;  3X39 A;  1KN7 A;  1KTM A;  1KB0 A;  1RE3 C;  1N73 B;  1FU1 A;  1JY3 N;  2PRR A;  3L73 G;  1HGZ A;  2E74 B;  1VL2 A;  1Q86 Q;  4UB6 V;  3ZCF A;  1U7M A;  2W90 A;  3AE1 C;  2Q9I A;  1DH3 A;  2Y9Z A;  1EXJ A;  4I1L A;  1LTJ A;  2YNY A;  2B12 B;  2CXB A;  1CIG A;  3N4X A;  3FXD A;  3KDP B;  4R4L A;  1T3J A;  3S1K A;  2C9X B;  4FAV A;  3BRV B;  5E79 E;  1IFI A;  2QJP C;  3CCU P;  1N9C A;  1FJ0 A;  2BCN B;  2KSJ A;  1IZL 0;  1HJ4 A;  2I1J A;  1PPJ D;  1DIP A;  1I8P A;  3I56 P;  1SQB K;  4K35 A;  3TSI A;  3CPW O;  1CW5 A;  4I7Z B;  4KHX A;  2NPS D;  4N0K A;  2M5A B;  2HPC B;  3RK3 C;  1BGY J;  1IRV A;  3RN0 A;  2DW3 A;  1L0L D;  4J20 A;  5APW A;  4EYY Q;  3O6Q B;  1GU4 A;  4H44 D;  2BLF B;  1FHB A;  3AEG C;  2OTL P;  2CA4 B;  1HCM A;  2W27 A;  2FFD B;  1OAE A;  3MTU E;  2P1J A;  3CLQ A;  1KIL C;  1DVV A;  3G71 P;  1LTJ B;  5EXQ A;  4OVN F;  1SQQ K;  1COT A;  2QM7 A;  4H0L B;  4BWN A;  1DT1 A;  3VP9 A;  5CID B;  1FZC B;  5B5E E;  3AE3 C;  3QWO C;  5B66 E;  2ZFC A;  2FRC A;  4ZKU A;  2D2C B;  1GTW A;  1RAP A;  3VYM A;  1QX8 A;  351C A;  1FBM A;  2D0S A;  4XYD B;  4YTP C;  3WU2 H;  3TGU D;  2XV5 A;  1YEA A;  3CX5 H;  4HB1 A;  2MKV A;  1IFD A;  2A45 I;  1HTL C;  3QH9 A;  3RK3 B;  3RK2 C;  4UB6 E;  2WPQ A;  2KXP B;  4EOT A;  4JF7 A;  2ZXX A;  1L4A D;  1C6R A;  1VQP P;  1NTZ G;  4GYD A;  1E79 H;  2WT7 A;  3L4M A;  2IBZ D;  1KX2 A;  3H1L J;  3HQ9 A;  4L3H A;  4ZMD A;  2FXM A;  4MN4 C;  3L72 D;  3U59 A;  5APT A;  1JY2 O;  5GTH V;  3TGU E;  3L35 A;  4L73 A;  5GTH H;  1LTS C;  3ZOO A;  1CXC A;  5KJ7 A;  3PXT A;  1X0T A;  1X8Y A;  3SWY A;  2R5B A;  5B6Q A;  4YXW H;  1W5C E;  1SQB D;  3RK3 E;  2MJZ A;  1EZV E;  3BAS A;  1BCC J;  3V2N A;  4IFM A;  5AVT B;  2MTA C;  1HJ5 A;  3M91 A;  2W6B A;  1YCC A;  3WUT A;  3CX5 E;  5APX A;  1OCD A;  3HE5 B;  3WU2 E;  3L70 G;  3L37 A;  1RF1 C;  1VQ4 P;  1GMJ A;  2V4H A;  3OW2 O;  1NOH A;  2K88 A;  1RHZ B;  5B66 H;  1NVO A;  1T2K D;  1ZME C;  1KYO I;  4Y28 J;  5DJQ C;  2ZON G;  2I8D A;  1I55 A;  4H44 B;  2PCC B;  2E5Y A;  1GDV A;  3EQ2 A;  1X22 A;  1SQQ E;  1IJD B;  1P84 I;  2GIW A;  1SQB E;  2N1T A;  2AEJ A;  5B5E V;  1K9M Q;  3RK2 D;  1CCR A;  1JB0 J;  2FKW B;  2VHD A;  2XKM A;  5E79 V;  1CI6 A;  1QVG O;  1L0L G;  2MHM A;  2FYN C;  3CP5 A;  2C0X A;  1OWA A;  4WB4 A;  3PTZ A;  1SQB G;  1HH7 A;  3TGU J;  3WMM 0;  4N3Y B;  3H6P A;  4RES B;  2QSI A;  1SFC B;  2K9J B;  3VTP C;  3A9F A;  4NFG B;  1OW6 A;  3MK7 C;  1H33 B;  1C52 A;  5H2F V;  2L4D A;  2O1K A;  1MZ9 A;  1PGJ A;  1CHH A;  2C1D B;  3OA8 A;  3P32 A;  3N7N A;  4B86 A;  2E43 A;  1IRW A;  5E79 H;  1I5T A;  2Z5H A;  1DII C;  3RMZ A;  2JO1 A;  4Y5R A;  2KYV A;  2W8Z A;  3ABV C;  4JYB A;  1CRG A;  3AE4 C;  1MG2 D;  1S5L V;  4OGQ C;  5AW6 B;  4C7N A;  4M3L A;  5KAF H;  3C1L A;  2B88 A;  4QMA A;  3NBT A;  5TIS H;  2E74 D;  3I5C A;  2YO2 A;  2YKQ A;  2O3J A;  1SQP E;  4D6T E;  3CCE P;  1ZW0 A;  1SFC C;  1MFT A;  3OCD A;  2WPR A;  4HH2 A;  2QRX A;  1QL4 A;  1CSV A;  1RZ6 A;  5CHX A;  1C6O A;  1NML A;  3HTK B;  5CMZ A;  1H89 A;  1J1E C;  5KLI C;  3IR9 A;  1Q90 D;  3PLN A;  4WY4 D;  3RL0 C;  5KAI V;  1NO4 A;  3I55 P;  3E7K A;  1IK7 A;  3HUS A;  1NAF A;  3A0H E;  3FWL A;  1GKS A;  4LLH A;  1DD3 A;  1AFO A;  5EFW B;  4H13 B;  5KLV J;  1YHQ P;  4U3F G;  4FA5 A;  1NYH A;  2KNC A;  1CNO A;  1ZV8 A;  3A0B H;  5GTH E;  1R5L A;  3CWB J;  2LIR A;  5C39 A;  3CCS P;  1JMB A;  1LTT C;  1OVV A;  1OVR A;  2E42 A;  3PXS A;  4PD4 D;  1H32 B;  1U7J A;  3HUS B;  3M9H A;  1L2P A;  1VF5 D;  1FJP A;  3H1I E;  1S72 P;  4UB8 V;  3L72 E;  2FY8 A;  1EQ7 A;  4JYC A;  5BU8 B;  2WIT A;  1S4X A;  3Q2Y A;  1SQV K;  1CXA A;  2ZVO B;  1C6S A;  2OYH C;  3DP5 A;  2PGD A;  1IC2 A;  5K5G B;  1BGY G;  2R5D A;  2HOD B;  3CCV P;  3CCJ P;  1M70 A;  3W67 A;  1A02 J;  3O20 A;  1GDT A;  1A56 A;  1HVV A;  3L36 A;  2E74 C;  5DFS A;  1PP9 D;  3H1I D;  4O1W A;  1FZF A;  2QJY C;  1W2B O;  1RE3 A;  5B5E H;  1VYD A;  4WY4 C;  3WUV A;  3U1C A;  3ZIY A;  3GHG A;  5KLV E;  4Q5P A;  1OFC X;  5KLV G;  3WFD C;  2A45 G;  3CMA P;  2LXC B;  2LIT A;  1NTM K;  1HRC A;  4FA4 A;  2N18 C;  1JCD A;  1NJI Q;  3H1H E;  1JY3 P;  1KOR A;  1IO3 A;  3HQ6 A;  1J2J B;  2CE0 A;  1KIL E;  3BCC E;  5CJ4 A;  3TF5 A;  3CC7 P;  2HLO A;  4PV1 B;  1LT9 C;  4ZKP A;  2V7Q J;  2WQY C;  2AI5 A;  1GU5 A;  1FZE A;  3HD7 D;  1I6E A;  1BCC D;  2BAS A;  1W5C T;  4WY4 B;  1W2L A;  1FC2 C;  4GDO A;  3EFF K;  4PJ0 H;  1PZQ A;  2WPS A;  1N90 A;  2V08 A;  4U3F J;  1URQ C;  2BCC G;  3BCC J;  3H1K J;  2VRS A;  2Y0D A;  4HYT B;  4H44 C;  1JM0 A;  1YJW P;  3L75 G;  3CI9 A;  3O8Z A;  1YJ9 P;  3L74 J;  3CD6 P;  1SLQ A;  2H43 A;  4PV1 D;  5GTI V;  1PGO A;  1PL5 A;  4WQE A;  3RGU A;  3HQ8 A;  1OX3 A;  1VPC A;  3PH0 A;  1TU3 F;  3P8C E;  2FYZ A;  1BSH A;  4DCK A;  2XU6 A;  1GL2 D;  4JBZ A;  1PFI A;  1CC5 A;  1NHL A;  4H0K A;  1J1E B;  1S9K D;  1S3J A;  2FBW C;  1H9Y A;  4LGD E;  1SQX E;  1L9J C;  3SVW A;  5CCG D;  3KXD A;  2AXC A;  1EDK A;  1JDL A;  1RAQ A;  1L0N G;  2YO3 A;  4O1Q A;  1VQ7 P;  1SQV D;  1VQ9 P;  3D6Z A;  2BPB B;  4WWI A;  3MIW A;  1LNQ A;  1L4A C;  1K8A Q;  3HD7 C;  1KB9 H;  1MFZ A;  2YKO A;  4K3A A;  1NTM G;  1CSX A;  3RL0 B;  3SFE C;  1DEE G;  1FDM A;  2C1U A;  3JCU E;  2GA1 A;  2B0Z B;  2FYN B;  3M0D A;  1NAY A;  4WBA A;  3VMZ A;  3O0R C;  1OMI A;  4KMG A;  2E75 D;  2IYP A;  2JWD A;  2YXR B;  4IL6 E;  2IBZ E;  1FZC C;  2YIU B;  3GF3 A;  3SWS A;  1LWU C;  3TK1 A;  2ORL A;  1OVU A; 
#chains in the Genus database with same CATH homology
 1A2S A;  5KAF V;  5DJQ B;  5KKZ B;  2N3B A;  1LFM A;  2OZ1 B;  3ORV A;  1SQX D;  2MTA C;  1HJ5 A;  5C9M A;  2N9Y B;  1YCC A;  5CYT R;  1HZU A;  2PAC A;  1H31 B;  1OCD A;  1B7V A;  1YIC A;  3M97 X;  1EZV D;  1CCH A;  5CIC B;  1BE3 D;  1N50 A;  1C2R A;  2KNC B;  4AAM A;  2Y0E A;  2EXV A;  1LC1 A;  5DJQ C;  2V07 A;  2ZON G;  3ITK A;  5CIF B;  1I55 A;  4AX3 A;  2PCC B;  1GDV A;  1C75 A;  1I8O A;  1A8C A;  1KX7 A;  1CTZ A;  4U3F D;  1S6V B;  2QJY B;  2GIW A;  3ZOW A;  5B5E V;  1MZ4 A;  1QN2 A;  3L75 D;  1AKK A;  1CCR A;  3ZBM A;  3O1Y A;  4EID A;  1F1F A;  3NWV A;  2VHD A;  3KZI V;  2HV4 A;  2C1V A;  4L1Q A;  1NMI A;  5E79 V;  2MHM A;  4K3I A;  3CP5 A;  5C0Z A;  3NBS A;  3VMA A;  3PTZ A;  1HH7 A;  3HQ7 A;  4IL6 V;  5AUR A;  4EDF A;  2K9J B;  3A9F A;  4NFG B;  4RSZ A;  3MK7 C;  1H33 B;  2QG4 A;  1C52 A;  5H2F V;  2L4D A;  2B11 B;  1CHH A;  2C1D B;  3L74 D;  3OA8 A;  4V2K A;  1H1O A;  2OZ1 A;  1ZZH A;  2N9J A;  1BL9 A;  1IRW A;  1DIQ C;  5CIB B;  1I5T A;  2YCC A;  5CIG B;  1DW3 A;  1DII C;  3RMZ A;  3H1L D;  3WU2 V;  1LC2 A;  1HZV A;  2CA3 B;  4Y5R A;  1H31 A;  1E29 A;  3SJL A;  4AAL A;  1CRG A;  5KLV D;  1BGY D;  1CYC A;  1CRJ A;  1GJQ A;  1CO6 A;  1R0Q A;  3ZOY A;  1E2R A;  1GIW A;  5TJH A;  1CYI A;  1CHI A;  2ZBO A;  1MG2 D;  3PH2 B;  3H1K D;  4FA1 A;  1S5L V;  1COR A;  3BCC D;  4RJT A;  1L9B C;  1KIB A;  2N18 B;  5KLI B;  1AOQ A;  1U75 B;  2FWL A;  1FI7 A;  3NBT A;  3DR0 A;  1IQC A;  4WQD A;  4AAN A;  3H1H D;  3KHU A;  2O3J A;  1C7M A;  3TDK A;  1M6Z A;  3OCD A;  1WEJ F;  2YQB A;  1H33 A;  1QL4 A;  1YFC A;  1CSV A;  1HRO A;  1RZ6 A;  1NTZ D;  1AOF A;  2AIU A;  2C8S A;  1C6O A;  2BH4 X;  1NML A;  1ETP A;  2FYU D;  3JBT B;  1CYJ A;  4PWA A;  3CXH D;  3PLN A;  5KAI V;  2Y0C A;  2BH5 X;  1U74 B;  1CSU A;  3FWL A;  1GKS A;  3CYT I;  1E8E A;  1FCD C;  1FI3 A;  3MK7 B;  1C2N A;  1YIQ A;  1M60 A;  4FA5 A;  1RZ5 A;  2A06 D;  1CNO A;  4WQ9 A;  4EIF A;  1DW2 A;  2LIR A;  3L71 D;  4H0J A;  4XXL A;  3PXS A;  1CTJ A;  2PCB B;  4PD4 D;  1SQQ D;  1H32 B;  4GED B;  1LMS A;  2KS1 A;  2N9I A;  3L70 D;  3PHL A;  3CX5 D;  1CIF A;  4UB8 V;  2BCC D;  1P84 D;  2QJK B;  1CHJ A;  1CXA A;  3C2C A;  3TYI A;  1C6S A;  1FOC A;  2L91 A;  1CRI A;  3DP5 A;  3WUI A;  2XTS B;  4WQC A;  4FAN A;  4MU8 A;  2YK3 A;  2C1D A;  2JQR A;  3OA8 B;  1YNR A;  1CED A;  1CRH A;  1M70 A;  2D0W A;  1L0N D;  3CU4 A;  3O20 A;  1A56 A;  1I54 A;  3CX5 W;  5DFS A;  1PP9 D;  1NNO A;  3X39 A;  2B4Z A;  4WQ8 A;  4JCG A;  3H1I D;  3L73 D;  1KB0 A;  4O1W A;  1K3H A;  3ZOX A;  1CIH A;  451C A;  4UB6 V;  3ZCF A;  1NTM D;  4EIE A;  1VYD A;  4FB1 A;  3ZIY A;  4AAO A;  1DVH A;  4Q5P A;  5B66 V;  2AXT V;  3WFD C;  2B12 B;  2CXB A;  1CIG A;  2LIT A;  1HRC A;  4FA4 A;  2N18 C;  2QJP B;  3WFE C;  2C9X B;  4FAV A;  3VNW A;  1IO3 A;  3HQ6 A;  2CE1 A;  1DW0 A;  2DVH A;  2CE0 A;  3TF5 A;  1N9C A;  1FJ0 A;  2BCN B;  1AYG A;  2AI5 A;  1WVE C;  4LJI A;  1I6E A;  1IZL 0;  1GU2 A;  1BCC D;  1W5C T;  1HJ4 A;  1PPJ D;  1I8P A;  5CIE B;  3GG2 A;  1W2L A;  1YTC A;  3PXW A;  1KB9 D;  5CIH B;  4N0K A;  1N90 A;  2V08 A;  3O5C A;  1IRV A;  4P4Q B;  4WQA A;  3RN0 A;  1L0L D;  4J20 A;  2I8F A;  4YE1 A;  1YEB A;  1NTK D;  2N3Y A;  4PW9 B;  1EB7 A;  1ZRT D;  3VRD A;  4WQB A;  1QYZ A;  2ZXY A;  2BLF B;  1FHB A;  3A0B V;  4EIC A;  1MG3 D;  1HCM A;  2CA4 B;  2Y0D A;  1H9X A;  1OAE A;  1KV9 A;  1F1C A;  1DVV A;  1CRC A;  1FI9 A;  5EXQ A;  1CRY A;  1COT A;  2RN0 A;  1KYO W;  5TIS V;  3DMI A;  5GTI V;  1HJ3 A;  3PRJ A;  4WQ7 A;  2BGV X;  4WQE A;  3HQ8 A;  1K3G A;  1DT1 A;  3SLE A;  2DGE A;  5CID B;  2GB8 B;  2ZOO A;  3WFC C;  2JWA A;  5IY5 1;  3CWB D;  2FRC A;  3WC8 A;  1RAP A;  1CSW A;  1CC5 A;  3L4O A;  3VYM A;  4H0K A;  2ZZS 1;  351C A;  2D0S A;  1H9Y A;  4XYD B;  1LS9 A;  1NIR A;  3TGU D;  1L9J C;  1YEA A;  3SVW A;  1JDL A;  2Q3E A;  4A7P A;  1RAQ A;  4L3G A;  3WFB C;  2JTI B;  1KYO D;  4O1Q A;  1SQV D;  3RLM A;  3H1J D;  2BPB B;  4PJ0 V;  1GQ1 A;  1CIE A;  5DF5 A;  2GC7 D;  1QKS A;  1C6R A;  3SXT A;  4GYD A;  3A0H V;  1CSX A;  1H32 A;  1DW1 A;  2C2C A;  2B10 B;  1SQP D;  4D6T D;  2C1U A;  3L4M A;  2B0Z B;  3GW6 A;  2FYN B;  2IBZ D;  1KX2 A;  1N15 A;  4QAO A;  1I6D A;  4FA9 A;  3HQ9 A;  2GC4 D;  4L3H A;  3O0R C;  3L72 D;  4KMG A;  5GTH V;  3OCD B;  1CTY A;  2RMZ A;  3ZOO A;  1QL3 A;  1CXC A;  155C A;  2YIU B;  3SWS A;  3PXT A;  2ORL A;  3RN1 A;  5B6Q A;  1NU1 D;  1J3S A;  3CXH W;  1SQB D;  4DY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...