3L74D

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l74D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l74D02
3NBTA 3DMIA 1KB9D 1SQQD 3A0BV 5CIEB 1YCCA 1IQCA 1HCMA 4MU8A 5KAFV 1YEBA 4Q5PA 5B6QA 1OCDA 1CHIA 4Y5RA 3OCDB 1CIGA 3CX5W 2YIUB 1S6VB 1CSUA 2O3JA 1ZRTD 3O5CA 3L4MA 5TISV 2C1VA 1W5CT 1FI9A 1CEDA 4O1QA 1KYOW 4AANA 1CIFA 3GW6A 3DP5A 1CHJA 3A0HV 3CWBD 1F1CA 4YE1A 3C2CA 1CSXA 1CTJA 5H2FV 1H32B 2ZZS1 2GC7D 1U75B 2LIRA 1I8OA 4PW9B 2CA4B 5CYTR 2CE1A 3SVWA 2HV4A 2BPBB 2OZ1A 1SQXD 2XTSB 1A8CA 4XXLA 4L1QA 3ORVA 4WQ8A 1BL9A 1FCDC 2CE0A 1MG2D 3O0RC 3TGUD 1I6DA 3L70D 1IRVA 1I8PA 1CIHA 3SJLA 1I6EA 3HQ7A 5DFSA 1N90A 2FWLA 3CXHW 3RLMA 1RAQA 1HJ4A 2C1UA 1C52A 1NTMD 3CX5D 2D0SA 1HJ3A 1GJQA 4WQBA 1PP9D 1QYZA 1FOCA 1LC1A 2BCCD 3RN1A 4FA4A 2ZOOA 2C8SA 3ITKA 3WFBC 2B11B 1KYOD 1I5TA 3WFEC 4FA9A 2FYUD 1FHBA 1H31A 1CTYA 1C75A 1C6RA 2C2CA 4QAOA 1RAPA 2N3BA 1BGYD 3L72D 1DW1A 1NTZD 4DY9A 4FAVA 4V2KA 1FJ0A 2YK3A 2AXTV 5KKZB 1DW2A 1H33B 4WQAA 1PPJD 1C2RA 2VHDA 1I55A 1DIIC 2JTIB 5KLIB 1KV9A 3HQ6A 2OZ1B 4AAOA 3H1ID 3ZOOA 3O20A 1QL4A 1AYGA 4FANA 4EIDA 2MTAC 3SXTA 2B12B 5CIFB 4UB8V 4AALA 1AKKA 2QJYB 2PCBB 1E29A 3CP5A 1NMLA 1WEJF 1K3GA 3DR0A 2V08A 3H1JD 1HZVA 1L9JC 1YIQA 3KZIV 2FRCA 1CSVA 1CTZA 3TYIA 4AAMA 1NNOA 1P84D 2DGEA 2GC4D 451CA 2BH4X 1AOQA 3ZBMA 1IO3A 155CA 4JCGA 3L75D 1NTKD 2Q3EA 1M6ZA 5KLVD 1F1FA 1CNOA 2N3YA 2L91A 3ZOXA 5DF5A 2JQRA 4PD4D 3OA8B 5GTIV 1C2NA 5TJHA 1N15A 4PWAA 5DJQB 1CYJA 1GKSA 3PHLA 3M97X 4N0KA 4L3GA 2V07A 1E8EA 1DVHA 1DT1A 5C9MA 2AIUA 1LS9A 1QN2A 1KX7A 3RMZA 1CHHA 1YICA 1W2LA 1CRCA 3CXHD 4WQ9A 4RJTA 4WQCA 3OA8A 3CYTI 1E2RA 1RZ5A 4EIFA 2QG4A 2PACA 2MHMA 5GTHV 1HH7A 3A9FA 1N9CA 2PCCB 1CSWA 3VMAA 1H9XA 4EICA 1JDLA 3TF5A 5CIGB 1KB0A 1OAEA 2DVHA 2JWAA 3L73D 1FI3A 2C1DA 1CCRA 1CCHA 2Y0CA 2ZXYA 1HROA 5CIBB 5B66V 1HRCA 1R0QA 1GIWA 4XYDB 3SLEA 3WC8A 5CIDB 2N9IA 4EIEA 3VNWA 3PTZA 4KMGA 1AOFA 5B5EV 2L4DA 1N50A 3WUIA 3H1LD 3NBSA 2C9XB 1H9YA 1IZL0 1YNRA 3ZOYA 3TDKA 4RSZA 2IBZD 1QL3A 1CRGA 1M70A 1EZVD 3HQ8A 1DVVA 4L3HA 1HJ5A 1MG3D 3O1YA 1LFMA 4H0KA 1HZUA 1LC2A 4PJ0V 2EXVA 3H1HD 2N18B 3VYMA 2KS1A 2I8FA 1S5LV 1GQ1A 2RN0A 1MZ4A 1J3SA 1DIQC 1QKSA 1EB7A 4FB1A 1CRIA 1LMSA 2RMZA 3CU4A 4FA5A 4H0JA 1BE3D 4FA1A 1C6SA 4K3IA 1BCCD 2BLFB 1H32A 4A7PA 3ZOWA 4AX3A 1L9BC 1C7MA 1DW3A 1NMIA 1NIRA 2GB8B 5KAIV 2YQBA 1C6OA 2K9JB 3PLNA 2B4ZA 1FI7A 4GEDB 1I54A 2ORLA 4WQ7A 1CYCA 4NFGB 1SQPD 3L71D 1ETPA 1B7VA 1VYDA 1DW0A 5AURA 2CA3B 1WVEC 3FWLA 3OCDA 3NWVA 4LJIA 3H1KD 1GDVA 3KHUA 1A56A 1CRHA 1CYIA 1L0LD 4P4QB 2Y0DA 2YCCA 1NU1D 3WFCC 2QJPB 2A06D 3SWSA 351CA 4D6TD 1SQBD 1YEAA 5CICB 1CXCA 4WQEA 2BCNB 2AI5A 2KNCB 4EDFA 3WFDC 1CIEA 1CRJA 1H33A 2ZBOA 1H1OA 1ZZHA 1CRYA 2BGVX 4J20A 1A2SA 2GIWA 1H31B 1U74B 1COTA 1YFCA 3PXWA 5DJQC 3VRDA 2C1DB 2FYNB 1YTCA 2B10B 3L4OA 3RN0A 3MK7C 3HQ9A 1GU2A 4UB6V 1CO6A 3L74D 4O1WA 2CXBA 5CIHB 2B0ZB 3MK7B 2N18C 1CC5A 2N9YB 2N9JA 2D0WA 4GYDA 1CXAA 3WU2V 1RZ6A 1CORA 3PXSA 5E79V 3PRJA 2ZONG 4U3FD 4IL6V 2Y0EA 2LITA 1L0ND 3X39A 2QJKB 3BCCD 2BH5X 5IY51 3GG2A 3JBTB 3ZCFA 5EXQA 5C0ZA 1IRWA 3PH2B 1M60A 1KIBA 1SQVD 3PXTA 1KX2A 1K3HA 3ZIYA 4WQDA
chains in the Genus database with same CATH superfamily
1KB9D 1PPJE 4L76A 2D2CC 3A0BV 2YXQB 2WSSH 2OQQA 3GMAA 1S5LH 1X8YA 1YEBA 2V4HA 5AW4B 2FYUE 1OCDA 1NU1G 1CHIA 3BRTB 4YXDC 3B5NB 2L5GB 2Q5UA 1WMKA 2B88A 2W90A 3L4MA 4WWIA 2FBWC 2WSEH 2O01J 3OW2O 1IFPA 2IBZE 5KLIC 1FC2C 1HH0A 2BASA 3KZIH 1N73A 1H0TB 2KSEA 3C2CA 5H2FV 3VMYA 1QX8A 3MTUE 1I8OA 5CYTR 1BSNA 2OYIC 1SLQA 2OZ1A 1A8CA 4XXLA 4L1QA 3A0BH 5AVTB 1I8PA 2AEFA 3HQ7A 5DFSA 1JY3P 1PGPA 3RBXA 3A0HE 3CCVP 1RAQA 1IFMA 5APXA 1OW6A 2ZAEB 3CX5D 2WSEJ 2I8DA 1HJ3A 1USEA 2P1JA 1RHZB 1N73B 1H0TA 2ZOOA 2C8SA 1GU5A 1I5TA 1JY3N 1VQMP 1CI6A 1JNMA 1FHBA 2ZYDA 1H31A 2J5UA 1L4AD 2C2CA 4WB4A 4QAOA 1JMMA 1RAPA 2N3BA 3L72D 3BASA 3BRVB 2MKVA 1QL2A 1RF0C 4V2KA 1YJWP 1DW2A 2VHDA 1I55A 2E74B 3SWYA 1VF5D 1W5CE 5AVWB 1IFJA 3CXHH 3L75J 1RF1B 3AEDC 3HE5B 2M5AA 4W80A 3KXDA 1QL1A 4UB8V 1AKKA 2XDJA 3CP5A 1M1JA 5B5EH 5KLVE 1VQ4P 1OWAA 1L9JC 4M3LA 3WUUA 3KZIV 1CTZA 1SVFA 3TYIA 2QM8A 1DX7A 2KB7P 1FZAA 2DGEA 2GC4D 1FOSF 5APWA 3H1KJ 2JDIH 5AW6B 2POHA 3H6PA 3CCEP 5AVZB 3Q5PA 4DCKA 3CXHE 1FDIA 1NTMG 2Q3EA 4N3YB 2OYHA 5KLVD 1CNOA 2KOGA 2L91A 3ZOXA 3H1JE 3D70A 5DF5A 5GTIV 1EXIA 4ZKPA 2K3RA 3LW5J 1N15A 3AEGC 4U7JA 3P8MC 4GOFA 1YBKA 2GM4A 3M97X 1H88A 1Q7YQ 3AEEC 4WY4D 4JYBA 3G71P 3I5CA 1S5LX 1SQPK 1E8EA 2HODA 5C9MA 3L72J 1NTMJ 3AE7C 1LS9A 1SQPE 2E75C 1QN2A 1FZCB 1KX7A 2H43A 2OYHC 3CI9A 1ZLLA 2E43A 2YKPA 1FJKA 1NTZG 2KLVA 2UWJE 3H1HJ 1HH7A 2JJLA 2KLUA 3A9FA 2PCCB 3H1KG 2ZT9B 2A45H 2E74C 1KILE 1VQLP 1NU1K 2FXOA 3H25A 1FI3A 1U7JA 3TGUJ 1CCRA 4C7RA 1Q90D 1YTZI 1DD3A 1Z56A 1NYHA 1HRCA 1EDIA 1RF1C 1R0QA 1SP4A 4O9BA 1GIWA 3RK3B 3WC8A 2N9IA 4KMGA 1AOFA 5B5EV 1M1JB 1BCCE 1PV3A 2R3CA 5KTBA 2PFXA 3KZIE 1KB9I 3HE5A 2N1TD 3TK1A 2R5DA 3O1YA 2C9LY 4H0KA 2NPSC 3AE2C 1LC2A 2N18B 2RN0A 1KQLA 1VQ8P 3GF7A 1DIQC 3H1HG 3U1AA 1QKSA 1YQ4C 2M8RA 2J59M 1VPCA 1ZMEC 2N1TA 1R5LA 4FA1A 2W27A 1C6SA 4K3IA 3V5BA 2K88A 1H32A 4A7PA 3ZOWA 4IFMA 3AE4C 1L0NJ 2YQBA 4YPCA 1C6OA 3VP9A 3QWOC 4TLFA 4L74A 1SQPD 2WPRA 3L71E 5CHXA 1EDLA 1PL5A 3AE8C 3MIWA 3OCDA 3HUSB 5GTHE 3KHUA 1CRHA 3IF4A 1FU1A 2Y0DA 3RL0D 2YCCA 1NU1D 1IK7A 2HG5D 2Q9IA 1SS1A 4ASWA 351CA 4C7NB 5APUA 2K1AA 1SQBD 1VQNP 4JQ0D 1L4AC 1QLED 5AVSB 2KNCB 2NPSA 3L70G 1GU4A 5DJTB 3NXSA 1LTGC 1YJ9P 1CIEA 1CRJA 2XZRA 1LT9C 1OFCX 1N7SB 2FY8A 1SQVK 1D7MA 3GF3A 2BGVX 4AQRD 3RK2D 1U74B 1GTWA 3CMAP 3M9BA 3RN0A 2J58A 2FYUK 3VMZA 4UB6V 1VQPP 1OW8A 2CXBA 3M06A 5CIHB 1LTBC 3CC7P 2D2CD 3MHVA 1S9KE 3NTNA 4WY4B 1OVVA 3C8VA 2YKQA 3BCCD 1YIJP 3VYIA 1PP9E 2BH5X 4I7ZC 3JBTB 3ZCFA 2JEEA 1BDCA 1LTIC 1KYOI 1OZHA 1T2KD 1ZR4A 5H2FE 1IJDB 1JY3O 2VRSA 3H32B 1GK6A 1K3HA 1M7LA 2PAJA 1NTZK 4OGQC 1SQQD 1YCCA 1PGOA 2E5TA 4MU8A 1JTHA 1QEXA 3W67A 4Q5PA 3L73E 3ZDMA 4Y5RA 1YYCA 3OCDB 1T3UA 3D0WA 2YIUB 3JSVC 3G6EP 1J1EC 5TISV 1NJIQ 2C1VA 1NTKK 1J2JB 1FI9A 1CEDA 1IK9A 1FZCA 2B87B 1KYOW 2HPCB 4AANA 1CIFA 3DP5A 1CHJA 4N78D 3CWBD 1F1CA 2WTYA 1KFNA 2E74D 2CA4B 1JUNA 3UIAA 1Q86Q 1SFCC 2BPBB 3H1HE 1SQXD 4BXLA 4WQ8A 1NOHA 1MG2D 2YO2A 3TGUD 1G1JA 1I6DA 3L70D 1BSHA 3QH9A 1L4AB 2OYIA 2FWLA 1UIXA 3L74G 1HJ4A 1KV4A 2D0SA 1MV8A 1LT9B 1GJQA 2V7QJ 4WQBA 1RF0A 3ITKA 2YMKA 2Z5HA 5AW3B 1FDMA 1CTYA 1C75A 2WSFH 3IN6A 1S1CX 1EXJA 2O01N 4LLHA 3M9HA 1NTZD 2BEQD 4FAVA 2Q7CA 2YK3A 1K73Q 5C39A 2AXTV 5KKZB 1NU1J 3OAKA 3FXEA 1LWUB 1C2RA 2E76D 3RK2B 1KV9A 4AAOA 1SQBE 3LIDA 2WT7B 1BDDA 3O20A 4OGQB 1KD1Q 4FANA 1A02J 1FZGA 3L74J 3CCUP 4EIDA 3L70E 4YTPC 2FFDA 1CW5A 3VTPC 2B12B 5CIFB 2PCBB 3SSUA 1L0NE 1ZN5A 3H32A 1NMLA 5TISH 1ZW0A 2LXCB 2JR8A 2OTJP 1DIPA 2P2UA 1AVYA 2V08A 3RGUA 2JP3A 4NPEA 1HTLC 5KKZC 3G3ZA 1FBMA 2IZ0A 2FRCA 4EIJA 3PH0A 4AAMA 2BCCJ 1NNOA 1GMJA 4U3FJ 2E75D 1PFIA 451CA 2BH4X 1AOQA 3CC2P 3L71G 5GTHH 1JO5A 1NTKD 3U59A 3JC22 1M6ZA 1F1FA 2N3YA 2FFDB 4PD4D 2YXRB 3OA8B 1KB9H 1C2NA 5TJHA 1QVGO 2M0BA 4HJGH 1M8OB 1KYOH 1L0LG 1JM0A 1CYJA 5TISE 4W7YA 3IFMA 5BU5A 2R5BA 2FKWB 2V07A 1NAYA 3WUTA 2IX7C 3GLMA 3S9OA 2V7QH 1YICA 4H0LB 2NZ2A 4Y99C 1W2LA 4LC1A 4WQ9A 2AEMA 1AQ5A 1JMBA 4U3FG 2W6AA 3PJSK 1N9CA 1ZRTE 1CSWA 2AXTH 2JWDA 3VMAA 2HLOA 2QIWA 4EICA 3L73G 1JDLA 2IBZG 3TF5A 1NTMK 3CPWO 1JEKA 1KYOE 1YITP 3G4SP 2M5AB 4GKGA 1N7LA 4Y28J 1KILA 1A02F 3RK3D 4EIEA 4ASVA 3PTZA 3C1LA 1SQQG 4H13B 1N50A 3WUIA 3H1LD 2FYNC 1H9YA 1IZL0 2QJKC 3TDKA 2WWWA 3IAOA 1JB0J 4JPZB 1M70A 3LW5H 4H13D 4I7ZB 2ZT9D 4L3HA 1HJ5A 1MG3D 2AXTE 3VYMA 2EXVA 1U57A 2FXPA 2PGDA 2KS1A 1N86A 1GL2C 4UB6E 1J3SA 3U1CA 1N2DC 1IC2A 2WMMA 3P32A 4B86A 1CRIA 3N7NA 2RMZA 4KT0J 1IZNB 2QM7A 3L73J 1AFOA 2WSCJ 4FA5A 2GUSA 1QVFO 4H0JA 1BE3D 5KJ7D 1OW7A 2FXMA 1BCCD 2BLFB 3RL0C 1JCCA 1C7MA 1L0NK 1DW3A 1NMIA 2K9YA 3KPEA 1I54A 5AW2B 2ORLA 1T6AA 1CYCA 1N7SC 3W68A 2Q6QA 4H0LD 4H44C 3L71D 3V2QA 1B7VA 5AVYB 2H8PD 5AURA 3CXHI 1VQ6P 1CZQA 1M57D 3BCCE 3CCSP 4LJIA 3H1KD 4I6MC 2QJPC 1SFCD 3TNUA 4P4QB 4OWFA 3HRNA 1RE4C 2C9NY 3CCQP 1TU3F 1IFDA 2A06D 3SWSA 1HF9A 1RF1A 3V2PA 1MZ9A 5E79H 2R44A 3V6IA 3L71J 2RH0A 1RE3C 1HVVA 1FZCC 2LR2A 1MFTA 2E75B 3FWNA 5AW8B 4EDFA 2E42A 5AVUB 1LWUA 3M0DC 3L72E 3LIEA 1NTKE 4NPFX 3HE4A 1SFCA 1VF5B 2HYNA 1NU1E 1COTA 3VRDA 1T2KC 1YTCA 3MK7C 3NFQA 1CO6A 3L74D 3M91A 1BGYG 2E76C 1SQVG 2QJYC 1E79H 4OGQD 4GODA 1CXAA 3WU2V 3TGUE 3H1LG 1RZ6A 1UIIA 3D71A 2E76B 3PRJA 4U3FD 2Y0EA 1SQXE 1NO4A 1L0ND 4OVNF 5CCGA 3BCCG 3N4XA 1FE6A 4N6JA 3AE6C 1NAFA 3PXTA 1WT6A 2KXPB 4WQDA 3NBTA 3DMIA 1L0LK 1BE3G 1EDKA 3S4RA 1MFZA 1NTZE 1IQCA 1HCMA 3TNUB 1NWQA 5KAFV 1CIGA 3CX5W 1EC5A 1PGJA 3KQGA 3CCLP 3H1LJ 1USDA 1KB9E 2Y9ZA 4O1QA 1L4AA 3WMM0 3GW6A 3B5ND 4DJGA 4YE1A 4WY4A 1CSXA 1DD4A 3S1KA 4BWNA 1URQC 1DEEG 1FDOA 2ZZS1 1NKZB 2GC7D 1U75B 1EZVI 3EFGA 2H89C 2LIRA 4PW9B 5CCHA 2Q3IA 2HV4A 1SQBK 1EZVG 1LNQA 3ORVA 1BE3J 1VF5C 1GZLA 1BL9A 2G3AA 2XU6A 3Q2YA 1KILB 1SQXG 2Y9YA 3SJLA 2E5YA 1I6EA 2OYOA 3CWBE 3RLMA 3CXHW 2C1UA 1C52A 1NTMD 2ITAA 3JCUH 3CLQA 2WT7A 1YHQP 1FOCA 1LC1A 2BCCD 2IBZI 2I1JA 2FYUG 3CL3D 3OA7A 2IPPA 2B11B 4AYCA 1C6RA 4DY9A 1RY3A 3BVHA 1FJ0A 2ZT9C 2HPCA 3L37A 3V4QA 3B8EB 1Q82Q 1H33B 2HODB 1PPJD 1L0NG 1NVOA 5KJ7C 2JTIB 1SQQK 2G8YA 3Q1MA 1RE4A 2W6JH 1K04A 1K9MQ 1RQUA 1S3JA 3ZOOA 2D2CB 3CCMP 3R4YA 4UB6H 1AYGA 2QEXP 4ZKUA 2WVRA 3H1IJ 1Q81Q 5E79E 4IL6X 2KP8A 2MTAC 3SXTA 2XNDH 4AALA 4K3AA 4R4LA 3AE9C 3CWBG 1N7SA 1S9KD 5DJUB 3PP5A 4K35A 1GDTA 1URQA 1IFNA 3DR0A 3E1RA 1SQBJ 4WBAA 1N7SD 3HUSA 4Y99B 4L75A 3BCCJ 3FGAD 2IZ1A 5AVRB 3L70J 5AW9B 1E5WA 1IO4A 3KDPB 1IO3A 155CA 4D6TE 2ZYAA 4JCGA 3L75D 2LXBA 3CX5H 2KIKA 1OVRA 1HBWA 3EQ2A 1GL2A 1VQOP 1M90Q 1OVUA 1R5SA 1P84H 2IYOA 4PWAA 2ZYGA 1T8ZA 1GW3A 3PHLA 4U3FE 4PD4H 4N0KA 2XNXA 1DVHA 1H89A 5BU8B 1DT1A 4GIFA 3Q5SA 2AIUA 2BCCG 1SQVE 4TT3H 2XV5A 1J1DC 2N1TC 2AEJA 1KTMA 3EFFK 3CXHD 2NPSD 2H7HA 4JBZA 4WQCA 3AE3C 1LTJC 1E2RA 1RZ5A 4EIFA 2XKMA 2QG4A 3CX5E 2ZXXA 2MJZA 1X0TA 1H8AA 5AW1B 1H9XA 5CIGB 1KB0A 1OAEA 2C0XA 2HFED 5AVQB 2C1DA 1CCHA 2ZXYA 3L35A 1GL2D 1XTGB 1SQXJ 2QSIA 3USSA 4XYDB 1KN7A 3VNWA 5M1BA 1W2BO 4GDOA 5KLVK 2N1TB 3F89A 2FYZA 2JO1A 2O01H 4WY4C 4JYCA 3NBSA 1YNRA 3ZOYA 2IBZD 1GD2E 2B9BA 4HH2A 4EOTA 2PP6A 1HZUA 4PJ0V 1LT1A 4H44D 3HD7D 3TYYA 2P58A 3A3YB 1VDFA 3HTKA 1EB7A 4FB1A 3HD7A 2KUBA 3CU4A 2AXCA 3O6QB 2Z4EA 1KZUB 1SQQJ 1ZP0C 3L74E 4AX3A 3SFEC 4IL6E 1URQB 1URQD 3JCUE 1LJ2A 1VQKP 3H1IG 5AW5B 2K9JB 2B4ZA 1FI7A 4WQ7A 1HWTC 1ETPA 1VYDA 1WRGA 1KMIZ 2CA3B 3A2AA 2IFMA 1WVEC 5AVXB 2QE7H 2WQYC 2ZVOB 3NWVA 2BCCE 2K37A 4BRYB 1GDVA 4XFJA 4H44B 1BCCG 1KC8Q 1L0LD 1S5LE 3I56P 2R32A 1LTSC 1N8RQ 2YO3A 2A45I 1AQTA 2W83C 3CC4P 4LGDE 4D6TD 2A06E 3AEAC 2GUVA 1LTTC 3GHGC 2P10A 4WQEA 1NHLA 2BCNB 3KYQA 1YTZT 2BEZF 4XE5B 3WFDC 1GL2B 1H33A 1LP1B 1BGYE 2ZBOA 2N9BA 3CCJP 1H1OA 4L73A 1LWUC 5APQA 1CRYA 2JKVA 4KJMA 1A2SA 2GIWA 2KZJA 2SPZA 2C0WA 3PXWA 4RO0A 3K5BA 2FYNB 2W8ZA 2B10B 2IFNA 3HQ9A 1GU2A 2P67A 4O1WA 1YQ3C 2ZFCA 3L72G 2B0ZB 3TGUG 3MK7B 1CC5A 1HGZA 2N9YB 2B87A 1HJBA 3VMXA 3SFDC 2OYIB 1MKMA 1CORA 2QRXA 3PXSA 1ZR2A 5E79V 2ZONG 4IL6V 1T3JA 4OH8B 1EDJA 3FX0A 2QJKB 2WSFJ 5CCGC 1NTZJ 1LP1A 3GG2A 1SQPG 2A06G 1CI6B 2P7JA 4D6TG 4PD4E 3A7OA 2IYPA 3BATA 1M60A 1YI2P 3HTKB 2O1JA 3H1LE 2ZJSE 4ZMDA 1L2PA 4I2LC 1JCDA 3GHGA 1L0LJ 4PJ0E 2KK7A 1PZQA 1LTJB 3RK2C 1HJ0A 3B5NC 3H1KE 2K9JA 5CIEB 4CPGA 5AW0B 4D6TJ 3AE5C 1HUCA 5B6QA 2I1KA 1JY2N 4ZNCA 4N78E 1S6VB 1CSUA 2O3JA 1ZRTD 3A5TA 3O5CA 5CBOA 3MGNA 4HB1A 1W5CT 4DZOA 4W7ZA 2QA4P 1P84E 1RE3A 2OTKE 4GT1A 1SQXK 2OGUA 1SQPJ 3HUSC 3CD6P 3P8CE 4RESB 3A0HV 2WPSA 2WSCH 1JY2P 1CTJA 2KSJA 1H32B 4EYYQ 3O8ZA 4BRYA 3G9RA 4HKZH 4WVZA 2CE1A 3SVWA 4RKUJ 2XTSB 1FCDC 2CE0A 3O0RC 1IRVA 1PGQA 1CIHA 1N90A 2H88C 1OX3A 3P7KA 1KORA 3B71A 3D6ZA 3RL0B 5L8RJ 4UB8H 5GTIE 1HGVA 3RK3E 2M3EA 3MZWB 4XA4A 4I1LA 5KAFH 1PP9D 1QYZA 3RN1A 3E7KA 1Q2NA 4FA4A 3WFBC 1KYOD 3AEBC 3WFEC 4FA9A 1G2CB 2FYUD 3B4SA 2CPBA 1BGYD 1NTKJ 1OXZA 1DW1A 1KILD 3CCRP 1ZXGA 3F5HA 5EFWB 4WQAA 2GA1A 1DIIC 3T97B 5KLIB 3E1IA 3HQ6A 5KLVJ 2OZ1B 3H1ID 1ZOYC 1QL4A 1GK4A 5CMZA 4GOEA 3MUDA 2YNYA 5B66E 1LTJA 3RL0g 1OMIA 2QJYB 1VQ7P 5CCHC 1E29A 1RH5B 1FZBA 3FXDA 4PV1C 1S4XA 5KLVG 3SWKA 2IDBA 1PPJG 1WEJF 1G1IA 2OARA 4KHXA 1K3GA 5CBNA 3H1JD 1HZVA 1YIQA 2CPSA 1CSVA 1OIPA 3WU2E 3Q5RA 1KFMA 3H1IE 2KYVA 3EWKA 1P84D 1LGHB 2FFDC 5BVZA 1NTME 1FAVA 3M0AA 3ZBMA 3L36A 3SWFA 1M1JC 2FYUJ 2JQRA 1FZEA 1QGKB 2HR3A 2DW3A 1K05A 3B5NA 2R3SA 3RK3C 5DJQB 2LKMA 1GKSA 1VL2A 2A45G 4L3GA 1BGYJ 4IFFA 2OTLP 2KI7B 3M9QA 4H13C 1FOSE 2B89A 3RMZA 1CHHA 1NKNA 2QVAA 1LTAC 4DOJA 1CRCA 1DH3A 2YIUC 4RJTA 3NMDA 3OA8A 3CYTI 1FJPA 1J1DB 3HD7B 1VQ5P 2PACA 2MHMA 5GTHV 3A0HH 1BE3E 2OYHB 3WUVA 2WITA 1KQSO 3T97A 3MD0A 4MN4C 4QMAA 2DVHA 3D6YA 1Y9BA 2JWAA 3L73D 1SQVJ 3HD7C 3CWBJ 1JOCA 2Y0CA 2KS1B 1HROA 5CIBB 5B66V 1RQVA 3AE1C 1JY2O 3VN0A 2YMYA 2CK3H 1SQBG 3SLEA 5CIDB 5AVVB 1MUUA 1EQ7A 4PD4I 1G2CA 1AA0A 1NGMB 1Y47A 5APSA 4H0LC 2KZIA 2L4DA 1Y8AA 1FS0E 3I55P 3P8CD 2C9XB 4RSZA 1QL3A 1LT9A 1CRGA 1EZVD 3HQ8A 1VQ9P 1DVVA 1LFMA 1SFCB 2ZVNB 3CX5I 3H1HD 5APYA 2I8FA 1S5LV 1GQ1A 1MZ4A 3A0BE 1NTKG 1EZVE 4PJ0H 2KNCA 1KQGB 2NPSB 2WZ7A 1LMSA 5APTA 1X9VA 4YXWH 1PIXA 3VP8A 4R4MA 2Z5IA 1CSBA 3L75E 1M1KQ 4UB8E 5GTIH 2RKLA 3MUDC 1L9BC 4DT0A 1NIRA 2GB8B 5KAIV 5KAFE 3VOPA 3PLNA 4GEDB 5H2FH 3V2RA 1K8AQ 4NFGB 2YKOA 2ZXEB 1KQFB 5KJ7A 4IOIH 1DW0A 3OJAB 1NH4A 3RBZA 3FWLA 5AW7B 1SQQE 3TSIA 4IFDK 1A56A 1AVOA 1ZV8A 1CYIA 1JTHB 2WPQA 4JF7A 3R2PA 3WFCC 2QJPB 4NPDA 1J1EB 1N73C 3II6A 3H1JJ 1YEAA 1DEBA 5CICB 1S2EA 1CXCA 4C46A 4AUWA 1IFIA 2NRGA 5APVA 2AI5A 1X22A 1S72P 4Z1MH 5B5EE 5KAIH 1GW4A 3M0DA 1ZZHA 5CCGD 3V2NA 1AV1A 4J20A 1H31B 3WU2H 5K5GB 1YFCA 1PP9J 5DJQC 1W2EA 2C1DB 1KILC 5CJ4A 4HYTB 3L4OA 2W6BA 2M3BA 3L75G 2Q1KA 1YJNP 3IR9A 3AEFC 2N18C 5CCHD 3AECC 1AJYA 2N9JA 3V4WA 2D0WA 4GYDA 3GHGB 1L0LE 3H1JG 3HE4B 1PP9G 2O1KA 2LITA 3O6QA 4C7NA 1XTCC 4EI2A 1X79B 3X39A 3MP7B 5B66H 5KAIE 3CMEP 3ABVC 4IL6H 1R8EA 5IY51 1M56D 3L4FA 5EXQA 3Q3DA 5C0ZA 1IRWA 1U7MA 1P84I 4PV1D 1BCCJ 3C9IA 3PH2B 1FZFA 4PV1B 1KIBA 1SQVD 1KX2A 2PRRA 3ZIYA 2WPVB 5CJ0A
chains in the Genus database with same CATH topology
3NBTA 3DMIA 1KB9D 1SQQD 3A0BV 5CIEB 1YCCA 1IQCA 1HCMA 4MU8A 5KAFV 1YEBA 4Q5PA 5B6QA 1OCDA 1CHIA 4Y5RA 3OCDB 1CIGA 3CX5W 2YIUB 1S6VB 1CSUA 2O3JA 1ZRTD 3O5CA 3L4MA 5TISV 2C1VA 1W5CT 1FI9A 1CEDA 4O1QA 1KYOW 4AANA 1CIFA 3GW6A 3DP5A 1CHJA 3A0HV 3CWBD 1F1CA 4YE1A 3C2CA 1CSXA 1CTJA 5H2FV 1H32B 2ZZS1 2GC7D 1U75B 2LIRA 1I8OA 4PW9B 2CA4B 5CYTR 2CE1A 3SVWA 2HV4A 2BPBB 2OZ1A 1SQXD 2XTSB 1A8CA 4XXLA 4L1QA 3ORVA 4WQ8A 1BL9A 1FCDC 2CE0A 1MG2D 3O0RC 3TGUD 1I6DA 3L70D 1IRVA 1I8PA 1CIHA 3SJLA 1I6EA 3HQ7A 5DFSA 1N90A 2FWLA 3CXHW 3RLMA 1RAQA 1HJ4A 2C1UA 1C52A 1NTMD 3CX5D 2D0SA 1HJ3A 1GJQA 4WQBA 1PP9D 1QYZA 1FOCA 1LC1A 2BCCD 3RN1A 4FA4A 2ZOOA 2C8SA 3ITKA 3WFBC 2B11B 1KYOD 1I5TA 3WFEC 4FA9A 2FYUD 1FHBA 1H31A 1CTYA 1C75A 1C6RA 2C2CA 4QAOA 1RAPA 2N3BA 1BGYD 3L72D 1DW1A 1NTZD 4DY9A 4FAVA 4V2KA 1FJ0A 2YK3A 2AXTV 5KKZB 1DW2A 1H33B 4WQAA 1PPJD 1C2RA 2VHDA 1I55A 1DIIC 2JTIB 5KLIB 1KV9A 3HQ6A 2OZ1B 4AAOA 3H1ID 3ZOOA 3O20A 1QL4A 1AYGA 4FANA 4EIDA 2MTAC 3SXTA 2B12B 5CIFB 4UB8V 4AALA 1AKKA 2QJYB 2PCBB 1E29A 3CP5A 1NMLA 1WEJF 1K3GA 3DR0A 2V08A 3H1JD 1HZVA 1L9JC 1YIQA 3KZIV 2FRCA 1CSVA 1CTZA 3TYIA 4AAMA 1NNOA 1P84D 2DGEA 2GC4D 451CA 2BH4X 1AOQA 3ZBMA 1IO3A 155CA 4JCGA 3L75D 1NTKD 2Q3EA 1M6ZA 5KLVD 1F1FA 1CNOA 2N3YA 2L91A 3ZOXA 5DF5A 2JQRA 4PD4D 3OA8B 5GTIV 1C2NA 5TJHA 1N15A 4PWAA 5DJQB 1CYJA 1GKSA 3PHLA 3M97X 4N0KA 4L3GA 2V07A 1E8EA 1DVHA 1DT1A 5C9MA 2AIUA 1LS9A 1QN2A 1KX7A 3RMZA 1CHHA 1YICA 1W2LA 1CRCA 3CXHD 4WQ9A 4RJTA 4WQCA 3OA8A 3CYTI 1E2RA 1RZ5A 4EIFA 2QG4A 2PACA 2MHMA 5GTHV 1HH7A 3A9FA 1N9CA 2PCCB 1CSWA 3VMAA 1H9XA 4EICA 1JDLA 3TF5A 5CIGB 1KB0A 1OAEA 2DVHA 2JWAA 3L73D 1FI3A 2C1DA 1CCRA 1CCHA 2Y0CA 2ZXYA 1HROA 5CIBB 5B66V 1HRCA 1R0QA 1GIWA 4XYDB 3SLEA 3WC8A 5CIDB 2N9IA 4EIEA 3VNWA 3PTZA 4KMGA 1AOFA 5B5EV 2L4DA 1N50A 3WUIA 3H1LD 3NBSA 2C9XB 1H9YA 1IZL0 1YNRA 3ZOYA 3TDKA 4RSZA 2IBZD 1QL3A 1CRGA 1M70A 1EZVD 3HQ8A 1DVVA 4L3HA 1HJ5A 1MG3D 3O1YA 1LFMA 4H0KA 1HZUA 1LC2A 4PJ0V 2EXVA 3H1HD 2N18B 3VYMA 2KS1A 2I8FA 1S5LV 1GQ1A 2RN0A 1MZ4A 1J3SA 1DIQC 1QKSA 1EB7A 4FB1A 1CRIA 1LMSA 2RMZA 3CU4A 4FA5A 4H0JA 1BE3D 4FA1A 1C6SA 4K3IA 1BCCD 2BLFB 1H32A 4A7PA 3ZOWA 4AX3A 1L9BC 1C7MA 1DW3A 1NMIA 1NIRA 2GB8B 5KAIV 2YQBA 1C6OA 2K9JB 3PLNA 2B4ZA 1FI7A 4GEDB 1I54A 2ORLA 4WQ7A 1CYCA 4NFGB 1SQPD 3L71D 1ETPA 1B7VA 1VYDA 1DW0A 5AURA 2CA3B 1WVEC 3FWLA 3OCDA 3NWVA 4LJIA 3H1KD 1GDVA 3KHUA 1A56A 1CRHA 1CYIA 1L0LD 4P4QB 2Y0DA 2YCCA 1NU1D 3WFCC 2QJPB 2A06D 3SWSA 351CA 4D6TD 1SQBD 1YEAA 5CICB 1CXCA 4WQEA 2BCNB 2AI5A 2KNCB 4EDFA 3WFDC 1CIEA 1CRJA 1H33A 2ZBOA 1H1OA 1ZZHA 1CRYA 2BGVX 4J20A 1A2SA 2GIWA 1H31B 1U74B 1COTA 1YFCA 3PXWA 5DJQC 3VRDA 2C1DB 2FYNB 1YTCA 2B10B 3L4OA 3RN0A 3MK7C 3HQ9A 1GU2A 4UB6V 1CO6A 3L74D 4O1WA 2CXBA 5CIHB 2B0ZB 3MK7B 2N18C 1CC5A 2N9YB 2N9JA 2D0WA 4GYDA 1CXAA 3WU2V 1RZ6A 1CORA 3PXSA 5E79V 3PRJA 2ZONG 4U3FD 4IL6V 2Y0EA 2LITA 1L0ND 3X39A 2QJKB 3BCCD 2BH5X 5IY51 3GG2A 3JBTB 3ZCFA 5EXQA 5C0ZA 1IRWA 3PH2B 1M60A 1KIBA 1SQVD 3PXTA 1KX2A 1K3HA 3ZIYA 4WQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBT A;  3DMI A;  1KB9 D;  1SQQ D;  3A0B V;  5CIE B;  1YCC A;  1IQC A;  1HCM A;  4MU8 A;  5KAF V;  1YEB A;  4Q5P A;  5B6Q A;  1OCD A;  1CHI A;  4Y5R A;  3OCD B;  1CIG A;  3CX5 W;  2YIU B;  1S6V B;  1CSU A;  2O3J A;  1ZRT D;  3O5C A;  3L4M A;  5TIS V;  2C1V A;  1W5C T;  1FI9 A;  1CED A;  4O1Q A;  1KYO W;  4AAN A;  1CIF A;  3GW6 A;  3DP5 A;  1CHJ A;  3A0H V;  3CWB D;  1F1C A;  4YE1 A;  3C2C A;  1CSX A;  1CTJ A;  5H2F V;  1H32 B;  2ZZS 1;  2GC7 D;  1U75 B;  2LIR A;  1I8O A;  4PW9 B;  2CA4 B;  5CYT R;  2CE1 A;  3SVW A;  2HV4 A;  2BPB B;  2OZ1 A;  1SQX D;  2XTS B;  1A8C A;  4XXL A;  4L1Q A;  3ORV A;  4WQ8 A;  1BL9 A;  1FCD C;  2CE0 A;  1MG2 D;  3O0R C;  3TGU D;  1I6D A;  3L70 D;  1IRV A;  1I8P A;  1CIH A;  3SJL A;  1I6E A;  3HQ7 A;  5DFS A;  1N90 A;  2FWL A;  3CXH W;  3RLM A;  1RAQ A;  1HJ4 A;  2C1U A;  1C52 A;  1NTM D;  3CX5 D;  2D0S A;  1HJ3 A;  1GJQ A;  4WQB A;  1PP9 D;  1QYZ A;  1FOC A;  1LC1 A;  2BCC D;  3RN1 A;  4FA4 A;  2ZOO A;  2C8S A;  3ITK A;  3WFB C;  2B11 B;  1KYO D;  1I5T A;  3WFE C;  4FA9 A;  2FYU D;  1FHB A;  1H31 A;  1CTY A;  1C75 A;  1C6R A;  2C2C A;  4QAO A;  1RAP A;  2N3B A;  1BGY D;  3L72 D;  1DW1 A;  1NTZ D;  4DY9 A;  4FAV A;  4V2K A;  1FJ0 A;  2YK3 A;  2AXT V;  5KKZ B;  1DW2 A;  1H33 B;  4WQA A;  1PPJ D;  1C2R A;  2VHD A;  1I55 A;  1DII C;  2JTI B;  5KLI B;  1KV9 A;  3HQ6 A;  2OZ1 B;  4AAO A;  3H1I D;  3ZOO A;  3O20 A;  1QL4 A;  1AYG A;  4FAN A;  4EID A;  2MTA C;  3SXT A;  2B12 B;  5CIF B;  4UB8 V;  4AAL A;  1AKK A;  2QJY B;  2PCB B;  1E29 A;  3CP5 A;  1NML A;  1WEJ F;  1K3G A;  3DR0 A;  2V08 A;  3H1J D;  1HZV A;  1L9J C;  1YIQ A;  3KZI V;  2FRC A;  1CSV A;  1CTZ A;  3TYI A;  4AAM A;  1NNO A;  1P84 D;  2DGE A;  2GC4 D;  451C A;  2BH4 X;  1AOQ A;  3ZBM A;  1IO3 A;  155C A;  4JCG A;  3L75 D;  1NTK D;  2Q3E A;  1M6Z A;  5KLV D;  1F1F A;  1CNO A;  2N3Y A;  2L91 A;  3ZOX A;  5DF5 A;  2JQR A;  4PD4 D;  3OA8 B;  5GTI V;  1C2N A;  5TJH A;  1N15 A;  4PWA A;  5DJQ B;  1CYJ A;  1GKS A;  3PHL A;  3M97 X;  4N0K A;  4L3G A;  2V07 A;  1E8E A;  1DVH A;  1DT1 A;  5C9M A;  2AIU A;  1LS9 A;  1QN2 A;  1KX7 A;  3RMZ A;  1CHH A;  1YIC A;  1W2L A;  1CRC A;  3CXH D;  4WQ9 A;  4RJT A;  4WQC A;  3OA8 A;  3CYT I;  1E2R A;  1RZ5 A;  4EIF A;  2QG4 A;  2PAC A;  2MHM A;  5GTH V;  1HH7 A;  3A9F A;  1N9C A;  2PCC B;  1CSW A;  3VMA A;  1H9X A;  4EIC A;  1JDL A;  3TF5 A;  5CIG B;  1KB0 A;  1OAE A;  2DVH A;  2JWA A;  3L73 D;  1FI3 A;  2C1D A;  1CCR A;  1CCH A;  2Y0C A;  2ZXY A;  1HRO A;  5CIB B;  5B66 V;  1HRC A;  1R0Q A;  1GIW A;  4XYD B;  3SLE A;  3WC8 A;  5CID B;  2N9I A;  4EIE A;  3VNW A;  3PTZ A;  4KMG A;  1AOF A;  5B5E V;  2L4D A;  1N50 A;  3WUI A;  3H1L D;  3NBS A;  2C9X B;  1H9Y A;  1IZL 0;  1YNR A;  3ZOY A;  3TDK A;  4RSZ A;  2IBZ D;  1QL3 A;  1CRG A;  1M70 A;  1EZV D;  3HQ8 A;  1DVV A;  4L3H A;  1HJ5 A;  1MG3 D;  3O1Y A;  1LFM A;  4H0K A;  1HZU A;  1LC2 A;  4PJ0 V;  2EXV A;  3H1H D;  2N18 B;  3VYM A;  2KS1 A;  2I8F A;  1S5L V;  1GQ1 A;  2RN0 A;  1MZ4 A;  1J3S A;  1DIQ C;  1QKS A;  1EB7 A;  4FB1 A;  1CRI A;  1LMS A;  2RMZ A;  3CU4 A;  4FA5 A;  4H0J A;  1BE3 D;  4FA1 A;  1C6S A;  4K3I A;  1BCC D;  2BLF B;  1H32 A;  4A7P A;  3ZOW A;  4AX3 A;  1L9B C;  1C7M A;  1DW3 A;  1NMI A;  1NIR A;  2GB8 B;  5KAI V;  2YQB A;  1C6O A;  2K9J B;  3PLN A;  2B4Z A;  1FI7 A;  4GED B;  1I54 A;  2ORL A;  4WQ7 A;  1CYC A;  4NFG B;  1SQP D;  3L71 D;  1ETP A;  1B7V A;  1VYD A;  1DW0 A;  5AUR A;  2CA3 B;  1WVE C;  3FWL A;  3OCD A;  3NWV A;  4LJI A;  3H1K D;  1GDV A;  3KHU A;  1A56 A;  1CRH A;  1CYI A;  1L0L D;  4P4Q B;  2Y0D A;  2YCC A;  1NU1 D;  3WFC C;  2QJP B;  2A06 D;  3SWS A;  351C A;  4D6T D;  1SQB D;  1YEA A;  5CIC B;  1CXC A;  4WQE A;  2BCN B;  2AI5 A;  2KNC B;  4EDF A;  3WFD C;  1CIE A;  1CRJ A;  1H33 A;  2ZBO A;  1H1O A;  1ZZH A;  1CRY A;  2BGV X;  4J20 A;  1A2S A;  2GIW A;  1H31 B;  1U74 B;  1COT A;  1YFC A;  3PXW A;  5DJQ C;  3VRD A;  2C1D B;  2FYN B;  1YTC A;  2B10 B;  3L4O A;  3RN0 A;  3MK7 C;  3HQ9 A;  1GU2 A;  4UB6 V;  1CO6 A;  3L74 D;  4O1W A;  2CXB A;  5CIH B;  2B0Z B;  3MK7 B;  2N18 C;  1CC5 A;  2N9Y B;  2N9J A;  2D0W A;  4GYD A;  1CXA A;  3WU2 V;  1RZ6 A;  1COR A;  3PXS A;  5E79 V;  3PRJ A;  2ZON G;  4U3F D;  4IL6 V;  2Y0E A;  2LIT A;  1L0N D;  3X39 A;  2QJK B;  3BCC D;  2BH5 X;  5IY5 1;  3GG2 A;  3JBT B;  3ZCF A;  5EXQ A;  5C0Z A;  1IRW A;  3PH2 B;  1M60 A;  1KIB A;  1SQV D;  3PXT A;  1KX2 A;  1K3H A;  3ZIY A;  4WQD A; 
#chains in the Genus database with same CATH topology
 1KB9 D;  1PPJ E;  4L76 A;  2D2C C;  3A0B V;  2YXQ B;  2WSS H;  2OQQ A;  3GMA A;  1S5L H;  1X8Y A;  1YEB A;  2V4H A;  5AW4 B;  2FYU E;  1OCD A;  1NU1 G;  1CHI A;  3BRT B;  4YXD C;  3B5N B;  2L5G B;  2Q5U A;  1WMK A;  2B88 A;  2W90 A;  3L4M A;  4WWI A;  2FBW C;  2WSE H;  2O01 J;  3OW2 O;  1IFP A;  2IBZ E;  5KLI C;  1FC2 C;  1HH0 A;  2BAS A;  3KZI H;  1N73 A;  1H0T B;  2KSE A;  3C2C A;  5H2F V;  3VMY A;  1QX8 A;  3MTU E;  1I8O A;  5CYT R;  1BSN A;  2OYI C;  1SLQ A;  2OZ1 A;  1A8C A;  4XXL A;  4L1Q A;  3A0B H;  5AVT B;  1I8P A;  2AEF A;  3HQ7 A;  5DFS A;  1JY3 P;  1PGP A;  3RBX A;  3A0H E;  3CCV P;  1RAQ A;  1IFM A;  5APX A;  1OW6 A;  2ZAE B;  3CX5 D;  2WSE J;  2I8D A;  1HJ3 A;  1USE A;  2P1J A;  1RHZ B;  1N73 B;  1H0T A;  2ZOO A;  2C8S A;  1GU5 A;  1I5T A;  1JY3 N;  1VQM P;  1CI6 A;  1JNM A;  1FHB A;  2ZYD A;  1H31 A;  2J5U A;  1L4A D;  2C2C A;  4WB4 A;  4QAO A;  1JMM A;  1RAP A;  2N3B A;  3L72 D;  3BAS A;  3BRV B;  2MKV A;  1QL2 A;  1RF0 C;  4V2K A;  1YJW P;  1DW2 A;  2VHD A;  1I55 A;  2E74 B;  3SWY A;  1VF5 D;  1W5C E;  5AVW B;  1IFJ A;  3CXH H;  3L75 J;  1RF1 B;  3AED C;  3HE5 B;  2M5A A;  4W80 A;  3KXD A;  1QL1 A;  4UB8 V;  1AKK A;  2XDJ A;  3CP5 A;  1M1J A;  5B5E H;  5KLV E;  1VQ4 P;  1OWA A;  1L9J C;  4M3L A;  3WUU A;  3KZI V;  1CTZ A;  1SVF A;  3TYI A;  2QM8 A;  1DX7 A;  2KB7 P;  1FZA A;  2DGE A;  2GC4 D;  1FOS F;  5APW A;  3H1K J;  2JDI H;  5AW6 B;  2POH A;  3H6P A;  3CCE P;  5AVZ B;  3Q5P A;  4DCK A;  3CXH E;  1FDI A;  1NTM G;  2Q3E A;  4N3Y B;  2OYH A;  5KLV D;  1CNO A;  2KOG A;  2L91 A;  3ZOX A;  3H1J E;  3D70 A;  5DF5 A;  5GTI V;  1EXI A;  4ZKP A;  2K3R A;  3LW5 J;  1N15 A;  3AEG C;  4U7J A;  3P8M C;  4GOF A;  1YBK A;  2GM4 A;  3M97 X;  1H88 A;  1Q7Y Q;  3AEE C;  4WY4 D;  4JYB A;  3G71 P;  3I5C A;  1S5L X;  1SQP K;  1E8E A;  2HOD A;  5C9M A;  3L72 J;  1NTM J;  3AE7 C;  1LS9 A;  1SQP E;  2E75 C;  1QN2 A;  1FZC B;  1KX7 A;  2H43 A;  2OYH C;  3CI9 A;  1ZLL A;  2E43 A;  2YKP A;  1FJK A;  1NTZ G;  2KLV A;  2UWJ E;  3H1H J;  1HH7 A;  2JJL A;  2KLU A;  3A9F A;  2PCC B;  3H1K G;  2ZT9 B;  2A45 H;  2E74 C;  1KIL E;  1VQL P;  1NU1 K;  2FXO A;  3H25 A;  1FI3 A;  1U7J A;  3TGU J;  1CCR A;  4C7R A;  1Q90 D;  1YTZ I;  1DD3 A;  1Z56 A;  1NYH A;  1HRC A;  1EDI A;  1RF1 C;  1R0Q A;  1SP4 A;  4O9B A;  1GIW A;  3RK3 B;  3WC8 A;  2N9I A;  4KMG A;  1AOF A;  5B5E V;  1M1J B;  1BCC E;  1PV3 A;  2R3C A;  5KTB A;  2PFX A;  3KZI E;  1KB9 I;  3HE5 A;  2N1T D;  3TK1 A;  2R5D A;  3O1Y A;  2C9L Y;  4H0K A;  2NPS C;  3AE2 C;  1LC2 A;  2N18 B;  2RN0 A;  1KQL A;  1VQ8 P;  3GF7 A;  1DIQ C;  3H1H G;  3U1A A;  1QKS A;  1YQ4 C;  2M8R A;  2J59 M;  1VPC A;  1ZME C;  2N1T A;  1R5L A;  4FA1 A;  2W27 A;  1C6S A;  4K3I A;  3V5B A;  2K88 A;  1H32 A;  4A7P A;  3ZOW A;  4IFM A;  3AE4 C;  1L0N J;  2YQB A;  4YPC A;  1C6O A;  3VP9 A;  3QWO C;  4TLF A;  4L74 A;  1SQP D;  2WPR A;  3L71 E;  5CHX A;  1EDL A;  1PL5 A;  3AE8 C;  3MIW A;  3OCD A;  3HUS B;  5GTH E;  3KHU A;  1CRH A;  3IF4 A;  1FU1 A;  2Y0D A;  3RL0 D;  2YCC A;  1NU1 D;  1IK7 A;  2HG5 D;  2Q9I A;  1SS1 A;  4ASW A;  351C A;  4C7N B;  5APU A;  2K1A A;  1SQB D;  1VQN P;  4JQ0 D;  1L4A C;  1QLE D;  5AVS B;  2KNC B;  2NPS A;  3L70 G;  1GU4 A;  5DJT B;  3NXS A;  1LTG C;  1YJ9 P;  1CIE A;  1CRJ A;  2XZR A;  1LT9 C;  1OFC X;  1N7S B;  2FY8 A;  1SQV K;  1D7M A;  3GF3 A;  2BGV X;  4AQR D;  3RK2 D;  1U74 B;  1GTW A;  3CMA P;  3M9B A;  3RN0 A;  2J58 A;  2FYU K;  3VMZ A;  4UB6 V;  1VQP P;  1OW8 A;  2CXB A;  3M06 A;  5CIH B;  1LTB C;  3CC7 P;  2D2C D;  3MHV A;  1S9K E;  3NTN A;  4WY4 B;  1OVV A;  3C8V A;  2YKQ A;  3BCC D;  1YIJ P;  3VYI A;  1PP9 E;  2BH5 X;  4I7Z C;  3JBT B;  3ZCF A;  2JEE A;  1BDC A;  1LTI C;  1KYO I;  1OZH A;  1T2K D;  1ZR4 A;  5H2F E;  1IJD B;  1JY3 O;  2VRS A;  3H32 B;  1GK6 A;  1K3H A;  1M7L A;  2PAJ A;  1NTZ K;  4OGQ C;  1SQQ D;  1YCC A;  1PGO A;  2E5T A;  4MU8 A;  1JTH A;  1QEX A;  3W67 A;  4Q5P A;  3L73 E;  3ZDM A;  4Y5R A;  1YYC A;  3OCD B;  1T3U A;  3D0W A;  2YIU B;  3JSV C;  3G6E P;  1J1E C;  5TIS V;  1NJI Q;  2C1V A;  1NTK K;  1J2J B;  1FI9 A;  1CED A;  1IK9 A;  1FZC A;  2B87 B;  1KYO W;  2HPC B;  4AAN A;  1CIF A;  3DP5 A;  1CHJ A;  4N78 D;  3CWB D;  1F1C A;  2WTY A;  1KFN A;  2E74 D;  2CA4 B;  1JUN A;  3UIA A;  1Q86 Q;  1SFC C;  2BPB B;  3H1H E;  1SQX D;  4BXL A;  4WQ8 A;  1NOH A;  1MG2 D;  2YO2 A;  3TGU D;  1G1J A;  1I6D A;  3L70 D;  1BSH A;  3QH9 A;  1L4A B;  2OYI A;  2FWL A;  1UIX A;  3L74 G;  1HJ4 A;  1KV4 A;  2D0S A;  1MV8 A;  1LT9 B;  1GJQ A;  2V7Q J;  4WQB A;  1RF0 A;  3ITK A;  2YMK A;  2Z5H A;  5AW3 B;  1FDM A;  1CTY A;  1C75 A;  2WSF H;  3IN6 A;  1S1C X;  1EXJ A;  2O01 N;  4LLH A;  3M9H A;  1NTZ D;  2BEQ D;  4FAV A;  2Q7C A;  2YK3 A;  1K73 Q;  5C39 A;  2AXT V;  5KKZ B;  1NU1 J;  3OAK A;  3FXE A;  1LWU B;  1C2R A;  2E76 D;  3RK2 B;  1KV9 A;  4AAO A;  1SQB E;  3LID A;  2WT7 B;  1BDD A;  3O20 A;  4OGQ B;  1KD1 Q;  4FAN A;  1A02 J;  1FZG A;  3L74 J;  3CCU P;  4EID A;  3L70 E;  4YTP C;  2FFD A;  1CW5 A;  3VTP C;  2B12 B;  5CIF B;  2PCB B;  3SSU A;  1L0N E;  1ZN5 A;  3H32 A;  1NML A;  5TIS H;  1ZW0 A;  2LXC B;  2JR8 A;  2OTJ P;  1DIP A;  2P2U A;  1AVY A;  2V08 A;  3RGU A;  2JP3 A;  4NPE A;  1HTL C;  5KKZ C;  3G3Z A;  1FBM A;  2IZ0 A;  2FRC A;  4EIJ A;  3PH0 A;  4AAM A;  2BCC J;  1NNO A;  1GMJ A;  4U3F J;  2E75 D;  1PFI A;  451C A;  2BH4 X;  1AOQ A;  3CC2 P;  3L71 G;  5GTH H;  1JO5 A;  1NTK D;  3U59 A;  3JC2 2;  1M6Z A;  1F1F A;  2N3Y A;  2FFD B;  4PD4 D;  2YXR B;  3OA8 B;  1KB9 H;  1C2N A;  5TJH A;  1QVG O;  2M0B A;  4HJG H;  1M8O B;  1KYO H;  1L0L G;  1JM0 A;  1CYJ A;  5TIS E;  4W7Y A;  3IFM A;  5BU5 A;  2R5B A;  2FKW B;  2V07 A;  1NAY A;  3WUT A;  2IX7 C;  3GLM A;  3S9O A;  2V7Q H;  1YIC A;  4H0L B;  2NZ2 A;  4Y99 C;  1W2L A;  4LC1 A;  4WQ9 A;  2AEM A;  1AQ5 A;  1JMB A;  4U3F G;  2W6A A;  3PJS K;  1N9C A;  1ZRT E;  1CSW A;  2AXT H;  2JWD A;  3VMA A;  2HLO A;  2QIW A;  4EIC A;  3L73 G;  1JDL A;  2IBZ G;  3TF5 A;  1NTM K;  3CPW O;  1JEK A;  1KYO E;  1YIT P;  3G4S P;  2M5A B;  4GKG A;  1N7L A;  4Y28 J;  1KIL A;  1A02 F;  3RK3 D;  4EIE A;  4ASV A;  3PTZ A;  3C1L A;  1SQQ G;  4H13 B;  1N50 A;  3WUI A;  3H1L D;  2FYN C;  1H9Y A;  1IZL 0;  2QJK C;  3TDK A;  2WWW A;  3IAO A;  1JB0 J;  4JPZ B;  1M70 A;  3LW5 H;  4H13 D;  4I7Z B;  2ZT9 D;  4L3H A;  1HJ5 A;  1MG3 D;  2AXT E;  3VYM A;  2EXV A;  1U57 A;  2FXP A;  2PGD A;  2KS1 A;  1N86 A;  1GL2 C;  4UB6 E;  1J3S A;  3U1C A;  1N2D C;  1IC2 A;  2WMM A;  3P32 A;  4B86 A;  1CRI A;  3N7N A;  2RMZ A;  4KT0 J;  1IZN B;  2QM7 A;  3L73 J;  1AFO A;  2WSC J;  4FA5 A;  2GUS A;  1QVF O;  4H0J A;  1BE3 D;  5KJ7 D;  1OW7 A;  2FXM A;  1BCC D;  2BLF B;  3RL0 C;  1JCC A;  1C7M A;  1L0N K;  1DW3 A;  1NMI A;  2K9Y A;  3KPE A;  1I54 A;  5AW2 B;  2ORL A;  1T6A A;  1CYC A;  1N7S C;  3W68 A;  2Q6Q A;  4H0L D;  4H44 C;  3L71 D;  3V2Q A;  1B7V A;  5AVY B;  2H8P D;  5AUR A;  3CXH I;  1VQ6 P;  1CZQ A;  1M57 D;  3BCC E;  3CCS P;  4LJI A;  3H1K D;  4I6M C;  2QJP C;  1SFC D;  3TNU A;  4P4Q B;  4OWF A;  3HRN A;  1RE4 C;  2C9N Y;  3CCQ P;  1TU3 F;  1IFD A;  2A06 D;  3SWS A;  1HF9 A;  1RF1 A;  3V2P A;  1MZ9 A;  5E79 H;  2R44 A;  3V6I A;  3L71 J;  2RH0 A;  1RE3 C;  1HVV A;  1FZC C;  2LR2 A;  1MFT A;  2E75 B;  3FWN A;  5AW8 B;  4EDF A;  2E42 A;  5AVU B;  1LWU A;  3M0D C;  3L72 E;  3LIE A;  1NTK E;  4NPF X;  3HE4 A;  1SFC A;  1VF5 B;  2HYN A;  1NU1 E;  1COT A;  3VRD A;  1T2K C;  1YTC A;  3MK7 C;  3NFQ A;  1CO6 A;  3L74 D;  3M91 A;  1BGY G;  2E76 C;  1SQV G;  2QJY C;  1E79 H;  4OGQ D;  4GOD A;  1CXA A;  3WU2 V;  3TGU E;  3H1L G;  1RZ6 A;  1UII A;  3D71 A;  2E76 B;  3PRJ A;  4U3F D;  2Y0E A;  1SQX E;  1NO4 A;  1L0N D;  4OVN F;  5CCG A;  3BCC G;  3N4X A;  1FE6 A;  4N6J A;  3AE6 C;  1NAF A;  3PXT A;  1WT6 A;  2KXP B;  4WQD A;  3NBT A;  3DMI A;  1L0L K;  1BE3 G;  1EDK A;  3S4R A;  1MFZ A;  1NTZ E;  1IQC A;  1HCM A;  3TNU B;  1NWQ A;  5KAF V;  1CIG A;  3CX5 W;  1EC5 A;  1PGJ A;  3KQG A;  3CCL P;  3H1L J;  1USD A;  1KB9 E;  2Y9Z A;  4O1Q A;  1L4A A;  3WMM 0;  3GW6 A;  3B5N D;  4DJG A;  4YE1 A;  4WY4 A;  1CSX A;  1DD4 A;  3S1K A;  4BWN A;  1URQ C;  1DEE G;  1FDO A;  2ZZS 1;  1NKZ B;  2GC7 D;  1U75 B;  1EZV I;  3EFG A;  2H89 C;  2LIR A;  4PW9 B;  5CCH A;  2Q3I A;  2HV4 A;  1SQB K;  1EZV G;  1LNQ A;  3ORV A;  1BE3 J;  1VF5 C;  1GZL A;  1BL9 A;  2G3A A;  2XU6 A;  3Q2Y A;  1KIL B;  1SQX G;  2Y9Y A;  3SJL A;  2E5Y A;  1I6E A;  2OYO A;  3CWB E;  3RLM A;  3CXH W;  2C1U A;  1C52 A;  1NTM D;  2ITA A;  3JCU H;  3CLQ A;  2WT7 A;  1YHQ P;  1FOC A;  1LC1 A;  2BCC D;  2IBZ I;  2I1J A;  2FYU G;  3CL3 D;  3OA7 A;  2IPP A;  2B11 B;  4AYC A;  1C6R A;  4DY9 A;  1RY3 A;  3BVH A;  1FJ0 A;  2ZT9 C;  2HPC A;  3L37 A;  3V4Q A;  3B8E B;  1Q82 Q;  1H33 B;  2HOD B;  1PPJ D;  1L0N G;  1NVO A;  5KJ7 C;  2JTI B;  1SQQ K;  2G8Y A;  3Q1M A;  1RE4 A;  2W6J H;  1K04 A;  1K9M Q;  1RQU A;  1S3J A;  3ZOO A;  2D2C B;  3CCM P;  3R4Y A;  4UB6 H;  1AYG A;  2QEX P;  4ZKU A;  2WVR A;  3H1I J;  1Q81 Q;  5E79 E;  4IL6 X;  2KP8 A;  2MTA C;  3SXT A;  2XND H;  4AAL A;  4K3A A;  4R4L A;  3AE9 C;  3CWB G;  1N7S A;  1S9K D;  5DJU B;  3PP5 A;  4K35 A;  1GDT A;  1URQ A;  1IFN A;  3DR0 A;  3E1R A;  1SQB J;  4WBA A;  1N7S D;  3HUS A;  4Y99 B;  4L75 A;  3BCC J;  3FGA D;  2IZ1 A;  5AVR B;  3L70 J;  5AW9 B;  1E5W A;  1IO4 A;  3KDP B;  1IO3 A;  155C A;  4D6T E;  2ZYA A;  4JCG A;  3L75 D;  2LXB A;  3CX5 H;  2KIK A;  1OVR A;  1HBW A;  3EQ2 A;  1GL2 A;  1VQO P;  1M90 Q;  1OVU A;  1R5S A;  1P84 H;  2IYO A;  4PWA A;  2ZYG A;  1T8Z A;  1GW3 A;  3PHL A;  4U3F E;  4PD4 H;  4N0K A;  2XNX A;  1DVH A;  1H89 A;  5BU8 B;  1DT1 A;  4GIF A;  3Q5S A;  2AIU A;  2BCC G;  1SQV E;  4TT3 H;  2XV5 A;  1J1D C;  2N1T C;  2AEJ A;  1KTM A;  3EFF K;  3CXH D;  2NPS D;  2H7H A;  4JBZ A;  4WQC A;  3AE3 C;  1LTJ C;  1E2R A;  1RZ5 A;  4EIF A;  2XKM A;  2QG4 A;  3CX5 E;  2ZXX A;  2MJZ A;  1X0T A;  1H8A A;  5AW1 B;  1H9X A;  5CIG B;  1KB0 A;  1OAE A;  2C0X A;  2HFE D;  5AVQ B;  2C1D A;  1CCH A;  2ZXY A;  3L35 A;  1GL2 D;  1XTG B;  1SQX J;  2QSI A;  3USS A;  4XYD B;  1KN7 A;  3VNW A;  5M1B A;  1W2B O;  4GDO A;  5KLV K;  2N1T B;  3F89 A;  2FYZ A;  2JO1 A;  2O01 H;  4WY4 C;  4JYC A;  3NBS A;  1YNR A;  3ZOY A;  2IBZ D;  1GD2 E;  2B9B A;  4HH2 A;  4EOT A;  2PP6 A;  1HZU A;  4PJ0 V;  1LT1 A;  4H44 D;  3HD7 D;  3TYY A;  2P58 A;  3A3Y B;  1VDF A;  3HTK A;  1EB7 A;  4FB1 A;  3HD7 A;  2KUB A;  3CU4 A;  2AXC A;  3O6Q B;  2Z4E A;  1KZU B;  1SQQ J;  1ZP0 C;  3L74 E;  4AX3 A;  3SFE C;  4IL6 E;  1URQ B;  1URQ D;  3JCU E;  1LJ2 A;  1VQK P;  3H1I G;  5AW5 B;  2K9J B;  2B4Z A;  1FI7 A;  4WQ7 A;  1HWT C;  1ETP A;  1VYD A;  1WRG A;  1KMI Z;  2CA3 B;  3A2A A;  2IFM A;  1WVE C;  5AVX B;  2QE7 H;  2WQY C;  2ZVO B;  3NWV A;  2BCC E;  2K37 A;  4BRY B;  1GDV A;  4XFJ A;  4H44 B;  1BCC G;  1KC8 Q;  1L0L D;  1S5L E;  3I56 P;  2R32 A;  1LTS C;  1N8R Q;  2YO3 A;  2A45 I;  1AQT A;  2W83 C;  3CC4 P;  4LGD E;  4D6T D;  2A06 E;  3AEA C;  2GUV A;  1LTT C;  3GHG C;  2P10 A;  4WQE A;  1NHL A;  2BCN B;  3KYQ A;  1YTZ T;  2BEZ F;  4XE5 B;  3WFD C;  1GL2 B;  1H33 A;  1LP1 B;  1BGY E;  2ZBO A;  2N9B A;  3CCJ P;  1H1O A;  4L73 A;  1LWU C;  5APQ A;  1CRY A;  2JKV A;  4KJM A;  1A2S A;  2GIW A;  2KZJ A;  2SPZ A;  2C0W A;  3PXW A;  4RO0 A;  3K5B A;  2FYN B;  2W8Z A;  2B10 B;  2IFN A;  3HQ9 A;  1GU2 A;  2P67 A;  4O1W A;  1YQ3 C;  2ZFC A;  3L72 G;  2B0Z B;  3TGU G;  3MK7 B;  1CC5 A;  1HGZ A;  2N9Y B;  2B87 A;  1HJB A;  3VMX A;  3SFD C;  2OYI B;  1MKM A;  1COR A;  2QRX A;  3PXS A;  1ZR2 A;  5E79 V;  2ZON G;  4IL6 V;  1T3J A;  4OH8 B;  1EDJ A;  3FX0 A;  2QJK B;  2WSF J;  5CCG C;  1NTZ J;  1LP1 A;  3GG2 A;  1SQP G;  2A06 G;  1CI6 B;  2P7J A;  4D6T G;  4PD4 E;  3A7O A;  2IYP A;  3BAT A;  1M60 A;  1YI2 P;  3HTK B;  2O1J A;  3H1L E;  2ZJS E;  4ZMD A;  1L2P A;  4I2L C;  1JCD A;  3GHG A;  1L0L J;  4PJ0 E;  2KK7 A;  1PZQ A;  1LTJ B;  3RK2 C;  1HJ0 A;  3B5N C;  3H1K E;  2K9J A;  5CIE B;  4CPG A;  5AW0 B;  4D6T J;  3AE5 C;  1HUC A;  5B6Q A;  2I1K A;  1JY2 N;  4ZNC A;  4N78 E;  1S6V B;  1CSU A;  2O3J A;  1ZRT D;  3A5T A;  3O5C A;  5CBO A;  3MGN A;  4HB1 A;  1W5C T;  4DZO A;  4W7Z A;  2QA4 P;  1P84 E;  1RE3 A;  2OTK E;  4GT1 A;  1SQX K;  2OGU A;  1SQP J;  3HUS C;  3CD6 P;  3P8C E;  4RES B;  3A0H V;  2WPS A;  2WSC H;  1JY2 P;  1CTJ A;  2KSJ A;  1H32 B;  4EYY Q;  3O8Z A;  4BRY A;  3G9R A;  4HKZ H;  4WVZ A;  2CE1 A;  3SVW A;  4RKU J;  2XTS B;  1FCD C;  2CE0 A;  3O0R C;  1IRV A;  1PGQ A;  1CIH A;  1N90 A;  2H88 C;  1OX3 A;  3P7K A;  1KOR A;  3B71 A;  3D6Z A;  3RL0 B;  5L8R J;  4UB8 H;  5GTI E;  1HGV A;  3RK3 E;  2M3E A;  3MZW B;  4XA4 A;  4I1L A;  5KAF H;  1PP9 D;  1QYZ A;  3RN1 A;  3E7K A;  1Q2N A;  4FA4 A;  3WFB C;  1KYO D;  3AEB C;  3WFE C;  4FA9 A;  1G2C B;  2FYU D;  3B4S A;  2CPB A;  1BGY D;  1NTK J;  1OXZ A;  1DW1 A;  1KIL D;  3CCR P;  1ZXG A;  3F5H A;  5EFW B;  4WQA A;  2GA1 A;  1DII C;  3T97 B;  5KLI B;  3E1I A;  3HQ6 A;  5KLV J;  2OZ1 B;  3H1I D;  1ZOY C;  1QL4 A;  1GK4 A;  5CMZ A;  4GOE A;  3MUD A;  2YNY A;  5B66 E;  1LTJ A;  3RL0 g;  1OMI A;  2QJY B;  1VQ7 P;  5CCH C;  1E29 A;  1RH5 B;  1FZB A;  3FXD A;  4PV1 C;  1S4X A;  5KLV G;  3SWK A;  2IDB A;  1PPJ G;  1WEJ F;  1G1I A;  2OAR A;  4KHX A;  1K3G A;  5CBN A;  3H1J D;  1HZV A;  1YIQ A;  2CPS A;  1CSV A;  1OIP A;  3WU2 E;  3Q5R A;  1KFM A;  3H1I E;  2KYV A;  3EWK A;  1P84 D;  1LGH B;  2FFD C;  5BVZ A;  1NTM E;  1FAV A;  3M0A A;  3ZBM A;  3L36 A;  3SWF A;  1M1J C;  2FYU J;  2JQR A;  1FZE A;  1QGK B;  2HR3 A;  2DW3 A;  1K05 A;  3B5N A;  2R3S A;  3RK3 C;  5DJQ B;  2LKM A;  1GKS A;  1VL2 A;  2A45 G;  4L3G A;  1BGY J;  4IFF A;  2OTL P;  2KI7 B;  3M9Q A;  4H13 C;  1FOS E;  2B89 A;  3RMZ A;  1CHH A;  1NKN A;  2QVA A;  1LTA C;  4DOJ A;  1CRC A;  1DH3 A;  2YIU C;  4RJT A;  3NMD A;  3OA8 A;  3CYT I;  1FJP A;  1J1D B;  3HD7 B;  1VQ5 P;  2PAC A;  2MHM A;  5GTH V;  3A0H H;  1BE3 E;  2OYH B;  3WUV A;  2WIT A;  1KQS O;  3T97 A;  3MD0 A;  4MN4 C;  4QMA A;  2DVH A;  3D6Y A;  1Y9B A;  2JWA A;  3L73 D;  1SQV J;  3HD7 C;  3CWB J;  1JOC A;  2Y0C A;  2KS1 B;  1HRO A;  5CIB B;  5B66 V;  1RQV A;  3AE1 C;  1JY2 O;  3VN0 A;  2YMY A;  2CK3 H;  1SQB G;  3SLE A;  5CID B;  5AVV B;  1MUU A;  1EQ7 A;  4PD4 I;  1G2C A;  1AA0 A;  1NGM B;  1Y47 A;  5APS A;  4H0L C;  2KZI A;  2L4D A;  1Y8A A;  1FS0 E;  3I55 P;  3P8C D;  2C9X B;  4RSZ A;  1QL3 A;  1LT9 A;  1CRG A;  1EZV D;  3HQ8 A;  1VQ9 P;  1DVV A;  1LFM A;  1SFC B;  2ZVN B;  3CX5 I;  3H1H D;  5APY A;  2I8F A;  1S5L V;  1GQ1 A;  1MZ4 A;  3A0B E;  1NTK G;  1EZV E;  4PJ0 H;  2KNC A;  1KQG B;  2NPS B;  2WZ7 A;  1LMS A;  5APT A;  1X9V A;  4YXW H;  1PIX A;  3VP8 A;  4R4M A;  2Z5I A;  1CSB A;  3L75 E;  1M1K Q;  4UB8 E;  5GTI H;  2RKL A;  3MUD C;  1L9B C;  4DT0 A;  1NIR A;  2GB8 B;  5KAI V;  5KAF E;  3VOP A;  3PLN A;  4GED B;  5H2F H;  3V2R A;  1K8A Q;  4NFG B;  2YKO A;  2ZXE B;  1KQF B;  5KJ7 A;  4IOI H;  1DW0 A;  3OJA B;  1NH4 A;  3RBZ A;  3FWL A;  5AW7 B;  1SQQ E;  3TSI A;  4IFD K;  1A56 A;  1AVO A;  1ZV8 A;  1CYI A;  1JTH B;  2WPQ A;  4JF7 A;  3R2P A;  3WFC C;  2QJP B;  4NPD A;  1J1E B;  1N73 C;  3II6 A;  3H1J J;  1YEA A;  1DEB A;  5CIC B;  1S2E A;  1CXC A;  4C46 A;  4AUW A;  1IFI A;  2NRG A;  5APV A;  2AI5 A;  1X22 A;  1S72 P;  4Z1M H;  5B5E E;  5KAI H;  1GW4 A;  3M0D A;  1ZZH A;  5CCG D;  3V2N A;  1AV1 A;  4J20 A;  1H31 B;  3WU2 H;  5K5G B;  1YFC A;  1PP9 J;  5DJQ C;  1W2E A;  2C1D B;  1KIL C;  5CJ4 A;  4HYT B;  3L4O A;  2W6B A;  2M3B A;  3L75 G;  2Q1K A;  1YJN P;  3IR9 A;  3AEF C;  2N18 C;  5CCH D;  3AEC C;  1AJY A;  2N9J A;  3V4W A;  2D0W A;  4GYD A;  3GHG B;  1L0L E;  3H1J G;  3HE4 B;  1PP9 G;  2O1K A;  2LIT A;  3O6Q A;  4C7N A;  1XTC C;  4EI2 A;  1X79 B;  3X39 A;  3MP7 B;  5B66 H;  5KAI E;  3CME P;  3ABV C;  4IL6 H;  1R8E A;  5IY5 1;  1M56 D;  3L4F A;  5EXQ A;  3Q3D A;  5C0Z A;  1IRW A;  1U7M A;  1P84 I;  4PV1 D;  1BCC J;  3C9I A;  3PH2 B;  1FZF A;  4PV1 B;  1KIB A;  1SQV D;  1KX2 A;  2PRR A;  3ZIY A;  2WPV B;  5CJ0 A; 
#chains in the Genus database with same CATH homology
 3NBT A;  3DMI A;  1KB9 D;  1SQQ D;  3A0B V;  5CIE B;  1YCC A;  1IQC A;  1HCM A;  4MU8 A;  5KAF V;  1YEB A;  4Q5P A;  5B6Q A;  1OCD A;  1CHI A;  4Y5R A;  3OCD B;  1CIG A;  3CX5 W;  2YIU B;  1S6V B;  1CSU A;  2O3J A;  1ZRT D;  3O5C A;  3L4M A;  5TIS V;  2C1V A;  1W5C T;  1FI9 A;  1CED A;  4O1Q A;  1KYO W;  4AAN A;  1CIF A;  3GW6 A;  3DP5 A;  1CHJ A;  3A0H V;  3CWB D;  1F1C A;  4YE1 A;  3C2C A;  1CSX A;  1CTJ A;  5H2F V;  1H32 B;  2ZZS 1;  2GC7 D;  1U75 B;  2LIR A;  1I8O A;  4PW9 B;  2CA4 B;  5CYT R;  2CE1 A;  3SVW A;  2HV4 A;  2BPB B;  2OZ1 A;  1SQX D;  2XTS B;  1A8C A;  4XXL A;  4L1Q A;  3ORV A;  4WQ8 A;  1BL9 A;  1FCD C;  2CE0 A;  1MG2 D;  3O0R C;  3TGU D;  1I6D A;  3L70 D;  1IRV A;  1I8P A;  1CIH A;  3SJL A;  1I6E A;  3HQ7 A;  5DFS A;  1N90 A;  2FWL A;  3CXH W;  3RLM A;  1RAQ A;  1HJ4 A;  2C1U A;  1C52 A;  1NTM D;  3CX5 D;  2D0S A;  1HJ3 A;  1GJQ A;  4WQB A;  1PP9 D;  1QYZ A;  1FOC A;  1LC1 A;  2BCC D;  3RN1 A;  4FA4 A;  2ZOO A;  2C8S A;  3ITK A;  3WFB C;  2B11 B;  1KYO D;  1I5T A;  3WFE C;  4FA9 A;  2FYU D;  1FHB A;  1H31 A;  1CTY A;  1C75 A;  1C6R A;  2C2C A;  4QAO A;  1RAP A;  2N3B A;  1BGY D;  3L72 D;  1DW1 A;  1NTZ D;  4DY9 A;  4FAV A;  4V2K A;  1FJ0 A;  2YK3 A;  2AXT V;  5KKZ B;  1DW2 A;  1H33 B;  4WQA A;  1PPJ D;  1C2R A;  2VHD A;  1I55 A;  1DII C;  2JTI B;  5KLI B;  1KV9 A;  3HQ6 A;  2OZ1 B;  4AAO A;  3H1I D;  3ZOO A;  3O20 A;  1QL4 A;  1AYG A;  4FAN A;  4EID A;  2MTA C;  3SXT A;  2B12 B;  5CIF B;  4UB8 V;  4AAL A;  1AKK A;  2QJY B;  2PCB B;  1E29 A;  3CP5 A;  1NML A;  1WEJ F;  1K3G A;  3DR0 A;  2V08 A;  3H1J D;  1HZV A;  1L9J C;  1YIQ A;  3KZI V;  2FRC A;  1CSV A;  1CTZ A;  3TYI A;  4AAM A;  1NNO A;  1P84 D;  2DGE A;  2GC4 D;  451C A;  2BH4 X;  1AOQ A;  3ZBM A;  1IO3 A;  155C A;  4JCG A;  3L75 D;  1NTK D;  2Q3E A;  1M6Z A;  5KLV D;  1F1F A;  1CNO A;  2N3Y A;  2L91 A;  3ZOX A;  5DF5 A;  2JQR A;  4PD4 D;  3OA8 B;  5GTI V;  1C2N A;  5TJH A;  1N15 A;  4PWA A;  5DJQ B;  1CYJ A;  1GKS A;  3PHL A;  3M97 X;  4N0K A;  4L3G A;  2V07 A;  1E8E A;  1DVH A;  1DT1 A;  5C9M A;  2AIU A;  1LS9 A;  1QN2 A;  1KX7 A;  3RMZ A;  1CHH A;  1YIC A;  1W2L A;  1CRC A;  3CXH D;  4WQ9 A;  4RJT A;  4WQC A;  3OA8 A;  3CYT I;  1E2R A;  1RZ5 A;  4EIF A;  2QG4 A;  2PAC A;  2MHM A;  5GTH V;  1HH7 A;  3A9F A;  1N9C A;  2PCC B;  1CSW A;  3VMA A;  1H9X A;  4EIC A;  1JDL A;  3TF5 A;  5CIG B;  1KB0 A;  1OAE A;  2DVH A;  2JWA A;  3L73 D;  1FI3 A;  2C1D A;  1CCR A;  1CCH A;  2Y0C A;  2ZXY A;  1HRO A;  5CIB B;  5B66 V;  1HRC A;  1R0Q A;  1GIW A;  4XYD B;  3SLE A;  3WC8 A;  5CID B;  2N9I A;  4EIE A;  3VNW A;  3PTZ A;  4KMG A;  1AOF A;  5B5E V;  2L4D A;  1N50 A;  3WUI A;  3H1L D;  3NBS A;  2C9X B;  1H9Y A;  1IZL 0;  1YNR A;  3ZOY A;  3TDK A;  4RSZ A;  2IBZ D;  1QL3 A;  1CRG A;  1M70 A;  1EZV D;  3HQ8 A;  1DVV A;  4L3H A;  1HJ5 A;  1MG3 D;  3O1Y A;  1LFM A;  4H0K A;  1HZU A;  1LC2 A;  4PJ0 V;  2EXV A;  3H1H D;  2N18 B;  3VYM A;  2KS1 A;  2I8F A;  1S5L V;  1GQ1 A;  2RN0 A;  1MZ4 A;  1J3S A;  1DIQ C;  1QKS A;  1EB7 A;  4FB1 A;  1CRI A;  1LMS A;  2RMZ A;  3CU4 A;  4FA5 A;  4H0J A;  1BE3 D;  4FA1 A;  1C6S A;  4K3I A;  1BCC D;  2BLF B;  1H32 A;  4A7P A;  3ZOW A;  4AX3 A;  1L9B C;  1C7M A;  1DW3 A;  1NMI A;  1NIR A;  2GB8 B;  5KAI V;  2YQB A;  1C6O A;  2K9J B;  3PLN A;  2B4Z A;  1FI7 A;  4GED B;  1I54 A;  2ORL A;  4WQ7 A;  1CYC A;  4NFG B;  1SQP D;  3L71 D;  1ETP A;  1B7V A;  1VYD A;  1DW0 A;  5AUR A;  2CA3 B;  1WVE C;  3FWL A;  3OCD A;  3NWV A;  4LJI A;  3H1K D;  1GDV A;  3KHU A;  1A56 A;  1CRH A;  1CYI A;  1L0L D;  4P4Q B;  2Y0D A;  2YCC A;  1NU1 D;  3WFC C;  2QJP B;  2A06 D;  3SWS A;  351C A;  4D6T D;  1SQB D;  1YEA A;  5CIC B;  1CXC A;  4WQE A;  2BCN B;  2AI5 A;  2KNC B;  4EDF A;  3WFD C;  1CIE A;  1CRJ A;  1H33 A;  2ZBO A;  1H1O A;  1ZZH A;  1CRY A;  2BGV X;  4J20 A;  1A2S A;  2GIW A;  1H31 B;  1U74 B;  1COT A;  1YFC A;  3PXW A;  5DJQ C;  3VRD A;  2C1D B;  2FYN B;  1YTC A;  2B10 B;  3L4O A;  3RN0 A;  3MK7 C;  3HQ9 A;  1GU2 A;  4UB6 V;  1CO6 A;  3L74 D;  4O1W A;  2CXB A;  5CIH B;  2B0Z B;  3MK7 B;  2N18 C;  1CC5 A;  2N9Y B;  2N9J A;  2D0W A;  4GYD A;  1CXA A;  3WU2 V;  1RZ6 A;  1COR A;  3PXS A;  5E79 V;  3PRJ A;  2ZON G;  4U3F D;  4IL6 V;  2Y0E A;  2LIT A;  1L0N D;  3X39 A;  2QJK B;  3BCC D;  2BH5 X;  5IY5 1;  3GG2 A;  3JBT B;  3ZCF A;  5EXQ A;  5C0Z A;  1IRW A;  3PH2 B;  1M60 A;  1KIB A;  1SQV D;  3PXT A;  1KX2 A;  1K3H A;  3ZIY A;  4WQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...