3L74D

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l74D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l74D02
1VYDA 1C52A 1KYOD 4GYDA 1CIEA 2ZOOA 3ZCFA 3CX5W 1H32A 2GB8B 1CCHA 1H9YA 3DMIA 2ORLA 1U74B 1FJ0A 2DVHA 3PXSA 1RAQA 1DW2A 2B4ZA 1L9BC 1C75A 2N9YB 1CC5A 4YE1A 2I8FA 5AURA 3KZIV 2L4DA 3HQ9A 4H0JA 3HQ6A 1EB7A 1RZ5A 4WQBA 2BH5X 2LITA 3O0RC 3WFEC 1FI3A 2BPBB 1ETPA 1S5LV 1GIWA 3OA8A 1DT1A 2JQRA 4L1QA 1BGYD 2KS1A 4PWAA 4U3FD 4XYDB 3RLMA 1JDLA 3L72D 1HRCA 1CHIA 1E8EA 3DP5A 3PHLA 2ZZS1 3OCDB 3WUIA 4FA4A 3CXHW 1YFCA 1COTA 1OAEA 1KB0A 1CIFA 3ZBMA 4IL6V 1CHHA 3L74D 1AOFA 2RN0A 2YCCA 1W2LA 3L73D 2O3JA 4JCGA 1KV9A 1QYZA 1H33A 5CYTR 2GC7D 1CXAA 3O1YA 5DFSA 1WEJF 1BL9A 1YIQA 1CSUA 1ZRTD 3A9FA 2B0ZB 5CIBB 1NU1D 4UB8V 4EICA 1CIHA 2B10B 3CYTI 1I8PA 1CCRA 2Y0DA 3H1ID 2VHDA 1HROA 1N50A 1CRGA 2BGVX 1AKKA 2QJPB 2C8SA 1E29A 5B6QA 1CO6A 4Y5RA 1K3GA 2L91A 2PCCB 5KLIB 1NTKD 4QAOA 3KHUA 1CRJA 1C7MA 1OCDA 4A7PA 3WFDC 1IRVA 1YEAA 1GDVA 1IO3A 1YEBA 3SJLA 1IZL0 3X39A 2ZONG 4FAVA 4EDFA 4WQ7A 2BCCD 1FCDC 3RMZA 1KX2A 3JBTB 1CXCA 4UB6V 1SQPD 1KIBA 1NMIA 2EXVA 3H1HD 2DGEA 2OZ1B 3MK7B 1HZUA 2JTIB 5KLVD 1CYJA 2N18B 1PP9D 1DW3A 2QJYB 4H0KA 1DVHA 3HQ7A 5TJHA 2C1DB 1C6SA 1LC1A 1CTZA 4WQ8A 3ORVA 2CA4B 3VYMA 2C1UA 2D0SA 5CIGB 3ZIYA 3O5CA 1DIIC 1YTCA 3HQ8A 5B66V 2BLFB 4L3HA 2YK3A 1EZVD 5B5EV 5C9MA 2GIWA 1N9CA 1MG2D 5DF5A 4FA1A 1J3SA 1RZ6A 3OA8B 3PH2B 451CA 1NNOA 5GTIV 3VMAA 3BCCD 1DW1A 1HCMA 1IQCA 1CSVA 1M70A 3L4MA 4RJTA 1CRIA 4KMGA 2N3YA 1I54A 2C2CA 4O1QA 3NBSA 4DY9A 1U75B 1I8OA 1CRHA 2JWAA 1NIRA 1YICA 2QG4A 1H1OA 3MK7C 1GJQA 2FYNB 2N18C 4AAMA 2AI5A 3TF5A 2Y0CA 1W5CT 3L75D 3PTZA 3H1LD 2V07A 2CE1A 1I6DA 1N90A 1DIQC 3OCDA 5CIHB 5CIFB 1B7VA 3H1KD 1CHJA 4O1WA 1YNRA 5CIDB 1LFMA 2YIUB 4PW9B 2KNCB 1H33B 5DJQB 2CXBA 2PCBB 4WQ9A 1I55A 3SWSA 1DVVA 3L70D 5KAIV 1SQQD 2LIRA 2ZBOA 3DR0A 2BCNB 3WU2V 3ZOWA 2D0WA 1GU2A 1H9XA 5CIEB 2N3BA 5KKZB 2QJKB 1CRCA 1LS9A 2AIUA 3ZOYA 4MU8A 4P4QB 2HV4A 5IY51 1E2RA 1H31A 4WQAA 4L3GA 3WC8A 155CA 1CYIA 1I5TA 4V2KA 3GW6A 1P84D 1L9JC 2XTSB 3SXTA 4WQDA 3PLNA 3O20A 1S6VB 2Y0EA 1GQ1A 4EIEA 1C6OA 1M60A 4GEDB 3ZOOA 1QN2A 1CORA 1H32B 1AYGA 1C2RA 1FI9A 1CTYA 2YQBA 4Q5PA 3SLEA 2FYUD 2OZ1A 3WFBC 1QL3A 5DJQC 2C9XB 1IRWA 1HH7A 4FANA 1SQVD 2AXTV 5H2FV 1KX7A 2C1DA 1CTJA 3PRJA 3PXTA 3M97X 1C6RA 1KB9D 2BH4X 3CX5D 4J20A 1FHBA 4FB1A 2FWLA 3A0HV 4N0KA 1L0LD 4LJIA 2IBZD 1N15A 1QKSA 1HZVA 3GG2A 5EXQA 4FA9A 4RSZA 3NWVA 3VRDA 4NFGB 1HJ3A 1PPJD 2CE0A 1LMSA 2K9JB 2CA3B 3RN0A 1HJ5A 1QL4A 1A56A 1RAPA 4D6TD 1CEDA 1F1CA 3A0BV 5C0ZA 2N9IA 1WVEC 4EIDA 1MG3D 2PACA 3RN1A 4FA5A 1GKSA 1HJ4A 5GTHV 3TDKA 5TISV 1CSWA 4WQEA 4PJ0V 1A2SA 3NBTA 3SVWA 2RMZA 2V08A 1CSXA 3H1JD 1C2NA 1FOCA 3ZOXA 2MTAC 1FI7A 1CIGA 2ZXYA 4K3IA 1I6EA 1DW0A 1LC2A 3CXHD 4AANA 1L0ND 3ITKA 3C2CA 4AAOA 3TGUD 4XXLA 1CYCA 1NTMD 1SQXD 1K3HA 5KAFV 3WFCC 3TYIA 1YCCA 3PXWA 1F1FA 1CRYA 4PD4D 2MHMA 4AX3A 1R0QA 2B12B 4EIFA 1CNOA 351CA 1BCCD 1NMLA 2A06D 1H31B 3CWBD 2FRCA 1ZZHA 3CP5A 1NTZD 3L71D 3L4OA 5E79V 1MZ4A 2Q3EA 1A8CA 4AALA 1SQBD 5CICB 2GC4D 1M6ZA 4WQCA 2C1VA 1BE3D 2B11B 2N9JA 3CU4A 1AOQA 1KYOW 3VNWA 3FWLA
chains in the Genus database with same CATH superfamily
1SQXK 1SQVJ 5E79E 1SQPG 3H1HG 1KYOD 1HBWA 1DX7A 5AVUB 1DEEG 2GM4A 1CIEA 2R3CA 1NH4A 5KLVG 1KYOI 4LC1A 2OQQA 5BU8B 2E75B 1GMJA 2ORLA 3NFQA 1KILD 4WY4B 2J58A 1C75A 2ZT9D 4H13D 3RK2C 2I8FA 1P84H 3AEFC 3KZIV 2L4DA 3M9HA 3HTKA 2LITA 3P8CD 3WFEC 2Q6QA 1URQD 2K9YA 1LT9C 2WSCH 1GIWA 2QJPC 3VMYA 3CCQP 3LW5J 1Y8AA 5E79H 3HE5B 4K35A 1OZHA 2KS1A 2O01H 5AW4B 1ZP0C 2HYNA 4CPGA 4AUWA 3H1JJ 3G9RA 2JKVA 3L75E 4PWAA 4EYYQ 4U3FD 3RLMA 4AQRD 1R8EA 2A45I 4H0LC 3MIWA 1QL1A 1RQVA 2B89A 1KZUB 1LP1B 2KLUA 3B5ND 1N7SD 1OAEA 1VQ7P 1CIFA 3ZBMA 1SQXJ 1IFPA 4PJ0E 1VDFA 1W2BO 2BASA 1JY3N 2RN0A 5APVA 1L4AD 2JP3A 1SQQE 3D71A 5AVXB 1KV9A 1H33A 1X8YA 1EDJA 2GC7D 3HD7A 3AE4C 3CWBJ 3AEBC 1WEJF 3I5CA 4H44C 5AW0B 2N1TC 2KSJA 1DD4A 4UB8V 4EICA 2LR2A 5CMZA 2FFDA 2VHDA 1EXIA 1M1JB 4OGQD 3V4WA 5APUA 1E29A 2PCCB 2QVAA 4OWFA 4A7PA 2QEXP 1YEAA 1N2DC 5AVVB 1IO3A 3SJLA 1IZL0 4EDFA 1YJNP 3RMZA 2EXVA 1OW7A 2OZ1B 2WPVB 5DJTB 4ASVA 2N18B 1RE3C 1PP9D 2QJYB 1GW4A 1YTZI 1C6SA 2Q7CA 4Z1MH 2CA4B 3CX5E 2B87B 4LLHA 3G6EP 2D0SA 1N73B 3O5CA 1X9VA 3M0AA 2QJKC 4BXLA 5APQA 4U3FJ 1NNOA 1VQ4P 2E74C 4C7RA 1IQCA 1Q86Q 1CSVA 2IBZI 1J1DC 1EDIA 1CI6B 5B5EE 4O1QA 1IZNB 1I8OA 1VQOP 1GJQA 3AE2C 3L72E 3IAOA 3CX5H 2AI5A 3TF5A 3CC4P 2Y0CA 3RL0B 4U3FG 4EI2A 4DJGA 2V07A 1LTJA 2O1KA 1FZFA 5APYA 5AW5B 5CIHB 2MJZA 3H1KD 5AVSB 3CL3D 2OYHA 1RF1B 2KNCB 1VQNP 4WQ9A 2WPRA 5B5EH 3S4RA 1LTSC 1BCCE 4KHXA 3WU2V 1H9XA 2KSEA 3FX0A 3H1IE 4YPCA 2AIUA 4P4QB 1R5SA 1G2CA 1SQBE 5M1BA 2A06G 2FYNC 4XE5B 1NTZG 1BE3E 1I5TA 2HLOA 3VP9A 3P8MC 4BWNA 4ZKPA 1PP9J 1BSNA 3SXTA 2P2UA 2ITAA 1LTBC 2XV5A 1MV8A 4EIEA 1C6OA 1K73Q 1M56D 4PV1C 1H0TA 1AA0A 1FI9A 2FYZA 1CTYA 3AE3C 4HKZH 2BEZF 4GODA 4XFJA 2C9XB 1OXZA 1OW6A 2O01N 2WZ7A 1PP9G 1S4XA 1KX7A 2E74D 2C1DA 3V6IA 2WSEH 5CBNA 1AJYA 3W67A 2R32A 1HH0A 5L8RJ 3HTKB 2FWLA 5AVRB 2B88A 3VTPC 4GDOA 3H32A 5AW9B 1RY3A 2I1KA 2PFXA 4QMAA 1QKSA 1FOSF 2P58A 3TK1A 5AW7B 5B66E 1M1KQ 4NFGB 1HJ3A 4HB1A 1PPJD 4I1LA 3A0HE 3RN0A 1NAFA 1HJ5A 2PRRA 1L2PA 4D6TD 1F1CA 5C39A 1WVEC 2K37A 1MG3D 2GUVA 1SLQA 3H1KJ 3BRVB 3L72G 1CSWA 3H1LE 2G8YA 4PJ0V 1A2SA 1G1IA 3SVWA 4EOTA 3Q5PA 2RMZA 1CSXA 3H25A 1C2NA 3B4SA 2MTAC 2L5GB 2E75C 5H2FH 1K9MQ 3HD7B 3HRNA 1JY3P 3KDPB 3L73G 1L0ND 3RK3C 5BVZA 3L70E 3A0HH 4XXLA 1VQMP 1NTMD 1ZR4A 2OYIB 1K3HA 2FFDB 3WFCC 1FC2C 3S1KA 3E1RA 2MHMA 1NU1G 4L75A 4C7NB 3H1IG 1SS1A 1H31B 1JOCA 1XTGB 1YQ4C 2CPSA 3GHGC 1NTKG 1FZBA 1SQPE 3H1HE 1L0NK 1HWTC 3CCLP 2B11B 5KLVE 2M3EA 1NTMK 4LGDE 5CCGA 2BCCG 3FWLA 2AEMA 1KFNA 1GU5A 4GT1A 1HJBA 3AEGC 2ZOOA 3S9OA 3CX5W 1H32A 1GL2D 3KXDA 4TT3H 4I6MC 2YMKA 1NWQA 3MGNA 2CPBA 3CCSP 3M9BA 1RAQA 3FXDA 1L9BC 2IZ0A 5KJ7D 2N9YB 3M0DA 4ASWA 5AURA 4D6TJ 5AW1B 1KILC 2BH5X 4JYBA 1FI3A 1RF0A 1S5LV 3KPEA 2ZT9C 4H13C 1EZVI 1YTZT 1FZCA 1VQ5P 2NPSA 4JPZB 3AE5C 1EC5A 1NOHA 3AE7C 4Y99C 1LWUA 1USDA 2E75D 4N78D 2XKMA 1JDLA 1HRCA 1CHIA 3GMAA 4WY4D 4JYCA 1KB9H 3CCUP 1L0NJ 2QJYC 3H1JE 4FA4A 3A2AA 1LTTC 1KC8Q 1YFCA 1NTMJ 2FY8A 2W90A 2OYHB 1QGKB 1KTMA 1VF5C 3MUDC 2KB7P 3CMAP 2YCCA 3K5BA 2J5UA 1N7SC 1JB0J 1A02J 3T97B 1H88A 4GOEA 2IPPA 4IL6E 2QSIA 3O1YA 3L70G 1ZRTD 3HUSC 4PD4E 5CIBB 1G2CB 2GUSA 1L4AC 1CIHA 3CYTI 3RBZA 1MFTA 1HROA 2E42A 1JNMA 3BRTB 2XZRA 2BGVX 1P84E 1AKKA 2C8SA 2KXPB 1SFCC 1CO6A 3AE1C 1K3GA 2L91A 3BASA 5KLIB 3MZWB 3KHUA 1C7MA 3WFDC 4GOFA 2WPQA 1IRVA 1GDVA 3U1CA 2R3SA 1H0TB 4OGQC 2FKWB 1SP4A 3L35A 4B86A 4WQ7A 2FXMA 1KX2A 4UB6V 2DGEA 1HZUA 2W83C 4IL6H 2H8PD 4H0KA 1DVHA 1OW8A 4PD4H 4L73A 1YHQP 1T3UA 3GLMA 2C1DB 3OA7A 1CTZA 4JBZA 2D2CB 3ORVA 1RQUA 2M5AB 1YITP 1SQVG 3VYMA 2IYOA 2HG5D 2ZXXA 3H32B 3ZIYA 1FOSE 2WTYA 1YTCA 3HQ8A 5B66V 1OWAA 4L3HA 2YK3A 2Z4EA 1YJWP 1N9CA 4FA1A 1X22A 3G4SP 3OA8B 1FDOA 3BCCD 1DW1A 1HCMA 1KYOH 1M70A 4RJTA 3I56P 2K88A 2C9NY 4ZKUA 2N3YA 1I54A 1IO4A 1J1EC 1QLED 2RH0A 1YICA 2N1TA 5AW8B 4U3FE 1VF5D 1H1OA 3MK7C 5GTIE 2CK3H 2LXBA 4MN4C 2Y9ZA 1GK4A 1W5CT 3L75D 2JDIH 3NTNA 1JCDA 2ZYDA 2YKOA 3OCDA 3H1JG 3CXHE 3KQGA 1B7VA 2LXCB 3V4QA 4DZOA 2GA1A 5CIDB 1JY3O 1S1CX 4PW9B 1M8OB 5DJQB 1CZQA 1YQ3C 1SFCD 1RE3A 1SQQD 1SQXG 2OYIA 2A45H 2ZBOA 3DR0A 2ZAEB 2A06E 3AEDC 2J59M 2N3BA 1GU4A 5KKZB 5GTIH 1NTZE 3R4YA 1CRCA 2NZ2A 1GD2E 2M3BA 3RL0D 1YBKA 2IZ1A 4C7NA 3PP5A 1E2RA 5KAIE 1VQPP 2QRXA 1H31A 3CWBG 2C9LY 1CYIA 3GW6A 1IFJA 1A02F 3OW2O 2K1AA 3CXHH 3L4FA 4WQDA 3PLNA 2Y0EA 1CW5A 1PZQA 2P7JA 2E76B 2WPSA 2P1JA 3QWOC 2JEEA 1CORA 2FBWC 1NYHA 1SQQK 1H32B 3VYIA 3LIDA 1PP9E 1E79H 3AE6C 2FYUD 2YIUC 1IC2A 3H6PA 3USSA 2IDBA 3SFDC 1CTJA 2IFMA 3BCCJ 3PRJA 3M97X 1C6RA 5KAIH 2BH4X 3CX5D 4J20A 2WT7B 1L0LD 3IF4A 2SPZA 3CX5I 2H89C 2IBZD 5CHXA 3B5NB 1FZCB 4JQ0D 3EWKA 2AXTE 3GG2A 3E1IA 2NPSB 1NKNA 1M90Q 3VRDA 3V2RA 2FYUK 1LWUB 2CE0A 5CJ4A 2CA3B 3L75J 1QL4A 1A56A 4O9BA 1RAPA 3BCCG 3A0BV 1QL2A 2POHA 4N3YB 2YMYA 2PACA 2A45G 2Q1KA 2QM8A 1JMBA 1GKSA 1HJ4A 5GTHV 2E43A 2OTLP 1GDTA 1L0LK 1ZXGA 3GF7A 2H7HA 1DH3A 3NBTA 5BU5A 1X79B 5CCHA 1VQ9P 3H1KE 3ZOXA 3L73E 1PFIA 1SQQJ 3F89A 1CIGA 2AXTH 4K3IA 5TISE 1DW0A 1J2JB 1YI2P 2OYOA 1R5LA 2Q9IA 3ABVC 4AANA 3Q5RA 3ITKA 2V7QJ 3TGUD 1YIJP 1NU1E 1GK6A 1IFDA 3T97A 3TYIA 1YCCA 3PXWA 1F1FA 3CC2P 2WSFH 2AEJA 4AX3A 2KYVA 1PL5A 3B71A 351CA 3RK2B 3RBXA 1AQ5A 1BCCD 1NMLA 1NTKE 2FRCA 3L71D 5KAFE 5E79V 3CLQA 2Q3EA 1N86A 2BCCE 1SQBD 3CD6P 1S72P 5AVWB 2FYUJ 1FJPA 3TSIA 3WUVA 3HD7D 3W68A 1LTJC 1ZMEC 3D6YA 1BE3D 2N9JA 2RKLA 5TISH 1KYOW 2WSSH 4M3LA 1RE4A 3HE4A 1PGQA 4DT0A 1UIIA 2BEQD 4H0LB 3CCEP 3JCUE 3Q3DA 3M06A 3ZCFA 3O6QA 1AFOA 1L0LJ 1K8AQ 2GB8B 3C9IA 2Z5HA 3I55P 3Q1MA 1CSBA 1H9YA 2YO2A 3DMIA 2QE7H 3BVHA 1U74B 1FJ0A 2M5AA 1OX3A 3ZDMA 2DVHA 2OARA 2R44A 3PXSA 4W80A 1SQBK 1DW2A 2B4ZA 5KAFH 4I7ZC 1JEKA 3CCRP 1NJIQ 1GL2C 1HGVA 2W27A 5H2FE 1FDMA 4H0JA 1WT6A 4WBAA 1EB7A 1RZ5A 4WQBA 3O0RC 2BPBB 3D70A 1ETPA 3EFGA 5KJ7C 3OA8A 1PPJE 4H44B 1Q2NA 2B9BA 2KI7B 5AW6B 1N7LA 2ZVNB 1DT1A 2N1TB 2YKQA 5KLIC 3VOPA 4L1QA 4D6TE 1BGYD 3KZIE 3JCUH 3P32A 1ZLLA 4TLFA 2K9JA 3P7KA 1S9KE 3DP5A 5DJUB 3OCDB 2G3AA 3CXHW 3TGUJ 1COTA 3GHGA 2D2CC 2YNYA 3L74D 1AOFA 3H1KG 4WY4C 2IYPA 2FXOA 2ZXEB 1T2KD 4JCGA 4ZNCA 1BCCJ 2E5YA 3OJAB 5CYTR 1FE6A 3KZIH 1FJKA 3L71J 1KN7A 1BL9A 4R4MA 1CSUA 3A9FA 3SWYA 2B0ZB 3TGUG 1HF9A 1SQBJ 2WSEJ 5APXA 3G71P 1BE3J 2KIKA 5CCHD 1E5WA 3PJSK 4W7ZA 1VL2A 2ZFCA 2QA4P 1OCDA 2E74B 4UB8E 1KILA 1YEBA 3X39A 3FXEA 2ZONG 1LJ2A 1JTHA 1FZGA 1ZOYC 1SQPD 1NMIA 3H1HD 1GTWA 5KLVD 1CYJA 1FS0E 1SQVE 1U7MA 3AEEC 1URQA 5TJHA 1KB9E 3L37A 2C1UA 1YJ9P 3FGAD 4HJGH 1DIIC 1AVOA 1M1JC 2WT7A 1BGYJ 5B5EV 1EZVD 1M7LA 4UB8H 2GIWA 4ZMDA 2QIWA 1SQPK 2FXPA 2HR3A 3B5NA 1T6AA 1RZ6A 3N7NA 3PH2B 2WQYC 1N7SA 4RKUJ 5KLVK 1Q82Q 2KP8A 1JMMA 3IR9A 3L4MA 1PPJG 1CRIA 3MP7B 3V2QA 5CCGC 2C2CA 3NBSA 3HUSA 1U75B 4D6TG 1CRHA 4N78E 2D2CD 1L4AA 3C1LA 2FYNB 3L74J 2N18C 3RK3E 2IFNA 1KQGB 3PTZA 4KT0J 3SWKA 3G3ZA 1EQ7A 3R2PA 1DIQC 4PV1B 3CPWO 5CIFB 1N73C 3M0DC 2P67A 5AVYB 1YNRA 2JO1A 1KQLA 1LFMA 1SQXE 3PH0A 2PCBB 1L0NG 4C46A 3SWSA 1DVVA 1OIPA 1NTMG 1OFCX 3IN6A 3LW5H 2LIRA 1M57D 1FZCC 1DEBA 2NPSC 1JO5A 2BCNB 3ZOWA 3FWNA 2D0WA 1GU2A 1IK7A 2ZYGA 1MKMA 3CWBE 2V4HA 2K3RA 2PAJA 1JY2N 1LS9A 3ZOYA 1VQKP 1USEA 3TNUA 1SQPJ 3H1HJ 4L76A 4WQAA 4PD4I 3WC8A 155CA 1H8AA 1PV3A 3UIAA 4V2KA 5KLVJ 1LT9A 1P84D 3RL0C 1L9JC 2XTSB 3HE4B 1S6VB 1KYOE 1P84I 2XNXA 1PGJA 3EQ2A 1OVUA 1Y47A 4HH2A 3ZOOA 4DOJA 3O6QB 1Q7YQ 1AYGA 2C0WA 4Q5PA 3SLEA 1RF1C 2DW3A 3WFBC 1KILE 1D7MA 1IRWA 2WMMA 5APWA 2M0BA 5H2FV 2I1JA 1KV4A 3PXTA 1Q81Q 1FDIA 5AW2B 1FHBA 1HGZA 5CCGD 4IFDK 3P8CE 3A0HV 2C0XA 4N0KA 3WU2H 4LJIA 3A5TA 1N15A 3RK3B 2E76D 2LKMA 5EXQA 3BCCE 1EZVG 4L74A 3NWVA 4IFMA 1LMSA 2K9JB 4RO0A 1Q90D 1CEDA 4R4LA 1ZV8A 4W7YA 3CMEP 5C0ZA 2N9IA 4WB4A 4EIDA 1KMIZ 4FA5A 3GHGB 4IOIH 2OGUA 3Q2YA 3V2PA 1HVVA 3B8EB 1LNQA 3Q5SA 2V08A 3AE9C 1W2EA 3AECC 1FOCA 2NPSD 2E5TA 2YXRB 2IX7C 1IFNA 3CXHD 3C2CA 4AAOA 3CXHI 1K04A 1VPCA 1EDLA 2N9BA 5AVTB 2AXCA 1BDDA 2B12B 4EIFA 4JF7A 4YXDC 1IJDB 3A7OA 2HFED 1QVGO 2A06D 2UWJE 3CP5A 1ZZHA 4HYTB 1NTZD 1KILB 2WSCJ 4GIFA 1IK9A 1MZ4A 1BDCA 1A8CA 1JTHB 5CICB 1U57A 2ZT9B 4H13B 2O01J 4OH8B 1M6ZA 4WQCA 5APTA 3CU4A 5EFWB 2P10A 1TU3F 4PJ0H 4Y99B 1VYDA 1URQB 2WWWA 1C52A 2KUBA 3AEAC 4GYDA 4GKGA 2FYUE 3HD7C 3KYQA 1CCHA 2R5DA 2O1JA 3RK2D 1HTLC 2V7QH 2OYIC 1NTZK 2MKVA 3AE8C 2FFDC 1LTAC 1VF5B 1FU1A 1NVOA 1L0LE 4OVNF 1CC5A 2IBZE 1QEXA 4YE1A 1HUCA 1N7SB 1ZR2A 3HQ9A 3NXSA 2XDJA 1LGHB 1VQLP 3HQ6A 2XNDH 3CCJP 3VN0A 3HUSB 3VMZA 2OTJP 1L4AB 2JQRA 4H0LD 2NRGA 1PIXA 4EIJA 5AW3B 1KD1Q 1S5LE 1SFCB 4XYDB 3L72D 2HPCB 1E8EA 3PHLA 4BRYA 2ZZS1 3CI9A 3WUIA 4OGQB 3L75G 1G1JA 3CCVP 1X0TA 1EXJA 1U7JA 1KB0A 4IFFA 4IL6V 1CHHA 4K3AA 4DCKA 4H44D 4N6JA 2N1TD 1W2LA 3L73D 1IFIA 1WRGA 2O3JA 5APSA 3TGUE 4YTPC 1YYCA 5KTBA 2R5BA 4IL6X 1QYZA 2HODB 1NTZJ 1CXAA 3WUUA 5DFSA 1NO4A 1YIQA 2H88C 1SQQG 3CCMP 1NU1D 3TNUB 1T2KC 1S5LH 3D0WA 2B10B 3MHVA 1I8PA 1CCRA 1OVVA 2Y0DA 3H1ID 4RESB 3LIEA 1N50A 1CRGA 4YXWH 1JY2P 1LT9B 3L71E 2I8DA 2QJPB 1GL2A 5B6QA 4Y5RA 1FZAA 1NTKD 4QAOA 3O8ZA 1CRJA 4WVZA 2KZIA 1Y9BA 1JM0A 4FAVA 5CCHC 4WWIA 2KOGA 5KJ7A 2BCCD 1J1EB 1FCDC 3JBTB 1CXCA 1KIBA 1PGOA 3NMDA 2W6AA 2OYHC 3MK7B 2KZJA 3VMXA 2JTIB 1NU1K 4XA4A 1DW3A 3HQ7A 4NPEA 1HJ0A 2FYUG 3RL0g 3GF3A 1LC1A 3IFMA 4WQ8A 4UB6E 1MUUA 1W5CE 1EDKA 1LTGC 1UIXA 5AVZB 1NTKK 5CIGB 2BLFB 1NHLA 1L0LG 1IFMA 5C9MA 1MG2D 2IBZG 4WY4A 5DF5A 5K5GB 1J3SA 3MTUE 451CA 5GTIV 3VMAA 3L72J 3WUTA 1BGYE 2KS1B 2WSFJ 2ZVOB 1JCCA 4I2LC 4KMGA 1RE4C 4KJMA 4DY9A 2JWAA 1NIRA 2QG4A 4NPDA 3HE5A 4UB6H 2WITA 4AAMA 1FAVA 3L73J 1QVFO 1S9KD 3H1LD 1MFZA 2CE1A 1I6DA 1KORA 1N90A 3L74E 1Z56A 1LP1A 1L0NE 1LTIC 2ZJSE 1CHJA 4O1WA 5CJ0A 1NU1J 1NTME 3JC22 2JWDA 2YIUB 3A3YB 3H1IJ 1H33B 1S3JA 2CXBA 1I55A 3M9QA 5B66H 1GZLA 3U1AA 3L70D 3E7KA 5KAIV 3F5HA 1NTKJ 2H43A 5CIEB 2M8RA 2QJKB 2KLVA 2QM7A 4MU8A 1DD3A 2XU6A 1BCCG 2BCCJ 2HV4A 5IY51 1ZN5A 2YO3A 1K05A 1N8RQ 3WMM0 4L3GA 1S2EA 1T3JA 3II6A 3L71G 1J1DB 4PV1D 1M1JA 2PGDA 1SQBG 3O20A 1GQ1A 1BE3G 1H89A 1AQTA 1M60A 4GEDB 3SSUA 1QN2A 3JSVC 3D6ZA 1C2RA 1XTCC 2YKPA 2YQBA 3MD0A 3QH9A 2Q3IA 2OZ1A 1QL3A 5DJQC 1NAYA 2Q5UA 1VQ8P 1HH7A 4FANA 1MZ9A 1SQVD 2AXTV 2KK7A 3TYYA 3OAKA 1PGPA 2AEFA 4AYCA 1KFMA 3C8VA 3MUDA 1KB9D 5KKZC 3V2NA 1NGMB 2B87A 4FB1A 2YXQB 1EZVE 2Z5IA 1KB9I 1N73A 1HZVA 1AVYA 4FA9A 4RSZA 2WVRA 1ZW0A 1FBMA 2ZYAA 1OVRA 2E76C 1BGYG 3H1LJ 3N4XA 1LT1A 4BRYB 1KQFB 1SQVK 1CI6A 3RN1A 3V5BA 4U7JA 1JUNA 3BATA 1S5LX 1URQC 1SFCA 3M91A 3TDKA 2HPCA 5TISV 3CC7P 1FZEA 2JR8A 4WQEA 3RGUA 3SWFA 1BSHA 2Y9YA 1LTJB 3A0BE 1GW3A 4Y28J 1QX8A 3H1JD 2W6BA 3RK3D 1RH5B 3L70J 1NKZB 1FI7A 1SVFA 4NPFX 2JJLA 3H1LG 2ZXYA 5GTHE 3L74G 3L36A 1I6EA 1VQ6P 1RF0C 1LC2A 2W8ZA 1ZRTE 1AV1A 3B5NC 2OTKE 1CYCA 1OMIA 2PP6A 1KQSO 1SQXD 2HODA 5KAFV 1RF1A 2KNCA 3U59A 1LWUC 1CRYA 4PD4D 1RHZB 1T8ZA 3EFFK 1R0QA 4I7ZB 1CNOA 1GL2B 1JY2O 3VP8A 5CBOA 3WU2E 3CWBD 3L4OA 3A0BH 4AALA 5AVQB 1WMKA 3SFEC 2GC4D 2W6JH 5GTHH 2C1VA 1AOQA 2VRSA 3VNWA 1DIPA
chains in the Genus database with same CATH topology
1VYDA 1C52A 1KYOD 4GYDA 1CIEA 2ZOOA 3ZCFA 3CX5W 1H32A 2GB8B 1CCHA 1H9YA 3DMIA 2ORLA 1U74B 1FJ0A 2DVHA 3PXSA 1RAQA 1DW2A 2B4ZA 1L9BC 1C75A 2N9YB 1CC5A 4YE1A 2I8FA 5AURA 3KZIV 2L4DA 3HQ9A 4H0JA 3HQ6A 1EB7A 1RZ5A 4WQBA 2BH5X 2LITA 3O0RC 3WFEC 1FI3A 2BPBB 1ETPA 1S5LV 1GIWA 3OA8A 1DT1A 2JQRA 4L1QA 1BGYD 2KS1A 4PWAA 4U3FD 4XYDB 3RLMA 1JDLA 3L72D 1HRCA 1CHIA 1E8EA 3DP5A 3PHLA 2ZZS1 3OCDB 3WUIA 4FA4A 3CXHW 1YFCA 1COTA 1OAEA 1KB0A 1CIFA 3ZBMA 4IL6V 1CHHA 3L74D 1AOFA 2RN0A 2YCCA 1W2LA 3L73D 2O3JA 4JCGA 1KV9A 1QYZA 1H33A 5CYTR 2GC7D 1CXAA 3O1YA 5DFSA 1WEJF 1BL9A 1YIQA 1CSUA 1ZRTD 3A9FA 2B0ZB 5CIBB 1NU1D 4UB8V 4EICA 1CIHA 2B10B 3CYTI 1I8PA 1CCRA 2Y0DA 3H1ID 2VHDA 1HROA 1N50A 1CRGA 2BGVX 1AKKA 2QJPB 2C8SA 1E29A 5B6QA 1CO6A 4Y5RA 1K3GA 2L91A 2PCCB 5KLIB 1NTKD 4QAOA 3KHUA 1CRJA 1C7MA 1OCDA 4A7PA 3WFDC 1IRVA 1YEAA 1GDVA 1IO3A 1YEBA 3SJLA 1IZL0 3X39A 2ZONG 4FAVA 4EDFA 4WQ7A 2BCCD 1FCDC 3RMZA 1KX2A 3JBTB 1CXCA 4UB6V 1SQPD 1KIBA 1NMIA 2EXVA 3H1HD 2DGEA 2OZ1B 3MK7B 1HZUA 2JTIB 5KLVD 1CYJA 2N18B 1PP9D 1DW3A 2QJYB 4H0KA 1DVHA 3HQ7A 5TJHA 2C1DB 1C6SA 1LC1A 1CTZA 4WQ8A 3ORVA 2CA4B 3VYMA 2C1UA 2D0SA 5CIGB 3ZIYA 3O5CA 1DIIC 1YTCA 3HQ8A 5B66V 2BLFB 4L3HA 2YK3A 1EZVD 5B5EV 5C9MA 2GIWA 1N9CA 1MG2D 5DF5A 4FA1A 1J3SA 1RZ6A 3OA8B 3PH2B 451CA 1NNOA 5GTIV 3VMAA 3BCCD 1DW1A 1HCMA 1IQCA 1CSVA 1M70A 3L4MA 4RJTA 1CRIA 4KMGA 2N3YA 1I54A 2C2CA 4O1QA 3NBSA 4DY9A 1U75B 1I8OA 1CRHA 2JWAA 1NIRA 1YICA 2QG4A 1H1OA 3MK7C 1GJQA 2FYNB 2N18C 4AAMA 2AI5A 3TF5A 2Y0CA 1W5CT 3L75D 3PTZA 3H1LD 2V07A 2CE1A 1I6DA 1N90A 1DIQC 3OCDA 5CIHB 5CIFB 1B7VA 3H1KD 1CHJA 4O1WA 1YNRA 5CIDB 1LFMA 2YIUB 4PW9B 2KNCB 1H33B 5DJQB 2CXBA 2PCBB 4WQ9A 1I55A 3SWSA 1DVVA 3L70D 5KAIV 1SQQD 2LIRA 2ZBOA 3DR0A 2BCNB 3WU2V 3ZOWA 2D0WA 1GU2A 1H9XA 5CIEB 2N3BA 5KKZB 2QJKB 1CRCA 1LS9A 2AIUA 3ZOYA 4MU8A 4P4QB 2HV4A 5IY51 1E2RA 1H31A 4WQAA 4L3GA 3WC8A 155CA 1CYIA 1I5TA 4V2KA 3GW6A 1P84D 1L9JC 2XTSB 3SXTA 4WQDA 3PLNA 3O20A 1S6VB 2Y0EA 1GQ1A 4EIEA 1C6OA 1M60A 4GEDB 3ZOOA 1QN2A 1CORA 1H32B 1AYGA 1C2RA 1FI9A 1CTYA 2YQBA 4Q5PA 3SLEA 2FYUD 2OZ1A 3WFBC 1QL3A 5DJQC 2C9XB 1IRWA 1HH7A 4FANA 1SQVD 2AXTV 5H2FV 1KX7A 2C1DA 1CTJA 3PRJA 3PXTA 3M97X 1C6RA 1KB9D 2BH4X 3CX5D 4J20A 1FHBA 4FB1A 2FWLA 3A0HV 4N0KA 1L0LD 4LJIA 2IBZD 1N15A 1QKSA 1HZVA 3GG2A 5EXQA 4FA9A 4RSZA 3NWVA 3VRDA 4NFGB 1HJ3A 1PPJD 2CE0A 1LMSA 2K9JB 2CA3B 3RN0A 1HJ5A 1QL4A 1A56A 1RAPA 4D6TD 1CEDA 1F1CA 3A0BV 5C0ZA 2N9IA 1WVEC 4EIDA 1MG3D 2PACA 3RN1A 4FA5A 1GKSA 1HJ4A 5GTHV 3TDKA 5TISV 1CSWA 4WQEA 4PJ0V 1A2SA 3NBTA 3SVWA 2RMZA 2V08A 1CSXA 3H1JD 1C2NA 1FOCA 3ZOXA 2MTAC 1FI7A 1CIGA 2ZXYA 4K3IA 1I6EA 1DW0A 1LC2A 3CXHD 4AANA 1L0ND 3ITKA 3C2CA 4AAOA 3TGUD 4XXLA 1CYCA 1NTMD 1SQXD 1K3HA 5KAFV 3WFCC 3TYIA 1YCCA 3PXWA 1F1FA 1CRYA 4PD4D 2MHMA 4AX3A 1R0QA 2B12B 4EIFA 1CNOA 351CA 1BCCD 1NMLA 2A06D 1H31B 3CWBD 2FRCA 1ZZHA 3CP5A 1NTZD 3L71D 3L4OA 5E79V 1MZ4A 2Q3EA 1A8CA 4AALA 1SQBD 5CICB 2GC4D 1M6ZA 4WQCA 2C1VA 1BE3D 2B11B 2N9JA 3CU4A 1AOQA 1KYOW 3VNWA 3FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYD A;  1C52 A;  1KYO D;  4GYD A;  1CIE A;  2ZOO A;  3ZCF A;  3CX5 W;  1H32 A;  2GB8 B;  1CCH A;  1H9Y A;  3DMI A;  2ORL A;  1U74 B;  1FJ0 A;  2DVH A;  3PXS A;  1RAQ A;  1DW2 A;  2B4Z A;  1L9B C;  1C75 A;  2N9Y B;  1CC5 A;  4YE1 A;  2I8F A;  5AUR A;  3KZI V;  2L4D A;  3HQ9 A;  4H0J A;  3HQ6 A;  1EB7 A;  1RZ5 A;  4WQB A;  2BH5 X;  2LIT A;  3O0R C;  3WFE C;  1FI3 A;  2BPB B;  1ETP A;  1S5L V;  1GIW A;  3OA8 A;  1DT1 A;  2JQR A;  4L1Q A;  1BGY D;  2KS1 A;  4PWA A;  4U3F D;  4XYD B;  3RLM A;  1JDL A;  3L72 D;  1HRC A;  1CHI A;  1E8E A;  3DP5 A;  3PHL A;  2ZZS 1;  3OCD B;  3WUI A;  4FA4 A;  3CXH W;  1YFC A;  1COT A;  1OAE A;  1KB0 A;  1CIF A;  3ZBM A;  4IL6 V;  1CHH A;  3L74 D;  1AOF A;  2RN0 A;  2YCC A;  1W2L A;  3L73 D;  2O3J A;  4JCG A;  1KV9 A;  1QYZ A;  1H33 A;  5CYT R;  2GC7 D;  1CXA A;  3O1Y A;  5DFS A;  1WEJ F;  1BL9 A;  1YIQ A;  1CSU A;  1ZRT D;  3A9F A;  2B0Z B;  5CIB B;  1NU1 D;  4UB8 V;  4EIC A;  1CIH A;  2B10 B;  3CYT I;  1I8P A;  1CCR A;  2Y0D A;  3H1I D;  2VHD A;  1HRO A;  1N50 A;  1CRG A;  2BGV X;  1AKK A;  2QJP B;  2C8S A;  1E29 A;  5B6Q A;  1CO6 A;  4Y5R A;  1K3G A;  2L91 A;  2PCC B;  5KLI B;  1NTK D;  4QAO A;  3KHU A;  1CRJ A;  1C7M A;  1OCD A;  4A7P A;  3WFD C;  1IRV A;  1YEA A;  1GDV A;  1IO3 A;  1YEB A;  3SJL A;  1IZL 0;  3X39 A;  2ZON G;  4FAV A;  4EDF A;  4WQ7 A;  2BCC D;  1FCD C;  3RMZ A;  1KX2 A;  3JBT B;  1CXC A;  4UB6 V;  1SQP D;  1KIB A;  1NMI A;  2EXV A;  3H1H D;  2DGE A;  2OZ1 B;  3MK7 B;  1HZU A;  2JTI B;  5KLV D;  1CYJ A;  2N18 B;  1PP9 D;  1DW3 A;  2QJY B;  4H0K A;  1DVH A;  3HQ7 A;  5TJH A;  2C1D B;  1C6S A;  1LC1 A;  1CTZ A;  4WQ8 A;  3ORV A;  2CA4 B;  3VYM A;  2C1U A;  2D0S A;  5CIG B;  3ZIY A;  3O5C A;  1DII C;  1YTC A;  3HQ8 A;  5B66 V;  2BLF B;  4L3H A;  2YK3 A;  1EZV D;  5B5E V;  5C9M A;  2GIW A;  1N9C A;  1MG2 D;  5DF5 A;  4FA1 A;  1J3S A;  1RZ6 A;  3OA8 B;  3PH2 B;  451C A;  1NNO A;  5GTI V;  3VMA A;  3BCC D;  1DW1 A;  1HCM A;  1IQC A;  1CSV A;  1M70 A;  3L4M A;  4RJT A;  1CRI A;  4KMG A;  2N3Y A;  1I54 A;  2C2C A;  4O1Q A;  3NBS A;  4DY9 A;  1U75 B;  1I8O A;  1CRH A;  2JWA A;  1NIR A;  1YIC A;  2QG4 A;  1H1O A;  3MK7 C;  1GJQ A;  2FYN B;  2N18 C;  4AAM A;  2AI5 A;  3TF5 A;  2Y0C A;  1W5C T;  3L75 D;  3PTZ A;  3H1L D;  2V07 A;  2CE1 A;  1I6D A;  1N90 A;  1DIQ C;  3OCD A;  5CIH B;  5CIF B;  1B7V A;  3H1K D;  1CHJ A;  4O1W A;  1YNR A;  5CID B;  1LFM A;  2YIU B;  4PW9 B;  2KNC B;  1H33 B;  5DJQ B;  2CXB A;  2PCB B;  4WQ9 A;  1I55 A;  3SWS A;  1DVV A;  3L70 D;  5KAI V;  1SQQ D;  2LIR A;  2ZBO A;  3DR0 A;  2BCN B;  3WU2 V;  3ZOW A;  2D0W A;  1GU2 A;  1H9X A;  5CIE B;  2N3B A;  5KKZ B;  2QJK B;  1CRC A;  1LS9 A;  2AIU A;  3ZOY A;  4MU8 A;  4P4Q B;  2HV4 A;  5IY5 1;  1E2R A;  1H31 A;  4WQA A;  4L3G A;  3WC8 A;  155C A;  1CYI A;  1I5T A;  4V2K A;  3GW6 A;  1P84 D;  1L9J C;  2XTS B;  3SXT A;  4WQD A;  3PLN A;  3O20 A;  1S6V B;  2Y0E A;  1GQ1 A;  4EIE A;  1C6O A;  1M60 A;  4GED B;  3ZOO A;  1QN2 A;  1COR A;  1H32 B;  1AYG A;  1C2R A;  1FI9 A;  1CTY A;  2YQB A;  4Q5P A;  3SLE A;  2FYU D;  2OZ1 A;  3WFB C;  1QL3 A;  5DJQ C;  2C9X B;  1IRW A;  1HH7 A;  4FAN A;  1SQV D;  2AXT V;  5H2F V;  1KX7 A;  2C1D A;  1CTJ A;  3PRJ A;  3PXT A;  3M97 X;  1C6R A;  1KB9 D;  2BH4 X;  3CX5 D;  4J20 A;  1FHB A;  4FB1 A;  2FWL A;  3A0H V;  4N0K A;  1L0L D;  4LJI A;  2IBZ D;  1N15 A;  1QKS A;  1HZV A;  3GG2 A;  5EXQ A;  4FA9 A;  4RSZ A;  3NWV A;  3VRD A;  4NFG B;  1HJ3 A;  1PPJ D;  2CE0 A;  1LMS A;  2K9J B;  2CA3 B;  3RN0 A;  1HJ5 A;  1QL4 A;  1A56 A;  1RAP A;  4D6T D;  1CED A;  1F1C A;  3A0B V;  5C0Z A;  2N9I A;  1WVE C;  4EID A;  1MG3 D;  2PAC A;  3RN1 A;  4FA5 A;  1GKS A;  1HJ4 A;  5GTH V;  3TDK A;  5TIS V;  1CSW A;  4WQE A;  4PJ0 V;  1A2S A;  3NBT A;  3SVW A;  2RMZ A;  2V08 A;  1CSX A;  3H1J D;  1C2N A;  1FOC A;  3ZOX A;  2MTA C;  1FI7 A;  1CIG A;  2ZXY A;  4K3I A;  1I6E A;  1DW0 A;  1LC2 A;  3CXH D;  4AAN A;  1L0N D;  3ITK A;  3C2C A;  4AAO A;  3TGU D;  4XXL A;  1CYC A;  1NTM D;  1SQX D;  1K3H A;  5KAF V;  3WFC C;  3TYI A;  1YCC A;  3PXW A;  1F1F A;  1CRY A;  4PD4 D;  2MHM A;  4AX3 A;  1R0Q A;  2B12 B;  4EIF A;  1CNO A;  351C A;  1BCC D;  1NML A;  2A06 D;  1H31 B;  3CWB D;  2FRC A;  1ZZH A;  3CP5 A;  1NTZ D;  3L71 D;  3L4O A;  5E79 V;  1MZ4 A;  2Q3E A;  1A8C A;  4AAL A;  1SQB D;  5CIC B;  2GC4 D;  1M6Z A;  4WQC A;  2C1V A;  1BE3 D;  2B11 B;  2N9J A;  3CU4 A;  1AOQ A;  1KYO W;  3VNW A;  3FWL A; 
#chains in the Genus database with same CATH topology
 1SQX K;  1SQV J;  5E79 E;  1SQP G;  3H1H G;  1KYO D;  1HBW A;  1DX7 A;  5AVU B;  1DEE G;  2GM4 A;  1CIE A;  2R3C A;  1NH4 A;  5KLV G;  1KYO I;  4LC1 A;  2OQQ A;  5BU8 B;  2E75 B;  1GMJ A;  2ORL A;  3NFQ A;  1KIL D;  4WY4 B;  2J58 A;  1C75 A;  2ZT9 D;  4H13 D;  3RK2 C;  2I8F A;  1P84 H;  3AEF C;  3KZI V;  2L4D A;  3M9H A;  3HTK A;  2LIT A;  3P8C D;  3WFE C;  2Q6Q A;  1URQ D;  2K9Y A;  1LT9 C;  2WSC H;  1GIW A;  2QJP C;  3VMY A;  3CCQ P;  3LW5 J;  1Y8A A;  5E79 H;  3HE5 B;  4K35 A;  1OZH A;  2KS1 A;  2O01 H;  5AW4 B;  1ZP0 C;  2HYN A;  4CPG A;  4AUW A;  3H1J J;  3G9R A;  2JKV A;  3L75 E;  4PWA A;  4EYY Q;  4U3F D;  3RLM A;  4AQR D;  1R8E A;  2A45 I;  4H0L C;  3MIW A;  1QL1 A;  1RQV A;  2B89 A;  1KZU B;  1LP1 B;  2KLU A;  3B5N D;  1N7S D;  1OAE A;  1VQ7 P;  1CIF A;  3ZBM A;  1SQX J;  1IFP A;  4PJ0 E;  1VDF A;  1W2B O;  2BAS A;  1JY3 N;  2RN0 A;  5APV A;  1L4A D;  2JP3 A;  1SQQ E;  3D71 A;  5AVX B;  1KV9 A;  1H33 A;  1X8Y A;  1EDJ A;  2GC7 D;  3HD7 A;  3AE4 C;  3CWB J;  3AEB C;  1WEJ F;  3I5C A;  4H44 C;  5AW0 B;  2N1T C;  2KSJ A;  1DD4 A;  4UB8 V;  4EIC A;  2LR2 A;  5CMZ A;  2FFD A;  2VHD A;  1EXI A;  1M1J B;  4OGQ D;  3V4W A;  5APU A;  1E29 A;  2PCC B;  2QVA A;  4OWF A;  4A7P A;  2QEX P;  1YEA A;  1N2D C;  5AVV B;  1IO3 A;  3SJL A;  1IZL 0;  4EDF A;  1YJN P;  3RMZ A;  2EXV A;  1OW7 A;  2OZ1 B;  2WPV B;  5DJT B;  4ASV A;  2N18 B;  1RE3 C;  1PP9 D;  2QJY B;  1GW4 A;  1YTZ I;  1C6S A;  2Q7C A;  4Z1M H;  2CA4 B;  3CX5 E;  2B87 B;  4LLH A;  3G6E P;  2D0S A;  1N73 B;  3O5C A;  1X9V A;  3M0A A;  2QJK C;  4BXL A;  5APQ A;  4U3F J;  1NNO A;  1VQ4 P;  2E74 C;  4C7R A;  1IQC A;  1Q86 Q;  1CSV A;  2IBZ I;  1J1D C;  1EDI A;  1CI6 B;  5B5E E;  4O1Q A;  1IZN B;  1I8O A;  1VQO P;  1GJQ A;  3AE2 C;  3L72 E;  3IAO A;  3CX5 H;  2AI5 A;  3TF5 A;  3CC4 P;  2Y0C A;  3RL0 B;  4U3F G;  4EI2 A;  4DJG A;  2V07 A;  1LTJ A;  2O1K A;  1FZF A;  5APY A;  5AW5 B;  5CIH B;  2MJZ A;  3H1K D;  5AVS B;  3CL3 D;  2OYH A;  1RF1 B;  2KNC B;  1VQN P;  4WQ9 A;  2WPR A;  5B5E H;  3S4R A;  1LTS C;  1BCC E;  4KHX A;  3WU2 V;  1H9X A;  2KSE A;  3FX0 A;  3H1I E;  4YPC A;  2AIU A;  4P4Q B;  1R5S A;  1G2C A;  1SQB E;  5M1B A;  2A06 G;  2FYN C;  4XE5 B;  1NTZ G;  1BE3 E;  1I5T A;  2HLO A;  3VP9 A;  3P8M C;  4BWN A;  4ZKP A;  1PP9 J;  1BSN A;  3SXT A;  2P2U A;  2ITA A;  1LTB C;  2XV5 A;  1MV8 A;  4EIE A;  1C6O A;  1K73 Q;  1M56 D;  4PV1 C;  1H0T A;  1AA0 A;  1FI9 A;  2FYZ A;  1CTY A;  3AE3 C;  4HKZ H;  2BEZ F;  4GOD A;  4XFJ A;  2C9X B;  1OXZ A;  1OW6 A;  2O01 N;  2WZ7 A;  1PP9 G;  1S4X A;  1KX7 A;  2E74 D;  2C1D A;  3V6I A;  2WSE H;  5CBN A;  1AJY A;  3W67 A;  2R32 A;  1HH0 A;  5L8R J;  3HTK B;  2FWL A;  5AVR B;  2B88 A;  3VTP C;  4GDO A;  3H32 A;  5AW9 B;  1RY3 A;  2I1K A;  2PFX A;  4QMA A;  1QKS A;  1FOS F;  2P58 A;  3TK1 A;  5AW7 B;  5B66 E;  1M1K Q;  4NFG B;  1HJ3 A;  4HB1 A;  1PPJ D;  4I1L A;  3A0H E;  3RN0 A;  1NAF A;  1HJ5 A;  2PRR A;  1L2P A;  4D6T D;  1F1C A;  5C39 A;  1WVE C;  2K37 A;  1MG3 D;  2GUV A;  1SLQ A;  3H1K J;  3BRV B;  3L72 G;  1CSW A;  3H1L E;  2G8Y A;  4PJ0 V;  1A2S A;  1G1I A;  3SVW A;  4EOT A;  3Q5P A;  2RMZ A;  1CSX A;  3H25 A;  1C2N A;  3B4S A;  2MTA C;  2L5G B;  2E75 C;  5H2F H;  1K9M Q;  3HD7 B;  3HRN A;  1JY3 P;  3KDP B;  3L73 G;  1L0N D;  3RK3 C;  5BVZ A;  3L70 E;  3A0H H;  4XXL A;  1VQM P;  1NTM D;  1ZR4 A;  2OYI B;  1K3H A;  2FFD B;  3WFC C;  1FC2 C;  3S1K A;  3E1R A;  2MHM A;  1NU1 G;  4L75 A;  4C7N B;  3H1I G;  1SS1 A;  1H31 B;  1JOC A;  1XTG B;  1YQ4 C;  2CPS A;  3GHG C;  1NTK G;  1FZB A;  1SQP E;  3H1H E;  1L0N K;  1HWT C;  3CCL P;  2B11 B;  5KLV E;  2M3E A;  1NTM K;  4LGD E;  5CCG A;  2BCC G;  3FWL A;  2AEM A;  1KFN A;  1GU5 A;  4GT1 A;  1HJB A;  3AEG C;  2ZOO A;  3S9O A;  3CX5 W;  1H32 A;  1GL2 D;  3KXD A;  4TT3 H;  4I6M C;  2YMK A;  1NWQ A;  3MGN A;  2CPB A;  3CCS P;  3M9B A;  1RAQ A;  3FXD A;  1L9B C;  2IZ0 A;  5KJ7 D;  2N9Y B;  3M0D A;  4ASW A;  5AUR A;  4D6T J;  5AW1 B;  1KIL C;  2BH5 X;  4JYB A;  1FI3 A;  1RF0 A;  1S5L V;  3KPE A;  2ZT9 C;  4H13 C;  1EZV I;  1YTZ T;  1FZC A;  1VQ5 P;  2NPS A;  4JPZ B;  3AE5 C;  1EC5 A;  1NOH A;  3AE7 C;  4Y99 C;  1LWU A;  1USD A;  2E75 D;  4N78 D;  2XKM A;  1JDL A;  1HRC A;  1CHI A;  3GMA A;  4WY4 D;  4JYC A;  1KB9 H;  3CCU P;  1L0N J;  2QJY C;  3H1J E;  4FA4 A;  3A2A A;  1LTT C;  1KC8 Q;  1YFC A;  1NTM J;  2FY8 A;  2W90 A;  2OYH B;  1QGK B;  1KTM A;  1VF5 C;  3MUD C;  2KB7 P;  3CMA P;  2YCC A;  3K5B A;  2J5U A;  1N7S C;  1JB0 J;  1A02 J;  3T97 B;  1H88 A;  4GOE A;  2IPP A;  4IL6 E;  2QSI A;  3O1Y A;  3L70 G;  1ZRT D;  3HUS C;  4PD4 E;  5CIB B;  1G2C B;  2GUS A;  1L4A C;  1CIH A;  3CYT I;  3RBZ A;  1MFT A;  1HRO A;  2E42 A;  1JNM A;  3BRT B;  2XZR A;  2BGV X;  1P84 E;  1AKK A;  2C8S A;  2KXP B;  1SFC C;  1CO6 A;  3AE1 C;  1K3G A;  2L91 A;  3BAS A;  5KLI B;  3MZW B;  3KHU A;  1C7M A;  3WFD C;  4GOF A;  2WPQ A;  1IRV A;  1GDV A;  3U1C A;  2R3S A;  1H0T B;  4OGQ C;  2FKW B;  1SP4 A;  3L35 A;  4B86 A;  4WQ7 A;  2FXM A;  1KX2 A;  4UB6 V;  2DGE A;  1HZU A;  2W83 C;  4IL6 H;  2H8P D;  4H0K A;  1DVH A;  1OW8 A;  4PD4 H;  4L73 A;  1YHQ P;  1T3U A;  3GLM A;  2C1D B;  3OA7 A;  1CTZ A;  4JBZ A;  2D2C B;  3ORV A;  1RQU A;  2M5A B;  1YIT P;  1SQV G;  3VYM A;  2IYO A;  2HG5 D;  2ZXX A;  3H32 B;  3ZIY A;  1FOS E;  2WTY A;  1YTC A;  3HQ8 A;  5B66 V;  1OWA A;  4L3H A;  2YK3 A;  2Z4E A;  1YJW P;  1N9C A;  4FA1 A;  1X22 A;  3G4S P;  3OA8 B;  1FDO A;  3BCC D;  1DW1 A;  1HCM A;  1KYO H;  1M70 A;  4RJT A;  3I56 P;  2K88 A;  2C9N Y;  4ZKU A;  2N3Y A;  1I54 A;  1IO4 A;  1J1E C;  1QLE D;  2RH0 A;  1YIC A;  2N1T A;  5AW8 B;  4U3F E;  1VF5 D;  1H1O A;  3MK7 C;  5GTI E;  2CK3 H;  2LXB A;  4MN4 C;  2Y9Z A;  1GK4 A;  1W5C T;  3L75 D;  2JDI H;  3NTN A;  1JCD A;  2ZYD A;  2YKO A;  3OCD A;  3H1J G;  3CXH E;  3KQG A;  1B7V A;  2LXC B;  3V4Q A;  4DZO A;  2GA1 A;  5CID B;  1JY3 O;  1S1C X;  4PW9 B;  1M8O B;  5DJQ B;  1CZQ A;  1YQ3 C;  1SFC D;  1RE3 A;  1SQQ D;  1SQX G;  2OYI A;  2A45 H;  2ZBO A;  3DR0 A;  2ZAE B;  2A06 E;  3AED C;  2J59 M;  2N3B A;  1GU4 A;  5KKZ B;  5GTI H;  1NTZ E;  3R4Y A;  1CRC A;  2NZ2 A;  1GD2 E;  2M3B A;  3RL0 D;  1YBK A;  2IZ1 A;  4C7N A;  3PP5 A;  1E2R A;  5KAI E;  1VQP P;  2QRX A;  1H31 A;  3CWB G;  2C9L Y;  1CYI A;  3GW6 A;  1IFJ A;  1A02 F;  3OW2 O;  2K1A A;  3CXH H;  3L4F A;  4WQD A;  3PLN A;  2Y0E A;  1CW5 A;  1PZQ A;  2P7J A;  2E76 B;  2WPS A;  2P1J A;  3QWO C;  2JEE A;  1COR A;  2FBW C;  1NYH A;  1SQQ K;  1H32 B;  3VYI A;  3LID A;  1PP9 E;  1E79 H;  3AE6 C;  2FYU D;  2YIU C;  1IC2 A;  3H6P A;  3USS A;  2IDB A;  3SFD C;  1CTJ A;  2IFM A;  3BCC J;  3PRJ A;  3M97 X;  1C6R A;  5KAI H;  2BH4 X;  3CX5 D;  4J20 A;  2WT7 B;  1L0L D;  3IF4 A;  2SPZ A;  3CX5 I;  2H89 C;  2IBZ D;  5CHX A;  3B5N B;  1FZC B;  4JQ0 D;  3EWK A;  2AXT E;  3GG2 A;  3E1I A;  2NPS B;  1NKN A;  1M90 Q;  3VRD A;  3V2R A;  2FYU K;  1LWU B;  2CE0 A;  5CJ4 A;  2CA3 B;  3L75 J;  1QL4 A;  1A56 A;  4O9B A;  1RAP A;  3BCC G;  3A0B V;  1QL2 A;  2POH A;  4N3Y B;  2YMY A;  2PAC A;  2A45 G;  2Q1K A;  2QM8 A;  1JMB A;  1GKS A;  1HJ4 A;  5GTH V;  2E43 A;  2OTL P;  1GDT A;  1L0L K;  1ZXG A;  3GF7 A;  2H7H A;  1DH3 A;  3NBT A;  5BU5 A;  1X79 B;  5CCH A;  1VQ9 P;  3H1K E;  3ZOX A;  3L73 E;  1PFI A;  1SQQ J;  3F89 A;  1CIG A;  2AXT H;  4K3I A;  5TIS E;  1DW0 A;  1J2J B;  1YI2 P;  2OYO A;  1R5L A;  2Q9I A;  3ABV C;  4AAN A;  3Q5R A;  3ITK A;  2V7Q J;  3TGU D;  1YIJ P;  1NU1 E;  1GK6 A;  1IFD A;  3T97 A;  3TYI A;  1YCC A;  3PXW A;  1F1F A;  3CC2 P;  2WSF H;  2AEJ A;  4AX3 A;  2KYV A;  1PL5 A;  3B71 A;  351C A;  3RK2 B;  3RBX A;  1AQ5 A;  1BCC D;  1NML A;  1NTK E;  2FRC A;  3L71 D;  5KAF E;  5E79 V;  3CLQ A;  2Q3E A;  1N86 A;  2BCC E;  1SQB D;  3CD6 P;  1S72 P;  5AVW B;  2FYU J;  1FJP A;  3TSI A;  3WUV A;  3HD7 D;  3W68 A;  1LTJ C;  1ZME C;  3D6Y A;  1BE3 D;  2N9J A;  2RKL A;  5TIS H;  1KYO W;  2WSS H;  4M3L A;  1RE4 A;  3HE4 A;  1PGQ A;  4DT0 A;  1UII A;  2BEQ D;  4H0L B;  3CCE P;  3JCU E;  3Q3D A;  3M06 A;  3ZCF A;  3O6Q A;  1AFO A;  1L0L J;  1K8A Q;  2GB8 B;  3C9I A;  2Z5H A;  3I55 P;  3Q1M A;  1CSB A;  1H9Y A;  2YO2 A;  3DMI A;  2QE7 H;  3BVH A;  1U74 B;  1FJ0 A;  2M5A A;  1OX3 A;  3ZDM A;  2DVH A;  2OAR A;  2R44 A;  3PXS A;  4W80 A;  1SQB K;  1DW2 A;  2B4Z A;  5KAF H;  4I7Z C;  1JEK A;  3CCR P;  1NJI Q;  1GL2 C;  1HGV A;  2W27 A;  5H2F E;  1FDM A;  4H0J A;  1WT6 A;  4WBA A;  1EB7 A;  1RZ5 A;  4WQB A;  3O0R C;  2BPB B;  3D70 A;  1ETP A;  3EFG A;  5KJ7 C;  3OA8 A;  1PPJ E;  4H44 B;  1Q2N A;  2B9B A;  2KI7 B;  5AW6 B;  1N7L A;  2ZVN B;  1DT1 A;  2N1T B;  2YKQ A;  5KLI C;  3VOP A;  4L1Q A;  4D6T E;  1BGY D;  3KZI E;  3JCU H;  3P32 A;  1ZLL A;  4TLF A;  2K9J A;  3P7K A;  1S9K E;  3DP5 A;  5DJU B;  3OCD B;  2G3A A;  3CXH W;  3TGU J;  1COT A;  3GHG A;  2D2C C;  2YNY A;  3L74 D;  1AOF A;  3H1K G;  4WY4 C;  2IYP A;  2FXO A;  2ZXE B;  1T2K D;  4JCG A;  4ZNC A;  1BCC J;  2E5Y A;  3OJA B;  5CYT R;  1FE6 A;  3KZI H;  1FJK A;  3L71 J;  1KN7 A;  1BL9 A;  4R4M A;  1CSU A;  3A9F A;  3SWY A;  2B0Z B;  3TGU G;  1HF9 A;  1SQB J;  2WSE J;  5APX A;  3G71 P;  1BE3 J;  2KIK A;  5CCH D;  1E5W A;  3PJS K;  4W7Z A;  1VL2 A;  2ZFC A;  2QA4 P;  1OCD A;  2E74 B;  4UB8 E;  1KIL A;  1YEB A;  3X39 A;  3FXE A;  2ZON G;  1LJ2 A;  1JTH A;  1FZG A;  1ZOY C;  1SQP D;  1NMI A;  3H1H D;  1GTW A;  5KLV D;  1CYJ A;  1FS0 E;  1SQV E;  1U7M A;  3AEE C;  1URQ A;  5TJH A;  1KB9 E;  3L37 A;  2C1U A;  1YJ9 P;  3FGA D;  4HJG H;  1DII C;  1AVO A;  1M1J C;  2WT7 A;  1BGY J;  5B5E V;  1EZV D;  1M7L A;  4UB8 H;  2GIW A;  4ZMD A;  2QIW A;  1SQP K;  2FXP A;  2HR3 A;  3B5N A;  1T6A A;  1RZ6 A;  3N7N A;  3PH2 B;  2WQY C;  1N7S A;  4RKU J;  5KLV K;  1Q82 Q;  2KP8 A;  1JMM A;  3IR9 A;  3L4M A;  1PPJ G;  1CRI A;  3MP7 B;  3V2Q A;  5CCG C;  2C2C A;  3NBS A;  3HUS A;  1U75 B;  4D6T G;  1CRH A;  4N78 E;  2D2C D;  1L4A A;  3C1L A;  2FYN B;  3L74 J;  2N18 C;  3RK3 E;  2IFN A;  1KQG B;  3PTZ A;  4KT0 J;  3SWK A;  3G3Z A;  1EQ7 A;  3R2P A;  1DIQ C;  4PV1 B;  3CPW O;  5CIF B;  1N73 C;  3M0D C;  2P67 A;  5AVY B;  1YNR A;  2JO1 A;  1KQL A;  1LFM A;  1SQX E;  3PH0 A;  2PCB B;  1L0N G;  4C46 A;  3SWS A;  1DVV A;  1OIP A;  1NTM G;  1OFC X;  3IN6 A;  3LW5 H;  2LIR A;  1M57 D;  1FZC C;  1DEB A;  2NPS C;  1JO5 A;  2BCN B;  3ZOW A;  3FWN A;  2D0W A;  1GU2 A;  1IK7 A;  2ZYG A;  1MKM A;  3CWB E;  2V4H A;  2K3R A;  2PAJ A;  1JY2 N;  1LS9 A;  3ZOY A;  1VQK P;  1USE A;  3TNU A;  1SQP J;  3H1H J;  4L76 A;  4WQA A;  4PD4 I;  3WC8 A;  155C A;  1H8A A;  1PV3 A;  3UIA A;  4V2K A;  5KLV J;  1LT9 A;  1P84 D;  3RL0 C;  1L9J C;  2XTS B;  3HE4 B;  1S6V B;  1KYO E;  1P84 I;  2XNX A;  1PGJ A;  3EQ2 A;  1OVU A;  1Y47 A;  4HH2 A;  3ZOO A;  4DOJ A;  3O6Q B;  1Q7Y Q;  1AYG A;  2C0W A;  4Q5P A;  3SLE A;  1RF1 C;  2DW3 A;  3WFB C;  1KIL E;  1D7M A;  1IRW A;  2WMM A;  5APW A;  2M0B A;  5H2F V;  2I1J A;  1KV4 A;  3PXT A;  1Q81 Q;  1FDI A;  5AW2 B;  1FHB A;  1HGZ A;  5CCG D;  4IFD K;  3P8C E;  3A0H V;  2C0X A;  4N0K A;  3WU2 H;  4LJI A;  3A5T A;  1N15 A;  3RK3 B;  2E76 D;  2LKM A;  5EXQ A;  3BCC E;  1EZV G;  4L74 A;  3NWV A;  4IFM A;  1LMS A;  2K9J B;  4RO0 A;  1Q90 D;  1CED A;  4R4L A;  1ZV8 A;  4W7Y A;  3CME P;  5C0Z A;  2N9I A;  4WB4 A;  4EID A;  1KMI Z;  4FA5 A;  3GHG B;  4IOI H;  2OGU A;  3Q2Y A;  3V2P A;  1HVV A;  3B8E B;  1LNQ A;  3Q5S A;  2V08 A;  3AE9 C;  1W2E A;  3AEC C;  1FOC A;  2NPS D;  2E5T A;  2YXR B;  2IX7 C;  1IFN A;  3CXH D;  3C2C A;  4AAO A;  3CXH I;  1K04 A;  1VPC A;  1EDL A;  2N9B A;  5AVT B;  2AXC A;  1BDD A;  2B12 B;  4EIF A;  4JF7 A;  4YXD C;  1IJD B;  3A7O A;  2HFE D;  1QVG O;  2A06 D;  2UWJ E;  3CP5 A;  1ZZH A;  4HYT B;  1NTZ D;  1KIL B;  2WSC J;  4GIF A;  1IK9 A;  1MZ4 A;  1BDC A;  1A8C A;  1JTH B;  5CIC B;  1U57 A;  2ZT9 B;  4H13 B;  2O01 J;  4OH8 B;  1M6Z A;  4WQC A;  5APT A;  3CU4 A;  5EFW B;  2P10 A;  1TU3 F;  4PJ0 H;  4Y99 B;  1VYD A;  1URQ B;  2WWW A;  1C52 A;  2KUB A;  3AEA C;  4GYD A;  4GKG A;  2FYU E;  3HD7 C;  3KYQ A;  1CCH A;  2R5D A;  2O1J A;  3RK2 D;  1HTL C;  2V7Q H;  2OYI C;  1NTZ K;  2MKV A;  3AE8 C;  2FFD C;  1LTA C;  1VF5 B;  1FU1 A;  1NVO A;  1L0L E;  4OVN F;  1CC5 A;  2IBZ E;  1QEX A;  4YE1 A;  1HUC A;  1N7S B;  1ZR2 A;  3HQ9 A;  3NXS A;  2XDJ A;  1LGH B;  1VQL P;  3HQ6 A;  2XND H;  3CCJ P;  3VN0 A;  3HUS B;  3VMZ A;  2OTJ P;  1L4A B;  2JQR A;  4H0L D;  2NRG A;  1PIX A;  4EIJ A;  5AW3 B;  1KD1 Q;  1S5L E;  1SFC B;  4XYD B;  3L72 D;  2HPC B;  1E8E A;  3PHL A;  4BRY A;  2ZZS 1;  3CI9 A;  3WUI A;  4OGQ B;  3L75 G;  1G1J A;  3CCV P;  1X0T A;  1EXJ A;  1U7J A;  1KB0 A;  4IFF A;  4IL6 V;  1CHH A;  4K3A A;  4DCK A;  4H44 D;  4N6J A;  2N1T D;  1W2L A;  3L73 D;  1IFI A;  1WRG A;  2O3J A;  5APS A;  3TGU E;  4YTP C;  1YYC A;  5KTB A;  2R5B A;  4IL6 X;  1QYZ A;  2HOD B;  1NTZ J;  1CXA A;  3WUU A;  5DFS A;  1NO4 A;  1YIQ A;  2H88 C;  1SQQ G;  3CCM P;  1NU1 D;  3TNU B;  1T2K C;  1S5L H;  3D0W A;  2B10 B;  3MHV A;  1I8P A;  1CCR A;  1OVV A;  2Y0D A;  3H1I D;  4RES B;  3LIE A;  1N50 A;  1CRG A;  4YXW H;  1JY2 P;  1LT9 B;  3L71 E;  2I8D A;  2QJP B;  1GL2 A;  5B6Q A;  4Y5R A;  1FZA A;  1NTK D;  4QAO A;  3O8Z A;  1CRJ A;  4WVZ A;  2KZI A;  1Y9B A;  1JM0 A;  4FAV A;  5CCH C;  4WWI A;  2KOG A;  5KJ7 A;  2BCC D;  1J1E B;  1FCD C;  3JBT B;  1CXC A;  1KIB A;  1PGO A;  3NMD A;  2W6A A;  2OYH C;  3MK7 B;  2KZJ A;  3VMX A;  2JTI B;  1NU1 K;  4XA4 A;  1DW3 A;  3HQ7 A;  4NPE A;  1HJ0 A;  2FYU G;  3RL0 g;  3GF3 A;  1LC1 A;  3IFM A;  4WQ8 A;  4UB6 E;  1MUU A;  1W5C E;  1EDK A;  1LTG C;  1UIX A;  5AVZ B;  1NTK K;  5CIG B;  2BLF B;  1NHL A;  1L0L G;  1IFM A;  5C9M A;  1MG2 D;  2IBZ G;  4WY4 A;  5DF5 A;  5K5G B;  1J3S A;  3MTU E;  451C A;  5GTI V;  3VMA A;  3L72 J;  3WUT A;  1BGY E;  2KS1 B;  2WSF J;  2ZVO B;  1JCC A;  4I2L C;  4KMG A;  1RE4 C;  4KJM A;  4DY9 A;  2JWA A;  1NIR A;  2QG4 A;  4NPD A;  3HE5 A;  4UB6 H;  2WIT A;  4AAM A;  1FAV A;  3L73 J;  1QVF O;  1S9K D;  3H1L D;  1MFZ A;  2CE1 A;  1I6D A;  1KOR A;  1N90 A;  3L74 E;  1Z56 A;  1LP1 A;  1L0N E;  1LTI C;  2ZJS E;  1CHJ A;  4O1W A;  5CJ0 A;  1NU1 J;  1NTM E;  3JC2 2;  2JWD A;  2YIU B;  3A3Y B;  3H1I J;  1H33 B;  1S3J A;  2CXB A;  1I55 A;  3M9Q A;  5B66 H;  1GZL A;  3U1A A;  3L70 D;  3E7K A;  5KAI V;  3F5H A;  1NTK J;  2H43 A;  5CIE B;  2M8R A;  2QJK B;  2KLV A;  2QM7 A;  4MU8 A;  1DD3 A;  2XU6 A;  1BCC G;  2BCC J;  2HV4 A;  5IY5 1;  1ZN5 A;  2YO3 A;  1K05 A;  1N8R Q;  3WMM 0;  4L3G A;  1S2E A;  1T3J A;  3II6 A;  3L71 G;  1J1D B;  4PV1 D;  1M1J A;  2PGD A;  1SQB G;  3O20 A;  1GQ1 A;  1BE3 G;  1H89 A;  1AQT A;  1M60 A;  4GED B;  3SSU A;  1QN2 A;  3JSV C;  3D6Z A;  1C2R A;  1XTC C;  2YKP A;  2YQB A;  3MD0 A;  3QH9 A;  2Q3I A;  2OZ1 A;  1QL3 A;  5DJQ C;  1NAY A;  2Q5U A;  1VQ8 P;  1HH7 A;  4FAN A;  1MZ9 A;  1SQV D;  2AXT V;  2KK7 A;  3TYY A;  3OAK A;  1PGP A;  2AEF A;  4AYC A;  1KFM A;  3C8V A;  3MUD A;  1KB9 D;  5KKZ C;  3V2N A;  1NGM B;  2B87 A;  4FB1 A;  2YXQ B;  1EZV E;  2Z5I A;  1KB9 I;  1N73 A;  1HZV A;  1AVY A;  4FA9 A;  4RSZ A;  2WVR A;  1ZW0 A;  1FBM A;  2ZYA A;  1OVR A;  2E76 C;  1BGY G;  3H1L J;  3N4X A;  1LT1 A;  4BRY B;  1KQF B;  1SQV K;  1CI6 A;  3RN1 A;  3V5B A;  4U7J A;  1JUN A;  3BAT A;  1S5L X;  1URQ C;  1SFC A;  3M91 A;  3TDK A;  2HPC A;  5TIS V;  3CC7 P;  1FZE A;  2JR8 A;  4WQE A;  3RGU A;  3SWF A;  1BSH A;  2Y9Y A;  1LTJ B;  3A0B E;  1GW3 A;  4Y28 J;  1QX8 A;  3H1J D;  2W6B A;  3RK3 D;  1RH5 B;  3L70 J;  1NKZ B;  1FI7 A;  1SVF A;  4NPF X;  2JJL A;  3H1L G;  2ZXY A;  5GTH E;  3L74 G;  3L36 A;  1I6E A;  1VQ6 P;  1RF0 C;  1LC2 A;  2W8Z A;  1ZRT E;  1AV1 A;  3B5N C;  2OTK E;  1CYC A;  1OMI A;  2PP6 A;  1KQS O;  1SQX D;  2HOD A;  5KAF V;  1RF1 A;  2KNC A;  3U59 A;  1LWU C;  1CRY A;  4PD4 D;  1RHZ B;  1T8Z A;  3EFF K;  1R0Q A;  4I7Z B;  1CNO A;  1GL2 B;  1JY2 O;  3VP8 A;  5CBO A;  3WU2 E;  3CWB D;  3L4O A;  3A0B H;  4AAL A;  5AVQ B;  1WMK A;  3SFE C;  2GC4 D;  2W6J H;  5GTH H;  2C1V A;  1AOQ A;  2VRS A;  3VNW A;  1DIP A; 
#chains in the Genus database with same CATH homology
 1VYD A;  1C52 A;  1KYO D;  4GYD A;  1CIE A;  2ZOO A;  3ZCF A;  3CX5 W;  1H32 A;  2GB8 B;  1CCH A;  1H9Y A;  3DMI A;  2ORL A;  1U74 B;  1FJ0 A;  2DVH A;  3PXS A;  1RAQ A;  1DW2 A;  2B4Z A;  1L9B C;  1C75 A;  2N9Y B;  1CC5 A;  4YE1 A;  2I8F A;  5AUR A;  3KZI V;  2L4D A;  3HQ9 A;  4H0J A;  3HQ6 A;  1EB7 A;  1RZ5 A;  4WQB A;  2BH5 X;  2LIT A;  3O0R C;  3WFE C;  1FI3 A;  2BPB B;  1ETP A;  1S5L V;  1GIW A;  3OA8 A;  1DT1 A;  2JQR A;  4L1Q A;  1BGY D;  2KS1 A;  4PWA A;  4U3F D;  4XYD B;  3RLM A;  1JDL A;  3L72 D;  1HRC A;  1CHI A;  1E8E A;  3DP5 A;  3PHL A;  2ZZS 1;  3OCD B;  3WUI A;  4FA4 A;  3CXH W;  1YFC A;  1COT A;  1OAE A;  1KB0 A;  1CIF A;  3ZBM A;  4IL6 V;  1CHH A;  3L74 D;  1AOF A;  2RN0 A;  2YCC A;  1W2L A;  3L73 D;  2O3J A;  4JCG A;  1KV9 A;  1QYZ A;  1H33 A;  5CYT R;  2GC7 D;  1CXA A;  3O1Y A;  5DFS A;  1WEJ F;  1BL9 A;  1YIQ A;  1CSU A;  1ZRT D;  3A9F A;  2B0Z B;  5CIB B;  1NU1 D;  4UB8 V;  4EIC A;  1CIH A;  2B10 B;  3CYT I;  1I8P A;  1CCR A;  2Y0D A;  3H1I D;  2VHD A;  1HRO A;  1N50 A;  1CRG A;  2BGV X;  1AKK A;  2QJP B;  2C8S A;  1E29 A;  5B6Q A;  1CO6 A;  4Y5R A;  1K3G A;  2L91 A;  2PCC B;  5KLI B;  1NTK D;  4QAO A;  3KHU A;  1CRJ A;  1C7M A;  1OCD A;  4A7P A;  3WFD C;  1IRV A;  1YEA A;  1GDV A;  1IO3 A;  1YEB A;  3SJL A;  1IZL 0;  3X39 A;  2ZON G;  4FAV A;  4EDF A;  4WQ7 A;  2BCC D;  1FCD C;  3RMZ A;  1KX2 A;  3JBT B;  1CXC A;  4UB6 V;  1SQP D;  1KIB A;  1NMI A;  2EXV A;  3H1H D;  2DGE A;  2OZ1 B;  3MK7 B;  1HZU A;  2JTI B;  5KLV D;  1CYJ A;  2N18 B;  1PP9 D;  1DW3 A;  2QJY B;  4H0K A;  1DVH A;  3HQ7 A;  5TJH A;  2C1D B;  1C6S A;  1LC1 A;  1CTZ A;  4WQ8 A;  3ORV A;  2CA4 B;  3VYM A;  2C1U A;  2D0S A;  5CIG B;  3ZIY A;  3O5C A;  1DII C;  1YTC A;  3HQ8 A;  5B66 V;  2BLF B;  4L3H A;  2YK3 A;  1EZV D;  5B5E V;  5C9M A;  2GIW A;  1N9C A;  1MG2 D;  5DF5 A;  4FA1 A;  1J3S A;  1RZ6 A;  3OA8 B;  3PH2 B;  451C A;  1NNO A;  5GTI V;  3VMA A;  3BCC D;  1DW1 A;  1HCM A;  1IQC A;  1CSV A;  1M70 A;  3L4M A;  4RJT A;  1CRI A;  4KMG A;  2N3Y A;  1I54 A;  2C2C A;  4O1Q A;  3NBS A;  4DY9 A;  1U75 B;  1I8O A;  1CRH A;  2JWA A;  1NIR A;  1YIC A;  2QG4 A;  1H1O A;  3MK7 C;  1GJQ A;  2FYN B;  2N18 C;  4AAM A;  2AI5 A;  3TF5 A;  2Y0C A;  1W5C T;  3L75 D;  3PTZ A;  3H1L D;  2V07 A;  2CE1 A;  1I6D A;  1N90 A;  1DIQ C;  3OCD A;  5CIH B;  5CIF B;  1B7V A;  3H1K D;  1CHJ A;  4O1W A;  1YNR A;  5CID B;  1LFM A;  2YIU B;  4PW9 B;  2KNC B;  1H33 B;  5DJQ B;  2CXB A;  2PCB B;  4WQ9 A;  1I55 A;  3SWS A;  1DVV A;  3L70 D;  5KAI V;  1SQQ D;  2LIR A;  2ZBO A;  3DR0 A;  2BCN B;  3WU2 V;  3ZOW A;  2D0W A;  1GU2 A;  1H9X A;  5CIE B;  2N3B A;  5KKZ B;  2QJK B;  1CRC A;  1LS9 A;  2AIU A;  3ZOY A;  4MU8 A;  4P4Q B;  2HV4 A;  5IY5 1;  1E2R A;  1H31 A;  4WQA A;  4L3G A;  3WC8 A;  155C A;  1CYI A;  1I5T A;  4V2K A;  3GW6 A;  1P84 D;  1L9J C;  2XTS B;  3SXT A;  4WQD A;  3PLN A;  3O20 A;  1S6V B;  2Y0E A;  1GQ1 A;  4EIE A;  1C6O A;  1M60 A;  4GED B;  3ZOO A;  1QN2 A;  1COR A;  1H32 B;  1AYG A;  1C2R A;  1FI9 A;  1CTY A;  2YQB A;  4Q5P A;  3SLE A;  2FYU D;  2OZ1 A;  3WFB C;  1QL3 A;  5DJQ C;  2C9X B;  1IRW A;  1HH7 A;  4FAN A;  1SQV D;  2AXT V;  5H2F V;  1KX7 A;  2C1D A;  1CTJ A;  3PRJ A;  3PXT A;  3M97 X;  1C6R A;  1KB9 D;  2BH4 X;  3CX5 D;  4J20 A;  1FHB A;  4FB1 A;  2FWL A;  3A0H V;  4N0K A;  1L0L D;  4LJI A;  2IBZ D;  1N15 A;  1QKS A;  1HZV A;  3GG2 A;  5EXQ A;  4FA9 A;  4RSZ A;  3NWV A;  3VRD A;  4NFG B;  1HJ3 A;  1PPJ D;  2CE0 A;  1LMS A;  2K9J B;  2CA3 B;  3RN0 A;  1HJ5 A;  1QL4 A;  1A56 A;  1RAP A;  4D6T D;  1CED A;  1F1C A;  3A0B V;  5C0Z A;  2N9I A;  1WVE C;  4EID A;  1MG3 D;  2PAC A;  3RN1 A;  4FA5 A;  1GKS A;  1HJ4 A;  5GTH V;  3TDK A;  5TIS V;  1CSW A;  4WQE A;  4PJ0 V;  1A2S A;  3NBT A;  3SVW A;  2RMZ A;  2V08 A;  1CSX A;  3H1J D;  1C2N A;  1FOC A;  3ZOX A;  2MTA C;  1FI7 A;  1CIG A;  2ZXY A;  4K3I A;  1I6E A;  1DW0 A;  1LC2 A;  3CXH D;  4AAN A;  1L0N D;  3ITK A;  3C2C A;  4AAO A;  3TGU D;  4XXL A;  1CYC A;  1NTM D;  1SQX D;  1K3H A;  5KAF V;  3WFC C;  3TYI A;  1YCC A;  3PXW A;  1F1F A;  1CRY A;  4PD4 D;  2MHM A;  4AX3 A;  1R0Q A;  2B12 B;  4EIF A;  1CNO A;  351C A;  1BCC D;  1NML A;  2A06 D;  1H31 B;  3CWB D;  2FRC A;  1ZZH A;  3CP5 A;  1NTZ D;  3L71 D;  3L4O A;  5E79 V;  1MZ4 A;  2Q3E A;  1A8C A;  4AAL A;  1SQB D;  5CIC B;  2GC4 D;  1M6Z A;  4WQC A;  2C1V A;  1BE3 D;  2B11 B;  2N9J A;  3CU4 A;  1AOQ A;  1KYO W;  3VNW A;  3FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...