3L74D

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l74D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l74D02
1N9CA 1E29A 2GC4D 1YEBA 4FA5A 2Y0EA 5KKZB 2ORLA 1CCRA 1NMIA 1FCDC 1HCMA 1BGYD 1MG3D 1S5LV 2BPBB 4AX3A 1H1OA 3OA8B 1FOCA 1LS9A 4EIEA 3O1YA 1SQQD 1QKSA 5GTIV 4UB8V 3PH2B 1IRWA 3L75D 5TISV 2ZBOA 5CIFB 1L9BC 1HROA 1CRYA 1M6ZA 1CNOA 1HZUA 3TGUD 3ZOYA 5CIDB 4FANA 451CA 1YTCA 2RMZA 2ZOOA 3H1HD 1CSWA 4QAOA 3GW6A 5CYTR 1FI7A 4WQ7A 1GQ1A 1A56A 155CA 2I8FA 1YNRA 4GYDA 3CXHW 4YE1A 3KZIV 4H0KA 3PTZA 2JQRA 3HQ6A 3X39A 2ZXYA 2MHMA 4WQAA 2QJKB 2C1UA 1HJ3A 4RJTA 2YK3A 1DVHA 4WQDA 4U3FD 2C2CA 4JCGA 3SLEA 3RMZA 3HQ8A 3SXTA 3TDKA 2BCCD 1C6RA 2D0SA 3RLMA 1QN2A 1A2SA 1NU1D 3BCCD 1ETPA 1SQBD 2XTSB 2N18C 1CSUA 2AI5A 1N50A 2B4ZA 3WUIA 1GJQA 2N18B 1HH7A 4FA9A 5CIGB 1H32A 2B10B 1BL9A 1CIHA 4WQCA 1PP9D 1DW1A 5E79V 4J20A 1IZL0 1I55A 3ORVA 4DY9A 2ZZS1 1SQXD 3ZBMA 4FA4A 1CTZA 1U74B 3SVWA 1LMSA 2CXBA 4PJ0V 3C2CA 1YICA 1CRJA 2OZ1B 5EXQA 2BH4X 2FWLA 4AAMA 2LIRA 2BCNB 4L1QA 1GIWA 3PXWA 1PPJD 5C9MA 2B0ZB 3CX5D 4FAVA 2MTAC 3DP5A 3H1ID 5DJQB 2C8SA 5CIEB 3TYIA 2N9JA 3PLNA 1C2RA 1CRHA 1MZ4A 4PD4D 5H2FV 1YIQA 2Y0DA 1NMLA 5KAFV 1DVVA 4EICA 3WFDC 2K9JB 1H32B 2PACA 3ZCFA 5B6QA 1YFCA 2N9YB 4Y5RA 3A0HV 3VYMA 1B7VA 1F1FA 1I5TA 2AXTV 2O3JA 1YEAA 4PWAA 4FB1A 1CCHA 4AANA 1CRIA 5AURA 5B5EV 1H9YA 5TJHA 2BLFB 2QG4A 1CORA 2Q3EA 1JDLA 2CA4B 1QL3A 1CIGA 3WC8A 1CSXA 2DGEA 1W2LA 3DMIA 1OAEA 1L0LD 1J3SA 3MK7B 1WVEC 1RZ5A 1CHJA 5B66V 2GC7D 1CYIA 1E2RA 3MK7C 3SJLA 1FI9A 4WQ8A 2B11B 5IY51 1CXAA 1CYCA 1NTKD 1YCCA 5DJQC 5C0ZA 5KAIV 5CIHB 1DW3A 1WEJF 1QYZA 3GG2A 3H1KD 1N90A 2LITA 3VNWA 2QJPB 1GKSA 1FI3A 1BE3D 1SQPD 4AAOA 4A7PA 3PXTA 2CE0A 1FHBA 4LJIA 1COTA 4XXLA 1KB0A 1HJ4A 1LFMA 4PW9B 1CSVA 3L72D 1EZVD 1C75A 1SQVD 1RAQA 2YIUB 4WQEA 2KNCB 3CXHD 4L3GA 2N9IA 2A06D 3HQ9A 3NBTA 1NIRA 3WFCC 5KLIB 4EDFA 2D0WA 2VHDA 4UB6V 3H1JD 3ZOWA 5GTHV 5KLVD 3WFEC 1U75B 3OCDA 4FA1A 1CXCA 3WU2V 2PCBB 1L9JC 2GIWA 5DFSA 1MG2D 4K3IA 1CIEA 3TF5A 1CTYA 3L73D 2OZ1A 1ZRTD 1R0QA 2C9XB 2B12B 1RZ6A 3M97X 2CA3B 1IQCA 4RSZA 4L3HA 1LC1A 4O1WA 3VRDA 5CICB 4IL6V 3L4OA 1AOFA 4N0KA 1H31B 2RN0A 1C6SA 3DR0A 1NNOA 1CIFA 1I8OA 3ITKA 2FYNB 1C52A 1DIQC 3O20A 1K3GA 1L0ND 3ZOXA 3VMAA 2Y0CA 1F1CA 1AYGA 1HJ5A 1CEDA 1KV9A 1I6DA 1HZVA 4Q5PA 1A8CA 4MU8A 3L74D 2L4DA 1AOQA 3OA8A 4EIFA 2KS1A 3ZOOA 3A0BV 3PHLA 1H9XA 1EB7A 1H33A 3SWSA 3A9FA 4WQ9A 1CYJA 4KMGA 4AALA 5CIBB 2JWAA 1AKKA 1CRCA 1DIIC 4NFGB 1FJ0A 4GEDB 4WQBA 1H33B 1NTZD 1GU2A 2L91A 3PXSA 2EXVA 1CHIA 4O1QA 1KX7A 4V2KA 2IBZD 2N3YA 3CWBD 4EIDA 2CE1A 1P84D 1N15A 1LC2A 2HV4A 1I54A 1K3HA 1IO3A 1I8PA 3O0RC 1DW2A 1KYOW 2BGVX 2GB8B 2QJYB 1KB9D 3RN0A 1CC5A 2C1DB 1CO6A 1HRCA 1OCDA 3HQ7A 4H0JA 2N3BA 1VYDA 3H1LD 1RAPA 1C6OA 2FYUD 2DVHA 2AIUA 1W5CT 3CYTI 1KX2A 1S6VB 3NBSA 2YCCA 2C1DA 2FRCA 5DF5A 1C2NA 3CU4A 1GDVA 2YQBA 2ZONG 2V08A 2V07A 1DW0A 2C1VA 4D6TD 3KHUA 1H31A 1M60A 3CP5A 1ZZHA 3FWLA 1KIBA 3RN1A 3CX5W 3L71D 3WFBC 1NTMD 3OCDB 1I6EA 1CHHA 3JBTB 3O5CA 351CA 1C7MA 1DT1A 2PCCB 2BH5X 1QL4A 2JTIB 3ZIYA 1M70A 1E8EA 3NWVA 1CRGA 1IRVA 3L4MA 4XYDB 3PRJA 1BCCD 1CTJA 1KYOD 3L70D 4P4QB
chains in the Genus database with same CATH superfamily
1KILD 2KB7P 3AEEC 2WT7A 1S9KE 1E29A 1T8ZA 2P1JA 4FA5A 5KKZB 4WY4C 4IL6E 1HUCA 2JR8A 3CI9A 3NTNA 3SWKA 1N73C 1MG3D 2KK7A 3RBZA 3O6QA 2QEXP 1DX7A 2E75C 1FDMA 4GODA 2DW3A 4LGDE 5GTIV 3HD7C 3CCVP 2JEEA 2K1AA 1FOSE 3L75D 3RL0g 3AE4C 1HROA 1CRYA 1GW4A 1KQFB 1CNOA 4FANA 4ASVA 1KYOE 3L37A 2ZOOA 5AVVB 2WVRA 3WUVA 2BEZF 5CYTR 3AECC 4WQ7A 3GF3A 1S4XA 4HJGH 3AE7C 1RE3A 3CC2P 3CXHW 4L76A 4YE1A 1NAYA 5AW4B 1NYHA 3U1CA 3KZIV 4H0KA 1M56D 2JQRA 3OA7A 1KB9E 3HQ6A 2ZXYA 3C1LA 1HJ3A 3RL0D 2E5YA 1N7SB 1DVHA 1R8EA 4U3FD 5DJUB 1L0LE 3SXTA 2FYUK 1C6RA 2W6BA 1SQQG 1VQ8P 2L5GB 3BCCD 1QLED 2XNDH 2FFDC 1E5WA 3VP8A 1SP4A 1CSUA 2M0BA 2AI5A 2YKPA 3CXHH 1N50A 2G3AA 1JM0A 2N18B 3TGUE 3HTKA 4FA9A 1AA0A 4Z1MH 1H32A 3V6IA 1Q90D 1PP9D 1P84E 3EFGA 1NU1G 4DY9A 1SQXD 3ZBMA 1FOSF 1CTZA 1N7SA 1U74B 4ZNCA 5DJTB 1YICA 1CRJA 2IBZG 2OZ1B 3AE5C 5APVA 3V4WA 1HF9A 2FWLA 4AAMA 1YTZI 3D6YA 2LIRA 1USEA 1L2PA 4L1QA 3RK2C 2IYPA 3CCQP 4IFDK 2P67A 1JUNA 1T6AA 3L70J 5AW9B 2MTAC 5DJQB 3H1IJ 3L72J 3LW5H 2KS1B 1N7LA 2N9JA 1EXJA 1C2RA 1CRHA 1X9VA 2FXPA 5H2FV 1YIQA 2C0XA 2FYUG 1SQPK 5B5EE 3A2AA 3B5NB 1NGMB 5APTA 1M57D 1IFPA 3G6EP 1SQXE 1I5TA 3S1KA 1WT6A 2O3JA 2I8DA 1J1DB 1YEAA 2GUSA 2JJLA 1L0NG 1CCHA 1OXZA 4AANA 3AEGC 1ZN5A 1JMBA 5B5EH 3HE4A 1W2BO 2Q3EA 2NRGA 3LW5J 3CCJP 1CIGA 1FZAA 2YO3A 2R5BA 2M3EA 2O1JA 1PFIA 3MK7B 2QE7H 4H13C 1VQKP 3GHGB 1CHJA 2GC7D 4TLFA 4I7ZC 1YI2P 3SJLA 3MK7C 1Z56A 3BRTB 4H13B 3L36A 1IK7A 1GU4A 1FI9A 1MUUA 2JP3A 1ZRTE 1PGJA 3M9BA 1CYCA 3N7NA 1OZHA 1NTKD 2W8ZA 1A02J 5KAIV 1DW3A 2E75D 5CCGA 2NPSA 1QYZA 3GG2A 3H1KD 1L0LJ 2LITA 4NPDA 2O01N 2N1TD 4HB1A 1LTBC 2KZIA 2FXMA 1BE3J 3HE5A 4AAOA 4LJIA 4XXLA 3W67A 1HJ4A 1SFCB 4PW9B 2ZVOB 3LIDA 5CCHA 2J59M 4ZKPA 3HUSC 1DEBA 2Q9IA 3HD7A 3FXDA 2A06D 4WY4D 3HQ9A 1NIRA 4BXLA 5KLIB 4I6MC 2D0WA 2A45H 1NU1J 1VQMP 3WFEC 3EQ2A 2N9BA 4FA1A 1CXCA 5DFSA 4K3IA 1CTYA 3VYIA 3Q2YA 3NXSA 4BRYB 1ZRTD 5AVUB 5KLVE 4IL6V 4ASWA 1YJ9P 3FGAD 1IFDA 2WQYC 4W80A 1DIQC 3O20A 1K3GA 5GTHE 1VQOP 5BU5A 1GL2C 3SWYA 1IFNA 4DJGA 5CBOA 3GHGC 3L75G 2AXCA 5TISE 2R5DA 1CZQA 2KLVA 1FU1A 3L70E 5KAFE 2LXBA 4EIJA 3L74D 3RL0C 1AOQA 2HODA 2W27A 2KS1A 3PHLA 3H1KE 1WRGA 4CPGA 1KB9H 1L4AD 2P2UA 3SFEC 1PGOA 2LR2A 5AVQB 4WQ9A 2YMKA 5AW7B 2VRSA 4UB6H 4KMGA 2YXRB 3SSUA 1J1EC 3VMYA 1CRCA 1KFNA 4NFGB 3ABVC 4WQBA 3AE9C 1YJWP 1H33B 2GA1A 2L91A 1TU3F 1RE4A 1GL2B 1VQ7P 1CHIA 4Y99C 1QGKB 2FFDA 2QRXA 2IBZD 3TYYA 3CWBD 4EIDA 3CCEP 2CE1A 2O01H 1K3HA 3RK2D 1OMIA 1FAVA 3TK1A 1W5CE 2KUBA 3V2QA 2W90A 3I55P 1XTCC 5AVTB 2R44A 4H13D 2FYUJ 2DVHA 1W5CT 5C39A 2IZ0A 2YCCA 4H0LC 5DF5A 1AQTA 1MFTA 1LTSC 4N78E 4H0LB 4YTPC 2ZONG 2J5UA 1FZCC 1K8AQ 2C1VA 1S5LH 3CP5A 2KLUA 2ZVNB 3FWLA 4JF7A 1I6EA 1SQQE 2OYIA 351CA 1C7MA 4BRYA 1DT1A 1VL2A 3AE3C 3KQGA 1K73Q 1N7SD 3ZIYA 1E8EA 2HR3A 2CPBA 3L74E 3PRJA 1BCCD 2P10A 3CD6P 3GLMA 1CTJA 1KYOD 1VF5C 2B88A 1NKZB 1LTJC 1NH4A 2GC4D 2M5AA 1RE3C 1R5SA 1FCDC 1HCMA 3CWBG 5H2FH 1YHQP 5CCGC 4AX3A 1H1OA 3MIWA 1FOCA 1LS9A 1HVVA 4EIEA 4U3FE 5AVWB 1VQ9P 1NTME 1FZCB 3O1YA 3KZIE 3L71E 1QKSA 2KXPB 4D6TE 4OGQD 1DH3A 1L9BC 1M6ZA 1HZUA 3TGUD 5CIDB 2IBZE 4M3LA 2A45I 2YKOA 4H44D 1IO4A 1CSWA 1JEKA 2O1KA 3BCCE 1GQ1A 155CA 3H1KJ 3BCCJ 1MV8A 3B5ND 4PV1C 5BVZA 3CC4P 3L75J 1OVUA 3R2PA 1VQPP 1YTZT 1L4AB 5EFWB 3SLEA 1JY2P 1AV1A 1P84H 1G1JA 3TDKA 1QVGO 2I1KA 1JCCA 2YXQB 1LJ2A 1SFCA 3RLMA 1JO5A 1KQLA 2D2CC 2N18C 3H1KG 1K05A 1NTKE 3WUIA 1VQNP 3A0BH 1HH7A 1J2JB 1X0TA 2OYIC 5CHXA 4K3AA 1GL2D 1HJ0A 3II6A 3CLQA 4J20A 3ORVA 1NAFA 3H1LJ 5CCHD 4IFFA 4PJ0V 1BGYJ 1FJKA 1NTMG 1Y8AA 3H1JG 2BH4X 2FKWB 1N86A 2K37A 3VP9A 2BCNB 1PV3A 2W6JH 1GIWA 5KJ7C 2FY8A 5C9MA 2B0ZB 3CX5D 2AXTE 3DP5A 3KPEA 5AVRB 5CJ0A 3PLNA 4PD4D 3TGUG 2Y0DA 1L0LG 1FZFA 2ZT9C 4KJMA 2K9JB 5APWA 5CBNA 2FYUE 5B6QA 3ZCFA 4H0LD 1N73B 2N9YB 1LTTC 2ZT9B 3HUSA 2HYNA 4R4MA 2FYZA 1VPCA 3A0HV 3VYMA 3D6ZA 1B7VA 2ZFCA 3H32A 3L74G 3V2PA 1AQ5A 3L73E 1ZXGA 4DZOA 1SQBG 5APQA 2YNYA 1KZUB 2Q1KA 4KT0J 5TJHA 5KAIE 2QG4A 1JDLA 2WT7B 3OJAB 1CSXA 2DGEA 3DMIA 3RGUA 4LLHA 2IFMA 1RZ5A 4OWFA 1VF5B 1GMJA 5B66V 1CYIA 3P8CE 5IY51 2AEFA 5CIHB 1SFCC 3I56P 4U7JA 4OGQB 3TSIA 4HYTB 4AYCA 3CL3D 3V5BA 2QJPB 2OYHB 1YBKA 3HD7B 1LWUA 1SQVK 2KNCA 1BE3D 1SQPD 1N7SC 3PXTA 2A06G 2Z5IA 4H44C 3BASA 4PJ0H 1LFMA 1CSVA 3P8CD 4GDOA 3L72D 1KV4A 3CWBE 3S9OA 1JMMA 1LWUB 2YIUB 2KNCB 3CXHD 1FC2C 1VQLP 4L3GA 2N9IA 2ITAA 3NBTA 3NMDA 3WFCC 2E74D 4GIFA 3UIAA 4EDFA 1SQBJ 2KSEA 3MGNA 3H1JD 3ZOWA 1L9JC 2IX7C 2ZJSE 1FZBA 2KI7B 5BU8B 3TGUJ 4OGQC 1IQCA 2HLOA 4L3HA 1AOFA 1LNQA 1E79H 1RQVA 1S3JA 1N2DC 1RH5B 1G1IA 3G9RA 1D7MA 3RK2B 2XU6A 1SQVG 1C52A 3E7KA 1L0ND 1P84I 2Y0CA 1EZVE 3KYQA 1M7LA 2W6AA 1VQ5P 1S9KD 2WWWA 2C9NY 1LP1B 3HE5B 1T2KD 5E79H 2E5TA 3H1LG 3OA8A 4EIFA 1Y47A 2V7QH 2A06E 4IOIH 1EB7A 2KOGA 1HH0A 1H33A 3WU2H 4W7YA 3A9FA 1IK9A 1LT9C 2N1TC 3U59A 3NFQA 1T3JA 5CIBB 4NPEA 3SWFA 2ZT9D 1AKKA 1PPJE 2H88C 1OIPA 3C9IA 1PIXA 2PP6A 4YXWH 1GU2A 1GZLA 3CCSP 2IPPA 1KX7A 3RK3C 1PGPA 1SQPJ 4V2KA 2N3YA 1LC2A 1WMKA 3E1IA 1I8PA 3O0RC 1SVFA 5KJ7D 1KYOW 2BGVX 1CC5A 4L73A 5E79E 2C1DB 1SQXJ 2QJPC 1JCDA 3JCUE 1LTJB 1OCDA 4IL6H 3HQ7A 1SQBE 4H0JA 2N3BA 3H1LD 3MP7B 1C6OA 1NKNA 1ZW0A 3CYTI 3H32B 3U1AA 1S6VB 3H6PA 1EDIA 2ZYDA 3EWKA 4H44B 3C8VA 1BCCJ 2RH0A 2C1DA 2FRCA 1RF0A 1EXIA 5GTHH 1C2NA 1HBWA 2QM8A 3H1IE 4QMAA 5K5GB 2IBZI 1HJBA 1M60A 1DIPA 1ZZHA 3CX5W 3L71D 3WFBC 2PAJA 3OCDB 3B71A 3GHGA 1M8OB 1HTLC 1QL4A 2JTIB 2B87A 3NWVA 3Q5PA 1JY2N 1CRGA 3L4MA 3WU2E 3IN6A 1ZMEC 3V2RA 4B86A 2V08A 4P4QB 2IDBA 1N9CA 1L4AC 3PP5A 1GK4A 1PL5A 2WPSA 2E74B 1YEBA 2Y0EA 5AW6B 2ORLA 3TNUB 2YIUC 3R4YA 4D6TJ 3JCUH 2E74C 1EC5A 2SPZA 3CX5H 1QL2A 2D2CB 3T97A 1SQPG 2BPBB 5CMZA 4AUWA 2K9JA 3Q5RA 4TT3H 3L72G 1SQQD 4UB8V 3PH2B 5B66E 5TISV 1M1JB 1GL2A 1R5LA 3ZOYA 2XNXA 2ZYGA 3N4XA 3GW6A 1FE6A 2I8FA 2QVAA 4GYDA 1RF1A 1NTZE 3H1HE 1AVYA 1QL1A 3PTZA 4O9BA 1YITP 1SQQJ 2WMMA 1ZR4A 3X39A 3VN0A 2C1UA 4RJTA 3CCLP 2YK3A 1CW5A 2CK3H 1RHZB 1LT1A 4XA4A 1H0TB 2M3BA 3H1HJ 4JCGA 1N8RQ 5KKZC 1JOCA 2LXCB 2LKMA 3HQ8A 2BCCD 4PJ0E 1QX8A 2D0SA 3HTKB 4Y28J 1KYOI 3H1LE 1ETPA 1IJDB 2GUVA 3Q1MA 2H7HA 3M91A 1L0NJ 2OYHA 2B4ZA 3MUDC 4K35A 1QVFO 3RK3E 2E43A 3CXHI 3KDPB 2B10B 1CIHA 4WQCA 3JC22 1IZL0 1VF5D 1RE4C 2ZZS1 1S2EA 2PGDA 3CMAP 4JYCA 4YXDC 3SVWA 1CI6B 1DEEG 2QA4P 3BRVB 3M9QA 4UB8H 1PPJD 2OQQA 2JWDA 5APXA 1YJNP 3H1ID 2CPSA 2C8SA 1JY2O 1JY3O 1UIXA 1JTHA 1IFJA 1KILE 3HD7D 1MZ4A 2NZ2A 2Q6QA 3PH0A 3MUDA 3AE6C 2PACA 3BVHA 1RF0C 1YFCA 2XKMA 4I1LA 3A0BE 5APSA 1KILA 1MFZA 1G2CA 1URQA 4JYBA 2AXTV 1NTKK 2WSEH 3CX5I 1KD1Q 5AVYB 3G4SP 4PWAA 4FB1A 3HUSB 2OTJP 3B5NC 2M8RA 4PV1D 1CRIA 5AURA 2JO1A 1VQ6P 1H9YA 5KLIC 4ZKUA 1RY3A 1H88A 1CORA 1L0NE 1A02F 2CA4B 1USDA 3L71G 1QL3A 1EDLA 3OW2O 1YQ3C 1BE3G 1OAEA 2JDIH 2P58A 1KFMA 4ZMDA 1WVEC 4GOFA 5GTIH 2AEMA 1E2RA 2ZAEB 1RF1B 2D2CD 4WQ8A 3IR9A 1CI6A 2B11B 1ZLLA 3MHVA 4N78D 3B4SA 3A7OA 3L74J 5C0ZA 2OARA 1FZCA 1NU1E 3LIEA 1EDJA 1N90A 3VNWA 5CCHC 5AVSB 1PGQA 2GM4A 1FI3A 3AE2C 1FZEA 2CE0A 1FHBA 1Q81Q 1COTA 1H89A 1KB0A 1EQ7A 1GK6A 1LGHB 3T97B 1C75A 1GW3A 2R3CA 1KN7A 1SQVD 3K5BA 1BE3E 1NTZJ 1BSNA 2Z5HA 4WWIA 2P7JA 1NTKG 2WPRA 3H25A 2YMYA 2AXTH 2OYIB 3OAKA 2H8PD 3OCDA 1U75B 2OTLP 3WU2V 2GIWA 1FBMA 2B89A 1S5LX 1MG2D 1JY3P 5L8RJ 1CIEA 3F5HA 3L73D 2MKVA 3AEBC 2C9XB 3M97X 1RZ6A 2CA3B 4RSZA 1LC1A 3VRDA 3L4OA 2KSJA 3L35A 2ZYAA 2WITA 2RN0A 4AQRD 3DR0A 3RK3B 1CIFA 1I8OA 3AE8C 4DT0A 4RKUJ 5APUA 5KLVG 4RESB 2PFXA 3CXHE 2UWJE 1U57A 3KZIH 1SQVE 3ZOXA 3VMXA 4L74A 3CMEP 1F1CA 4DOJA 1CEDA 1J1DC 1I6DA 1HZVA 4JQ0D 1SS1A 1YQ4C 3MTUE 1A8CA 2FYNC 4MU8A 4LC1A 1NHLA 2L4DA 2QJYC 2BEQD 3ZOOA 3P32A 2BCCJ 1H9XA 2MJZA 2OYOA 1BDCA 1MKMA 3A0HE 3B5NA 1CSBA 1VQ4P 1EDKA 1KB9I 1U7JA 4PD4E 4PD4I 1DIIC 3AE1C 1Q86Q 1FJ0A 4GEDB 3HRNA 2I1JA 3MD0A 3PXSA 1BDDA 1Q82Q 1HWTC 3HE4B 1IFIA 2PRRA 2WPVB 3H1JJ 1BGYG 1LP1A 1N15A 1IO3A 3D0WA 1DW2A 3O6QB 2NPSD 2V7QJ 2QJYB 2GB8B 1KB9D 1RQUA 2K9YA 1OVVA 1CO6A 2KYVA 2N1TA 1ZV8A 1K9MQ 1VYDA 2FYUD 5TISH 1OVRA 1KX2A 3NBSA 1LTJA 2WSFH 3VMZA 3CU4A 1GDVA 2YQBA 1LT9A 5AW2B 2E76B 1DW0A 1Y9BA 4D6TD 2XV5A 4JBZA 1H31A 4EI2A 1KIBA 1NTMD 3CCRP 1CHHA 5APYA 1H8AA 4IFMA 1T2KC 2BH5X 5AW3B 1M1JA 4UB6E 1M70A 1EZVI 2R32A 4OH8B 5AW1B 5KTBA 1JB0J 4HKZH 2HPCB 1FDOA 1AFOA 1NO4A 4BWNA 2B9BA 1CCRA 1KORA 2Q3IA 1NMIA 2XDJA 3H1JE 1BGYD 1UIIA 1S5LV 1SQBK 1L0LK 1OW8A 2Y9YA 1HGVA 3IFMA 3SFDC 3OA8B 3I5CA 3G3ZA 1H0TA 4I2LC 1IRWA 2ZXEB 2ZBOA 3KXDA 5CIFB 1NWQA 2OTKE 3RK3D 4U3FG 2HPCA 1OFCX 3M06A 451CA 1YTCA 2RMZA 3L73G 3H1HD 4N3YB 2ZXXA 1BCCE 5M1BA 4QAOA 4YPCA 1FI7A 1A56A 4XFJA 4GT1A 1YNRA 1W2EA 4WY4A 3QH9A 2BCCE 4I7ZB 2Y9ZA 2E42A 2KZJA 3E1RA 1U7MA 2MHMA 4WQAA 3L72E 2QJKB 3ZDMA 4C7RA 1KMIZ 5AW5B 1XTGB 4EOTA 2WSCH 1M90Q 4WQDA 1SQPE 2C2CA 1URQB 2WSFJ 3GF7A 5KAFH 3RMZA 2HFED 2YKQA 4WBAA 4PV1B 3F89A 3CCMP 1KQGB 1QN2A 1A2SA 2IZ1A 1NU1D 2IFNA 2FBWC 1SQBD 2XTSB 1SQXK 2QM7A 3M9HA 1AJYA 2POHA 1GJQA 2H89C 5CIGB 1BL9A 1PP9J 1DW1A 5E79V 1OX3A 1I55A 1NVOA 1GDTA 4U3FJ 4FA4A 3B8EB 2J58A 2FFDB 1GD2E 1LMSA 2CXBA 3C2CA 2R3SA 5EXQA 1NTZK 2NPSB 1RF1C 2C9LY 2QJKC 2Q7CA 3PXWA 4GKGA 3WUUA 4FAVA 1KTMA 1LTGC 1PZQA 5CIEB 3D70A 3TYIA 1M1JC 1YIJP 5KAIH 1NMLA 3V4QA 4GOEA 1JNMA 5KAFV 1NOHA 1DVVA 4EICA 3WFDC 1Q2NA 1H32B 2E76D 3BCCG 4Y5RA 3AEAC 5AW0B 3RL0B 1BGYE 1F1FA 4Y99B 3VOPA 3RBXA 3D71A 1LTIC 1X22A 1N73A 2H43A 5AVZB 2QIWA 3CX5E 5B5EV 1NTKJ 3USSA 2BLFB 2NPSC 1URQC 1IZNB 3WC8A 1W2LA 1L0LD 1ZP0C 1M1KQ 1J3SA 1S72P 5GTIE 4UB8E 2WSCJ 3GMAA 3CWBJ 2V4HA 5KJ7A 5AW8B 2WSSH 4WVZA 1MZ9A 1CXAA 1JY3N 1HGZA 2JKVA 2FXOA 1YCCA 5DJQC 1GTWA 1IC2A 4C46A 5KLVK 2KP8A 1WEJF 1KYOH 3P8MC 4KHXA 4RO0A 1GKSA 4HH2A 5B66H 2QSIA 3FX0A 3M0AA 4A7PA 1FS0E 2WZ7A 2HODB 1GU5A 3M0DC 3L75E 4IL6X 1EZVD 3FWNA 1KILC 2A45G 3H1IG 1SQVJ 5CJ4A 1RAQA 4WQEA 3L70G 2OYHC 1L0NK 1KILB 2WSEJ 2O01J 4XE5B 2VHDA 4UB6V 2C0WA 2AEJA 3P7KA 5GTHV 5KLVD 3O8ZA 2PCBB 1X79B 2OGUA 1LWUC 2B87B 3TF5A 3L73J 2OZ1A 2YO2A 3PJSK 1R0QA 2B12B 2IYOA 1ZOYC 5CICB 4O1WA 4N0KA 4WB4A 3A3YB 3AEDC 1NU1K 1H31B 1C6SA 1LTAC 1SLQA 1NNOA 2XZRA 3ITKA 2FYNB 2Z4EA 4OVNF 1YYCA 3VMAA 1FDIA 4NPFX 5KLVJ 1BSHA 1AYGA 3V2NA 2E75B 1HJ5A 1KV9A 4Q5PA 5H2FE 1EZVG 2N1TB 1PP9G 3IAOA 3L4FA 1OW6A 4C7NA 1IFMA 3EFFK 3A0BV 3Q3DA 1SFCD 5AVXB 3SWSA 3FXEA 4N6JA 1T3UA 3TNUA 1FJPA 1PPJG 1X8YA 3G71P 1CYJA 1DD4A 4AALA 4WY4B 2JWAA 5CCGD 3Q5SA 1SQQK 4MN4C 1QEXA 1NTZD 1NTZG 1ZR2A 4L75A 2K88A 4W7ZA 2EXVA 4EYYQ 1LT9B 4O1QA 2WPQA 3H1HG 4PD4H 4C7NB 1AVOA 3QWOC 1VDFA 1P84D 1PP9E 3S4RA 2HV4A 1I54A 2RKLA 3RN0A 3CC7P 3CPWO 2BCCG 1G2CB 1HRCA 1NJIQ 3BATA 2M5AB 4JPZB 1RAPA 3MZWB 3A5TA 2AIUA 1OWAA 1KQSO 2HG5D 2WTYA 1KC8Q 1L4AA 1NTMK 2E76C 1OW7A 2BASA 1FZGA 2G8YA 3CCUP 1BCCG 2V07A 2K3RA 2KIKA 3KHUA 3W68A 2W83C 3RN1A 3L71J 1NTMJ 1J1EB 3IF4A 3JBTB 3O5CA 2Q5UA 3WUTA 1S5LE 1JTHB 3WMM0 2PCCB 1SQXG 4R4LA 1K04A 1IRVA 3AEFC 4D6TG 1URQD 4XYDB 1Q7YQ 3M0DA 1DD3A 3JSVC 4DCKA 3A0HH 3VTPC 3L70D 1S1CX
chains in the Genus database with same CATH topology
1N9CA 1E29A 2GC4D 1YEBA 4FA5A 2Y0EA 5KKZB 2ORLA 1CCRA 1NMIA 1FCDC 1HCMA 1BGYD 1MG3D 1S5LV 2BPBB 4AX3A 1H1OA 3OA8B 1FOCA 1LS9A 4EIEA 3O1YA 1SQQD 1QKSA 5GTIV 4UB8V 3PH2B 1IRWA 3L75D 5TISV 2ZBOA 5CIFB 1L9BC 1HROA 1CRYA 1M6ZA 1CNOA 1HZUA 3TGUD 3ZOYA 5CIDB 4FANA 451CA 1YTCA 2RMZA 2ZOOA 3H1HD 1CSWA 4QAOA 3GW6A 5CYTR 1FI7A 4WQ7A 1GQ1A 1A56A 155CA 2I8FA 1YNRA 4GYDA 3CXHW 4YE1A 3KZIV 4H0KA 3PTZA 2JQRA 3HQ6A 3X39A 2ZXYA 2MHMA 4WQAA 2QJKB 2C1UA 1HJ3A 4RJTA 2YK3A 1DVHA 4WQDA 4U3FD 2C2CA 4JCGA 3SLEA 3RMZA 3HQ8A 3SXTA 3TDKA 2BCCD 1C6RA 2D0SA 3RLMA 1QN2A 1A2SA 1NU1D 3BCCD 1ETPA 1SQBD 2XTSB 2N18C 1CSUA 2AI5A 1N50A 2B4ZA 3WUIA 1GJQA 2N18B 1HH7A 4FA9A 5CIGB 1H32A 2B10B 1BL9A 1CIHA 4WQCA 1PP9D 1DW1A 5E79V 4J20A 1IZL0 1I55A 3ORVA 4DY9A 2ZZS1 1SQXD 3ZBMA 4FA4A 1CTZA 1U74B 3SVWA 1LMSA 2CXBA 4PJ0V 3C2CA 1YICA 1CRJA 2OZ1B 5EXQA 2BH4X 2FWLA 4AAMA 2LIRA 2BCNB 4L1QA 1GIWA 3PXWA 1PPJD 5C9MA 2B0ZB 3CX5D 4FAVA 2MTAC 3DP5A 3H1ID 5DJQB 2C8SA 5CIEB 3TYIA 2N9JA 3PLNA 1C2RA 1CRHA 1MZ4A 4PD4D 5H2FV 1YIQA 2Y0DA 1NMLA 5KAFV 1DVVA 4EICA 3WFDC 2K9JB 1H32B 2PACA 3ZCFA 5B6QA 1YFCA 2N9YB 4Y5RA 3A0HV 3VYMA 1B7VA 1F1FA 1I5TA 2AXTV 2O3JA 1YEAA 4PWAA 4FB1A 1CCHA 4AANA 1CRIA 5AURA 5B5EV 1H9YA 5TJHA 2BLFB 2QG4A 1CORA 2Q3EA 1JDLA 2CA4B 1QL3A 1CIGA 3WC8A 1CSXA 2DGEA 1W2LA 3DMIA 1OAEA 1L0LD 1J3SA 3MK7B 1WVEC 1RZ5A 1CHJA 5B66V 2GC7D 1CYIA 1E2RA 3MK7C 3SJLA 1FI9A 4WQ8A 2B11B 5IY51 1CXAA 1CYCA 1NTKD 1YCCA 5DJQC 5C0ZA 5KAIV 5CIHB 1DW3A 1WEJF 1QYZA 3GG2A 3H1KD 1N90A 2LITA 3VNWA 2QJPB 1GKSA 1FI3A 1BE3D 1SQPD 4AAOA 4A7PA 3PXTA 2CE0A 1FHBA 4LJIA 1COTA 4XXLA 1KB0A 1HJ4A 1LFMA 4PW9B 1CSVA 3L72D 1EZVD 1C75A 1SQVD 1RAQA 2YIUB 4WQEA 2KNCB 3CXHD 4L3GA 2N9IA 2A06D 3HQ9A 3NBTA 1NIRA 3WFCC 5KLIB 4EDFA 2D0WA 2VHDA 4UB6V 3H1JD 3ZOWA 5GTHV 5KLVD 3WFEC 1U75B 3OCDA 4FA1A 1CXCA 3WU2V 2PCBB 1L9JC 2GIWA 5DFSA 1MG2D 4K3IA 1CIEA 3TF5A 1CTYA 3L73D 2OZ1A 1ZRTD 1R0QA 2C9XB 2B12B 1RZ6A 3M97X 2CA3B 1IQCA 4RSZA 4L3HA 1LC1A 4O1WA 3VRDA 5CICB 4IL6V 3L4OA 1AOFA 4N0KA 1H31B 2RN0A 1C6SA 3DR0A 1NNOA 1CIFA 1I8OA 3ITKA 2FYNB 1C52A 1DIQC 3O20A 1K3GA 1L0ND 3ZOXA 3VMAA 2Y0CA 1F1CA 1AYGA 1HJ5A 1CEDA 1KV9A 1I6DA 1HZVA 4Q5PA 1A8CA 4MU8A 3L74D 2L4DA 1AOQA 3OA8A 4EIFA 2KS1A 3ZOOA 3A0BV 3PHLA 1H9XA 1EB7A 1H33A 3SWSA 3A9FA 4WQ9A 1CYJA 4KMGA 4AALA 5CIBB 2JWAA 1AKKA 1CRCA 1DIIC 4NFGB 1FJ0A 4GEDB 4WQBA 1H33B 1NTZD 1GU2A 2L91A 3PXSA 2EXVA 1CHIA 4O1QA 1KX7A 4V2KA 2IBZD 2N3YA 3CWBD 4EIDA 2CE1A 1P84D 1N15A 1LC2A 2HV4A 1I54A 1K3HA 1IO3A 1I8PA 3O0RC 1DW2A 1KYOW 2BGVX 2GB8B 2QJYB 1KB9D 3RN0A 1CC5A 2C1DB 1CO6A 1HRCA 1OCDA 3HQ7A 4H0JA 2N3BA 1VYDA 3H1LD 1RAPA 1C6OA 2FYUD 2DVHA 2AIUA 1W5CT 3CYTI 1KX2A 1S6VB 3NBSA 2YCCA 2C1DA 2FRCA 5DF5A 1C2NA 3CU4A 1GDVA 2YQBA 2ZONG 2V08A 2V07A 1DW0A 2C1VA 4D6TD 3KHUA 1H31A 1M60A 3CP5A 1ZZHA 3FWLA 1KIBA 3RN1A 3CX5W 3L71D 3WFBC 1NTMD 3OCDB 1I6EA 1CHHA 3JBTB 3O5CA 351CA 1C7MA 1DT1A 2PCCB 2BH5X 1QL4A 2JTIB 3ZIYA 1M70A 1E8EA 3NWVA 1CRGA 1IRVA 3L4MA 4XYDB 3PRJA 1BCCD 1CTJA 1KYOD 3L70D 4P4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9C A;  1E29 A;  2GC4 D;  1YEB A;  4FA5 A;  2Y0E A;  5KKZ B;  2ORL A;  1CCR A;  1NMI A;  1FCD C;  1HCM A;  1BGY D;  1MG3 D;  1S5L V;  2BPB B;  4AX3 A;  1H1O A;  3OA8 B;  1FOC A;  1LS9 A;  4EIE A;  3O1Y A;  1SQQ D;  1QKS A;  5GTI V;  4UB8 V;  3PH2 B;  1IRW A;  3L75 D;  5TIS V;  2ZBO A;  5CIF B;  1L9B C;  1HRO A;  1CRY A;  1M6Z A;  1CNO A;  1HZU A;  3TGU D;  3ZOY A;  5CID B;  4FAN A;  451C A;  1YTC A;  2RMZ A;  2ZOO A;  3H1H D;  1CSW A;  4QAO A;  3GW6 A;  5CYT R;  1FI7 A;  4WQ7 A;  1GQ1 A;  1A56 A;  155C A;  2I8F A;  1YNR A;  4GYD A;  3CXH W;  4YE1 A;  3KZI V;  4H0K A;  3PTZ A;  2JQR A;  3HQ6 A;  3X39 A;  2ZXY A;  2MHM A;  4WQA A;  2QJK B;  2C1U A;  1HJ3 A;  4RJT A;  2YK3 A;  1DVH A;  4WQD A;  4U3F D;  2C2C A;  4JCG A;  3SLE A;  3RMZ A;  3HQ8 A;  3SXT A;  3TDK A;  2BCC D;  1C6R A;  2D0S A;  3RLM A;  1QN2 A;  1A2S A;  1NU1 D;  3BCC D;  1ETP A;  1SQB D;  2XTS B;  2N18 C;  1CSU A;  2AI5 A;  1N50 A;  2B4Z A;  3WUI A;  1GJQ A;  2N18 B;  1HH7 A;  4FA9 A;  5CIG B;  1H32 A;  2B10 B;  1BL9 A;  1CIH A;  4WQC A;  1PP9 D;  1DW1 A;  5E79 V;  4J20 A;  1IZL 0;  1I55 A;  3ORV A;  4DY9 A;  2ZZS 1;  1SQX D;  3ZBM A;  4FA4 A;  1CTZ A;  1U74 B;  3SVW A;  1LMS A;  2CXB A;  4PJ0 V;  3C2C A;  1YIC A;  1CRJ A;  2OZ1 B;  5EXQ A;  2BH4 X;  2FWL A;  4AAM A;  2LIR A;  2BCN B;  4L1Q A;  1GIW A;  3PXW A;  1PPJ D;  5C9M A;  2B0Z B;  3CX5 D;  4FAV A;  2MTA C;  3DP5 A;  3H1I D;  5DJQ B;  2C8S A;  5CIE B;  3TYI A;  2N9J A;  3PLN A;  1C2R A;  1CRH A;  1MZ4 A;  4PD4 D;  5H2F V;  1YIQ A;  2Y0D A;  1NML A;  5KAF V;  1DVV A;  4EIC A;  3WFD C;  2K9J B;  1H32 B;  2PAC A;  3ZCF A;  5B6Q A;  1YFC A;  2N9Y B;  4Y5R A;  3A0H V;  3VYM A;  1B7V A;  1F1F A;  1I5T A;  2AXT V;  2O3J A;  1YEA A;  4PWA A;  4FB1 A;  1CCH A;  4AAN A;  1CRI A;  5AUR A;  5B5E V;  1H9Y A;  5TJH A;  2BLF B;  2QG4 A;  1COR A;  2Q3E A;  1JDL A;  2CA4 B;  1QL3 A;  1CIG A;  3WC8 A;  1CSX A;  2DGE A;  1W2L A;  3DMI A;  1OAE A;  1L0L D;  1J3S A;  3MK7 B;  1WVE C;  1RZ5 A;  1CHJ A;  5B66 V;  2GC7 D;  1CYI A;  1E2R A;  3MK7 C;  3SJL A;  1FI9 A;  4WQ8 A;  2B11 B;  5IY5 1;  1CXA A;  1CYC A;  1NTK D;  1YCC A;  5DJQ C;  5C0Z A;  5KAI V;  5CIH B;  1DW3 A;  1WEJ F;  1QYZ A;  3GG2 A;  3H1K D;  1N90 A;  2LIT A;  3VNW A;  2QJP B;  1GKS A;  1FI3 A;  1BE3 D;  1SQP D;  4AAO A;  4A7P A;  3PXT A;  2CE0 A;  1FHB A;  4LJI A;  1COT A;  4XXL A;  1KB0 A;  1HJ4 A;  1LFM A;  4PW9 B;  1CSV A;  3L72 D;  1EZV D;  1C75 A;  1SQV D;  1RAQ A;  2YIU B;  4WQE A;  2KNC B;  3CXH D;  4L3G A;  2N9I A;  2A06 D;  3HQ9 A;  3NBT A;  1NIR A;  3WFC C;  5KLI B;  4EDF A;  2D0W A;  2VHD A;  4UB6 V;  3H1J D;  3ZOW A;  5GTH V;  5KLV D;  3WFE C;  1U75 B;  3OCD A;  4FA1 A;  1CXC A;  3WU2 V;  2PCB B;  1L9J C;  2GIW A;  5DFS A;  1MG2 D;  4K3I A;  1CIE A;  3TF5 A;  1CTY A;  3L73 D;  2OZ1 A;  1ZRT D;  1R0Q A;  2C9X B;  2B12 B;  1RZ6 A;  3M97 X;  2CA3 B;  1IQC A;  4RSZ A;  4L3H A;  1LC1 A;  4O1W A;  3VRD A;  5CIC B;  4IL6 V;  3L4O A;  1AOF A;  4N0K A;  1H31 B;  2RN0 A;  1C6S A;  3DR0 A;  1NNO A;  1CIF A;  1I8O A;  3ITK A;  2FYN B;  1C52 A;  1DIQ C;  3O20 A;  1K3G A;  1L0N D;  3ZOX A;  3VMA A;  2Y0C A;  1F1C A;  1AYG A;  1HJ5 A;  1CED A;  1KV9 A;  1I6D A;  1HZV A;  4Q5P A;  1A8C A;  4MU8 A;  3L74 D;  2L4D A;  1AOQ A;  3OA8 A;  4EIF A;  2KS1 A;  3ZOO A;  3A0B V;  3PHL A;  1H9X A;  1EB7 A;  1H33 A;  3SWS A;  3A9F A;  4WQ9 A;  1CYJ A;  4KMG A;  4AAL A;  5CIB B;  2JWA A;  1AKK A;  1CRC A;  1DII C;  4NFG B;  1FJ0 A;  4GED B;  4WQB A;  1H33 B;  1NTZ D;  1GU2 A;  2L91 A;  3PXS A;  2EXV A;  1CHI A;  4O1Q A;  1KX7 A;  4V2K A;  2IBZ D;  2N3Y A;  3CWB D;  4EID A;  2CE1 A;  1P84 D;  1N15 A;  1LC2 A;  2HV4 A;  1I54 A;  1K3H A;  1IO3 A;  1I8P A;  3O0R C;  1DW2 A;  1KYO W;  2BGV X;  2GB8 B;  2QJY B;  1KB9 D;  3RN0 A;  1CC5 A;  2C1D B;  1CO6 A;  1HRC A;  1OCD A;  3HQ7 A;  4H0J A;  2N3B A;  1VYD A;  3H1L D;  1RAP A;  1C6O A;  2FYU D;  2DVH A;  2AIU A;  1W5C T;  3CYT I;  1KX2 A;  1S6V B;  3NBS A;  2YCC A;  2C1D A;  2FRC A;  5DF5 A;  1C2N A;  3CU4 A;  1GDV A;  2YQB A;  2ZON G;  2V08 A;  2V07 A;  1DW0 A;  2C1V A;  4D6T D;  3KHU A;  1H31 A;  1M60 A;  3CP5 A;  1ZZH A;  3FWL A;  1KIB A;  3RN1 A;  3CX5 W;  3L71 D;  3WFB C;  1NTM D;  3OCD B;  1I6E A;  1CHH A;  3JBT B;  3O5C A;  351C A;  1C7M A;  1DT1 A;  2PCC B;  2BH5 X;  1QL4 A;  2JTI B;  3ZIY A;  1M70 A;  1E8E A;  3NWV A;  1CRG A;  1IRV A;  3L4M A;  4XYD B;  3PRJ A;  1BCC D;  1CTJ A;  1KYO D;  3L70 D;  4P4Q B; 
#chains in the Genus database with same CATH topology
 1KIL D;  2KB7 P;  3AEE C;  2WT7 A;  1S9K E;  1E29 A;  1T8Z A;  2P1J A;  4FA5 A;  5KKZ B;  4WY4 C;  4IL6 E;  1HUC A;  2JR8 A;  3CI9 A;  3NTN A;  3SWK A;  1N73 C;  1MG3 D;  2KK7 A;  3RBZ A;  3O6Q A;  2QEX P;  1DX7 A;  2E75 C;  1FDM A;  4GOD A;  2DW3 A;  4LGD E;  5GTI V;  3HD7 C;  3CCV P;  2JEE A;  2K1A A;  1FOS E;  3L75 D;  3RL0 g;  3AE4 C;  1HRO A;  1CRY A;  1GW4 A;  1KQF B;  1CNO A;  4FAN A;  4ASV A;  1KYO E;  3L37 A;  2ZOO A;  5AVV B;  2WVR A;  3WUV A;  2BEZ F;  5CYT R;  3AEC C;  4WQ7 A;  3GF3 A;  1S4X A;  4HJG H;  3AE7 C;  1RE3 A;  3CC2 P;  3CXH W;  4L76 A;  4YE1 A;  1NAY A;  5AW4 B;  1NYH A;  3U1C A;  3KZI V;  4H0K A;  1M56 D;  2JQR A;  3OA7 A;  1KB9 E;  3HQ6 A;  2ZXY A;  3C1L A;  1HJ3 A;  3RL0 D;  2E5Y A;  1N7S B;  1DVH A;  1R8E A;  4U3F D;  5DJU B;  1L0L E;  3SXT A;  2FYU K;  1C6R A;  2W6B A;  1SQQ G;  1VQ8 P;  2L5G B;  3BCC D;  1QLE D;  2XND H;  2FFD C;  1E5W A;  3VP8 A;  1SP4 A;  1CSU A;  2M0B A;  2AI5 A;  2YKP A;  3CXH H;  1N50 A;  2G3A A;  1JM0 A;  2N18 B;  3TGU E;  3HTK A;  4FA9 A;  1AA0 A;  4Z1M H;  1H32 A;  3V6I A;  1Q90 D;  1PP9 D;  1P84 E;  3EFG A;  1NU1 G;  4DY9 A;  1SQX D;  3ZBM A;  1FOS F;  1CTZ A;  1N7S A;  1U74 B;  4ZNC A;  5DJT B;  1YIC A;  1CRJ A;  2IBZ G;  2OZ1 B;  3AE5 C;  5APV A;  3V4W A;  1HF9 A;  2FWL A;  4AAM A;  1YTZ I;  3D6Y A;  2LIR A;  1USE A;  1L2P A;  4L1Q A;  3RK2 C;  2IYP A;  3CCQ P;  4IFD K;  2P67 A;  1JUN A;  1T6A A;  3L70 J;  5AW9 B;  2MTA C;  5DJQ B;  3H1I J;  3L72 J;  3LW5 H;  2KS1 B;  1N7L A;  2N9J A;  1EXJ A;  1C2R A;  1CRH A;  1X9V A;  2FXP A;  5H2F V;  1YIQ A;  2C0X A;  2FYU G;  1SQP K;  5B5E E;  3A2A A;  3B5N B;  1NGM B;  5APT A;  1M57 D;  1IFP A;  3G6E P;  1SQX E;  1I5T A;  3S1K A;  1WT6 A;  2O3J A;  2I8D A;  1J1D B;  1YEA A;  2GUS A;  2JJL A;  1L0N G;  1CCH A;  1OXZ A;  4AAN A;  3AEG C;  1ZN5 A;  1JMB A;  5B5E H;  3HE4 A;  1W2B O;  2Q3E A;  2NRG A;  3LW5 J;  3CCJ P;  1CIG A;  1FZA A;  2YO3 A;  2R5B A;  2M3E A;  2O1J A;  1PFI A;  3MK7 B;  2QE7 H;  4H13 C;  1VQK P;  3GHG B;  1CHJ A;  2GC7 D;  4TLF A;  4I7Z C;  1YI2 P;  3SJL A;  3MK7 C;  1Z56 A;  3BRT B;  4H13 B;  3L36 A;  1IK7 A;  1GU4 A;  1FI9 A;  1MUU A;  2JP3 A;  1ZRT E;  1PGJ A;  3M9B A;  1CYC A;  3N7N A;  1OZH A;  1NTK D;  2W8Z A;  1A02 J;  5KAI V;  1DW3 A;  2E75 D;  5CCG A;  2NPS A;  1QYZ A;  3GG2 A;  3H1K D;  1L0L J;  2LIT A;  4NPD A;  2O01 N;  2N1T D;  4HB1 A;  1LTB C;  2KZI A;  2FXM A;  1BE3 J;  3HE5 A;  4AAO A;  4LJI A;  4XXL A;  3W67 A;  1HJ4 A;  1SFC B;  4PW9 B;  2ZVO B;  3LID A;  5CCH A;  2J59 M;  4ZKP A;  3HUS C;  1DEB A;  2Q9I A;  3HD7 A;  3FXD A;  2A06 D;  4WY4 D;  3HQ9 A;  1NIR A;  4BXL A;  5KLI B;  4I6M C;  2D0W A;  2A45 H;  1NU1 J;  1VQM P;  3WFE C;  3EQ2 A;  2N9B A;  4FA1 A;  1CXC A;  5DFS A;  4K3I A;  1CTY A;  3VYI A;  3Q2Y A;  3NXS A;  4BRY B;  1ZRT D;  5AVU B;  5KLV E;  4IL6 V;  4ASW A;  1YJ9 P;  3FGA D;  1IFD A;  2WQY C;  4W80 A;  1DIQ C;  3O20 A;  1K3G A;  5GTH E;  1VQO P;  5BU5 A;  1GL2 C;  3SWY A;  1IFN A;  4DJG A;  5CBO A;  3GHG C;  3L75 G;  2AXC A;  5TIS E;  2R5D A;  1CZQ A;  2KLV A;  1FU1 A;  3L70 E;  5KAF E;  2LXB A;  4EIJ A;  3L74 D;  3RL0 C;  1AOQ A;  2HOD A;  2W27 A;  2KS1 A;  3PHL A;  3H1K E;  1WRG A;  4CPG A;  1KB9 H;  1L4A D;  2P2U A;  3SFE C;  1PGO A;  2LR2 A;  5AVQ B;  4WQ9 A;  2YMK A;  5AW7 B;  2VRS A;  4UB6 H;  4KMG A;  2YXR B;  3SSU A;  1J1E C;  3VMY A;  1CRC A;  1KFN A;  4NFG B;  3ABV C;  4WQB A;  3AE9 C;  1YJW P;  1H33 B;  2GA1 A;  2L91 A;  1TU3 F;  1RE4 A;  1GL2 B;  1VQ7 P;  1CHI A;  4Y99 C;  1QGK B;  2FFD A;  2QRX A;  2IBZ D;  3TYY A;  3CWB D;  4EID A;  3CCE P;  2CE1 A;  2O01 H;  1K3H A;  3RK2 D;  1OMI A;  1FAV A;  3TK1 A;  1W5C E;  2KUB A;  3V2Q A;  2W90 A;  3I55 P;  1XTC C;  5AVT B;  2R44 A;  4H13 D;  2FYU J;  2DVH A;  1W5C T;  5C39 A;  2IZ0 A;  2YCC A;  4H0L C;  5DF5 A;  1AQT A;  1MFT A;  1LTS C;  4N78 E;  4H0L B;  4YTP C;  2ZON G;  2J5U A;  1FZC C;  1K8A Q;  2C1V A;  1S5L H;  3CP5 A;  2KLU A;  2ZVN B;  3FWL A;  4JF7 A;  1I6E A;  1SQQ E;  2OYI A;  351C A;  1C7M A;  4BRY A;  1DT1 A;  1VL2 A;  3AE3 C;  3KQG A;  1K73 Q;  1N7S D;  3ZIY A;  1E8E A;  2HR3 A;  2CPB A;  3L74 E;  3PRJ A;  1BCC D;  2P10 A;  3CD6 P;  3GLM A;  1CTJ A;  1KYO D;  1VF5 C;  2B88 A;  1NKZ B;  1LTJ C;  1NH4 A;  2GC4 D;  2M5A A;  1RE3 C;  1R5S A;  1FCD C;  1HCM A;  3CWB G;  5H2F H;  1YHQ P;  5CCG C;  4AX3 A;  1H1O A;  3MIW A;  1FOC A;  1LS9 A;  1HVV A;  4EIE A;  4U3F E;  5AVW B;  1VQ9 P;  1NTM E;  1FZC B;  3O1Y A;  3KZI E;  3L71 E;  1QKS A;  2KXP B;  4D6T E;  4OGQ D;  1DH3 A;  1L9B C;  1M6Z A;  1HZU A;  3TGU D;  5CID B;  2IBZ E;  4M3L A;  2A45 I;  2YKO A;  4H44 D;  1IO4 A;  1CSW A;  1JEK A;  2O1K A;  3BCC E;  1GQ1 A;  155C A;  3H1K J;  3BCC J;  1MV8 A;  3B5N D;  4PV1 C;  5BVZ A;  3CC4 P;  3L75 J;  1OVU A;  3R2P A;  1VQP P;  1YTZ T;  1L4A B;  5EFW B;  3SLE A;  1JY2 P;  1AV1 A;  1P84 H;  1G1J A;  3TDK A;  1QVG O;  2I1K A;  1JCC A;  2YXQ B;  1LJ2 A;  1SFC A;  3RLM A;  1JO5 A;  1KQL A;  2D2C C;  2N18 C;  3H1K G;  1K05 A;  1NTK E;  3WUI A;  1VQN P;  3A0B H;  1HH7 A;  1J2J B;  1X0T A;  2OYI C;  5CHX A;  4K3A A;  1GL2 D;  1HJ0 A;  3II6 A;  3CLQ A;  4J20 A;  3ORV A;  1NAF A;  3H1L J;  5CCH D;  4IFF A;  4PJ0 V;  1BGY J;  1FJK A;  1NTM G;  1Y8A A;  3H1J G;  2BH4 X;  2FKW B;  1N86 A;  2K37 A;  3VP9 A;  2BCN B;  1PV3 A;  2W6J H;  1GIW A;  5KJ7 C;  2FY8 A;  5C9M A;  2B0Z B;  3CX5 D;  2AXT E;  3DP5 A;  3KPE A;  5AVR B;  5CJ0 A;  3PLN A;  4PD4 D;  3TGU G;  2Y0D A;  1L0L G;  1FZF A;  2ZT9 C;  4KJM A;  2K9J B;  5APW A;  5CBN A;  2FYU E;  5B6Q A;  3ZCF A;  4H0L D;  1N73 B;  2N9Y B;  1LTT C;  2ZT9 B;  3HUS A;  2HYN A;  4R4M A;  2FYZ A;  1VPC A;  3A0H V;  3VYM A;  3D6Z A;  1B7V A;  2ZFC A;  3H32 A;  3L74 G;  3V2P A;  1AQ5 A;  3L73 E;  1ZXG A;  4DZO A;  1SQB G;  5APQ A;  2YNY A;  1KZU B;  2Q1K A;  4KT0 J;  5TJH A;  5KAI E;  2QG4 A;  1JDL A;  2WT7 B;  3OJA B;  1CSX A;  2DGE A;  3DMI A;  3RGU A;  4LLH A;  2IFM A;  1RZ5 A;  4OWF A;  1VF5 B;  1GMJ A;  5B66 V;  1CYI A;  3P8C E;  5IY5 1;  2AEF A;  5CIH B;  1SFC C;  3I56 P;  4U7J A;  4OGQ B;  3TSI A;  4HYT B;  4AYC A;  3CL3 D;  3V5B A;  2QJP B;  2OYH B;  1YBK A;  3HD7 B;  1LWU A;  1SQV K;  2KNC A;  1BE3 D;  1SQP D;  1N7S C;  3PXT A;  2A06 G;  2Z5I A;  4H44 C;  3BAS A;  4PJ0 H;  1LFM A;  1CSV A;  3P8C D;  4GDO A;  3L72 D;  1KV4 A;  3CWB E;  3S9O A;  1JMM A;  1LWU B;  2YIU B;  2KNC B;  3CXH D;  1FC2 C;  1VQL P;  4L3G A;  2N9I A;  2ITA A;  3NBT A;  3NMD A;  3WFC C;  2E74 D;  4GIF A;  3UIA A;  4EDF A;  1SQB J;  2KSE A;  3MGN A;  3H1J D;  3ZOW A;  1L9J C;  2IX7 C;  2ZJS E;  1FZB A;  2KI7 B;  5BU8 B;  3TGU J;  4OGQ C;  1IQC A;  2HLO A;  4L3H A;  1AOF A;  1LNQ A;  1E79 H;  1RQV A;  1S3J A;  1N2D C;  1RH5 B;  1G1I A;  3G9R A;  1D7M A;  3RK2 B;  2XU6 A;  1SQV G;  1C52 A;  3E7K A;  1L0N D;  1P84 I;  2Y0C A;  1EZV E;  3KYQ A;  1M7L A;  2W6A A;  1VQ5 P;  1S9K D;  2WWW A;  2C9N Y;  1LP1 B;  3HE5 B;  1T2K D;  5E79 H;  2E5T A;  3H1L G;  3OA8 A;  4EIF A;  1Y47 A;  2V7Q H;  2A06 E;  4IOI H;  1EB7 A;  2KOG A;  1HH0 A;  1H33 A;  3WU2 H;  4W7Y A;  3A9F A;  1IK9 A;  1LT9 C;  2N1T C;  3U59 A;  3NFQ A;  1T3J A;  5CIB B;  4NPE A;  3SWF A;  2ZT9 D;  1AKK A;  1PPJ E;  2H88 C;  1OIP A;  3C9I A;  1PIX A;  2PP6 A;  4YXW H;  1GU2 A;  1GZL A;  3CCS P;  2IPP A;  1KX7 A;  3RK3 C;  1PGP A;  1SQP J;  4V2K A;  2N3Y A;  1LC2 A;  1WMK A;  3E1I A;  1I8P A;  3O0R C;  1SVF A;  5KJ7 D;  1KYO W;  2BGV X;  1CC5 A;  4L73 A;  5E79 E;  2C1D B;  1SQX J;  2QJP C;  1JCD A;  3JCU E;  1LTJ B;  1OCD A;  4IL6 H;  3HQ7 A;  1SQB E;  4H0J A;  2N3B A;  3H1L D;  3MP7 B;  1C6O A;  1NKN A;  1ZW0 A;  3CYT I;  3H32 B;  3U1A A;  1S6V B;  3H6P A;  1EDI A;  2ZYD A;  3EWK A;  4H44 B;  3C8V A;  1BCC J;  2RH0 A;  2C1D A;  2FRC A;  1RF0 A;  1EXI A;  5GTH H;  1C2N A;  1HBW A;  2QM8 A;  3H1I E;  4QMA A;  5K5G B;  2IBZ I;  1HJB A;  1M60 A;  1DIP A;  1ZZH A;  3CX5 W;  3L71 D;  3WFB C;  2PAJ A;  3OCD B;  3B71 A;  3GHG A;  1M8O B;  1HTL C;  1QL4 A;  2JTI B;  2B87 A;  3NWV A;  3Q5P A;  1JY2 N;  1CRG A;  3L4M A;  3WU2 E;  3IN6 A;  1ZME C;  3V2R A;  4B86 A;  2V08 A;  4P4Q B;  2IDB A;  1N9C A;  1L4A C;  3PP5 A;  1GK4 A;  1PL5 A;  2WPS A;  2E74 B;  1YEB A;  2Y0E A;  5AW6 B;  2ORL A;  3TNU B;  2YIU C;  3R4Y A;  4D6T J;  3JCU H;  2E74 C;  1EC5 A;  2SPZ A;  3CX5 H;  1QL2 A;  2D2C B;  3T97 A;  1SQP G;  2BPB B;  5CMZ A;  4AUW A;  2K9J A;  3Q5R A;  4TT3 H;  3L72 G;  1SQQ D;  4UB8 V;  3PH2 B;  5B66 E;  5TIS V;  1M1J B;  1GL2 A;  1R5L A;  3ZOY A;  2XNX A;  2ZYG A;  3N4X A;  3GW6 A;  1FE6 A;  2I8F A;  2QVA A;  4GYD A;  1RF1 A;  1NTZ E;  3H1H E;  1AVY A;  1QL1 A;  3PTZ A;  4O9B A;  1YIT P;  1SQQ J;  2WMM A;  1ZR4 A;  3X39 A;  3VN0 A;  2C1U A;  4RJT A;  3CCL P;  2YK3 A;  1CW5 A;  2CK3 H;  1RHZ B;  1LT1 A;  4XA4 A;  1H0T B;  2M3B A;  3H1H J;  4JCG A;  1N8R Q;  5KKZ C;  1JOC A;  2LXC B;  2LKM A;  3HQ8 A;  2BCC D;  4PJ0 E;  1QX8 A;  2D0S A;  3HTK B;  4Y28 J;  1KYO I;  3H1L E;  1ETP A;  1IJD B;  2GUV A;  3Q1M A;  2H7H A;  3M91 A;  1L0N J;  2OYH A;  2B4Z A;  3MUD C;  4K35 A;  1QVF O;  3RK3 E;  2E43 A;  3CXH I;  3KDP B;  2B10 B;  1CIH A;  4WQC A;  3JC2 2;  1IZL 0;  1VF5 D;  1RE4 C;  2ZZS 1;  1S2E A;  2PGD A;  3CMA P;  4JYC A;  4YXD C;  3SVW A;  1CI6 B;  1DEE G;  2QA4 P;  3BRV B;  3M9Q A;  4UB8 H;  1PPJ D;  2OQQ A;  2JWD A;  5APX A;  1YJN P;  3H1I D;  2CPS A;  2C8S A;  1JY2 O;  1JY3 O;  1UIX A;  1JTH A;  1IFJ A;  1KIL E;  3HD7 D;  1MZ4 A;  2NZ2 A;  2Q6Q A;  3PH0 A;  3MUD A;  3AE6 C;  2PAC A;  3BVH A;  1RF0 C;  1YFC A;  2XKM A;  4I1L A;  3A0B E;  5APS A;  1KIL A;  1MFZ A;  1G2C A;  1URQ A;  4JYB A;  2AXT V;  1NTK K;  2WSE H;  3CX5 I;  1KD1 Q;  5AVY B;  3G4S P;  4PWA A;  4FB1 A;  3HUS B;  2OTJ P;  3B5N C;  2M8R A;  4PV1 D;  1CRI A;  5AUR A;  2JO1 A;  1VQ6 P;  1H9Y A;  5KLI C;  4ZKU A;  1RY3 A;  1H88 A;  1COR A;  1L0N E;  1A02 F;  2CA4 B;  1USD A;  3L71 G;  1QL3 A;  1EDL A;  3OW2 O;  1YQ3 C;  1BE3 G;  1OAE A;  2JDI H;  2P58 A;  1KFM A;  4ZMD A;  1WVE C;  4GOF A;  5GTI H;  2AEM A;  1E2R A;  2ZAE B;  1RF1 B;  2D2C D;  4WQ8 A;  3IR9 A;  1CI6 A;  2B11 B;  1ZLL A;  3MHV A;  4N78 D;  3B4S A;  3A7O A;  3L74 J;  5C0Z A;  2OAR A;  1FZC A;  1NU1 E;  3LIE A;  1EDJ A;  1N90 A;  3VNW A;  5CCH C;  5AVS B;  1PGQ A;  2GM4 A;  1FI3 A;  3AE2 C;  1FZE A;  2CE0 A;  1FHB A;  1Q81 Q;  1COT A;  1H89 A;  1KB0 A;  1EQ7 A;  1GK6 A;  1LGH B;  3T97 B;  1C75 A;  1GW3 A;  2R3C A;  1KN7 A;  1SQV D;  3K5B A;  1BE3 E;  1NTZ J;  1BSN A;  2Z5H A;  4WWI A;  2P7J A;  1NTK G;  2WPR A;  3H25 A;  2YMY A;  2AXT H;  2OYI B;  3OAK A;  2H8P D;  3OCD A;  1U75 B;  2OTL P;  3WU2 V;  2GIW A;  1FBM A;  2B89 A;  1S5L X;  1MG2 D;  1JY3 P;  5L8R J;  1CIE A;  3F5H A;  3L73 D;  2MKV A;  3AEB C;  2C9X B;  3M97 X;  1RZ6 A;  2CA3 B;  4RSZ A;  1LC1 A;  3VRD A;  3L4O A;  2KSJ A;  3L35 A;  2ZYA A;  2WIT A;  2RN0 A;  4AQR D;  3DR0 A;  3RK3 B;  1CIF A;  1I8O A;  3AE8 C;  4DT0 A;  4RKU J;  5APU A;  5KLV G;  4RES B;  2PFX A;  3CXH E;  2UWJ E;  1U57 A;  3KZI H;  1SQV E;  3ZOX A;  3VMX A;  4L74 A;  3CME P;  1F1C A;  4DOJ A;  1CED A;  1J1D C;  1I6D A;  1HZV A;  4JQ0 D;  1SS1 A;  1YQ4 C;  3MTU E;  1A8C A;  2FYN C;  4MU8 A;  4LC1 A;  1NHL A;  2L4D A;  2QJY C;  2BEQ D;  3ZOO A;  3P32 A;  2BCC J;  1H9X A;  2MJZ A;  2OYO A;  1BDC A;  1MKM A;  3A0H E;  3B5N A;  1CSB A;  1VQ4 P;  1EDK A;  1KB9 I;  1U7J A;  4PD4 E;  4PD4 I;  1DII C;  3AE1 C;  1Q86 Q;  1FJ0 A;  4GED B;  3HRN A;  2I1J A;  3MD0 A;  3PXS A;  1BDD A;  1Q82 Q;  1HWT C;  3HE4 B;  1IFI A;  2PRR A;  2WPV B;  3H1J J;  1BGY G;  1LP1 A;  1N15 A;  1IO3 A;  3D0W A;  1DW2 A;  3O6Q B;  2NPS D;  2V7Q J;  2QJY B;  2GB8 B;  1KB9 D;  1RQU A;  2K9Y A;  1OVV A;  1CO6 A;  2KYV A;  2N1T A;  1ZV8 A;  1K9M Q;  1VYD A;  2FYU D;  5TIS H;  1OVR A;  1KX2 A;  3NBS A;  1LTJ A;  2WSF H;  3VMZ A;  3CU4 A;  1GDV A;  2YQB A;  1LT9 A;  5AW2 B;  2E76 B;  1DW0 A;  1Y9B A;  4D6T D;  2XV5 A;  4JBZ A;  1H31 A;  4EI2 A;  1KIB A;  1NTM D;  3CCR P;  1CHH A;  5APY A;  1H8A A;  4IFM A;  1T2K C;  2BH5 X;  5AW3 B;  1M1J A;  4UB6 E;  1M70 A;  1EZV I;  2R32 A;  4OH8 B;  5AW1 B;  5KTB A;  1JB0 J;  4HKZ H;  2HPC B;  1FDO A;  1AFO A;  1NO4 A;  4BWN A;  2B9B A;  1CCR A;  1KOR A;  2Q3I A;  1NMI A;  2XDJ A;  3H1J E;  1BGY D;  1UII A;  1S5L V;  1SQB K;  1L0L K;  1OW8 A;  2Y9Y A;  1HGV A;  3IFM A;  3SFD C;  3OA8 B;  3I5C A;  3G3Z A;  1H0T A;  4I2L C;  1IRW A;  2ZXE B;  2ZBO A;  3KXD A;  5CIF B;  1NWQ A;  2OTK E;  3RK3 D;  4U3F G;  2HPC A;  1OFC X;  3M06 A;  451C A;  1YTC A;  2RMZ A;  3L73 G;  3H1H D;  4N3Y B;  2ZXX A;  1BCC E;  5M1B A;  4QAO A;  4YPC A;  1FI7 A;  1A56 A;  4XFJ A;  4GT1 A;  1YNR A;  1W2E A;  4WY4 A;  3QH9 A;  2BCC E;  4I7Z B;  2Y9Z A;  2E42 A;  2KZJ A;  3E1R A;  1U7M A;  2MHM A;  4WQA A;  3L72 E;  2QJK B;  3ZDM A;  4C7R A;  1KMI Z;  5AW5 B;  1XTG B;  4EOT A;  2WSC H;  1M90 Q;  4WQD A;  1SQP E;  2C2C A;  1URQ B;  2WSF J;  3GF7 A;  5KAF H;  3RMZ A;  2HFE D;  2YKQ A;  4WBA A;  4PV1 B;  3F89 A;  3CCM P;  1KQG B;  1QN2 A;  1A2S A;  2IZ1 A;  1NU1 D;  2IFN A;  2FBW C;  1SQB D;  2XTS B;  1SQX K;  2QM7 A;  3M9H A;  1AJY A;  2POH A;  1GJQ A;  2H89 C;  5CIG B;  1BL9 A;  1PP9 J;  1DW1 A;  5E79 V;  1OX3 A;  1I55 A;  1NVO A;  1GDT A;  4U3F J;  4FA4 A;  3B8E B;  2J58 A;  2FFD B;  1GD2 E;  1LMS A;  2CXB A;  3C2C A;  2R3S A;  5EXQ A;  1NTZ K;  2NPS B;  1RF1 C;  2C9L Y;  2QJK C;  2Q7C A;  3PXW A;  4GKG A;  3WUU A;  4FAV A;  1KTM A;  1LTG C;  1PZQ A;  5CIE B;  3D70 A;  3TYI A;  1M1J C;  1YIJ P;  5KAI H;  1NML A;  3V4Q A;  4GOE A;  1JNM A;  5KAF V;  1NOH A;  1DVV A;  4EIC A;  3WFD C;  1Q2N A;  1H32 B;  2E76 D;  3BCC G;  4Y5R A;  3AEA C;  5AW0 B;  3RL0 B;  1BGY E;  1F1F A;  4Y99 B;  3VOP A;  3RBX A;  3D71 A;  1LTI C;  1X22 A;  1N73 A;  2H43 A;  5AVZ B;  2QIW A;  3CX5 E;  5B5E V;  1NTK J;  3USS A;  2BLF B;  2NPS C;  1URQ C;  1IZN B;  3WC8 A;  1W2L A;  1L0L D;  1ZP0 C;  1M1K Q;  1J3S A;  1S72 P;  5GTI E;  4UB8 E;  2WSC J;  3GMA A;  3CWB J;  2V4H A;  5KJ7 A;  5AW8 B;  2WSS H;  4WVZ A;  1MZ9 A;  1CXA A;  1JY3 N;  1HGZ A;  2JKV A;  2FXO A;  1YCC A;  5DJQ C;  1GTW A;  1IC2 A;  4C46 A;  5KLV K;  2KP8 A;  1WEJ F;  1KYO H;  3P8M C;  4KHX A;  4RO0 A;  1GKS A;  4HH2 A;  5B66 H;  2QSI A;  3FX0 A;  3M0A A;  4A7P A;  1FS0 E;  2WZ7 A;  2HOD B;  1GU5 A;  3M0D C;  3L75 E;  4IL6 X;  1EZV D;  3FWN A;  1KIL C;  2A45 G;  3H1I G;  1SQV J;  5CJ4 A;  1RAQ A;  4WQE A;  3L70 G;  2OYH C;  1L0N K;  1KIL B;  2WSE J;  2O01 J;  4XE5 B;  2VHD A;  4UB6 V;  2C0W A;  2AEJ A;  3P7K A;  5GTH V;  5KLV D;  3O8Z A;  2PCB B;  1X79 B;  2OGU A;  1LWU C;  2B87 B;  3TF5 A;  3L73 J;  2OZ1 A;  2YO2 A;  3PJS K;  1R0Q A;  2B12 B;  2IYO A;  1ZOY C;  5CIC B;  4O1W A;  4N0K A;  4WB4 A;  3A3Y B;  3AED C;  1NU1 K;  1H31 B;  1C6S A;  1LTA C;  1SLQ A;  1NNO A;  2XZR A;  3ITK A;  2FYN B;  2Z4E A;  4OVN F;  1YYC A;  3VMA A;  1FDI A;  4NPF X;  5KLV J;  1BSH A;  1AYG A;  3V2N A;  2E75 B;  1HJ5 A;  1KV9 A;  4Q5P A;  5H2F E;  1EZV G;  2N1T B;  1PP9 G;  3IAO A;  3L4F A;  1OW6 A;  4C7N A;  1IFM A;  3EFF K;  3A0B V;  3Q3D A;  1SFC D;  5AVX B;  3SWS A;  3FXE A;  4N6J A;  1T3U A;  3TNU A;  1FJP A;  1PPJ G;  1X8Y A;  3G71 P;  1CYJ A;  1DD4 A;  4AAL A;  4WY4 B;  2JWA A;  5CCG D;  3Q5S A;  1SQQ K;  4MN4 C;  1QEX A;  1NTZ D;  1NTZ G;  1ZR2 A;  4L75 A;  2K88 A;  4W7Z A;  2EXV A;  4EYY Q;  1LT9 B;  4O1Q A;  2WPQ A;  3H1H G;  4PD4 H;  4C7N B;  1AVO A;  3QWO C;  1VDF A;  1P84 D;  1PP9 E;  3S4R A;  2HV4 A;  1I54 A;  2RKL A;  3RN0 A;  3CC7 P;  3CPW O;  2BCC G;  1G2C B;  1HRC A;  1NJI Q;  3BAT A;  2M5A B;  4JPZ B;  1RAP A;  3MZW B;  3A5T A;  2AIU A;  1OWA A;  1KQS O;  2HG5 D;  2WTY A;  1KC8 Q;  1L4A A;  1NTM K;  2E76 C;  1OW7 A;  2BAS A;  1FZG A;  2G8Y A;  3CCU P;  1BCC G;  2V07 A;  2K3R A;  2KIK A;  3KHU A;  3W68 A;  2W83 C;  3RN1 A;  3L71 J;  1NTM J;  1J1E B;  3IF4 A;  3JBT B;  3O5C A;  2Q5U A;  3WUT A;  1S5L E;  1JTH B;  3WMM 0;  2PCC B;  1SQX G;  4R4L A;  1K04 A;  1IRV A;  3AEF C;  4D6T G;  1URQ D;  4XYD B;  1Q7Y Q;  3M0D A;  1DD3 A;  3JSV C;  4DCK A;  3A0H H;  3VTP C;  3L70 D;  1S1C X; 
#chains in the Genus database with same CATH homology
 1N9C A;  1E29 A;  2GC4 D;  1YEB A;  4FA5 A;  2Y0E A;  5KKZ B;  2ORL A;  1CCR A;  1NMI A;  1FCD C;  1HCM A;  1BGY D;  1MG3 D;  1S5L V;  2BPB B;  4AX3 A;  1H1O A;  3OA8 B;  1FOC A;  1LS9 A;  4EIE A;  3O1Y A;  1SQQ D;  1QKS A;  5GTI V;  4UB8 V;  3PH2 B;  1IRW A;  3L75 D;  5TIS V;  2ZBO A;  5CIF B;  1L9B C;  1HRO A;  1CRY A;  1M6Z A;  1CNO A;  1HZU A;  3TGU D;  3ZOY A;  5CID B;  4FAN A;  451C A;  1YTC A;  2RMZ A;  2ZOO A;  3H1H D;  1CSW A;  4QAO A;  3GW6 A;  5CYT R;  1FI7 A;  4WQ7 A;  1GQ1 A;  1A56 A;  155C A;  2I8F A;  1YNR A;  4GYD A;  3CXH W;  4YE1 A;  3KZI V;  4H0K A;  3PTZ A;  2JQR A;  3HQ6 A;  3X39 A;  2ZXY A;  2MHM A;  4WQA A;  2QJK B;  2C1U A;  1HJ3 A;  4RJT A;  2YK3 A;  1DVH A;  4WQD A;  4U3F D;  2C2C A;  4JCG A;  3SLE A;  3RMZ A;  3HQ8 A;  3SXT A;  3TDK A;  2BCC D;  1C6R A;  2D0S A;  3RLM A;  1QN2 A;  1A2S A;  1NU1 D;  3BCC D;  1ETP A;  1SQB D;  2XTS B;  2N18 C;  1CSU A;  2AI5 A;  1N50 A;  2B4Z A;  3WUI A;  1GJQ A;  2N18 B;  1HH7 A;  4FA9 A;  5CIG B;  1H32 A;  2B10 B;  1BL9 A;  1CIH A;  4WQC A;  1PP9 D;  1DW1 A;  5E79 V;  4J20 A;  1IZL 0;  1I55 A;  3ORV A;  4DY9 A;  2ZZS 1;  1SQX D;  3ZBM A;  4FA4 A;  1CTZ A;  1U74 B;  3SVW A;  1LMS A;  2CXB A;  4PJ0 V;  3C2C A;  1YIC A;  1CRJ A;  2OZ1 B;  5EXQ A;  2BH4 X;  2FWL A;  4AAM A;  2LIR A;  2BCN B;  4L1Q A;  1GIW A;  3PXW A;  1PPJ D;  5C9M A;  2B0Z B;  3CX5 D;  4FAV A;  2MTA C;  3DP5 A;  3H1I D;  5DJQ B;  2C8S A;  5CIE B;  3TYI A;  2N9J A;  3PLN A;  1C2R A;  1CRH A;  1MZ4 A;  4PD4 D;  5H2F V;  1YIQ A;  2Y0D A;  1NML A;  5KAF V;  1DVV A;  4EIC A;  3WFD C;  2K9J B;  1H32 B;  2PAC A;  3ZCF A;  5B6Q A;  1YFC A;  2N9Y B;  4Y5R A;  3A0H V;  3VYM A;  1B7V A;  1F1F A;  1I5T A;  2AXT V;  2O3J A;  1YEA A;  4PWA A;  4FB1 A;  1CCH A;  4AAN A;  1CRI A;  5AUR A;  5B5E V;  1H9Y A;  5TJH A;  2BLF B;  2QG4 A;  1COR A;  2Q3E A;  1JDL A;  2CA4 B;  1QL3 A;  1CIG A;  3WC8 A;  1CSX A;  2DGE A;  1W2L A;  3DMI A;  1OAE A;  1L0L D;  1J3S A;  3MK7 B;  1WVE C;  1RZ5 A;  1CHJ A;  5B66 V;  2GC7 D;  1CYI A;  1E2R A;  3MK7 C;  3SJL A;  1FI9 A;  4WQ8 A;  2B11 B;  5IY5 1;  1CXA A;  1CYC A;  1NTK D;  1YCC A;  5DJQ C;  5C0Z A;  5KAI V;  5CIH B;  1DW3 A;  1WEJ F;  1QYZ A;  3GG2 A;  3H1K D;  1N90 A;  2LIT A;  3VNW A;  2QJP B;  1GKS A;  1FI3 A;  1BE3 D;  1SQP D;  4AAO A;  4A7P A;  3PXT A;  2CE0 A;  1FHB A;  4LJI A;  1COT A;  4XXL A;  1KB0 A;  1HJ4 A;  1LFM A;  4PW9 B;  1CSV A;  3L72 D;  1EZV D;  1C75 A;  1SQV D;  1RAQ A;  2YIU B;  4WQE A;  2KNC B;  3CXH D;  4L3G A;  2N9I A;  2A06 D;  3HQ9 A;  3NBT A;  1NIR A;  3WFC C;  5KLI B;  4EDF A;  2D0W A;  2VHD A;  4UB6 V;  3H1J D;  3ZOW A;  5GTH V;  5KLV D;  3WFE C;  1U75 B;  3OCD A;  4FA1 A;  1CXC A;  3WU2 V;  2PCB B;  1L9J C;  2GIW A;  5DFS A;  1MG2 D;  4K3I A;  1CIE A;  3TF5 A;  1CTY A;  3L73 D;  2OZ1 A;  1ZRT D;  1R0Q A;  2C9X B;  2B12 B;  1RZ6 A;  3M97 X;  2CA3 B;  1IQC A;  4RSZ A;  4L3H A;  1LC1 A;  4O1W A;  3VRD A;  5CIC B;  4IL6 V;  3L4O A;  1AOF A;  4N0K A;  1H31 B;  2RN0 A;  1C6S A;  3DR0 A;  1NNO A;  1CIF A;  1I8O A;  3ITK A;  2FYN B;  1C52 A;  1DIQ C;  3O20 A;  1K3G A;  1L0N D;  3ZOX A;  3VMA A;  2Y0C A;  1F1C A;  1AYG A;  1HJ5 A;  1CED A;  1KV9 A;  1I6D A;  1HZV A;  4Q5P A;  1A8C A;  4MU8 A;  3L74 D;  2L4D A;  1AOQ A;  3OA8 A;  4EIF A;  2KS1 A;  3ZOO A;  3A0B V;  3PHL A;  1H9X A;  1EB7 A;  1H33 A;  3SWS A;  3A9F A;  4WQ9 A;  1CYJ A;  4KMG A;  4AAL A;  5CIB B;  2JWA A;  1AKK A;  1CRC A;  1DII C;  4NFG B;  1FJ0 A;  4GED B;  4WQB A;  1H33 B;  1NTZ D;  1GU2 A;  2L91 A;  3PXS A;  2EXV A;  1CHI A;  4O1Q A;  1KX7 A;  4V2K A;  2IBZ D;  2N3Y A;  3CWB D;  4EID A;  2CE1 A;  1P84 D;  1N15 A;  1LC2 A;  2HV4 A;  1I54 A;  1K3H A;  1IO3 A;  1I8P A;  3O0R C;  1DW2 A;  1KYO W;  2BGV X;  2GB8 B;  2QJY B;  1KB9 D;  3RN0 A;  1CC5 A;  2C1D B;  1CO6 A;  1HRC A;  1OCD A;  3HQ7 A;  4H0J A;  2N3B A;  1VYD A;  3H1L D;  1RAP A;  1C6O A;  2FYU D;  2DVH A;  2AIU A;  1W5C T;  3CYT I;  1KX2 A;  1S6V B;  3NBS A;  2YCC A;  2C1D A;  2FRC A;  5DF5 A;  1C2N A;  3CU4 A;  1GDV A;  2YQB A;  2ZON G;  2V08 A;  2V07 A;  1DW0 A;  2C1V A;  4D6T D;  3KHU A;  1H31 A;  1M60 A;  3CP5 A;  1ZZH A;  3FWL A;  1KIB A;  3RN1 A;  3CX5 W;  3L71 D;  3WFB C;  1NTM D;  3OCD B;  1I6E A;  1CHH A;  3JBT B;  3O5C A;  351C A;  1C7M A;  1DT1 A;  2PCC B;  2BH5 X;  1QL4 A;  2JTI B;  3ZIY A;  1M70 A;  1E8E A;  3NWV A;  1CRG A;  1IRV A;  3L4M A;  4XYD B;  3PRJ A;  1BCC D;  1CTJ A;  1KYO D;  3L70 D;  4P4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...