3L73D

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 68
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l73D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l73D02
3H1JD 5KLVD 2B0ZB 2PACA 2D0WA 2QJYB 1H32B 4XXLA 1EB7A 1F1CA 3ZOXA 3SVWA 1WVEC 1LMSA 2N3YA 3ZOYA 2JWAA 5CIGB 3C2CA 1CTYA 2N9YB 1IO3A 155CA 1RAPA 1CYIA 1HH7A 1C75A 2FWLA 1SQBD 2N18C 3ORVA 3GW6A 1KB9D 3WFEC 1CIGA 1QKSA 2A06D 2N9JA 2KNCB 5C9MA 3HQ8A 5H2FV 3SXTA 2JTIB 1N15A 1DW3A 1CCHA 1H9YA 1NU1D 3H1ID 4WQCA 2DGEA 5DJQC 4PW9B 1DW0A 1FCDC 2QJKB 3PH2B 1CTJA 3A0HV 2L91A 2RMZA 2ZONG 1DVHA 4WQDA 5CIEB 1H9XA 1N9CA 1KYOW 1C2RA 1RZ6A 5KAFV 1HJ4A 1I5TA 2FRCA 2GC7D 4EICA 5E79V 4PWAA 5DF5A 1H31A 1YICA 3KHUA 4WQEA 1GU2A 2C1DA 1L0ND 4WQ8A 2BPBB 3RN1A 3CXHW 1I6DA 1AKKA 3DR0A 4KMGA 2B12B 1NTKD 3WFCC 4FB1A 2V08A 3TYIA 5KKZB 2BH4X 1RAQA 4UB8V 3WFDC 3MK7B 5B6QA 3X39A 2CXBA 1FI9A 3GG2A 1CYCA 4PD4D 2BLFB 2MTAC 1DIQC 3H1LD 1S6VB 1QL4A 2FYUD 1AYGA 1WEJF 4P4QB 2DVHA 4N0KA 1H33A 2CA3B 351CA 2AIUA 5AURA 2O3JA 2LITA 2XTSB 5KLIB 1DT1A 451CA 3RN0A 4L3GA 3CX5D 1PPJD 3NBTA 1IRWA 2GIWA 1OCDA 3CU4A 1LC1A 3PXSA 1YFCA 5GTHV 1ZZHA 2C9XB 4EIEA 3L75D 2JQRA 2PCCB 3OA8A 4H0JA 4FA4A 5IY51 1L0LD 1CSXA 4O1WA 1BE3D 3H1KD 3ZOWA 4AAMA 4FANA 3OCDA 1DW1A 1HCMA 3L73D 1I8OA 2CE1A 1I8PA 1QL3A 1YIQA 4AAOA 1BGYD 3A9FA 3ZOOA 2Y0CA 3ZCFA 4AANA 1CIFA 2PCBB 1H31B 2EXVA 5GTIV 2C1VA 1C7MA 2C1DB 4NFGB 1GKSA 1W5CT 1C6RA 1DVVA 3RMZA 3ITKA 1CSVA 4FA5A 1CORA 1N90A 2LIRA 3L71D 1AOQA 1CSUA 3HQ7A 1C2NA 3MK7C 3CWBD 3FWLA 3O20A 2Y0EA 1LS9A 2QG4A 1FI7A 3PXWA 3JBTB 2ZXYA 1SQQD 3CP5A 3WU2V 2YK3A 4FA1A 1FHBA 1E8EA 1H33B 1HROA 1CIEA 5CIFB 1CRCA 2CE0A 1CRHA 3VMAA 1C52A 1I54A 1J3SA 2B11B 4EIDA 2N3BA 2YIUB 1ZRTD 4WQ7A 2VHDA 1R0QA 3L4OA 3PTZA 1GDVA 1B7VA 1U75B 5TISV 3KZIV 3CX5W 1LC2A 1CRYA 3OA8B 4UB6V 1VYDA 2N9IA 3M97X 2C8SA 1CRJA 3OCDB 1N50A 4D6TD 5B5EV 1LFMA 2KS1A 4EDFA 1MG2D 1FJ0A 1COTA 2ZOOA 1U74B 4V2KA 1CRGA 3WFBC 5B66V 3NWVA 1PP9D 3NBSA 2IBZD 3H1HD 4RJTA 3L72D 2FYNB 4AALA 1KX2A 1KYOD 1AOFA 3TGUD 1KB0A 2BCNB 5DJQB 1SQPD 2YCCA 2ZBOA 5CIDB 5DFSA 1NNOA 4JCGA 2ORLA 1CXCA 1YNRA 1YTCA 2GB8B 1C6OA 2Q3EA 5TJHA 1P84D 1NMIA 1NMLA 1CHHA 3WC8A 1HZUA 4Q5PA 1CTZA 1JDLA 3DP5A 4DY9A 5CIBB 2OZ1A 3VNWA 4AX3A 1NIRA 1L9JC 2BCCD 1E29A 1NTMD 4A7PA 4WQ9A 2BGVX 3SWSA 2CA4B 3DMIA 3VYMA 5CIHB 2V07A 1CO6A 1BL9A 1HRCA 1RZ5A 3O0RC 3L74D 3SLEA 1DIIC 1I6EA 3O1YA 2ZZS1 4K3IA 5CYTR 4GEDB 5CICB 3BCCD 3HQ6A 1DW2A 1HZVA 3O5CA 4EIFA 2GC4D 1I55A 1K3HA 1GJQA 4Y5RA 1IQCA 1KX7A 1BCCD 3CYTI 1HJ3A 5C0ZA 1CHIA 2AXTV 4U3FD 2I8FA 1IZL0 3SJLA 1NTZD 1FOCA 5KAIV 2AI5A 3PXTA 4WQBA 3TDKA 3ZIYA 1S5LV 3WUIA 1MG3D 4MU8A 4IL6V 1EZVD 1H32A 1SQXD 1YCCA 2YQBA 2QJPB 1CHJA 2Y0DA 3ZBMA 1M70A 1ETPA 3HQ9A 5EXQA 2B4ZA 1M60A 2BH5X 1QN2A 4O1QA 4L1QA 1CEDA 3L70D 1CNOA 4RSZA 2OZ1B 3L4MA 2N18B 1K3GA 4XYDB 1GQ1A 1QYZA 4PJ0V 1L9BC 2C2CA 3PHLA 1CXAA 2RN0A 1W2LA 1E2RA 1CSWA 2C1UA 4GYDA 1CC5A 1CIHA 1CRIA 1CCRA 4FAVA 1A56A 4YE1A 3VRDA 1F1FA 3A0BV 1IRVA 4LJIA 1YEBA 1H1OA 1M6ZA 4WQAA 4FA9A 3CXHD 4H0KA 3RLMA 2B10B 1A2SA 2MHMA 1GIWA 3PLNA 1SQVD 1OAEA 2D0SA 1FI3A 4L3HA 1MZ4A 3PRJA 1A8CA 3TF5A 4J20A 2K9JB 1KIBA 1YEAA 2HV4A 1C6SA 1HJ5A 1KV9A 1CYJA 2L4DA 4QAOA
chains in the Genus database with same CATH superfamily
1FZEA 5KLVD 2WT7B 2D0WA 1JMMA 3WU2H 2QM7A 1H89A 1E79H 1P84I 1EB7A 1F1CA 2N3YA 3ZOYA 3OJAB 2IYPA 1EZVE 1NWQA 3GMAA 5CIGB 3C2CA 3MUDA 3L35A 5AVQB 1L4AC 2N9YB 1USDA 1SLQA 1AFOA 4XE5B 5AW7B 2O1KA 1HH7A 3HTKB 1C75A 2FWLA 1HH0A 2WZ7A 2A06D 2GUVA 2W6JH 4OH8B 3SXTA 4DZOA 2JTIB 3L70E 1M1JB 2FYUG 3RK3C 1CCHA 1Y9BA 2JKVA 1VQKP 1H88A 1DD3A 3C8VA 1FCDC 3AE7C 2FYUJ 2WT7A 5APUA 2WPRA 2NRGA 1IK9A 3FXEA 1SQPG 4WQDA 5CIEB 4YTPC 1N9CA 4I1LA 1RZ6A 1I5TA 1PGQA 2QEXP 5E79V 4HH2A 4WQEA 3CXHE 5GTHH 1I6DA 1AKKA 1EZVI 1SQVE 2R3SA 4KMGA 2B12B 3L75J 5AW2B 3TYIA 1VQ8P 2BH4X 1S9KE 3MK7B 5AW1B 1L0LJ 1BE3J 4JBZA 3V2NA 1LWUB 4OVNF 2HODB 2GM4A 3RBZA 2O01J 1S2EA 2FFDC 2BLFB 3U1CA 1BGYJ 1QL4A 2FYUD 2MJZA 3L74G 2QVAA 5AURA 3NMDA 2E5TA 5KAIE 4KHXA 2LITA 2FYZA 1DT1A 4YPCA 5AW6B 4L3GA 3CX5D 1GL2D 5KJ7C 3A3YB 2I1KA 2J5UA 1OCDA 5CJ0A 4C46A 3CU4A 2NPSB 5KJ7D 1ZZHA 2WTYA 2E76C 3ABVC 3AEAC 2K88A 1SQBE 2OTKE 3O6QB 3RK2D 3L75D 3HUSB 1A02F 2PCCB 4OGQC 3OA8A 3CXHI 4H0JA 3HE5B 5IY51 1L0LD 1BE3D 4AAMA 1DW1A 2AXTH 1I8OA 1NU1E 4OGQD 1LTJA 1CZQA 1SFCD 4AAOA 3P7KA 1BGYD 3ZOOA 4ZKPA 1NTKK 4AANA 4HJGH 1J1EB 1ZV8A 2WWWA 3K5BA 1W5CT 3W67A 3A0BE 5KKZC 3CC7P 1AOQA 2YKOA 5TISH 5M1BA 4UB6H 3CWBD 2M5AB 1HF9A 4I7ZC 5B5EH 3PXWA 3D6ZA 1RF1A 2OTJP 5CCHD 2ZXYA 1JTHB 2M3BA 3D6YA 1PP9J 1H33B 3H1HJ 1CIEA 5CBOA 1GW3A 1CRCA 3H32A 4PD4E 1CRHA 3CC2P 4N78E 2WPSA 1NJIQ 3AE5C 3S4RA 5CCGC 1GDVA 5CCGD 1R5LA 1OXZA 1KQGB 2C8SA 1CRJA 3OCDB 1NTMG 3HE4B 1KORA 3H1JG 1HVVA 2ZT9D 4YXDC 1D7MA 2QRXA 2KS1A 5APSA 1AV1A 1W5CE 1COTA 1NTMJ 2ZOOA 2KSEA 2V7QJ 5B66V 1PP9D 3NBSA 3H1HD 4M3LA 3L73E 4AALA 2YCCA 1FC2C 1OMIA 1YQ4C 1T2KC 1NNOA 4JCGA 1KZUB 2ORLA 1YNRA 2JR8A 3AEGC 3CCSP 1T2KD 2C9NY 3L71E 2KIKA 1JOCA 1BCCJ 1ZXGA 1HZUA 1ZW0A 5K5GB 3MIWA 1MKMA 1L4AA 3AEBC 1CTZA 3DP5A 2CPBA 3VNWA 2D2CC 3MHVA 2POHA 1NTMD 3TNUA 2D2CD 2BGVX 1FZFA 2CA4B 3L37A 3AEEC 2KZIA 2H7HA 2OYHC 2FFDB 1IJDB 3AE9C 4PV1C 2ZZS1 2WSCJ 3G9RA 1GL2B 5CICB 3HQ6A 4PV1D 3CCRP 1I55A 1K3HA 1IQCA 1LT9B 3B5NC 2K3RA 1BCCD 4PJ0H 1RY3A 4D6TE 1IZL0 3RK2B 2FYNC 1FOCA 1G2CB 2E76B 4Y99C 3PXTA 4WQBA 2H88C 3TDKA 1N7SA 1S5LV 4EYYQ 3A2AA 1SQVK 3IFMA 4H0LD 4OGQB 1PV3A 1H32A 1SFCB 3KDPB 1QX8A 1A02J 4BRYB 3TGUE 1S1CX 1QL2A 2YMKA 1IFIA 1M60A 3VP8A 4L1QA 1YTZT 1X0TA 2HPCA 3B71A 5H2FE 3L4MA 1LTSC 1OVUA 1U7MA 1RH5B 3C9IA 1GQ1A 1GU4A 3PHLA 3BASA 4GODA 3V4QA 1M56D 3JCUE 4Z1MH 3MGNA 3OA7A 2XNDH 1OW7A 4I7ZB 1CSWA 2WPQA 1CI6B 3RBXA 1KYOH 1WRGA 3SWKA 1SQBK 1URQA 4ASVA 3E1IA 2WSEJ 5KAFE 3T97A 1M6ZA 3GHGA 4WQAA 5GTIH 3RLMA 2B10B 1YYCA 1NU1K 2D0SA 4BWNA 2IDBA 1FI3A 1MZ4A 1P84H 1LTGC 2K9JB 3BCCE 3CMEP 3Q5SA 2B88A 2XZRA 3CC4P 1BDCA 3U1AA 4L75A 3AE2C 3VP9A 1HJ5A 1KB9E 1USEA 4U3FE 4W7ZA 1NTZE 3EFGA 2YIUC 1GU5A 3Q2YA 3SVWA 1WVEC 1QL1A 3C1LA 1YJNP 1L0NK 1VPCA 1VQ7P 2ITAA 2XU6A 2QSIA 3FWNA 1NTKG 1OFCX 2JWAA 1CTYA 2PRRA 155CA 4H13C 2PAJA 1YJWP 1Q82Q 2E75C 1NTKJ 5DJUB 2Y9YA 3P32A 1KB9D 1QKSA 2KNCB 4H13D 2K9JA 2ZFCA 3P8CD 2IPPA 4H44C 5DJQC 4GOFA 3L72G 2QJKB 2Q3IA 2ZONG 4AUWA 3CCVP 1DVHA 2YKPA 1HTLC 1PL5A 2C9LY 5AW9B 5L8RJ 1RF1C 1HJ4A 2D2CB 4HKZH 4GKGA 1OVRA 2FRCA 2GC7D 2OGUA 3H25A 2I8DA 1YICA 2PFXA 2C1DA 1RQUA 1AJYA 1KILC 3ZDMA 3CXHW 5AVRB 1OX3A 1NTKD 4UB8V 2KNCA 2R32A 3WFDC 4C7NA 1YIJP 4PV1B 5B6QA 2CXBA 1LNQA 1FI9A 3I5CA 3V2PA 1EDKA 3CMAP 5KLVE 3B5NB 1RE3C 2JO1A 2AIUA 2O3JA 2XTSB 1NGMB 1ZR2A 1BDDA 2IBZI 2ZXXA 4H0LB 1BSHA 3CXHH 4Y99B 1KYOI 2E43A 4AQRD 3RGUA 1FDIA 5GTHV 1G1IA 3KZIE 1NH4A 3M9HA 2OYHA 2LXBA 1JEKA 1SQQJ 2JQRA 2A06E 2WSFJ 3AEDC 3ZOWA 1ZLLA 2QJPC 1FDMA 1HCMA 5AVSB 1GMJA 2CE1A 1KC8Q 3I55P 1EZVG 1VQ9P 1FU1A 1MUUA 3B5NA 3TYYA 3G71P 1M57D 2C1VA 1C7MA 4CPGA 1C6RA 2Y9ZA 1CSVA 2B87A 1L4AD 1CORA 3L70G 2LIRA 1XTCC 3SFDC 4OWFA 2E74C 1C2NA 2IYOA 3O20A 3JBTB 3RK3D 3LW5J 5APYA 5APVA 3A5TA 3CCQP 1K04A 1SQQD 1SP4A 3CP5A 4L73A 1IFPA 2E42A 2CE0A 1IFNA 2FYUE 1SQPJ 5APXA 2ZAEB 2KOGA 1FS0E 1J3SA 2B11B 3G3ZA 1SQVG 4EIDA 3A0BH 2N3BA 1MV8A 2YIUB 1NKZB 1ZRTD 4HB1A 1R0QA 3PTZA 3CX5E 1B7VA 4GT1A 1N7SC 5C39A 1U75B 5TISV 1OWAA 3OA8B 4UB6V 2N9IA 5APTA 1IC2A 5AW0B 2BCCG 3VMXA 1N50A 3B8EB 5B5EV 1LTJB 2B9BA 3CCUP 1LFMA 2ZVOB 4H13B 1PFIA 3L75E 4LLHA 3S1KA 3KYQA 2E75B 2Z5HA 2R5BA 2BCCJ 1U74B 1L0LE 4V2KA 3WFBC 1BE3E 1GK6A 4PD4H 1HWTC 3NWVA 1JMBA 1AQ5A 1AOFA 3L74J 4IL6E 1BGYE 2BCNB 5DJQB 3CI9A 1SQPD 1AVYA 1M8OB 4K35A 5CIDB 1JY2P 1SQBG 1SVFA 3H6PA 1IO4A 1CXCA 1OW8A 1YTCA 2GB8B 2YNYA 3IAOA 3I56P 2Q3EA 1RF1B 2E76D 1S72P 3CWBE 1NU1G 2JP3A 1URQC 3M0DC 3JC22 3FXDA 3GHGC 3CX5I 5CIBB 3H32B 1SQXK 4UB8E 1URQD 1RF0A 1QVGO 4C7RA 2BCCD 4A7PA 3HD7A 1AA0A 1CO6A 2WPVB 4U7JA 1U57A 3O0RC 3L74D 2C0XA 2L5GB 1Q2NA 1L0NG 3SFEC 2JJLA 5CYTR 3Q5PA 4GEDB 3O5CA 4EIFA 2AEMA 1L0NJ 2KS1B 4YXWH 1GJQA 1K8AQ 1KX7A 3E1RA 5C0ZA 1CHIA 2KLVA 2Q9IA 2GA1A 3H1LG 2N1TA 3SJLA 1KILA 3IN6A 5AVXB 1LTTC 1X22A 2M8RA 2AI5A 1S5LX 1LT1A 3M0AA 3H1LJ 4MU8A 1PP9E 3NXSA 3H1HE 4Y28J 4I2LC 2BEZF 1YCCA 2YQBA 2QJPB 3GLMA 3CCJP 1CHJA 1M70A 2R44A 3PP5A 5EXQA 1XTGB 3OAKA 1RE3A 2B4ZA 2H8PD 1G1JA 1L4AB 1N73C 2WMMA 2P1JA 2OQQA 3L73G 2WITA 5BU8B 3H1JJ 4XYDB 3TNUB 1QYZA 4PJ0V 4HYTB 3RK3B 2HLOA 4MN4C 1E2RA 2R5DA 2C1UA 1L2PA 1ZMEC 1CIHA 1JCDA 1NTME 4FAVA 1GD2E 2AEJA 4PD4I 1VQ5P 1YEBA 1H1OA 5BVZA 3L71G 3V4WA 2E5YA 3WUVA 4H0KA 3KQGA 5E79E 3H1IG 4L3HA 1A8CA 5H2FH 1PGOA 3H1IJ 5TISE 2HV4A 2XKMA 1EXJA 3JCUH 2W8ZA 2OARA 1N7SB 1CYJA 1BCCE 2L4DA 4QAOA 3H1JD 2LXCB 2PACA 2W6BA 5AVWB 1MFTA 1H32B 4XXLA 1NO4A 1VQPP 3F5HA 1VL2A 1AQTA 1LMSA 5KAFH 3G4SP 2HFED 4AYCA 1NKNA 1N8RQ 2HPCB 3B4SA 1HJBA 1VF5C 4D6TG 2N18C 3ORVA 2AXCA 1JUNA 5C9MA 2P58A 3F89A 1FOSE 1DW3A 3B5ND 4WY4C 1TU3F 2Z5IA 1T8ZA 1IFDA 2KUBA 3V5BA 1H9YA 3H1ID 1GDTA 3N4XA 2DGEA 1DW0A 4IL6X 1LP1A 3A0HV 2L91A 3TGUG 1PPJG 5AVZB 1URQB 3T97B 2IFNA 2XNXA 3GHGB 5DJTB 2W27A 4R4MA 1KYOW 1J2JB 3UIAA 1C2RA 3O8ZA 1NYHA 4NPEA 1QLED 5CJ4A 2H89C 1J1DC 4PWAA 5DF5A 1H31A 3KHUA 4WB4A 3P8MC 1GU2A 1L0LK 2J58A 3H1KG 2BPBB 1VQMP 1JY2O 3DR0A 2V08A 1BSNA 5KKZB 1RAQA 5CBNA 2OYIA 1U7JA 1E5WA 3X39A 3H1KJ 3Q3DA 1H0TA 1WT6A 3CD6P 3GG2A 1EXIA 4B86A 1KQSO 2MTAC 1DIQC 1S6VB 1AYGA 1WEJF 2DVHA 1DH3A 3M0DA 2CA3B 351CA 2Z4EA 3PJSK 1PPJD 1IRWA 1LC1A 1HUCA 1M1JC 3PXSA 1VQOP 1GTWA 3USSA 2FY8A 4U3FG 1JY2N 4WBAA 3KPEA 3U59A 4O1WA 3CLQA 3P8CE 3H1KD 3M9BA 1Q86Q 3WUUA 2QIWA 1I8PA 1QL3A 5B66E 1YIQA 1SQXG 1QGKB 3ZCFA 2SPZA 2M0BA 3L4FA 1VDFA 2EXVA 2C1DB 1GKSA 1SQXJ 3ITKA 1RF0C 3Q1MA 1N90A 3EQ2A 2YKQA 1HBWA 3HQ7A 1N86A 3MK7C 2KLUA 3HD7C 3KXDA 3KZIH 4C7NB 2RKLA 2E75D 4EI2A 1LS9A 1LGHB 1OZHA 4IFDK 2CK3H 3TSIA 3HD7D 2IBZG 2QG4A 1FI7A 1NTKE 2Q6QA 3L36A 4K3AA 3PH0A 3WU2V 2YK3A 2Q1KA 4H44D 1Z56A 4GDOA 3L72J 2LKMA 1X79B 1KQLA 4NPFX 1N73A 1KB9I 1CSBA 5APQA 2ZYAA 1VQNP 4GIFA 1ZR4A 2N1TC 1Y47A 1YTZI 2FXMA 2N9BA 2VHDA 3AE6C 1DD4A 3CCMP 2OYHB 2N1TD 3G6EP 1KILD 3CX5W 1CRYA 2P10A 4IFFA 2BEQD 2HYNA 2QJYC 1UIIA 1M7LA 1K73Q 1X9VA 1YJ9P 1DEBA 4LGDE 1H8AA 5AVTB 5EFWB 2IX7C 1J1EC 2IBZD 3L72D 5APWA 1Q81Q 2FYNB 1HGZA 1S5LE 1KYOD 2ZYDA 1KQFB 2LR2A 1KB0A 2B87B 3A0HE 2ZBOA 3CX5H 2ZYGA 3D0WA 2A06G 3R4YA 1P84D 1NMIA 5AW4B 2JWDA 1NMLA 2KYVA 4Q5PA 3WMM0 1JDLA 4DY9A 2M3EA 1YI2P 2OZ1A 4RKUJ 3RK3E 1NIRA 2W6AA 1SQQE 5KAIH 1E29A 4DJGA 1WMKA 1EDIA 2O01H 4WQ9A 1NVOA 3SWSA 4IL6H 3DMIA 5CIHB 4WY4A 1BL9A 3D71A 4JYBA 2ZXEB 3AE1C 1RZ5A 2W83C 2YXQB 1DIIC 1I6EA 3O1YA 2E74D 1ZRTE 2ZVNB 3L70J 5AVYB 3AEFC 4N3YB 4Y5RA 1YBKA 3CYTI 1HJ3A 4JPZB 4UB8H 1PIXA 1EDLA 2AXTV 5KLIC 3JSVC 1DX7A 3GF3A 1JO5A 4RESB 1LTIC 3ZIYA 3WUIA 1MG3D 1EZVD 3D70A 4BXLA 3MP7B 3M91A 1ETPA 1SQPE 4ZNCA 1SQVJ 2FXOA 5AVVB 1N7SD 1QN2A 4O1QA 2HR3A 3L75G 2YXRB 3LIDA 3L70D 1M1KQ 1CNOA 4RSZA 1S4XA 1L0LG 3CCEP 1BE3G 3HTKA 1FZCC 1K9MQ 2H43A 1K3GA 3HD7B 1RE4C 1L9BC 2C2CA 1DEEG 1M1JA 2O01N 1CXAA 3SWYA 1BGYG 4O9BA 1RQVA 3V6IA 4H44B 3WU2E 4GYDA 3HRNA 2BCCE 1N2DC 1FOSF 2OYIC 4YE1A 2I1JA 2IZ1A 4QMAA 4W80A 1IRVA 4LJIA 5AW5B 1GL2C 3VOPA 3CXHD 1PGPA 1NTZK 2XDJA 3L74E 3CWBG 1A2SA 2MHMA 1GIWA 1SQVD 1SQBJ 2BASA 1FZBA 1LT9C 2K37A 1S9KD 3CWBJ 4J20A 2N1TB 3RK2C 1KILB 1NU1J 1VQ6P 4DT0A 1KV9A 1Y8AA 2MKVA 1OW6A 2B0ZB 1YQ3C 1VQ4P 2QJYB 2CPSA 2V7QH 1SFCC 1LWUA 2HODA 3ZOXA 1KFNA 2FBWC 1LTAC 3CPWO 4TT3H 1KMIZ 2P7JA 2JEEA 1OVVA 5E79H 3AE3C 3IF4A 1IO3A 4DCKA 1RAPA 2OYOA 4R4LA 1CYIA 2KZJA 1SQBD 3GW6A 5GTHE 3SWFA 3WFEC 2DW3A 1CIGA 2N9JA 3QWOC 3HQ8A 1FBMA 5H2FV 1JNMA 2NPSA 1N15A 5CCHC 3OW2O 1L0NE 1JB0J 1JCCA 1NU1D 1PP9G 4WQCA 4KT0J 3H1HG 3O6QA 4PW9B 2YO3A 3HUSA 5AVUB 5BU5A 4EOTA 3CCLP 2PGDA 3PH2B 1CTJA 3HE5A 3II6A 4L74A 2RMZA 1IK7A 1H9XA 5KAFV 1S3JA 3FGAD 3H1LE 4EICA 2FKWB 4ASWA 5KLVK 2KK7A 3Q5RA 4JQ0D 1FDOA 1T3UA 1L0ND 2HG5D 3VYIA 4WQ8A 3RN1A 2WSCH 3M06A 1UIXA 3QH9A 3WFCC 4FB1A 2E74B 4JYCA 2R3CA 2ZT9C 2M5AA 4WWIA 3L73J 2P67A 3E7KA 2UWJE 3AECC 4IFMA 1CYCA 4PD4D 1JTHA 3H1LD 3H1JE 4N78D 2AXTE 4P4QB 4N0KA 1JY3P 1H33A 5KLIB 5KTBA 2XV5A 1VQLP 451CA 3RN0A 1K05A 3V2RA 2OTLP 1YITP 3NBTA 1DIPA 2GIWA 3L71J 3RL0g 2G8YA 1SQQK 3VN0A 1YFCA 2C9XB 4EIEA 1BCCG 2YMYA 4UB6E 2B89A 1NHLA 2QJKC 2QM8A 5AW3B 4XFJA 4FA4A 1LP1B 5B5EE 1CSXA 4FANA 3OCDA 1IZNB 3HE4A 3L73D 1HGVA 3H1IE 4EIJA 2V4HA 1T6AA 1FZCB 3A9FA 2Y0CA 1Q7YQ 2KB7P 4N6JA 1CIFA 2PCBB 2VRSA 1H31B 4W7YA 5GTIV 4NFGB 3A7OA 3MD0A 4IOIH 2IZ0A 1DVVA 3RMZA 2WSEH 4FA5A 2ZJSE 2KSJA 2WSSH 3L71D 1CSUA 1PGJA 2FYUK 2OYIB 3VMYA 1OIPA 3FWLA 1VF5D 2FXPA 1H0TB 1KB9H 2Y0EA 4D6TJ 1T3JA 3M9QA 3WUTA 4WY4D 4TLFA 2NZ2A 1YHQP 1X8YA 4FA1A 1FHBA 1SQPK 1E8EA 1HROA 5B66H 3MUDC 2G3AA 5CIFB 3BATA 1JM0A 1ZP0C 4H0LC 3TGUJ 1FZCA 3VMAA 1C52A 4NPDA 1I54A 2A45H 1RE4A 3NFQA 3R2PA 2PP6A 1ZN5A 1KFMA 4DOJA 4WQ7A 1PZQA 3L4OA 4JF7A 3RL0C 1PPJE 2FFDA 3BVHA 3KZIV 1LC2A 1N7LA 1VYDA 2JDIH 3M97X 1HJ0A 3RL0D 3SSUA 4D6TD 1GL2A 3AE4C 4EDFA 1MG2D 1FJ0A 2W90A 1LT9A 5KJ7A 1CRGA 3H1KE 4RJTA 1G2CA 5CHXA 1KX2A 3VMZA 1EQ7A 3TGUD 2QA4P 3BCCG 2RH0A 5AW8B 5CMZA 2GUSA 4ZKUA 5DFSA 1SS1A 1SFCA 2WVRA 4LC1A 3BCCJ 4BRYA 4WVZA 1R8EA 2Q5UA 1NTZG 1C6OA 3FX0A 5TJHA 1CW5A 4KJMA 1Q90D 1CHHA 3WC8A 4GOEA 4U3FJ 1NTZJ 1LTBC 1N73B 1AVOA 4AX3A 1GZLA 1R5SA 1L9JC 2IFMA 4PJ0E 1NOHA 1FZAA 1S5LH 4L76A 2A45G 3NTNA 2KP8A 2ZT9B 3A0HH 3VYMA 1NAFA 5CCHA 2V07A 2Q7CA 1HRCA 1NAYA 1FE6A 1KV4A 3SLEA 1CI6A 2QE7H 2AEFA 3MTUE 4K3IA 3LIEA 1LWUC 1SQXE 3BCCD 1DW2A 1HZVA 1QEXA 1ZOYC 1LTJC 2GC4D 1W2BO 3EWKA 1KILE 3GF7A 1FJKA 1FJPA 2P2UA 4ZMDA 4U3FD 2I8FA 2WSFH 1NTZD 5CCGA 3BRVB 5KAIV 2IBZE 4IL6V 2NPSC 3L72E 1GK4A 1SQXD 1FAVA 3BRTB 1W2EA 1IFMA 1KYOE 4XA4A 2Y0DA 3S9OA 1JY3O 3ZBMA 2NPSD 1MZ9A 1KTMA 3HQ9A 3HUSC 1EC5A 2YO2A 5GTIE 2A45I 1NTMK 2BH5X 1FZGA 4I6MC 1CEDA 5KLVG 2OZ1B 4RO0A 1P84E 1VF5B 2N18B 5KLVJ 2C0WA 3LW5H 1M90Q 2K1AA 2RN0A 1W2LA 4WY4B 1LJ2A 1KD1Q 1RHZB 2WQYC 1CC5A 1CRIA 1CCRA 1A56A 1IFJA 3VRDA 1F1FA 3A0BV 2KI7B 1MFZA 2K9YA 4FA9A 3W68A 1EDJA 1QVFO 1KN7A 1JY3N 3PLNA 3TK1A 2KXPB 1OAEA 3MZWB 3EFFK 3V2QA 3PRJA 1J1DB 3TF5A 1SQQG 1KIBA 1YEAA 3CL3D 2O1JA 3IR9A 3AE8C 1C6SA 2J59M 1GW4A 3RL0B 3N7NA 3VTPC
chains in the Genus database with same CATH topology
3H1JD 5KLVD 2B0ZB 2PACA 2D0WA 2QJYB 1H32B 4XXLA 1EB7A 1F1CA 3ZOXA 3SVWA 1WVEC 1LMSA 2N3YA 3ZOYA 2JWAA 5CIGB 3C2CA 1CTYA 2N9YB 1IO3A 155CA 1RAPA 1CYIA 1HH7A 1C75A 2FWLA 1SQBD 2N18C 3ORVA 3GW6A 1KB9D 3WFEC 1CIGA 1QKSA 2A06D 2N9JA 2KNCB 5C9MA 3HQ8A 5H2FV 3SXTA 2JTIB 1N15A 1DW3A 1CCHA 1H9YA 1NU1D 3H1ID 4WQCA 2DGEA 5DJQC 4PW9B 1DW0A 1FCDC 2QJKB 3PH2B 1CTJA 3A0HV 2L91A 2RMZA 2ZONG 1DVHA 4WQDA 5CIEB 1H9XA 1N9CA 1KYOW 1C2RA 1RZ6A 5KAFV 1HJ4A 1I5TA 2FRCA 2GC7D 4EICA 5E79V 4PWAA 5DF5A 1H31A 1YICA 3KHUA 4WQEA 1GU2A 2C1DA 1L0ND 4WQ8A 2BPBB 3RN1A 3CXHW 1I6DA 1AKKA 3DR0A 4KMGA 2B12B 1NTKD 3WFCC 4FB1A 2V08A 3TYIA 5KKZB 2BH4X 1RAQA 4UB8V 3WFDC 3MK7B 5B6QA 3X39A 2CXBA 1FI9A 3GG2A 1CYCA 4PD4D 2BLFB 2MTAC 1DIQC 3H1LD 1S6VB 1QL4A 2FYUD 1AYGA 1WEJF 4P4QB 2DVHA 4N0KA 1H33A 2CA3B 351CA 2AIUA 5AURA 2O3JA 2LITA 2XTSB 5KLIB 1DT1A 451CA 3RN0A 4L3GA 3CX5D 1PPJD 3NBTA 1IRWA 2GIWA 1OCDA 3CU4A 1LC1A 3PXSA 1YFCA 5GTHV 1ZZHA 2C9XB 4EIEA 3L75D 2JQRA 2PCCB 3OA8A 4H0JA 4FA4A 5IY51 1L0LD 1CSXA 4O1WA 1BE3D 3H1KD 3ZOWA 4AAMA 4FANA 3OCDA 1DW1A 1HCMA 3L73D 1I8OA 2CE1A 1I8PA 1QL3A 1YIQA 4AAOA 1BGYD 3A9FA 3ZOOA 2Y0CA 3ZCFA 4AANA 1CIFA 2PCBB 1H31B 2EXVA 5GTIV 2C1VA 1C7MA 2C1DB 4NFGB 1GKSA 1W5CT 1C6RA 1DVVA 3RMZA 3ITKA 1CSVA 4FA5A 1CORA 1N90A 2LIRA 3L71D 1AOQA 1CSUA 3HQ7A 1C2NA 3MK7C 3CWBD 3FWLA 3O20A 2Y0EA 1LS9A 2QG4A 1FI7A 3PXWA 3JBTB 2ZXYA 1SQQD 3CP5A 3WU2V 2YK3A 4FA1A 1FHBA 1E8EA 1H33B 1HROA 1CIEA 5CIFB 1CRCA 2CE0A 1CRHA 3VMAA 1C52A 1I54A 1J3SA 2B11B 4EIDA 2N3BA 2YIUB 1ZRTD 4WQ7A 2VHDA 1R0QA 3L4OA 3PTZA 1GDVA 1B7VA 1U75B 5TISV 3KZIV 3CX5W 1LC2A 1CRYA 3OA8B 4UB6V 1VYDA 2N9IA 3M97X 2C8SA 1CRJA 3OCDB 1N50A 4D6TD 5B5EV 1LFMA 2KS1A 4EDFA 1MG2D 1FJ0A 1COTA 2ZOOA 1U74B 4V2KA 1CRGA 3WFBC 5B66V 3NWVA 1PP9D 3NBSA 2IBZD 3H1HD 4RJTA 3L72D 2FYNB 4AALA 1KX2A 1KYOD 1AOFA 3TGUD 1KB0A 2BCNB 5DJQB 1SQPD 2YCCA 2ZBOA 5CIDB 5DFSA 1NNOA 4JCGA 2ORLA 1CXCA 1YNRA 1YTCA 2GB8B 1C6OA 2Q3EA 5TJHA 1P84D 1NMIA 1NMLA 1CHHA 3WC8A 1HZUA 4Q5PA 1CTZA 1JDLA 3DP5A 4DY9A 5CIBB 2OZ1A 3VNWA 4AX3A 1NIRA 1L9JC 2BCCD 1E29A 1NTMD 4A7PA 4WQ9A 2BGVX 3SWSA 2CA4B 3DMIA 3VYMA 5CIHB 2V07A 1CO6A 1BL9A 1HRCA 1RZ5A 3O0RC 3L74D 3SLEA 1DIIC 1I6EA 3O1YA 2ZZS1 4K3IA 5CYTR 4GEDB 5CICB 3BCCD 3HQ6A 1DW2A 1HZVA 3O5CA 4EIFA 2GC4D 1I55A 1K3HA 1GJQA 4Y5RA 1IQCA 1KX7A 1BCCD 3CYTI 1HJ3A 5C0ZA 1CHIA 2AXTV 4U3FD 2I8FA 1IZL0 3SJLA 1NTZD 1FOCA 5KAIV 2AI5A 3PXTA 4WQBA 3TDKA 3ZIYA 1S5LV 3WUIA 1MG3D 4MU8A 4IL6V 1EZVD 1H32A 1SQXD 1YCCA 2YQBA 2QJPB 1CHJA 2Y0DA 3ZBMA 1M70A 1ETPA 3HQ9A 5EXQA 2B4ZA 1M60A 2BH5X 1QN2A 4O1QA 4L1QA 1CEDA 3L70D 1CNOA 4RSZA 2OZ1B 3L4MA 2N18B 1K3GA 4XYDB 1GQ1A 1QYZA 4PJ0V 1L9BC 2C2CA 3PHLA 1CXAA 2RN0A 1W2LA 1E2RA 1CSWA 2C1UA 4GYDA 1CC5A 1CIHA 1CRIA 1CCRA 4FAVA 1A56A 4YE1A 3VRDA 1F1FA 3A0BV 1IRVA 4LJIA 1YEBA 1H1OA 1M6ZA 4WQAA 4FA9A 3CXHD 4H0KA 3RLMA 2B10B 1A2SA 2MHMA 1GIWA 3PLNA 1SQVD 1OAEA 2D0SA 1FI3A 4L3HA 1MZ4A 3PRJA 1A8CA 3TF5A 4J20A 2K9JB 1KIBA 1YEAA 2HV4A 1C6SA 1HJ5A 1KV9A 1CYJA 2L4DA 4QAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J D;  5KLV D;  2B0Z B;  2PAC A;  2D0W A;  2QJY B;  1H32 B;  4XXL A;  1EB7 A;  1F1C A;  3ZOX A;  3SVW A;  1WVE C;  1LMS A;  2N3Y A;  3ZOY A;  2JWA A;  5CIG B;  3C2C A;  1CTY A;  2N9Y B;  1IO3 A;  155C A;  1RAP A;  1CYI A;  1HH7 A;  1C75 A;  2FWL A;  1SQB D;  2N18 C;  3ORV A;  3GW6 A;  1KB9 D;  3WFE C;  1CIG A;  1QKS A;  2A06 D;  2N9J A;  2KNC B;  5C9M A;  3HQ8 A;  5H2F V;  3SXT A;  2JTI B;  1N15 A;  1DW3 A;  1CCH A;  1H9Y A;  1NU1 D;  3H1I D;  4WQC A;  2DGE A;  5DJQ C;  4PW9 B;  1DW0 A;  1FCD C;  2QJK B;  3PH2 B;  1CTJ A;  3A0H V;  2L91 A;  2RMZ A;  2ZON G;  1DVH A;  4WQD A;  5CIE B;  1H9X A;  1N9C A;  1KYO W;  1C2R A;  1RZ6 A;  5KAF V;  1HJ4 A;  1I5T A;  2FRC A;  2GC7 D;  4EIC A;  5E79 V;  4PWA A;  5DF5 A;  1H31 A;  1YIC A;  3KHU A;  4WQE A;  1GU2 A;  2C1D A;  1L0N D;  4WQ8 A;  2BPB B;  3RN1 A;  3CXH W;  1I6D A;  1AKK A;  3DR0 A;  4KMG A;  2B12 B;  1NTK D;  3WFC C;  4FB1 A;  2V08 A;  3TYI A;  5KKZ B;  2BH4 X;  1RAQ A;  4UB8 V;  3WFD C;  3MK7 B;  5B6Q A;  3X39 A;  2CXB A;  1FI9 A;  3GG2 A;  1CYC A;  4PD4 D;  2BLF B;  2MTA C;  1DIQ C;  3H1L D;  1S6V B;  1QL4 A;  2FYU D;  1AYG A;  1WEJ F;  4P4Q B;  2DVH A;  4N0K A;  1H33 A;  2CA3 B;  351C A;  2AIU A;  5AUR A;  2O3J A;  2LIT A;  2XTS B;  5KLI B;  1DT1 A;  451C A;  3RN0 A;  4L3G A;  3CX5 D;  1PPJ D;  3NBT A;  1IRW A;  2GIW A;  1OCD A;  3CU4 A;  1LC1 A;  3PXS A;  1YFC A;  5GTH V;  1ZZH A;  2C9X B;  4EIE A;  3L75 D;  2JQR A;  2PCC B;  3OA8 A;  4H0J A;  4FA4 A;  5IY5 1;  1L0L D;  1CSX A;  4O1W A;  1BE3 D;  3H1K D;  3ZOW A;  4AAM A;  4FAN A;  3OCD A;  1DW1 A;  1HCM A;  3L73 D;  1I8O A;  2CE1 A;  1I8P A;  1QL3 A;  1YIQ A;  4AAO A;  1BGY D;  3A9F A;  3ZOO A;  2Y0C A;  3ZCF A;  4AAN A;  1CIF A;  2PCB B;  1H31 B;  2EXV A;  5GTI V;  2C1V A;  1C7M A;  2C1D B;  4NFG B;  1GKS A;  1W5C T;  1C6R A;  1DVV A;  3RMZ A;  3ITK A;  1CSV A;  4FA5 A;  1COR A;  1N90 A;  2LIR A;  3L71 D;  1AOQ A;  1CSU A;  3HQ7 A;  1C2N A;  3MK7 C;  3CWB D;  3FWL A;  3O20 A;  2Y0E A;  1LS9 A;  2QG4 A;  1FI7 A;  3PXW A;  3JBT B;  2ZXY A;  1SQQ D;  3CP5 A;  3WU2 V;  2YK3 A;  4FA1 A;  1FHB A;  1E8E A;  1H33 B;  1HRO A;  1CIE A;  5CIF B;  1CRC A;  2CE0 A;  1CRH A;  3VMA A;  1C52 A;  1I54 A;  1J3S A;  2B11 B;  4EID A;  2N3B A;  2YIU B;  1ZRT D;  4WQ7 A;  2VHD A;  1R0Q A;  3L4O A;  3PTZ A;  1GDV A;  1B7V A;  1U75 B;  5TIS V;  3KZI V;  3CX5 W;  1LC2 A;  1CRY A;  3OA8 B;  4UB6 V;  1VYD A;  2N9I A;  3M97 X;  2C8S A;  1CRJ A;  3OCD B;  1N50 A;  4D6T D;  5B5E V;  1LFM A;  2KS1 A;  4EDF A;  1MG2 D;  1FJ0 A;  1COT A;  2ZOO A;  1U74 B;  4V2K A;  1CRG A;  3WFB C;  5B66 V;  3NWV A;  1PP9 D;  3NBS A;  2IBZ D;  3H1H D;  4RJT A;  3L72 D;  2FYN B;  4AAL A;  1KX2 A;  1KYO D;  1AOF A;  3TGU D;  1KB0 A;  2BCN B;  5DJQ B;  1SQP D;  2YCC A;  2ZBO A;  5CID B;  5DFS A;  1NNO A;  4JCG A;  2ORL A;  1CXC A;  1YNR A;  1YTC A;  2GB8 B;  1C6O A;  2Q3E A;  5TJH A;  1P84 D;  1NMI A;  1NML A;  1CHH A;  3WC8 A;  1HZU A;  4Q5P A;  1CTZ A;  1JDL A;  3DP5 A;  4DY9 A;  5CIB B;  2OZ1 A;  3VNW A;  4AX3 A;  1NIR A;  1L9J C;  2BCC D;  1E29 A;  1NTM D;  4A7P A;  4WQ9 A;  2BGV X;  3SWS A;  2CA4 B;  3DMI A;  3VYM A;  5CIH B;  2V07 A;  1CO6 A;  1BL9 A;  1HRC A;  1RZ5 A;  3O0R C;  3L74 D;  3SLE A;  1DII C;  1I6E A;  3O1Y A;  2ZZS 1;  4K3I A;  5CYT R;  4GED B;  5CIC B;  3BCC D;  3HQ6 A;  1DW2 A;  1HZV A;  3O5C A;  4EIF A;  2GC4 D;  1I55 A;  1K3H A;  1GJQ A;  4Y5R A;  1IQC A;  1KX7 A;  1BCC D;  3CYT I;  1HJ3 A;  5C0Z A;  1CHI A;  2AXT V;  4U3F D;  2I8F A;  1IZL 0;  3SJL A;  1NTZ D;  1FOC A;  5KAI V;  2AI5 A;  3PXT A;  4WQB A;  3TDK A;  3ZIY A;  1S5L V;  3WUI A;  1MG3 D;  4MU8 A;  4IL6 V;  1EZV D;  1H32 A;  1SQX D;  1YCC A;  2YQB A;  2QJP B;  1CHJ A;  2Y0D A;  3ZBM A;  1M70 A;  1ETP A;  3HQ9 A;  5EXQ A;  2B4Z A;  1M60 A;  2BH5 X;  1QN2 A;  4O1Q A;  4L1Q A;  1CED A;  3L70 D;  1CNO A;  4RSZ A;  2OZ1 B;  3L4M A;  2N18 B;  1K3G A;  4XYD B;  1GQ1 A;  1QYZ A;  4PJ0 V;  1L9B C;  2C2C A;  3PHL A;  1CXA A;  2RN0 A;  1W2L A;  1E2R A;  1CSW A;  2C1U A;  4GYD A;  1CC5 A;  1CIH A;  1CRI A;  1CCR A;  4FAV A;  1A56 A;  4YE1 A;  3VRD A;  1F1F A;  3A0B V;  1IRV A;  4LJI A;  1YEB A;  1H1O A;  1M6Z A;  4WQA A;  4FA9 A;  3CXH D;  4H0K A;  3RLM A;  2B10 B;  1A2S A;  2MHM A;  1GIW A;  3PLN A;  1SQV D;  1OAE A;  2D0S A;  1FI3 A;  4L3H A;  1MZ4 A;  3PRJ A;  1A8C A;  3TF5 A;  4J20 A;  2K9J B;  1KIB A;  1YEA A;  2HV4 A;  1C6S A;  1HJ5 A;  1KV9 A;  1CYJ A;  2L4D A;  4QAO A; 
#chains in the Genus database with same CATH topology
 1FZE A;  5KLV D;  2WT7 B;  2D0W A;  1JMM A;  3WU2 H;  2QM7 A;  1H89 A;  1E79 H;  1P84 I;  1EB7 A;  1F1C A;  2N3Y A;  3ZOY A;  3OJA B;  2IYP A;  1EZV E;  1NWQ A;  3GMA A;  5CIG B;  3C2C A;  3MUD A;  3L35 A;  5AVQ B;  1L4A C;  2N9Y B;  1USD A;  1SLQ A;  1AFO A;  4XE5 B;  5AW7 B;  2O1K A;  1HH7 A;  3HTK B;  1C75 A;  2FWL A;  1HH0 A;  2WZ7 A;  2A06 D;  2GUV A;  2W6J H;  4OH8 B;  3SXT A;  4DZO A;  2JTI B;  3L70 E;  1M1J B;  2FYU G;  3RK3 C;  1CCH A;  1Y9B A;  2JKV A;  1VQK P;  1H88 A;  1DD3 A;  3C8V A;  1FCD C;  3AE7 C;  2FYU J;  2WT7 A;  5APU A;  2WPR A;  2NRG A;  1IK9 A;  3FXE A;  1SQP G;  4WQD A;  5CIE B;  4YTP C;  1N9C A;  4I1L A;  1RZ6 A;  1I5T A;  1PGQ A;  2QEX P;  5E79 V;  4HH2 A;  4WQE A;  3CXH E;  5GTH H;  1I6D A;  1AKK A;  1EZV I;  1SQV E;  2R3S A;  4KMG A;  2B12 B;  3L75 J;  5AW2 B;  3TYI A;  1VQ8 P;  2BH4 X;  1S9K E;  3MK7 B;  5AW1 B;  1L0L J;  1BE3 J;  4JBZ A;  3V2N A;  1LWU B;  4OVN F;  2HOD B;  2GM4 A;  3RBZ A;  2O01 J;  1S2E A;  2FFD C;  2BLF B;  3U1C A;  1BGY J;  1QL4 A;  2FYU D;  2MJZ A;  3L74 G;  2QVA A;  5AUR A;  3NMD A;  2E5T A;  5KAI E;  4KHX A;  2LIT A;  2FYZ A;  1DT1 A;  4YPC A;  5AW6 B;  4L3G A;  3CX5 D;  1GL2 D;  5KJ7 C;  3A3Y B;  2I1K A;  2J5U A;  1OCD A;  5CJ0 A;  4C46 A;  3CU4 A;  2NPS B;  5KJ7 D;  1ZZH A;  2WTY A;  2E76 C;  3ABV C;  3AEA C;  2K88 A;  1SQB E;  2OTK E;  3O6Q B;  3RK2 D;  3L75 D;  3HUS B;  1A02 F;  2PCC B;  4OGQ C;  3OA8 A;  3CXH I;  4H0J A;  3HE5 B;  5IY5 1;  1L0L D;  1BE3 D;  4AAM A;  1DW1 A;  2AXT H;  1I8O A;  1NU1 E;  4OGQ D;  1LTJ A;  1CZQ A;  1SFC D;  4AAO A;  3P7K A;  1BGY D;  3ZOO A;  4ZKP A;  1NTK K;  4AAN A;  4HJG H;  1J1E B;  1ZV8 A;  2WWW A;  3K5B A;  1W5C T;  3W67 A;  3A0B E;  5KKZ C;  3CC7 P;  1AOQ A;  2YKO A;  5TIS H;  5M1B A;  4UB6 H;  3CWB D;  2M5A B;  1HF9 A;  4I7Z C;  5B5E H;  3PXW A;  3D6Z A;  1RF1 A;  2OTJ P;  5CCH D;  2ZXY A;  1JTH B;  2M3B A;  3D6Y A;  1PP9 J;  1H33 B;  3H1H J;  1CIE A;  5CBO A;  1GW3 A;  1CRC A;  3H32 A;  4PD4 E;  1CRH A;  3CC2 P;  4N78 E;  2WPS A;  1NJI Q;  3AE5 C;  3S4R A;  5CCG C;  1GDV A;  5CCG D;  1R5L A;  1OXZ A;  1KQG B;  2C8S A;  1CRJ A;  3OCD B;  1NTM G;  3HE4 B;  1KOR A;  3H1J G;  1HVV A;  2ZT9 D;  4YXD C;  1D7M A;  2QRX A;  2KS1 A;  5APS A;  1AV1 A;  1W5C E;  1COT A;  1NTM J;  2ZOO A;  2KSE A;  2V7Q J;  5B66 V;  1PP9 D;  3NBS A;  3H1H D;  4M3L A;  3L73 E;  4AAL A;  2YCC A;  1FC2 C;  1OMI A;  1YQ4 C;  1T2K C;  1NNO A;  4JCG A;  1KZU B;  2ORL A;  1YNR A;  2JR8 A;  3AEG C;  3CCS P;  1T2K D;  2C9N Y;  3L71 E;  2KIK A;  1JOC A;  1BCC J;  1ZXG A;  1HZU A;  1ZW0 A;  5K5G B;  3MIW A;  1MKM A;  1L4A A;  3AEB C;  1CTZ A;  3DP5 A;  2CPB A;  3VNW A;  2D2C C;  3MHV A;  2POH A;  1NTM D;  3TNU A;  2D2C D;  2BGV X;  1FZF A;  2CA4 B;  3L37 A;  3AEE C;  2KZI A;  2H7H A;  2OYH C;  2FFD B;  1IJD B;  3AE9 C;  4PV1 C;  2ZZS 1;  2WSC J;  3G9R A;  1GL2 B;  5CIC B;  3HQ6 A;  4PV1 D;  3CCR P;  1I55 A;  1K3H A;  1IQC A;  1LT9 B;  3B5N C;  2K3R A;  1BCC D;  4PJ0 H;  1RY3 A;  4D6T E;  1IZL 0;  3RK2 B;  2FYN C;  1FOC A;  1G2C B;  2E76 B;  4Y99 C;  3PXT A;  4WQB A;  2H88 C;  3TDK A;  1N7S A;  1S5L V;  4EYY Q;  3A2A A;  1SQV K;  3IFM A;  4H0L D;  4OGQ B;  1PV3 A;  1H32 A;  1SFC B;  3KDP B;  1QX8 A;  1A02 J;  4BRY B;  3TGU E;  1S1C X;  1QL2 A;  2YMK A;  1IFI A;  1M60 A;  3VP8 A;  4L1Q A;  1YTZ T;  1X0T A;  2HPC A;  3B71 A;  5H2F E;  3L4M A;  1LTS C;  1OVU A;  1U7M A;  1RH5 B;  3C9I A;  1GQ1 A;  1GU4 A;  3PHL A;  3BAS A;  4GOD A;  3V4Q A;  1M56 D;  3JCU E;  4Z1M H;  3MGN A;  3OA7 A;  2XND H;  1OW7 A;  4I7Z B;  1CSW A;  2WPQ A;  1CI6 B;  3RBX A;  1KYO H;  1WRG A;  3SWK A;  1SQB K;  1URQ A;  4ASV A;  3E1I A;  2WSE J;  5KAF E;  3T97 A;  1M6Z A;  3GHG A;  4WQA A;  5GTI H;  3RLM A;  2B10 B;  1YYC A;  1NU1 K;  2D0S A;  4BWN A;  2IDB A;  1FI3 A;  1MZ4 A;  1P84 H;  1LTG C;  2K9J B;  3BCC E;  3CME P;  3Q5S A;  2B88 A;  2XZR A;  3CC4 P;  1BDC A;  3U1A A;  4L75 A;  3AE2 C;  3VP9 A;  1HJ5 A;  1KB9 E;  1USE A;  4U3F E;  4W7Z A;  1NTZ E;  3EFG A;  2YIU C;  1GU5 A;  3Q2Y A;  3SVW A;  1WVE C;  1QL1 A;  3C1L A;  1YJN P;  1L0N K;  1VPC A;  1VQ7 P;  2ITA A;  2XU6 A;  2QSI A;  3FWN A;  1NTK G;  1OFC X;  2JWA A;  1CTY A;  2PRR A;  155C A;  4H13 C;  2PAJ A;  1YJW P;  1Q82 Q;  2E75 C;  1NTK J;  5DJU B;  2Y9Y A;  3P32 A;  1KB9 D;  1QKS A;  2KNC B;  4H13 D;  2K9J A;  2ZFC A;  3P8C D;  2IPP A;  4H44 C;  5DJQ C;  4GOF A;  3L72 G;  2QJK B;  2Q3I A;  2ZON G;  4AUW A;  3CCV P;  1DVH A;  2YKP A;  1HTL C;  1PL5 A;  2C9L Y;  5AW9 B;  5L8R J;  1RF1 C;  1HJ4 A;  2D2C B;  4HKZ H;  4GKG A;  1OVR A;  2FRC A;  2GC7 D;  2OGU A;  3H25 A;  2I8D A;  1YIC A;  2PFX A;  2C1D A;  1RQU A;  1AJY A;  1KIL C;  3ZDM A;  3CXH W;  5AVR B;  1OX3 A;  1NTK D;  4UB8 V;  2KNC A;  2R32 A;  3WFD C;  4C7N A;  1YIJ P;  4PV1 B;  5B6Q A;  2CXB A;  1LNQ A;  1FI9 A;  3I5C A;  3V2P A;  1EDK A;  3CMA P;  5KLV E;  3B5N B;  1RE3 C;  2JO1 A;  2AIU A;  2O3J A;  2XTS B;  1NGM B;  1ZR2 A;  1BDD A;  2IBZ I;  2ZXX A;  4H0L B;  1BSH A;  3CXH H;  4Y99 B;  1KYO I;  2E43 A;  4AQR D;  3RGU A;  1FDI A;  5GTH V;  1G1I A;  3KZI E;  1NH4 A;  3M9H A;  2OYH A;  2LXB A;  1JEK A;  1SQQ J;  2JQR A;  2A06 E;  2WSF J;  3AED C;  3ZOW A;  1ZLL A;  2QJP C;  1FDM A;  1HCM A;  5AVS B;  1GMJ A;  2CE1 A;  1KC8 Q;  3I55 P;  1EZV G;  1VQ9 P;  1FU1 A;  1MUU A;  3B5N A;  3TYY A;  3G71 P;  1M57 D;  2C1V A;  1C7M A;  4CPG A;  1C6R A;  2Y9Z A;  1CSV A;  2B87 A;  1L4A D;  1COR A;  3L70 G;  2LIR A;  1XTC C;  3SFD C;  4OWF A;  2E74 C;  1C2N A;  2IYO A;  3O20 A;  3JBT B;  3RK3 D;  3LW5 J;  5APY A;  5APV A;  3A5T A;  3CCQ P;  1K04 A;  1SQQ D;  1SP4 A;  3CP5 A;  4L73 A;  1IFP A;  2E42 A;  2CE0 A;  1IFN A;  2FYU E;  1SQP J;  5APX A;  2ZAE B;  2KOG A;  1FS0 E;  1J3S A;  2B11 B;  3G3Z A;  1SQV G;  4EID A;  3A0B H;  2N3B A;  1MV8 A;  2YIU B;  1NKZ B;  1ZRT D;  4HB1 A;  1R0Q A;  3PTZ A;  3CX5 E;  1B7V A;  4GT1 A;  1N7S C;  5C39 A;  1U75 B;  5TIS V;  1OWA A;  3OA8 B;  4UB6 V;  2N9I A;  5APT A;  1IC2 A;  5AW0 B;  2BCC G;  3VMX A;  1N50 A;  3B8E B;  5B5E V;  1LTJ B;  2B9B A;  3CCU P;  1LFM A;  2ZVO B;  4H13 B;  1PFI A;  3L75 E;  4LLH A;  3S1K A;  3KYQ A;  2E75 B;  2Z5H A;  2R5B A;  2BCC J;  1U74 B;  1L0L E;  4V2K A;  3WFB C;  1BE3 E;  1GK6 A;  4PD4 H;  1HWT C;  3NWV A;  1JMB A;  1AQ5 A;  1AOF A;  3L74 J;  4IL6 E;  1BGY E;  2BCN B;  5DJQ B;  3CI9 A;  1SQP D;  1AVY A;  1M8O B;  4K35 A;  5CID B;  1JY2 P;  1SQB G;  1SVF A;  3H6P A;  1IO4 A;  1CXC A;  1OW8 A;  1YTC A;  2GB8 B;  2YNY A;  3IAO A;  3I56 P;  2Q3E A;  1RF1 B;  2E76 D;  1S72 P;  3CWB E;  1NU1 G;  2JP3 A;  1URQ C;  3M0D C;  3JC2 2;  3FXD A;  3GHG C;  3CX5 I;  5CIB B;  3H32 B;  1SQX K;  4UB8 E;  1URQ D;  1RF0 A;  1QVG O;  4C7R A;  2BCC D;  4A7P A;  3HD7 A;  1AA0 A;  1CO6 A;  2WPV B;  4U7J A;  1U57 A;  3O0R C;  3L74 D;  2C0X A;  2L5G B;  1Q2N A;  1L0N G;  3SFE C;  2JJL A;  5CYT R;  3Q5P A;  4GED B;  3O5C A;  4EIF A;  2AEM A;  1L0N J;  2KS1 B;  4YXW H;  1GJQ A;  1K8A Q;  1KX7 A;  3E1R A;  5C0Z A;  1CHI A;  2KLV A;  2Q9I A;  2GA1 A;  3H1L G;  2N1T A;  3SJL A;  1KIL A;  3IN6 A;  5AVX B;  1LTT C;  1X22 A;  2M8R A;  2AI5 A;  1S5L X;  1LT1 A;  3M0A A;  3H1L J;  4MU8 A;  1PP9 E;  3NXS A;  3H1H E;  4Y28 J;  4I2L C;  2BEZ F;  1YCC A;  2YQB A;  2QJP B;  3GLM A;  3CCJ P;  1CHJ A;  1M70 A;  2R44 A;  3PP5 A;  5EXQ A;  1XTG B;  3OAK A;  1RE3 A;  2B4Z A;  2H8P D;  1G1J A;  1L4A B;  1N73 C;  2WMM A;  2P1J A;  2OQQ A;  3L73 G;  2WIT A;  5BU8 B;  3H1J J;  4XYD B;  3TNU B;  1QYZ A;  4PJ0 V;  4HYT B;  3RK3 B;  2HLO A;  4MN4 C;  1E2R A;  2R5D A;  2C1U A;  1L2P A;  1ZME C;  1CIH A;  1JCD A;  1NTM E;  4FAV A;  1GD2 E;  2AEJ A;  4PD4 I;  1VQ5 P;  1YEB A;  1H1O A;  5BVZ A;  3L71 G;  3V4W A;  2E5Y A;  3WUV A;  4H0K A;  3KQG A;  5E79 E;  3H1I G;  4L3H A;  1A8C A;  5H2F H;  1PGO A;  3H1I J;  5TIS E;  2HV4 A;  2XKM A;  1EXJ A;  3JCU H;  2W8Z A;  2OAR A;  1N7S B;  1CYJ A;  1BCC E;  2L4D A;  4QAO A;  3H1J D;  2LXC B;  2PAC A;  2W6B A;  5AVW B;  1MFT A;  1H32 B;  4XXL A;  1NO4 A;  1VQP P;  3F5H A;  1VL2 A;  1AQT A;  1LMS A;  5KAF H;  3G4S P;  2HFE D;  4AYC A;  1NKN A;  1N8R Q;  2HPC B;  3B4S A;  1HJB A;  1VF5 C;  4D6T G;  2N18 C;  3ORV A;  2AXC A;  1JUN A;  5C9M A;  2P58 A;  3F89 A;  1FOS E;  1DW3 A;  3B5N D;  4WY4 C;  1TU3 F;  2Z5I A;  1T8Z A;  1IFD A;  2KUB A;  3V5B A;  1H9Y A;  3H1I D;  1GDT A;  3N4X A;  2DGE A;  1DW0 A;  4IL6 X;  1LP1 A;  3A0H V;  2L91 A;  3TGU G;  1PPJ G;  5AVZ B;  1URQ B;  3T97 B;  2IFN A;  2XNX A;  3GHG B;  5DJT B;  2W27 A;  4R4M A;  1KYO W;  1J2J B;  3UIA A;  1C2R A;  3O8Z A;  1NYH A;  4NPE A;  1QLE D;  5CJ4 A;  2H89 C;  1J1D C;  4PWA A;  5DF5 A;  1H31 A;  3KHU A;  4WB4 A;  3P8M C;  1GU2 A;  1L0L K;  2J58 A;  3H1K G;  2BPB B;  1VQM P;  1JY2 O;  3DR0 A;  2V08 A;  1BSN A;  5KKZ B;  1RAQ A;  5CBN A;  2OYI A;  1U7J A;  1E5W A;  3X39 A;  3H1K J;  3Q3D A;  1H0T A;  1WT6 A;  3CD6 P;  3GG2 A;  1EXI A;  4B86 A;  1KQS O;  2MTA C;  1DIQ C;  1S6V B;  1AYG A;  1WEJ F;  2DVH A;  1DH3 A;  3M0D A;  2CA3 B;  351C A;  2Z4E A;  3PJS K;  1PPJ D;  1IRW A;  1LC1 A;  1HUC A;  1M1J C;  3PXS A;  1VQO P;  1GTW A;  3USS A;  2FY8 A;  4U3F G;  1JY2 N;  4WBA A;  3KPE A;  3U59 A;  4O1W A;  3CLQ A;  3P8C E;  3H1K D;  3M9B A;  1Q86 Q;  3WUU A;  2QIW A;  1I8P A;  1QL3 A;  5B66 E;  1YIQ A;  1SQX G;  1QGK B;  3ZCF A;  2SPZ A;  2M0B A;  3L4F A;  1VDF A;  2EXV A;  2C1D B;  1GKS A;  1SQX J;  3ITK A;  1RF0 C;  3Q1M A;  1N90 A;  3EQ2 A;  2YKQ A;  1HBW A;  3HQ7 A;  1N86 A;  3MK7 C;  2KLU A;  3HD7 C;  3KXD A;  3KZI H;  4C7N B;  2RKL A;  2E75 D;  4EI2 A;  1LS9 A;  1LGH B;  1OZH A;  4IFD K;  2CK3 H;  3TSI A;  3HD7 D;  2IBZ G;  2QG4 A;  1FI7 A;  1NTK E;  2Q6Q A;  3L36 A;  4K3A A;  3PH0 A;  3WU2 V;  2YK3 A;  2Q1K A;  4H44 D;  1Z56 A;  4GDO A;  3L72 J;  2LKM A;  1X79 B;  1KQL A;  4NPF X;  1N73 A;  1KB9 I;  1CSB A;  5APQ A;  2ZYA A;  1VQN P;  4GIF A;  1ZR4 A;  2N1T C;  1Y47 A;  1YTZ I;  2FXM A;  2N9B A;  2VHD A;  3AE6 C;  1DD4 A;  3CCM P;  2OYH B;  2N1T D;  3G6E P;  1KIL D;  3CX5 W;  1CRY A;  2P10 A;  4IFF A;  2BEQ D;  2HYN A;  2QJY C;  1UII A;  1M7L A;  1K73 Q;  1X9V A;  1YJ9 P;  1DEB A;  4LGD E;  1H8A A;  5AVT B;  5EFW B;  2IX7 C;  1J1E C;  2IBZ D;  3L72 D;  5APW A;  1Q81 Q;  2FYN B;  1HGZ A;  1S5L E;  1KYO D;  2ZYD A;  1KQF B;  2LR2 A;  1KB0 A;  2B87 B;  3A0H E;  2ZBO A;  3CX5 H;  2ZYG A;  3D0W A;  2A06 G;  3R4Y A;  1P84 D;  1NMI A;  5AW4 B;  2JWD A;  1NML A;  2KYV A;  4Q5P A;  3WMM 0;  1JDL A;  4DY9 A;  2M3E A;  1YI2 P;  2OZ1 A;  4RKU J;  3RK3 E;  1NIR A;  2W6A A;  1SQQ E;  5KAI H;  1E29 A;  4DJG A;  1WMK A;  1EDI A;  2O01 H;  4WQ9 A;  1NVO A;  3SWS A;  4IL6 H;  3DMI A;  5CIH B;  4WY4 A;  1BL9 A;  3D71 A;  4JYB A;  2ZXE B;  3AE1 C;  1RZ5 A;  2W83 C;  2YXQ B;  1DII C;  1I6E A;  3O1Y A;  2E74 D;  1ZRT E;  2ZVN B;  3L70 J;  5AVY B;  3AEF C;  4N3Y B;  4Y5R A;  1YBK A;  3CYT I;  1HJ3 A;  4JPZ B;  4UB8 H;  1PIX A;  1EDL A;  2AXT V;  5KLI C;  3JSV C;  1DX7 A;  3GF3 A;  1JO5 A;  4RES B;  1LTI C;  3ZIY A;  3WUI A;  1MG3 D;  1EZV D;  3D70 A;  4BXL A;  3MP7 B;  3M91 A;  1ETP A;  1SQP E;  4ZNC A;  1SQV J;  2FXO A;  5AVV B;  1N7S D;  1QN2 A;  4O1Q A;  2HR3 A;  3L75 G;  2YXR B;  3LID A;  3L70 D;  1M1K Q;  1CNO A;  4RSZ A;  1S4X A;  1L0L G;  3CCE P;  1BE3 G;  3HTK A;  1FZC C;  1K9M Q;  2H43 A;  1K3G A;  3HD7 B;  1RE4 C;  1L9B C;  2C2C A;  1DEE G;  1M1J A;  2O01 N;  1CXA A;  3SWY A;  1BGY G;  4O9B A;  1RQV A;  3V6I A;  4H44 B;  3WU2 E;  4GYD A;  3HRN A;  2BCC E;  1N2D C;  1FOS F;  2OYI C;  4YE1 A;  2I1J A;  2IZ1 A;  4QMA A;  4W80 A;  1IRV A;  4LJI A;  5AW5 B;  1GL2 C;  3VOP A;  3CXH D;  1PGP A;  1NTZ K;  2XDJ A;  3L74 E;  3CWB G;  1A2S A;  2MHM A;  1GIW A;  1SQV D;  1SQB J;  2BAS A;  1FZB A;  1LT9 C;  2K37 A;  1S9K D;  3CWB J;  4J20 A;  2N1T B;  3RK2 C;  1KIL B;  1NU1 J;  1VQ6 P;  4DT0 A;  1KV9 A;  1Y8A A;  2MKV A;  1OW6 A;  2B0Z B;  1YQ3 C;  1VQ4 P;  2QJY B;  2CPS A;  2V7Q H;  1SFC C;  1LWU A;  2HOD A;  3ZOX A;  1KFN A;  2FBW C;  1LTA C;  3CPW O;  4TT3 H;  1KMI Z;  2P7J A;  2JEE A;  1OVV A;  5E79 H;  3AE3 C;  3IF4 A;  1IO3 A;  4DCK A;  1RAP A;  2OYO A;  4R4L A;  1CYI A;  2KZJ A;  1SQB D;  3GW6 A;  5GTH E;  3SWF A;  3WFE C;  2DW3 A;  1CIG A;  2N9J A;  3QWO C;  3HQ8 A;  1FBM A;  5H2F V;  1JNM A;  2NPS A;  1N15 A;  5CCH C;  3OW2 O;  1L0N E;  1JB0 J;  1JCC A;  1NU1 D;  1PP9 G;  4WQC A;  4KT0 J;  3H1H G;  3O6Q A;  4PW9 B;  2YO3 A;  3HUS A;  5AVU B;  5BU5 A;  4EOT A;  3CCL P;  2PGD A;  3PH2 B;  1CTJ A;  3HE5 A;  3II6 A;  4L74 A;  2RMZ A;  1IK7 A;  1H9X A;  5KAF V;  1S3J A;  3FGA D;  3H1L E;  4EIC A;  2FKW B;  4ASW A;  5KLV K;  2KK7 A;  3Q5R A;  4JQ0 D;  1FDO A;  1T3U A;  1L0N D;  2HG5 D;  3VYI A;  4WQ8 A;  3RN1 A;  2WSC H;  3M06 A;  1UIX A;  3QH9 A;  3WFC C;  4FB1 A;  2E74 B;  4JYC A;  2R3C A;  2ZT9 C;  2M5A A;  4WWI A;  3L73 J;  2P67 A;  3E7K A;  2UWJ E;  3AEC C;  4IFM A;  1CYC A;  4PD4 D;  1JTH A;  3H1L D;  3H1J E;  4N78 D;  2AXT E;  4P4Q B;  4N0K A;  1JY3 P;  1H33 A;  5KLI B;  5KTB A;  2XV5 A;  1VQL P;  451C A;  3RN0 A;  1K05 A;  3V2R A;  2OTL P;  1YIT P;  3NBT A;  1DIP A;  2GIW A;  3L71 J;  3RL0 g;  2G8Y A;  1SQQ K;  3VN0 A;  1YFC A;  2C9X B;  4EIE A;  1BCC G;  2YMY A;  4UB6 E;  2B89 A;  1NHL A;  2QJK C;  2QM8 A;  5AW3 B;  4XFJ A;  4FA4 A;  1LP1 B;  5B5E E;  1CSX A;  4FAN A;  3OCD A;  1IZN B;  3HE4 A;  3L73 D;  1HGV A;  3H1I E;  4EIJ A;  2V4H A;  1T6A A;  1FZC B;  3A9F A;  2Y0C A;  1Q7Y Q;  2KB7 P;  4N6J A;  1CIF A;  2PCB B;  2VRS A;  1H31 B;  4W7Y A;  5GTI V;  4NFG B;  3A7O A;  3MD0 A;  4IOI H;  2IZ0 A;  1DVV A;  3RMZ A;  2WSE H;  4FA5 A;  2ZJS E;  2KSJ A;  2WSS H;  3L71 D;  1CSU A;  1PGJ A;  2FYU K;  2OYI B;  3VMY A;  1OIP A;  3FWL A;  1VF5 D;  2FXP A;  1H0T B;  1KB9 H;  2Y0E A;  4D6T J;  1T3J A;  3M9Q A;  3WUT A;  4WY4 D;  4TLF A;  2NZ2 A;  1YHQ P;  1X8Y A;  4FA1 A;  1FHB A;  1SQP K;  1E8E A;  1HRO A;  5B66 H;  3MUD C;  2G3A A;  5CIF B;  3BAT A;  1JM0 A;  1ZP0 C;  4H0L C;  3TGU J;  1FZC A;  3VMA A;  1C52 A;  4NPD A;  1I54 A;  2A45 H;  1RE4 A;  3NFQ A;  3R2P A;  2PP6 A;  1ZN5 A;  1KFM A;  4DOJ A;  4WQ7 A;  1PZQ A;  3L4O A;  4JF7 A;  3RL0 C;  1PPJ E;  2FFD A;  3BVH A;  3KZI V;  1LC2 A;  1N7L A;  1VYD A;  2JDI H;  3M97 X;  1HJ0 A;  3RL0 D;  3SSU A;  4D6T D;  1GL2 A;  3AE4 C;  4EDF A;  1MG2 D;  1FJ0 A;  2W90 A;  1LT9 A;  5KJ7 A;  1CRG A;  3H1K E;  4RJT A;  1G2C A;  5CHX A;  1KX2 A;  3VMZ A;  1EQ7 A;  3TGU D;  2QA4 P;  3BCC G;  2RH0 A;  5AW8 B;  5CMZ A;  2GUS A;  4ZKU A;  5DFS A;  1SS1 A;  1SFC A;  2WVR A;  4LC1 A;  3BCC J;  4BRY A;  4WVZ A;  1R8E A;  2Q5U A;  1NTZ G;  1C6O A;  3FX0 A;  5TJH A;  1CW5 A;  4KJM A;  1Q90 D;  1CHH A;  3WC8 A;  4GOE A;  4U3F J;  1NTZ J;  1LTB C;  1N73 B;  1AVO A;  4AX3 A;  1GZL A;  1R5S A;  1L9J C;  2IFM A;  4PJ0 E;  1NOH A;  1FZA A;  1S5L H;  4L76 A;  2A45 G;  3NTN A;  2KP8 A;  2ZT9 B;  3A0H H;  3VYM A;  1NAF A;  5CCH A;  2V07 A;  2Q7C A;  1HRC A;  1NAY A;  1FE6 A;  1KV4 A;  3SLE A;  1CI6 A;  2QE7 H;  2AEF A;  3MTU E;  4K3I A;  3LIE A;  1LWU C;  1SQX E;  3BCC D;  1DW2 A;  1HZV A;  1QEX A;  1ZOY C;  1LTJ C;  2GC4 D;  1W2B O;  3EWK A;  1KIL E;  3GF7 A;  1FJK A;  1FJP A;  2P2U A;  4ZMD A;  4U3F D;  2I8F A;  2WSF H;  1NTZ D;  5CCG A;  3BRV B;  5KAI V;  2IBZ E;  4IL6 V;  2NPS C;  3L72 E;  1GK4 A;  1SQX D;  1FAV A;  3BRT B;  1W2E A;  1IFM A;  1KYO E;  4XA4 A;  2Y0D A;  3S9O A;  1JY3 O;  3ZBM A;  2NPS D;  1MZ9 A;  1KTM A;  3HQ9 A;  3HUS C;  1EC5 A;  2YO2 A;  5GTI E;  2A45 I;  1NTM K;  2BH5 X;  1FZG A;  4I6M C;  1CED A;  5KLV G;  2OZ1 B;  4RO0 A;  1P84 E;  1VF5 B;  2N18 B;  5KLV J;  2C0W A;  3LW5 H;  1M90 Q;  2K1A A;  2RN0 A;  1W2L A;  4WY4 B;  1LJ2 A;  1KD1 Q;  1RHZ B;  2WQY C;  1CC5 A;  1CRI A;  1CCR A;  1A56 A;  1IFJ A;  3VRD A;  1F1F A;  3A0B V;  2KI7 B;  1MFZ A;  2K9Y A;  4FA9 A;  3W68 A;  1EDJ A;  1QVF O;  1KN7 A;  1JY3 N;  3PLN A;  3TK1 A;  2KXP B;  1OAE A;  3MZW B;  3EFF K;  3V2Q A;  3PRJ A;  1J1D B;  3TF5 A;  1SQQ G;  1KIB A;  1YEA A;  3CL3 D;  2O1J A;  3IR9 A;  3AE8 C;  1C6S A;  2J59 M;  1GW4 A;  3RL0 B;  3N7N A;  3VTP C; 
#chains in the Genus database with same CATH homology
 3H1J D;  5KLV D;  2B0Z B;  2PAC A;  2D0W A;  2QJY B;  1H32 B;  4XXL A;  1EB7 A;  1F1C A;  3ZOX A;  3SVW A;  1WVE C;  1LMS A;  2N3Y A;  3ZOY A;  2JWA A;  5CIG B;  3C2C A;  1CTY A;  2N9Y B;  1IO3 A;  155C A;  1RAP A;  1CYI A;  1HH7 A;  1C75 A;  2FWL A;  1SQB D;  2N18 C;  3ORV A;  3GW6 A;  1KB9 D;  3WFE C;  1CIG A;  1QKS A;  2A06 D;  2N9J A;  2KNC B;  5C9M A;  3HQ8 A;  5H2F V;  3SXT A;  2JTI B;  1N15 A;  1DW3 A;  1CCH A;  1H9Y A;  1NU1 D;  3H1I D;  4WQC A;  2DGE A;  5DJQ C;  4PW9 B;  1DW0 A;  1FCD C;  2QJK B;  3PH2 B;  1CTJ A;  3A0H V;  2L91 A;  2RMZ A;  2ZON G;  1DVH A;  4WQD A;  5CIE B;  1H9X A;  1N9C A;  1KYO W;  1C2R A;  1RZ6 A;  5KAF V;  1HJ4 A;  1I5T A;  2FRC A;  2GC7 D;  4EIC A;  5E79 V;  4PWA A;  5DF5 A;  1H31 A;  1YIC A;  3KHU A;  4WQE A;  1GU2 A;  2C1D A;  1L0N D;  4WQ8 A;  2BPB B;  3RN1 A;  3CXH W;  1I6D A;  1AKK A;  3DR0 A;  4KMG A;  2B12 B;  1NTK D;  3WFC C;  4FB1 A;  2V08 A;  3TYI A;  5KKZ B;  2BH4 X;  1RAQ A;  4UB8 V;  3WFD C;  3MK7 B;  5B6Q A;  3X39 A;  2CXB A;  1FI9 A;  3GG2 A;  1CYC A;  4PD4 D;  2BLF B;  2MTA C;  1DIQ C;  3H1L D;  1S6V B;  1QL4 A;  2FYU D;  1AYG A;  1WEJ F;  4P4Q B;  2DVH A;  4N0K A;  1H33 A;  2CA3 B;  351C A;  2AIU A;  5AUR A;  2O3J A;  2LIT A;  2XTS B;  5KLI B;  1DT1 A;  451C A;  3RN0 A;  4L3G A;  3CX5 D;  1PPJ D;  3NBT A;  1IRW A;  2GIW A;  1OCD A;  3CU4 A;  1LC1 A;  3PXS A;  1YFC A;  5GTH V;  1ZZH A;  2C9X B;  4EIE A;  3L75 D;  2JQR A;  2PCC B;  3OA8 A;  4H0J A;  4FA4 A;  5IY5 1;  1L0L D;  1CSX A;  4O1W A;  1BE3 D;  3H1K D;  3ZOW A;  4AAM A;  4FAN A;  3OCD A;  1DW1 A;  1HCM A;  3L73 D;  1I8O A;  2CE1 A;  1I8P A;  1QL3 A;  1YIQ A;  4AAO A;  1BGY D;  3A9F A;  3ZOO A;  2Y0C A;  3ZCF A;  4AAN A;  1CIF A;  2PCB B;  1H31 B;  2EXV A;  5GTI V;  2C1V A;  1C7M A;  2C1D B;  4NFG B;  1GKS A;  1W5C T;  1C6R A;  1DVV A;  3RMZ A;  3ITK A;  1CSV A;  4FA5 A;  1COR A;  1N90 A;  2LIR A;  3L71 D;  1AOQ A;  1CSU A;  3HQ7 A;  1C2N A;  3MK7 C;  3CWB D;  3FWL A;  3O20 A;  2Y0E A;  1LS9 A;  2QG4 A;  1FI7 A;  3PXW A;  3JBT B;  2ZXY A;  1SQQ D;  3CP5 A;  3WU2 V;  2YK3 A;  4FA1 A;  1FHB A;  1E8E A;  1H33 B;  1HRO A;  1CIE A;  5CIF B;  1CRC A;  2CE0 A;  1CRH A;  3VMA A;  1C52 A;  1I54 A;  1J3S A;  2B11 B;  4EID A;  2N3B A;  2YIU B;  1ZRT D;  4WQ7 A;  2VHD A;  1R0Q A;  3L4O A;  3PTZ A;  1GDV A;  1B7V A;  1U75 B;  5TIS V;  3KZI V;  3CX5 W;  1LC2 A;  1CRY A;  3OA8 B;  4UB6 V;  1VYD A;  2N9I A;  3M97 X;  2C8S A;  1CRJ A;  3OCD B;  1N50 A;  4D6T D;  5B5E V;  1LFM A;  2KS1 A;  4EDF A;  1MG2 D;  1FJ0 A;  1COT A;  2ZOO A;  1U74 B;  4V2K A;  1CRG A;  3WFB C;  5B66 V;  3NWV A;  1PP9 D;  3NBS A;  2IBZ D;  3H1H D;  4RJT A;  3L72 D;  2FYN B;  4AAL A;  1KX2 A;  1KYO D;  1AOF A;  3TGU D;  1KB0 A;  2BCN B;  5DJQ B;  1SQP D;  2YCC A;  2ZBO A;  5CID B;  5DFS A;  1NNO A;  4JCG A;  2ORL A;  1CXC A;  1YNR A;  1YTC A;  2GB8 B;  1C6O A;  2Q3E A;  5TJH A;  1P84 D;  1NMI A;  1NML A;  1CHH A;  3WC8 A;  1HZU A;  4Q5P A;  1CTZ A;  1JDL A;  3DP5 A;  4DY9 A;  5CIB B;  2OZ1 A;  3VNW A;  4AX3 A;  1NIR A;  1L9J C;  2BCC D;  1E29 A;  1NTM D;  4A7P A;  4WQ9 A;  2BGV X;  3SWS A;  2CA4 B;  3DMI A;  3VYM A;  5CIH B;  2V07 A;  1CO6 A;  1BL9 A;  1HRC A;  1RZ5 A;  3O0R C;  3L74 D;  3SLE A;  1DII C;  1I6E A;  3O1Y A;  2ZZS 1;  4K3I A;  5CYT R;  4GED B;  5CIC B;  3BCC D;  3HQ6 A;  1DW2 A;  1HZV A;  3O5C A;  4EIF A;  2GC4 D;  1I55 A;  1K3H A;  1GJQ A;  4Y5R A;  1IQC A;  1KX7 A;  1BCC D;  3CYT I;  1HJ3 A;  5C0Z A;  1CHI A;  2AXT V;  4U3F D;  2I8F A;  1IZL 0;  3SJL A;  1NTZ D;  1FOC A;  5KAI V;  2AI5 A;  3PXT A;  4WQB A;  3TDK A;  3ZIY A;  1S5L V;  3WUI A;  1MG3 D;  4MU8 A;  4IL6 V;  1EZV D;  1H32 A;  1SQX D;  1YCC A;  2YQB A;  2QJP B;  1CHJ A;  2Y0D A;  3ZBM A;  1M70 A;  1ETP A;  3HQ9 A;  5EXQ A;  2B4Z A;  1M60 A;  2BH5 X;  1QN2 A;  4O1Q A;  4L1Q A;  1CED A;  3L70 D;  1CNO A;  4RSZ A;  2OZ1 B;  3L4M A;  2N18 B;  1K3G A;  4XYD B;  1GQ1 A;  1QYZ A;  4PJ0 V;  1L9B C;  2C2C A;  3PHL A;  1CXA A;  2RN0 A;  1W2L A;  1E2R A;  1CSW A;  2C1U A;  4GYD A;  1CC5 A;  1CIH A;  1CRI A;  1CCR A;  4FAV A;  1A56 A;  4YE1 A;  3VRD A;  1F1F A;  3A0B V;  1IRV A;  4LJI A;  1YEB A;  1H1O A;  1M6Z A;  4WQA A;  4FA9 A;  3CXH D;  4H0K A;  3RLM A;  2B10 B;  1A2S A;  2MHM A;  1GIW A;  3PLN A;  1SQV D;  1OAE A;  2D0S A;  1FI3 A;  4L3H A;  1MZ4 A;  3PRJ A;  1A8C A;  3TF5 A;  4J20 A;  2K9J B;  1KIB A;  1YEA A;  2HV4 A;  1C6S A;  1HJ5 A;  1KV9 A;  1CYJ A;  2L4D A;  4QAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...