3L74D

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l74D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l74D02
1C7MA 4PWAA 2ZXYA 3TYIA 2CA3B 3PLNA 3L71D 1I6DA 1BE3D 2CE0A 1FHBA 4DY9A 2LIRA 1A56A 5CYTR 1CXAA 3VMAA 1E29A 1DT1A 1CTYA 1CCRA 1KX7A 2N9JA 2QJYB 3L75D 3NWVA 4XXLA 1MG3D 3TDKA 1SQQD 1JDLA 4PJ0V 1COTA 1CHHA 2FYUD 5TISV 4EIEA 3BCCD 3ZOYA 2L4DA 1K3HA 1CEDA 1S5LV 1CHJA 2B12B 1GIWA 3KHUA 1AOQA 2B0ZB 2B10B 4AANA 1H33A 5DJQB 2EXVA 1YNRA 2YIUB 1DW1A 1YTCA 2FYNB 1K3GA 3PXTA 3PXWA 1W2LA 1CIEA 1I8PA 1C75A 1NTKD 3CX5W 1KX2A 1CYCA 1U75B 1BCCD 1FJ0A 1YCCA 3A9FA 4H0JA 5B5EV 1YICA 5E79V 3MK7C 3HQ8A 3GW6A 2PACA 2YK3A 1CORA 1CRYA 3VNWA 1RZ5A 3WFEC 1SQBD 3HQ6A 1H31A 2O3JA 5GTHV 3ZIYA 1DVVA 2D0WA 1PP9D 5C0ZA 1NTMD 1AOFA 3A0HV 5KLVD 1L9BC 1QL3A 1NU1D 1H31B 1YEBA 1WVEC 1GDVA 2N9IA 3O20A 4WQAA 1MG2D 3X39A 1LC1A 2C1UA 4YE1A 1AKKA 4JCGA 1CYJA 4U3FD 5IY51 4AX3A 1I5TA 3OCDA 3PH2B 1C6SA 5KKZB 1H32A 2JQRA 2FRCA 4N0KA 1DIIC 3DMIA 5CIGB 1CIFA 1DIQC 1CSWA 1DW0A 1H32B 4EDFA 1NTZD 1GQ1A 1ZRTD 2ZZS1 2YQBA 1HJ3A 2N3BA 2V07A 3SJLA 2C8SA 4XYDB 3O5CA 1J3SA 3H1HD 3C2CA 2ORLA 1FOCA 1HRCA 2BH4X 1M6ZA 2DGEA 3CP5A 1P84D 1CSXA 2MTAC 4Q5PA 4EIFA 1BGYD 3NBTA 4WQEA 5KAIV 4WQBA 3ITKA 4EIDA 1W5CT 1GJQA 1IQCA 155CA 4WQDA 3L4OA 1KIBA 4O1WA 3PHLA 4FB1A 2PCCB 1EZVD 1CIHA 1CIGA 3CXHW 4L3GA 1NIRA 1HJ4A 1CSUA 1C6OA 1L0LD 3L73D 4LJIA 2BGVX 2N9YB 3SXTA 1M60A 1I6EA 4FA4A 2DVHA 4PD4D 4FA9A 1HCMA 1C2RA 2QG4A 3RN0A 3O0RC 4O1QA 4L3HA 1RAQA 2FWLA 3A0BV 2BH5X 1IO3A 2OZ1A 1RAPA 1CTZA 4QAOA 2QJPB 1IRWA 5DFSA 3SWSA 2C1DB 4L1QA 351CA 2OZ1B 3HQ9A 1VYDA 3WFBC 4WQ7A 1LC2A 4NFGB 1DW3A 3CWBD 2GC4D 3ZBMA 4FAVA 5B6QA 1AYGA 1C52A 2C9XB 1E2RA 1CRJA 1F1FA 4FANA 1FI3A 5CIHB 1L0ND 3GG2A 4EICA 5DF5A 1IZL0 1KYOW 2ZONG 1QKSA 1R0QA 2AXTV 1LMSA 4IL6V 1L9JC 451CA 3HQ7A 1A8CA 3FWLA 1CRCA 1H9XA 1HZUA 1FCDC 3VYMA 2BCNB 1HH7A 1OCDA 3H1ID 4K3IA 5KLIB 2YCCA 4GEDB 4Y5RA 5GTIV 3H1LD 2GB8B 2JTIB 2ZOOA 2RMZA 1GKSA 3L72D 4WQ8A 1CC5A 1CO6A 4UB8V 1CRGA 3ZOWA 3SVWA 1BL9A 5CIDB 1CHIA 2VHDA 3L70D 3WUIA 1HROA 4GYDA 1CYIA 3L74D 3CX5D 1NMLA 2LITA 3NBSA 3ZOOA 2KNCB 1N15A 2N18C 1B7VA 3MK7B 2HV4A 2Y0EA 4UB6V 1M70A 2XTSB 2BPBB 2Y0DA 3ZCFA 3PTZA 3H1JD 1C6RA 3WU2V 2I8FA 4RJTA 2KS1A 1KB9D 1HJ5A 1N50A 3DR0A 3L4MA 5DJQC 5AURA 3JBTB 1HZVA 2D0SA 1QN2A 3ORVA 4WQCA 1LFMA 1SQVD 4A7PA 1I54A 2GIWA 2CA4B 2QJKB 3TF5A 1FI9A 3H1KD 3CU4A 5H2FV 2BCCD 2BLFB 1QYZA 2B4ZA 3TGUD 5CIBB 1I55A 2ZBOA 5C9MA 2C1VA 5B66V 5CIEB 5CIFB 2N18B 3WFCC 2K9JB 1DW2A 2C1DA 3RLMA 4D6TD 1WEJF 1PPJD 1MZ4A 4RSZA 3RN1A 1QL4A 1LS9A 1CTJA 3WC8A 2RN0A 3WFDC 4KMGA 1CCHA 2CE1A 1A2SA 4V2KA 1H33B 1KB0A 4MU8A 4FA1A 2Q3EA 3CXHD 3O1YA 3PRJA 1FI7A 1CRIA 4PW9B 4FA5A 3ZOXA 1CRHA 4H0KA 1N90A 1NMIA 1U74B 1ETPA 2CXBA 1N9CA 2GC7D 1H1OA 3PXSA 3M97X 1I8OA 1SQXD 5EXQA 2JWAA 1C2NA 1IRVA 2C2CA 4WQ9A 1YEAA 1H9YA 3VRDA 1KV9A 5CICB 4J20A 4AAMA 2AI5A 1NNOA 1CXCA 2Y0CA 3KZIV 1CSVA 3OA8A 3RMZA 2B11B 2IBZD 1CNOA 1F1CA 5TJHA 1ZZHA 1RZ6A 2V08A 2N3YA 3CYTI 3OA8B 1SQPD 1YFCA 1E8EA 1OAEA 3SLEA 2PCBB 3OCDB 1YIQA 3DP5A 2MHMA 4AALA 1DVHA 5KAFV 2L91A 1S6VB 1KYOD 2A06D 4P4QB 4AAOA 1EB7A 1GU2A 2AIUA
chains in the Genus database with same CATH superfamily
1L0LG 2E5YA 3L73G 3V2RA 1KILC 3ZDMA 1ZR4A 3TYIA 5TISH 2HPCB 3PLNA 3L71D 2E75B 3BRTB 1S5LH 4ASVA 1GTWA 2LIRA 2WPSA 1KFNA 1NKNA 2ZAEB 3E1IA 1RHZB 1E29A 1L0NE 1E5WA 1VQLP 2Z4EA 3M0DA 1CTYA 4PJ0E 3L75D 4XXLA 1CHHA 1ZMEC 3BCCD 3HD7B 3VMZA 2L4DA 1CEDA 1PGQA 3PP5A 4IFMA 4HKZH 2B12B 3B5NC 5AW3B 3RL0C 5CCHD 2B0ZB 1L0NG 2KSJA 1FZGA 5CCGC 5DJQB 2QVAA 1UIIA 1J2JB 2EXVA 1YNRA 2FYNB 1K3GA 1N7SC 2KSEA 5GTHH 3PXTA 2ZT9D 1W2LA 1EDIA 3VP8A 3Q5PA 1N73A 1C75A 3JSVC 1HJBA 4I1LA 1FJ0A 3AEEC 3G9RA 3MK7C 1URQD 2M0BA 2AXTE 2D2CD 3GF7A 3ZIYA 1OVRA 5C0ZA 1NTMD 3TGUJ 2KB7P 5CJ0A 4WQAA 5GTIE 1JNMA 1BE3E 1MFZA 4H0LD 1CYJA 4C7NA 4GIFA 4AX3A 3PH2B 1W5CE 3D0WA 3H1KE 2JP3A 2YMYA 2BCCE 5AW5B 2PRRA 4C7NB 1JY2N 1DIQC 3CWBJ 5AW8B 2E76D 1YQ4C 3Q5SA 3A7OA 1BE3G 1YHQP 3H1HD 3P8CE 1M6ZA 4L75A 5CCHA 3CL3D 3H1KG 4BXLA 2BCCG 3NBTA 1J1EC 1W5CT 1Q7YQ 4WQDA 2IYOA 1IZNB 3PHLA 2PCCB 1EZVD 3H1LJ 4HB1A 2N1TD 1PGJA 3CXHW 3OJAB 2ZT9B 3L72J 2JWDA 1NIRA 4YXDC 3GMAA 1L0LD 1BCCE 3L73D 2N9BA 1T2KD 1H88A 1M1KQ 3SXTA 4H13D 1M60A 3C1LA 4FA4A 1VQMP 1IFDA 1URQB 1KQLA 2R44A 2E74C 1HCMA 1PP9E 1KILE 3RN0A 2D2CB 4O1QA 2W6JH 2FWLA 1X22A 2BH5X 1IO3A 1BCCG 2OARA 1CTZA 2QJPB 3HQ9A 2K88A 3EWKA 4H0LB 1SQBK 4WQ7A 1GK6A 3ZBMA 4FAVA 1SQXK 1GMJA 1C52A 1E2RA 1PP9G 1CRJA 4FANA 3KXDA 1L0ND 2ZVNB 1IZL0 3CXHI 3KDPB 1QKSA 2W8ZA 2AXTV 2E76B 1PZQA 5AVTB 1H9XA 1FCDC 2XU6A 1HH7A 1SQPK 1EXJA 4GEDB 3AE1C 5GTIV 3VYIA 1KC8Q 3CC4P 2ZOOA 2N1TA 2DW3A 4WQ8A 3WU2H 1CC5A 1CRGA 5K5GB 2FBWC 1CHIA 2QJYC 2N1TB 5M1BA 2NPSC 2FYUE 2M5AA 2BEZF 1CYIA 1OMIA 2RH0A 3CX5D 2FFDC 1USDA 2QM8A 1N15A 1VQOP 5AVYB 2OYIA 2Y0EA 4H13B 3AE6C 3LIDA 5KAFE 1M70A 2B87A 1LWUA 3HE4A 2Y0DA 4W7YA 3PTZA 1C6RA 5H2FH 1H8AA 1JUNA 1ZR2A 5AVQB 2OYIB 2B87B 1N50A 1BSNA 1LWUB 1SQBJ 3HE4B 3UIAA 4ZNCA 3JBTB 1SQXJ 4JF7A 2FYUG 1IK9A 1M1JB 4PV1B 3QH9A 5B66H 3R4YA 2B9BA 1I54A 3M9HA 1VQKP 1OVUA 5KJ7A 2QJKB 3TF5A 4BRYA 1KV4A 3H1KD 3CU4A 2BCCD 3BASA 1QYZA 5AW4B 3V2PA 3TGUD 2JEEA 4BRYB 3I5CA 1SQPJ 2WSEH 1I55A 2ZBOA 5C9MA 3CCMP 3D6ZA 5CIEB 5CIFB 2N18B 1DW2A 1J1DB 5BU5A 1EDKA 2PAJA 1YITP 3M06A 2FKWB 1MZ4A 3D6YA 3RN1A 4YPCA 1SFCC 3KYQA 1YJ9P 2ITAA 1ZXGA 1NGMB 3L71J 1HWTC 1ZW0A 2K1AA 3M91A 1NTMK 1NTZE 1A2SA 1H33B 1KB0A 4ZMDA 3WUTA 3RK2D 2O1KA 5C39A 4PW9B 1FDOA 2YNYA 3PH0A 3L75J 4FA5A 2Q1KA 3KZIH 1P84E 3HE5A 1NMIA 1QX8A 1ETPA 2CXBA 4JPZB 1BGYE 3BCCJ 1N9CA 1JY2O 3LW5H 3A0HE 2ZXEB 3HE5B 1NTZG 1LTJC 1QL1A 1KILD 3AE2C 1M56D 2C2CA 4WQ9A 1YEAA 1WMKA 3VRDA 1KV9A 2QRXA 3GHGA 3S9OA 4J20A 4AAMA 3S1KA 1NNOA 1SQVE 1FZEA 3V6IA 2J58A 3OA8A 2R3SA 1Q86Q 3SWKA 4WBAA 1ZZHA 1BGYG 4PD4E 2N3YA 2WVRA 3OA8B 1SS1A 3RL0g 3OCDB 1YIQA 1N7LA 4AALA 4NPDA 1SLQA 3FX0A 1FZCB 5KAFV 2L91A 1KQSO 1KYOD 4P4QB 3CX5I 1X0TA 1IFNA 4IFDK 1L0LK 2KLUA 4PWAA 4PJ0H 2ZXYA 1L4AC 5KAIE 3IF4A 1NTMJ 1VPCA 3BATA 5CCGD 3Q3DA 1FHBA 4JYBA 1N7SD 4I7ZC 3GF3A 1JMBA 2QM7A 4KHXA 1CXAA 3VMAA 3AE3C 2FYZA 1OVVA 3H25A 4H44C 1CCRA 1KX7A 1RE3A 3CXHE 3BRVB 1FZAA 1COTA 2FYUD 3RK2B 2OTLP 2Y9YA 1YBKA 2WPRA 3H1IE 2PFXA 1VQ8P 3CX5H 5B5EH 3KHUA 5E79H 5KLIC 1L0NK 4AANA 1JY3N 5KKZC 1YTZI 4XFJA 2E42A 1KMIZ 1OFCX 1KILB 1M90Q 1JEKA 1H0TB 1D7MA 3H1IG 1IFIA 1GU4A 3RK3C 2IFMA 1KTMA 1YCCA 2P2UA 1L0LJ 2YO3A 2YK3A 1CORA 3L73J 2KK7A 4JBZA 3OW2O 3VNWA 4IL6E 1SQBD 1H31A 1KB9E 1DVVA 2M3BA 1AOFA 1BDDA 3A0HV 1L9BC 3L74G 2YKPA 3AEAC 1H31B 1GDVA 1MG2D 3X39A 2YKQA 2ZFCA 1IFPA 1C6SA 4UB8E 1H32A 2A45G 2WTYA 2H7HA 2PP6A 3B71A 3DMIA 2OQQA 1CIFA 1DW0A 1H32B 3V5BA 1NTZD 3CCQP 3CD6P 1FOSE 1GQ1A 2N3BA 3SJLA 2HPCA 1L0NJ 4D6TE 3RBXA 1J3SA 1DEBA 1RF0C 3CCUP 3NTNA 2BH4X 2DGEA 1P84D 1LGHB 2MTAC 1BGYD 5KAIV 1KYOI 4EIDA 1LTSC 4LLHA 1IQCA 155CA 1R5LA 2YKOA 3L4OA 4WY4C 2LKMA 3WUVA 1AVYA 3MZWB 1CIHA 1MV8A 4AQRD 3Q5RA 1YYCA 3HD7A 4D6TG 2HLOA 5CMZA 3A0BH 2C9NY 1C6OA 1CSBA 1AV1A 4GOFA 2FXPA 1I6EA 4O9BA 5AVZB 4PD4D 3HRNA 1HH0A 4OGQC 2BEQD 2WITA 1FZBA 1LTGC 2QG4A 4I2LC 2FY8A 2KIKA 1WT6A 3O0RC 2W90A 1NJIQ 2OYOA 2SPZA 3V4QA 4L3HA 1MFTA 1LP1A 3W68A 2Q7CA 2WSCJ 4EYYQ 1RAPA 1KYOH 1EDJA 2WPQA 1IRWA 1LP1B 2C1DB 1VQ7P 5AVRB 1HGZA 1VYDA 2W27A 1FZFA 1QEXA 4NFGB 1DW3A 5B6QA 1BE3J 3U1AA 3WUUA 1LT9C 1F1FA 1YQ3C 2JDIH 2OYHA 4Z1MH 3VOPA 2NPSD 5BU8B 3MUDA 3CCLP 1GL2C 3H1KJ 2RKLA 2BCCJ 1LMSA 4IL6V 1L9JC 2OYHB 1A8CA 1RQUA 1HZUA 2KOGA 1ZP0C 2J5UA 2BCNB 3KQGA 4TLFA 3H1ID 3JCUE 2E75C 4UB6H 2NZ2A 2GB8B 4AUWA 1Q81Q 4UB8V 3SVWA 5CIDB 1SQQE 3RK3E 4GKGA 1HUCA 1HROA 2KI7B 4GYDA 3V2NA 1R5SA 2IBZI 3KPEA 3L74D 3EFGA 1QL2A 3M0DC 3NBSA 5APUA 3OA7A 1B7VA 1GW3A 3IAOA 2FXMA 1DH3A 3AE7C 4NPEA 3CLQA 1IFMA 1S5LX 2BPBB 3ZCFA 1NO4A 4RJTA 2JJLA 2VRSA 3U1CA 1KB9D 1GU5A 5DJQC 1SQQG 1Y9BA 1VQ4P 2LXCB 1Q2NA 2FYUK 1SFCD 2O1JA 1U7MA 1RY3A 3ORVA 3IR9A 1PGPA 1FBMA 1H89A 1L2PA 1URQA 1JY3O 3HUSC 3CCEP 1VQ6P 1N73C 4NPFX 2K9JA 2B4ZA 3VMYA 5AW6B 4XE5B 5TISE 2NPSB 2ZJSE 1YTZT 5KLVE 1AFOA 1S5LE 5CJ4A 1NU1E 2K9JB 1RQVA 3WFCC 3II6A 3RLMA 4D6TD 2Q5UA 1LNQA 5DJUB 4U3FE 3B8EB 1NOHA 4IFFA 1NAYA 3CCSP 1CCHA 2CE1A 1ZRTE 2CPSA 5KLVG 2UWJE 1NU1G 2Q3EA 4YXWH 3T97A 2HFED 4U3FG 3H6PA 1CRHA 1N90A 2YMKA 1E79H 1U74B 2FYUJ 5GTHE 3H1JE 3T97B 1FE6A 1VF5D 2GC7D 1KN7A 1I8OA 3A3YB 1NTZK 5APTA 2JWAA 1C2NA 1IRVA 1L4AD 3WMM0 1H9YA 1TU3F 5APWA 3VN0A 5CICB 1SFCB 2B11B 3H1JG 1RZ6A 4H44D 3CYTI 1JCCA 5APYA 2PCBB 2BASA 3DP5A 2MHMA 5AW2B 1M1JA 1GU2A 2D2CC 2AIUA 1SVFA 2YIUC 4DT0A 3PJSK 1VQPP 1LJ2A 2CA3B 3LIEA 1IJDB 1BE3D 3L35A 2CE0A 2QJPC 2WZ7A 1LTJB 4DY9A 2H43A 1A56A 5CYTR 1EZVI 4TT3H 1DT1A 2KZIA 2ZYAA 2N9JA 3NWVA 3HTKA 1MG3D 1AQ5A 1SQQD 3I55P 2J59M 2E76C 5TISV 2V4HA 1NTZJ 4EIEA 3AECC 3ZOYA 1CI6B 3HTKB 1JB0J 2QSIA 1S5LV 3P8CD 1CHJA 3RBZA 3MD0A 5AVVB 1PIXA 1GIWA 1L4AA 1AOQA 5AW9B 2B10B 1VF5B 1H33A 3ABVC 5AVUB 3MIWA 2QA4P 4LGDE 1BGYJ 2A45H 4M3LA 3D70A 1HJ0A 1L4AB 3L70E 3GLMA 2G3AA 2KZJA 3AEBC 4EIJA 2ZYDA 2N1TC 2QEXP 3CX5W 1RF1A 3L4FA 1CYCA 5AW7B 1U75B 4I7ZB 1JMMA 1BCCD 5DJTB 2Q9IA 1YICA 3GW6A 3HQ8A 1RF1B 1OX3A 2M3EA 4H44B 1CRYA 2W6AA 1T3UA 3CMEP 1RZ5A 4Y99B 2A06E 5GTHV 1PP9D 3L70G 2R5DA 2OYIC 4Y28J 5KLVD 1NU1D 1RE4A 1YEBA 1WVEC 3L71E 2N9IA 3CI9A 3O20A 4PV1C 3JC22 3E7KA 1KFMA 3L37A 4C7RA 4U3FD 5IY51 3OCDA 3B4SA 5KKZB 2JQRA 4GDOA 2IFNA 2FRCA 1DD3A 1FZCA 2E5TA 4IOIH 1VQNP 5EFWB 1ZRTD 2WSFJ 1N8RQ 1VQ9P 2K37A 2YQBA 5KJ7C 5CHXA 4EOTA 2I1KA 2XV5A 3L71G 2C8SA 4XYDB 4CPGA 3CC2P 1G2CA 1SQVG 1CZQA 1PPJE 1J1DC 3B5ND 1QVFO 4OGQD 1FOCA 3CP5A 3RL0D 1X9VA 1FJKA 2HYNA 4N6JA 1EC5A 1G2CB 4GODA 4WQBA 3ITKA 1GJQA 3W67A 2Z5HA 3H1IJ 4O1WA 4FB1A 1CIGA 1PPJG 1HJ4A 4ZKUA 1CSUA 4LJIA 4IL6X 2N9YB 5H2FE 3M9QA 2DVHA 3MP7B 3L74J 1GL2D 3IN6A 4WVZA 4OVNF 1KILA 1T8ZA 2OTKE 3P8MC 1WRGA 2POHA 5B66E 1H0TA 3SFEC 1RAQA 3G6EP 2HODA 2AXTH 4HYTB 2OZ1A 1FDIA 2E75D 1VDFA 2WSCH 5DFSA 2R32A 3EQ2A 1N86A 1NH4A 1FS0E 1HGVA 2HODB 4L1QA 1W2EA 1Q82Q 2OZ1B 3GHGC 3WFBC 1LTBC 1LC2A 3QWOC 1AYGA 3H32A 5GTIH 2C9XB 2CK3H 1K73Q 1PL5A 5DF5A 1KYOW 3TYYA 1R0QA 2YXRB 3H32B 1JM0A 1GZLA 3B5NA 451CA 3H1HE 3FWLA 3FWNA 3G3ZA 4OH8B 5AW0B 5CCGA 4N3YB 3VYMA 2P10A 5CBOA 3B5NB 1N7SA 4OGQB 5AVWB 4D6TJ 4K3IA 3RL0B 2YCCA 4Y5RA 2O01J 1AVOA 3OAKA 2KP8A 4RESB 1N7SB 1GKSA 1IO4A 1CO6A 3ZOWA 2W83C 1W2BO 3KZIE 1Q90D 2KNCA 3H1HG 2GUSA 3L70D 1S9KE 1K8AQ 1EDLA 1ZLLA 3SSUA 2G8YA 1GL2A 2KNCB 3RK2C 2OGUA 3MK7B 2IZ1A 3Q2YA 2E74D 2XTSB 1GK4A 1GL2B 2B89A 4L74A 3WU2V 1OIPA 2KS1A 4B86A 1HJ5A 1SQQK 3DR0A 1MKMA 1VQ5P 1DD4A 3TNUB 2R5BA 1AA0A 2D0SA 2KS1B 1NTKE 1QN2A 4N78E 1FOSF 3VMXA 3A2AA 1SQVD 3NMDA 2GIWA 1IC2A 1NAFA 2V7QH 2AEMA 1FI9A 4GT1A 1S72P 5H2FV 5CIBB 3Q1MA 1S4XA 1M57D 4R4LA 1R8EA 2MKVA 1NTKG 2C1VA 5B66V 3FGAD 1JO5A 2C1DA 1PPJD 4RSZA 2XNDH 4XA4A 1DEEG 2O01N 1J1EB 1NHLA 4KT0J 3WC8A 2RN0A 3WFDC 3CPWO 3AE8C 3BVHA 2IZ0A 3AEDC 3C8VA 1DX7A 2H89C 2QE7H 4KMGA 1MUUA 3HUSA 5KLVK 1NU1K 2Q3IA 1USEA 3CXHD 3PRJA 3CX5E 1CRIA 1N2DC 1OWAA 5B5EE 5E79E 1GDTA 3HUSB 3ZOXA 3MHVA 1SQQJ 1N73B 2I8DA 2AXCA 1EXIA 1NKZB 3PXSA 3M97X 2E74B 4W7ZA 3RGUA 1K05A 3FXEA 2PGDA 3VP9A 5KAFH 1M8OB 2CPBA 2M8RA 3MGNA 1ZV8A 1CXCA 2Y0CA 3KZIV 1IK7A 2K3RA 1CSVA 3V2QA 1OXZA 1U7JA 3RMZA 1CNOA 5TJHA 3HD7C 2MJZA 1PFIA 2C0XA 1YFCA 1T6AA 3TGUE 1OAEA 1BCCJ 1DVHA 1OW7A 2YXQB 1JY2P 4QMAA 3USSA 4AAOA 1EB7A 2ZVOB 2FYNC 1C7MA 3P7KA 1X79B 3M0AA 1PP9J 1P84I 5AW1B 3O6QA 5APQA 1I6DA 5KLVJ 1NU1J 3CWBE 3TGUG 2LXBA 2V7QJ 2NPSA 1OZHA 3O6QB 4U3FJ 1Z56A 4MN4C 2FFDA 1U57A 2Z5IA 2QJYB 2OTJP 4OWFA 3TDKA 2L5GB 1JDLA 2WMMA 4PJ0V 1S2EA 1S9KD 2FFDB 2OYHC 3MUDC 1K3HA 2JR8A 4PD4I 2WWWA 3SWYA 2KUBA 4ASWA 4ZKPA 3CWBG 2ZXXA 3M9BA 3NXSA 3H1LE 3SWFA 2XKMA 5APSA 3A0BE 3AEGC 3L36A 3L72E 1P84H 2YIUB 1DW1A 1YTCA 3H1JJ 4PV1D 3PXWA 1CIEA 3E1RA 1I8PA 3A0HH 5L8RJ 1NTKD 4N78D 1XTCC 1KX2A 3C9IA 2P67A 4H0JA 3A9FA 3H1LG 5B5EV 5E79V 2PACA 3F89A 3L72G 5KJ7D 2AEFA 1YJNP 3WFEC 3CCVP 3HQ6A 1KYOE 2O3JA 2D0WA 4PD4H 1SFCA 5CCHC 4JQ0D 1QL3A 1NVOA 2P1JA 1LC1A 2C1UA 2ZT9C 4YE1A 1AKKA 4JCGA 1ZN5A 1I5TA 4N0KA 1LTAC 2GM4A 1DIIC 5KAIH 1KD1Q 1LTTC 5CIGB 4L73A 1CSWA 4EDFA 2HR3A 1URQC 1FJPA 2ZZS1 1HJ3A 2V07A 2WSFH 1GD2E 4UB6E 1SQVK 3O5CA 3I56P 3C2CA 1LTIC 2ORLA 1HRCA 3CXHH 1LTJA 2M5AB 2A45I 1CSXA 4RO0A 2H88C 4Q5PA 4EIFA 3AE5C 1KZUB 4WQEA 4U7JA 4I6MC 1HBWA 1KB9I 5APVA 2I1JA 4H0LC 4JYCA 5AVSB 1KIBA 2WT7A 3TSIA 4KJMA 1FU1A 1CI6A 2QIWA 4L3GA 3RK3D 2WT7B 4L76A 1LT1A 2IDBA 1A02J 2KYVA 2H8PD 2BGVX 3L70J 4C46A 1CW5A 1HF9A 4FA9A 1SQBE 4HH2A 1SQXE 1C2RA 3CCJP 1K9MQ 2WQYC 2KLVA 5KTBA 1FDMA 3A0BV 2P7JA 4IL6H 1KQGB 1KB9H 1G1IA 4QAOA 4GOEA 2IBZE 3SWSA 1HTLC 351CA 2IPPA 5APXA 1SQBG 3CWBD 2GC4D 1JOCA 1SQPE 1SQVJ 1SQXG 2XZRA 1T2KC 4H13C 1FI3A 5CIHB 2YO2A 3VTPC 4DJGA 1VL2A 3GG2A 4EICA 4DZOA 4UB8H 1FC2C 2ZONG 3P32A 1XTGB 2KXPB 3HQ7A 3D71A 1LWUC 1CRCA 1A02F 2IBZG 2GA1A 1M1JC 1OCDA 4HJGH 4R4MA 3N7NA 1SQPG 5KLIB 2W6BA 3G4SP 1FAVA 4WY4D 3H1LD 1IFJA 2Q6QA 2JTIB 1M7LA 2O01H 2RMZA 3L72D 2QJKC 2A06G 3L75E 1EQ7A 1BL9A 3A5TA 3CC7P 1G1JA 2VHDA 2E43A 3WUIA 2JKVA 2JO1A 4K35A 3BCCE 1NMLA 3GHGB 3MTUE 3RK3B 1RH5B 2LITA 3ZOOA 2LR2A 2N18C 1YIJP 1UIXA 2HV4A 3R2PA 3WU2E 1NWQA 4UB6V 2P58A 1BSHA 1PV3A 1DIPA 3H1JD 2Y9ZA 2I8FA 2IX7C 3L75G 1VF5C 3AE4C 3L4MA 5AURA 4WB4A 1HZVA 1Y8AA 1KORA 1ZOYC 2AEJA 3BCCG 4WQCA 1LFMA 1AQTA 3TK1A 4A7PA 2CA4B 3F5HA 1YJWP 4W80A 1RF1C 2BLFB 3FXDA 1RF0A 4Y99C 2WSEJ 1K04A 1PGOA 2K9YA 1JTHA 1NTME 1KQFB 1NTKK 2GUVA 1YI2P 2NRGA 3V4WA 1WEJF 1JTHB 4YTPC 4WY4A 3IFMA 1QL4A 1X8YA 3H1HJ 5BVZA 1LS9A 1CTJA 1GW4A 2XDJA 1RE4C 1OW6A 4BWNA 2WPVB 4WY4B 2IYPA 1JY3P 1SP4A 3G71P 2C0WA 1NTMG 5CBNA 1QVGO 3S4RA 4V2KA 3JCUH 2WSSH 4MU8A 4FA1A 1BDCA 3O1YA 3L74E 1FZCC 1FI7A 2HG5D 1MZ9A 3HD7D 2R3CA 1QGKB 4H0KA 3N4XA 3LW5J 3CCRP 1H1OA 2XNXA 2C9LY 1SQXD 3EFFK 5EXQA 5AVXB 1EZVE 1HVVA 3O8ZA 4K3AA 1T3JA 2ZYGA 3U59A 3AE9C 3SFDC 4WWIA 1NYHA 2AI5A 3NFQA 1LT9A 1L0LE 3AEFC 3L73E 3CMAP 2IBZD 1F1CA 1S3JA 1S1CX 2B88A 4DOJA 1NTKJ 1RE3C 4RKUJ 1QLED 1LT9B 1OW8A 2V08A 1Y47A 1SQPD 1E8EA 3SLEA 4DCKA 3K5BA 1EZVG 1JCDA 4AYCA 3TNUA 1S6VB 2FXOA 2A06D 4LC1A 4EI2A 1AJYA
chains in the Genus database with same CATH topology
1C7MA 4PWAA 2ZXYA 3TYIA 2CA3B 3PLNA 3L71D 1I6DA 1BE3D 2CE0A 1FHBA 4DY9A 2LIRA 1A56A 5CYTR 1CXAA 3VMAA 1E29A 1DT1A 1CTYA 1CCRA 1KX7A 2N9JA 2QJYB 3L75D 3NWVA 4XXLA 1MG3D 3TDKA 1SQQD 1JDLA 4PJ0V 1COTA 1CHHA 2FYUD 5TISV 4EIEA 3BCCD 3ZOYA 2L4DA 1K3HA 1CEDA 1S5LV 1CHJA 2B12B 1GIWA 3KHUA 1AOQA 2B0ZB 2B10B 4AANA 1H33A 5DJQB 2EXVA 1YNRA 2YIUB 1DW1A 1YTCA 2FYNB 1K3GA 3PXTA 3PXWA 1W2LA 1CIEA 1I8PA 1C75A 1NTKD 3CX5W 1KX2A 1CYCA 1U75B 1BCCD 1FJ0A 1YCCA 3A9FA 4H0JA 5B5EV 1YICA 5E79V 3MK7C 3HQ8A 3GW6A 2PACA 2YK3A 1CORA 1CRYA 3VNWA 1RZ5A 3WFEC 1SQBD 3HQ6A 1H31A 2O3JA 5GTHV 3ZIYA 1DVVA 2D0WA 1PP9D 5C0ZA 1NTMD 1AOFA 3A0HV 5KLVD 1L9BC 1QL3A 1NU1D 1H31B 1YEBA 1WVEC 1GDVA 2N9IA 3O20A 4WQAA 1MG2D 3X39A 1LC1A 2C1UA 4YE1A 1AKKA 4JCGA 1CYJA 4U3FD 5IY51 4AX3A 1I5TA 3OCDA 3PH2B 1C6SA 5KKZB 1H32A 2JQRA 2FRCA 4N0KA 1DIIC 3DMIA 5CIGB 1CIFA 1DIQC 1CSWA 1DW0A 1H32B 4EDFA 1NTZD 1GQ1A 1ZRTD 2ZZS1 2YQBA 1HJ3A 2N3BA 2V07A 3SJLA 2C8SA 4XYDB 3O5CA 1J3SA 3H1HD 3C2CA 2ORLA 1FOCA 1HRCA 2BH4X 1M6ZA 2DGEA 3CP5A 1P84D 1CSXA 2MTAC 4Q5PA 4EIFA 1BGYD 3NBTA 4WQEA 5KAIV 4WQBA 3ITKA 4EIDA 1W5CT 1GJQA 1IQCA 155CA 4WQDA 3L4OA 1KIBA 4O1WA 3PHLA 4FB1A 2PCCB 1EZVD 1CIHA 1CIGA 3CXHW 4L3GA 1NIRA 1HJ4A 1CSUA 1C6OA 1L0LD 3L73D 4LJIA 2BGVX 2N9YB 3SXTA 1M60A 1I6EA 4FA4A 2DVHA 4PD4D 4FA9A 1HCMA 1C2RA 2QG4A 3RN0A 3O0RC 4O1QA 4L3HA 1RAQA 2FWLA 3A0BV 2BH5X 1IO3A 2OZ1A 1RAPA 1CTZA 4QAOA 2QJPB 1IRWA 5DFSA 3SWSA 2C1DB 4L1QA 351CA 2OZ1B 3HQ9A 1VYDA 3WFBC 4WQ7A 1LC2A 4NFGB 1DW3A 3CWBD 2GC4D 3ZBMA 4FAVA 5B6QA 1AYGA 1C52A 2C9XB 1E2RA 1CRJA 1F1FA 4FANA 1FI3A 5CIHB 1L0ND 3GG2A 4EICA 5DF5A 1IZL0 1KYOW 2ZONG 1QKSA 1R0QA 2AXTV 1LMSA 4IL6V 1L9JC 451CA 3HQ7A 1A8CA 3FWLA 1CRCA 1H9XA 1HZUA 1FCDC 3VYMA 2BCNB 1HH7A 1OCDA 3H1ID 4K3IA 5KLIB 2YCCA 4GEDB 4Y5RA 5GTIV 3H1LD 2GB8B 2JTIB 2ZOOA 2RMZA 1GKSA 3L72D 4WQ8A 1CC5A 1CO6A 4UB8V 1CRGA 3ZOWA 3SVWA 1BL9A 5CIDB 1CHIA 2VHDA 3L70D 3WUIA 1HROA 4GYDA 1CYIA 3L74D 3CX5D 1NMLA 2LITA 3NBSA 3ZOOA 2KNCB 1N15A 2N18C 1B7VA 3MK7B 2HV4A 2Y0EA 4UB6V 1M70A 2XTSB 2BPBB 2Y0DA 3ZCFA 3PTZA 3H1JD 1C6RA 3WU2V 2I8FA 4RJTA 2KS1A 1KB9D 1HJ5A 1N50A 3DR0A 3L4MA 5DJQC 5AURA 3JBTB 1HZVA 2D0SA 1QN2A 3ORVA 4WQCA 1LFMA 1SQVD 4A7PA 1I54A 2GIWA 2CA4B 2QJKB 3TF5A 1FI9A 3H1KD 3CU4A 5H2FV 2BCCD 2BLFB 1QYZA 2B4ZA 3TGUD 5CIBB 1I55A 2ZBOA 5C9MA 2C1VA 5B66V 5CIEB 5CIFB 2N18B 3WFCC 2K9JB 1DW2A 2C1DA 3RLMA 4D6TD 1WEJF 1PPJD 1MZ4A 4RSZA 3RN1A 1QL4A 1LS9A 1CTJA 3WC8A 2RN0A 3WFDC 4KMGA 1CCHA 2CE1A 1A2SA 4V2KA 1H33B 1KB0A 4MU8A 4FA1A 2Q3EA 3CXHD 3O1YA 3PRJA 1FI7A 1CRIA 4PW9B 4FA5A 3ZOXA 1CRHA 4H0KA 1N90A 1NMIA 1U74B 1ETPA 2CXBA 1N9CA 2GC7D 1H1OA 3PXSA 3M97X 1I8OA 1SQXD 5EXQA 2JWAA 1C2NA 1IRVA 2C2CA 4WQ9A 1YEAA 1H9YA 3VRDA 1KV9A 5CICB 4J20A 4AAMA 2AI5A 1NNOA 1CXCA 2Y0CA 3KZIV 1CSVA 3OA8A 3RMZA 2B11B 2IBZD 1CNOA 1F1CA 5TJHA 1ZZHA 1RZ6A 2V08A 2N3YA 3CYTI 3OA8B 1SQPD 1YFCA 1E8EA 1OAEA 3SLEA 2PCBB 3OCDB 1YIQA 3DP5A 2MHMA 4AALA 1DVHA 5KAFV 2L91A 1S6VB 1KYOD 2A06D 4P4QB 4AAOA 1EB7A 1GU2A 2AIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7M A;  4PWA A;  2ZXY A;  3TYI A;  2CA3 B;  3PLN A;  3L71 D;  1I6D A;  1BE3 D;  2CE0 A;  1FHB A;  4DY9 A;  2LIR A;  1A56 A;  5CYT R;  1CXA A;  3VMA A;  1E29 A;  1DT1 A;  1CTY A;  1CCR A;  1KX7 A;  2N9J A;  2QJY B;  3L75 D;  3NWV A;  4XXL A;  1MG3 D;  3TDK A;  1SQQ D;  1JDL A;  4PJ0 V;  1COT A;  1CHH A;  2FYU D;  5TIS V;  4EIE A;  3BCC D;  3ZOY A;  2L4D A;  1K3H A;  1CED A;  1S5L V;  1CHJ A;  2B12 B;  1GIW A;  3KHU A;  1AOQ A;  2B0Z B;  2B10 B;  4AAN A;  1H33 A;  5DJQ B;  2EXV A;  1YNR A;  2YIU B;  1DW1 A;  1YTC A;  2FYN B;  1K3G A;  3PXT A;  3PXW A;  1W2L A;  1CIE A;  1I8P A;  1C75 A;  1NTK D;  3CX5 W;  1KX2 A;  1CYC A;  1U75 B;  1BCC D;  1FJ0 A;  1YCC A;  3A9F A;  4H0J A;  5B5E V;  1YIC A;  5E79 V;  3MK7 C;  3HQ8 A;  3GW6 A;  2PAC A;  2YK3 A;  1COR A;  1CRY A;  3VNW A;  1RZ5 A;  3WFE C;  1SQB D;  3HQ6 A;  1H31 A;  2O3J A;  5GTH V;  3ZIY A;  1DVV A;  2D0W A;  1PP9 D;  5C0Z A;  1NTM D;  1AOF A;  3A0H V;  5KLV D;  1L9B C;  1QL3 A;  1NU1 D;  1H31 B;  1YEB A;  1WVE C;  1GDV A;  2N9I A;  3O20 A;  4WQA A;  1MG2 D;  3X39 A;  1LC1 A;  2C1U A;  4YE1 A;  1AKK A;  4JCG A;  1CYJ A;  4U3F D;  5IY5 1;  4AX3 A;  1I5T A;  3OCD A;  3PH2 B;  1C6S A;  5KKZ B;  1H32 A;  2JQR A;  2FRC A;  4N0K A;  1DII C;  3DMI A;  5CIG B;  1CIF A;  1DIQ C;  1CSW A;  1DW0 A;  1H32 B;  4EDF A;  1NTZ D;  1GQ1 A;  1ZRT D;  2ZZS 1;  2YQB A;  1HJ3 A;  2N3B A;  2V07 A;  3SJL A;  2C8S A;  4XYD B;  3O5C A;  1J3S A;  3H1H D;  3C2C A;  2ORL A;  1FOC A;  1HRC A;  2BH4 X;  1M6Z A;  2DGE A;  3CP5 A;  1P84 D;  1CSX A;  2MTA C;  4Q5P A;  4EIF A;  1BGY D;  3NBT A;  4WQE A;  5KAI V;  4WQB A;  3ITK A;  4EID A;  1W5C T;  1GJQ A;  1IQC A;  155C A;  4WQD A;  3L4O A;  1KIB A;  4O1W A;  3PHL A;  4FB1 A;  2PCC B;  1EZV D;  1CIH A;  1CIG A;  3CXH W;  4L3G A;  1NIR A;  1HJ4 A;  1CSU A;  1C6O A;  1L0L D;  3L73 D;  4LJI A;  2BGV X;  2N9Y B;  3SXT A;  1M60 A;  1I6E A;  4FA4 A;  2DVH A;  4PD4 D;  4FA9 A;  1HCM A;  1C2R A;  2QG4 A;  3RN0 A;  3O0R C;  4O1Q A;  4L3H A;  1RAQ A;  2FWL A;  3A0B V;  2BH5 X;  1IO3 A;  2OZ1 A;  1RAP A;  1CTZ A;  4QAO A;  2QJP B;  1IRW A;  5DFS A;  3SWS A;  2C1D B;  4L1Q A;  351C A;  2OZ1 B;  3HQ9 A;  1VYD A;  3WFB C;  4WQ7 A;  1LC2 A;  4NFG B;  1DW3 A;  3CWB D;  2GC4 D;  3ZBM A;  4FAV A;  5B6Q A;  1AYG A;  1C52 A;  2C9X B;  1E2R A;  1CRJ A;  1F1F A;  4FAN A;  1FI3 A;  5CIH B;  1L0N D;  3GG2 A;  4EIC A;  5DF5 A;  1IZL 0;  1KYO W;  2ZON G;  1QKS A;  1R0Q A;  2AXT V;  1LMS A;  4IL6 V;  1L9J C;  451C A;  3HQ7 A;  1A8C A;  3FWL A;  1CRC A;  1H9X A;  1HZU A;  1FCD C;  3VYM A;  2BCN B;  1HH7 A;  1OCD A;  3H1I D;  4K3I A;  5KLI B;  2YCC A;  4GED B;  4Y5R A;  5GTI V;  3H1L D;  2GB8 B;  2JTI B;  2ZOO A;  2RMZ A;  1GKS A;  3L72 D;  4WQ8 A;  1CC5 A;  1CO6 A;  4UB8 V;  1CRG A;  3ZOW A;  3SVW A;  1BL9 A;  5CID B;  1CHI A;  2VHD A;  3L70 D;  3WUI A;  1HRO A;  4GYD A;  1CYI A;  3L74 D;  3CX5 D;  1NML A;  2LIT A;  3NBS A;  3ZOO A;  2KNC B;  1N15 A;  2N18 C;  1B7V A;  3MK7 B;  2HV4 A;  2Y0E A;  4UB6 V;  1M70 A;  2XTS B;  2BPB B;  2Y0D A;  3ZCF A;  3PTZ A;  3H1J D;  1C6R A;  3WU2 V;  2I8F A;  4RJT A;  2KS1 A;  1KB9 D;  1HJ5 A;  1N50 A;  3DR0 A;  3L4M A;  5DJQ C;  5AUR A;  3JBT B;  1HZV A;  2D0S A;  1QN2 A;  3ORV A;  4WQC A;  1LFM A;  1SQV D;  4A7P A;  1I54 A;  2GIW A;  2CA4 B;  2QJK B;  3TF5 A;  1FI9 A;  3H1K D;  3CU4 A;  5H2F V;  2BCC D;  2BLF B;  1QYZ A;  2B4Z A;  3TGU D;  5CIB B;  1I55 A;  2ZBO A;  5C9M A;  2C1V A;  5B66 V;  5CIE B;  5CIF B;  2N18 B;  3WFC C;  2K9J B;  1DW2 A;  2C1D A;  3RLM A;  4D6T D;  1WEJ F;  1PPJ D;  1MZ4 A;  4RSZ A;  3RN1 A;  1QL4 A;  1LS9 A;  1CTJ A;  3WC8 A;  2RN0 A;  3WFD C;  4KMG A;  1CCH A;  2CE1 A;  1A2S A;  4V2K A;  1H33 B;  1KB0 A;  4MU8 A;  4FA1 A;  2Q3E A;  3CXH D;  3O1Y A;  3PRJ A;  1FI7 A;  1CRI A;  4PW9 B;  4FA5 A;  3ZOX A;  1CRH A;  4H0K A;  1N90 A;  1NMI A;  1U74 B;  1ETP A;  2CXB A;  1N9C A;  2GC7 D;  1H1O A;  3PXS A;  3M97 X;  1I8O A;  1SQX D;  5EXQ A;  2JWA A;  1C2N A;  1IRV A;  2C2C A;  4WQ9 A;  1YEA A;  1H9Y A;  3VRD A;  1KV9 A;  5CIC B;  4J20 A;  4AAM A;  2AI5 A;  1NNO A;  1CXC A;  2Y0C A;  3KZI V;  1CSV A;  3OA8 A;  3RMZ A;  2B11 B;  2IBZ D;  1CNO A;  1F1C A;  5TJH A;  1ZZH A;  1RZ6 A;  2V08 A;  2N3Y A;  3CYT I;  3OA8 B;  1SQP D;  1YFC A;  1E8E A;  1OAE A;  3SLE A;  2PCB B;  3OCD B;  1YIQ A;  3DP5 A;  2MHM A;  4AAL A;  1DVH A;  5KAF V;  2L91 A;  1S6V B;  1KYO D;  2A06 D;  4P4Q B;  4AAO A;  1EB7 A;  1GU2 A;  2AIU A; 
#chains in the Genus database with same CATH topology
 1L0L G;  2E5Y A;  3L73 G;  3V2R A;  1KIL C;  3ZDM A;  1ZR4 A;  3TYI A;  5TIS H;  2HPC B;  3PLN A;  3L71 D;  2E75 B;  3BRT B;  1S5L H;  4ASV A;  1GTW A;  2LIR A;  2WPS A;  1KFN A;  1NKN A;  2ZAE B;  3E1I A;  1RHZ B;  1E29 A;  1L0N E;  1E5W A;  1VQL P;  2Z4E A;  3M0D A;  1CTY A;  4PJ0 E;  3L75 D;  4XXL A;  1CHH A;  1ZME C;  3BCC D;  3HD7 B;  3VMZ A;  2L4D A;  1CED A;  1PGQ A;  3PP5 A;  4IFM A;  4HKZ H;  2B12 B;  3B5N C;  5AW3 B;  3RL0 C;  5CCH D;  2B0Z B;  1L0N G;  2KSJ A;  1FZG A;  5CCG C;  5DJQ B;  2QVA A;  1UII A;  1J2J B;  2EXV A;  1YNR A;  2FYN B;  1K3G A;  1N7S C;  2KSE A;  5GTH H;  3PXT A;  2ZT9 D;  1W2L A;  1EDI A;  3VP8 A;  3Q5P A;  1N73 A;  1C75 A;  3JSV C;  1HJB A;  4I1L A;  1FJ0 A;  3AEE C;  3G9R A;  3MK7 C;  1URQ D;  2M0B A;  2AXT E;  2D2C D;  3GF7 A;  3ZIY A;  1OVR A;  5C0Z A;  1NTM D;  3TGU J;  2KB7 P;  5CJ0 A;  4WQA A;  5GTI E;  1JNM A;  1BE3 E;  1MFZ A;  4H0L D;  1CYJ A;  4C7N A;  4GIF A;  4AX3 A;  3PH2 B;  1W5C E;  3D0W A;  3H1K E;  2JP3 A;  2YMY A;  2BCC E;  5AW5 B;  2PRR A;  4C7N B;  1JY2 N;  1DIQ C;  3CWB J;  5AW8 B;  2E76 D;  1YQ4 C;  3Q5S A;  3A7O A;  1BE3 G;  1YHQ P;  3H1H D;  3P8C E;  1M6Z A;  4L75 A;  5CCH A;  3CL3 D;  3H1K G;  4BXL A;  2BCC G;  3NBT A;  1J1E C;  1W5C T;  1Q7Y Q;  4WQD A;  2IYO A;  1IZN B;  3PHL A;  2PCC B;  1EZV D;  3H1L J;  4HB1 A;  2N1T D;  1PGJ A;  3CXH W;  3OJA B;  2ZT9 B;  3L72 J;  2JWD A;  1NIR A;  4YXD C;  3GMA A;  1L0L D;  1BCC E;  3L73 D;  2N9B A;  1T2K D;  1H88 A;  1M1K Q;  3SXT A;  4H13 D;  1M60 A;  3C1L A;  4FA4 A;  1VQM P;  1IFD A;  1URQ B;  1KQL A;  2R44 A;  2E74 C;  1HCM A;  1PP9 E;  1KIL E;  3RN0 A;  2D2C B;  4O1Q A;  2W6J H;  2FWL A;  1X22 A;  2BH5 X;  1IO3 A;  1BCC G;  2OAR A;  1CTZ A;  2QJP B;  3HQ9 A;  2K88 A;  3EWK A;  4H0L B;  1SQB K;  4WQ7 A;  1GK6 A;  3ZBM A;  4FAV A;  1SQX K;  1GMJ A;  1C52 A;  1E2R A;  1PP9 G;  1CRJ A;  4FAN A;  3KXD A;  1L0N D;  2ZVN B;  1IZL 0;  3CXH I;  3KDP B;  1QKS A;  2W8Z A;  2AXT V;  2E76 B;  1PZQ A;  5AVT B;  1H9X A;  1FCD C;  2XU6 A;  1HH7 A;  1SQP K;  1EXJ A;  4GED B;  3AE1 C;  5GTI V;  3VYI A;  1KC8 Q;  3CC4 P;  2ZOO A;  2N1T A;  2DW3 A;  4WQ8 A;  3WU2 H;  1CC5 A;  1CRG A;  5K5G B;  2FBW C;  1CHI A;  2QJY C;  2N1T B;  5M1B A;  2NPS C;  2FYU E;  2M5A A;  2BEZ F;  1CYI A;  1OMI A;  2RH0 A;  3CX5 D;  2FFD C;  1USD A;  2QM8 A;  1N15 A;  1VQO P;  5AVY B;  2OYI A;  2Y0E A;  4H13 B;  3AE6 C;  3LID A;  5KAF E;  1M70 A;  2B87 A;  1LWU A;  3HE4 A;  2Y0D A;  4W7Y A;  3PTZ A;  1C6R A;  5H2F H;  1H8A A;  1JUN A;  1ZR2 A;  5AVQ B;  2OYI B;  2B87 B;  1N50 A;  1BSN A;  1LWU B;  1SQB J;  3HE4 B;  3UIA A;  4ZNC A;  3JBT B;  1SQX J;  4JF7 A;  2FYU G;  1IK9 A;  1M1J B;  4PV1 B;  3QH9 A;  5B66 H;  3R4Y A;  2B9B A;  1I54 A;  3M9H A;  1VQK P;  1OVU A;  5KJ7 A;  2QJK B;  3TF5 A;  4BRY A;  1KV4 A;  3H1K D;  3CU4 A;  2BCC D;  3BAS A;  1QYZ A;  5AW4 B;  3V2P A;  3TGU D;  2JEE A;  4BRY B;  3I5C A;  1SQP J;  2WSE H;  1I55 A;  2ZBO A;  5C9M A;  3CCM P;  3D6Z A;  5CIE B;  5CIF B;  2N18 B;  1DW2 A;  1J1D B;  5BU5 A;  1EDK A;  2PAJ A;  1YIT P;  3M06 A;  2FKW B;  1MZ4 A;  3D6Y A;  3RN1 A;  4YPC A;  1SFC C;  3KYQ A;  1YJ9 P;  2ITA A;  1ZXG A;  1NGM B;  3L71 J;  1HWT C;  1ZW0 A;  2K1A A;  3M91 A;  1NTM K;  1NTZ E;  1A2S A;  1H33 B;  1KB0 A;  4ZMD A;  3WUT A;  3RK2 D;  2O1K A;  5C39 A;  4PW9 B;  1FDO A;  2YNY A;  3PH0 A;  3L75 J;  4FA5 A;  2Q1K A;  3KZI H;  1P84 E;  3HE5 A;  1NMI A;  1QX8 A;  1ETP A;  2CXB A;  4JPZ B;  1BGY E;  3BCC J;  1N9C A;  1JY2 O;  3LW5 H;  3A0H E;  2ZXE B;  3HE5 B;  1NTZ G;  1LTJ C;  1QL1 A;  1KIL D;  3AE2 C;  1M56 D;  2C2C A;  4WQ9 A;  1YEA A;  1WMK A;  3VRD A;  1KV9 A;  2QRX A;  3GHG A;  3S9O A;  4J20 A;  4AAM A;  3S1K A;  1NNO A;  1SQV E;  1FZE A;  3V6I A;  2J58 A;  3OA8 A;  2R3S A;  1Q86 Q;  3SWK A;  4WBA A;  1ZZH A;  1BGY G;  4PD4 E;  2N3Y A;  2WVR A;  3OA8 B;  1SS1 A;  3RL0 g;  3OCD B;  1YIQ A;  1N7L A;  4AAL A;  4NPD A;  1SLQ A;  3FX0 A;  1FZC B;  5KAF V;  2L91 A;  1KQS O;  1KYO D;  4P4Q B;  3CX5 I;  1X0T A;  1IFN A;  4IFD K;  1L0L K;  2KLU A;  4PWA A;  4PJ0 H;  2ZXY A;  1L4A C;  5KAI E;  3IF4 A;  1NTM J;  1VPC A;  3BAT A;  5CCG D;  3Q3D A;  1FHB A;  4JYB A;  1N7S D;  4I7Z C;  3GF3 A;  1JMB A;  2QM7 A;  4KHX A;  1CXA A;  3VMA A;  3AE3 C;  2FYZ A;  1OVV A;  3H25 A;  4H44 C;  1CCR A;  1KX7 A;  1RE3 A;  3CXH E;  3BRV B;  1FZA A;  1COT A;  2FYU D;  3RK2 B;  2OTL P;  2Y9Y A;  1YBK A;  2WPR A;  3H1I E;  2PFX A;  1VQ8 P;  3CX5 H;  5B5E H;  3KHU A;  5E79 H;  5KLI C;  1L0N K;  4AAN A;  1JY3 N;  5KKZ C;  1YTZ I;  4XFJ A;  2E42 A;  1KMI Z;  1OFC X;  1KIL B;  1M90 Q;  1JEK A;  1H0T B;  1D7M A;  3H1I G;  1IFI A;  1GU4 A;  3RK3 C;  2IFM A;  1KTM A;  1YCC A;  2P2U A;  1L0L J;  2YO3 A;  2YK3 A;  1COR A;  3L73 J;  2KK7 A;  4JBZ A;  3OW2 O;  3VNW A;  4IL6 E;  1SQB D;  1H31 A;  1KB9 E;  1DVV A;  2M3B A;  1AOF A;  1BDD A;  3A0H V;  1L9B C;  3L74 G;  2YKP A;  3AEA C;  1H31 B;  1GDV A;  1MG2 D;  3X39 A;  2YKQ A;  2ZFC A;  1IFP A;  1C6S A;  4UB8 E;  1H32 A;  2A45 G;  2WTY A;  2H7H A;  2PP6 A;  3B71 A;  3DMI A;  2OQQ A;  1CIF A;  1DW0 A;  1H32 B;  3V5B A;  1NTZ D;  3CCQ P;  3CD6 P;  1FOS E;  1GQ1 A;  2N3B A;  3SJL A;  2HPC A;  1L0N J;  4D6T E;  3RBX A;  1J3S A;  1DEB A;  1RF0 C;  3CCU P;  3NTN A;  2BH4 X;  2DGE A;  1P84 D;  1LGH B;  2MTA C;  1BGY D;  5KAI V;  1KYO I;  4EID A;  1LTS C;  4LLH A;  1IQC A;  155C A;  1R5L A;  2YKO A;  3L4O A;  4WY4 C;  2LKM A;  3WUV A;  1AVY A;  3MZW B;  1CIH A;  1MV8 A;  4AQR D;  3Q5R A;  1YYC A;  3HD7 A;  4D6T G;  2HLO A;  5CMZ A;  3A0B H;  2C9N Y;  1C6O A;  1CSB A;  1AV1 A;  4GOF A;  2FXP A;  1I6E A;  4O9B A;  5AVZ B;  4PD4 D;  3HRN A;  1HH0 A;  4OGQ C;  2BEQ D;  2WIT A;  1FZB A;  1LTG C;  2QG4 A;  4I2L C;  2FY8 A;  2KIK A;  1WT6 A;  3O0R C;  2W90 A;  1NJI Q;  2OYO A;  2SPZ A;  3V4Q A;  4L3H A;  1MFT A;  1LP1 A;  3W68 A;  2Q7C A;  2WSC J;  4EYY Q;  1RAP A;  1KYO H;  1EDJ A;  2WPQ A;  1IRW A;  1LP1 B;  2C1D B;  1VQ7 P;  5AVR B;  1HGZ A;  1VYD A;  2W27 A;  1FZF A;  1QEX A;  4NFG B;  1DW3 A;  5B6Q A;  1BE3 J;  3U1A A;  3WUU A;  1LT9 C;  1F1F A;  1YQ3 C;  2JDI H;  2OYH A;  4Z1M H;  3VOP A;  2NPS D;  5BU8 B;  3MUD A;  3CCL P;  1GL2 C;  3H1K J;  2RKL A;  2BCC J;  1LMS A;  4IL6 V;  1L9J C;  2OYH B;  1A8C A;  1RQU A;  1HZU A;  2KOG A;  1ZP0 C;  2J5U A;  2BCN B;  3KQG A;  4TLF A;  3H1I D;  3JCU E;  2E75 C;  4UB6 H;  2NZ2 A;  2GB8 B;  4AUW A;  1Q81 Q;  4UB8 V;  3SVW A;  5CID B;  1SQQ E;  3RK3 E;  4GKG A;  1HUC A;  1HRO A;  2KI7 B;  4GYD A;  3V2N A;  1R5S A;  2IBZ I;  3KPE A;  3L74 D;  3EFG A;  1QL2 A;  3M0D C;  3NBS A;  5APU A;  3OA7 A;  1B7V A;  1GW3 A;  3IAO A;  2FXM A;  1DH3 A;  3AE7 C;  4NPE A;  3CLQ A;  1IFM A;  1S5L X;  2BPB B;  3ZCF A;  1NO4 A;  4RJT A;  2JJL A;  2VRS A;  3U1C A;  1KB9 D;  1GU5 A;  5DJQ C;  1SQQ G;  1Y9B A;  1VQ4 P;  2LXC B;  1Q2N A;  2FYU K;  1SFC D;  2O1J A;  1U7M A;  1RY3 A;  3ORV A;  3IR9 A;  1PGP A;  1FBM A;  1H89 A;  1L2P A;  1URQ A;  1JY3 O;  3HUS C;  3CCE P;  1VQ6 P;  1N73 C;  4NPF X;  2K9J A;  2B4Z A;  3VMY A;  5AW6 B;  4XE5 B;  5TIS E;  2NPS B;  2ZJS E;  1YTZ T;  5KLV E;  1AFO A;  1S5L E;  5CJ4 A;  1NU1 E;  2K9J B;  1RQV A;  3WFC C;  3II6 A;  3RLM A;  4D6T D;  2Q5U A;  1LNQ A;  5DJU B;  4U3F E;  3B8E B;  1NOH A;  4IFF A;  1NAY A;  3CCS P;  1CCH A;  2CE1 A;  1ZRT E;  2CPS A;  5KLV G;  2UWJ E;  1NU1 G;  2Q3E A;  4YXW H;  3T97 A;  2HFE D;  4U3F G;  3H6P A;  1CRH A;  1N90 A;  2YMK A;  1E79 H;  1U74 B;  2FYU J;  5GTH E;  3H1J E;  3T97 B;  1FE6 A;  1VF5 D;  2GC7 D;  1KN7 A;  1I8O A;  3A3Y B;  1NTZ K;  5APT A;  2JWA A;  1C2N A;  1IRV A;  1L4A D;  3WMM 0;  1H9Y A;  1TU3 F;  5APW A;  3VN0 A;  5CIC B;  1SFC B;  2B11 B;  3H1J G;  1RZ6 A;  4H44 D;  3CYT I;  1JCC A;  5APY A;  2PCB B;  2BAS A;  3DP5 A;  2MHM A;  5AW2 B;  1M1J A;  1GU2 A;  2D2C C;  2AIU A;  1SVF A;  2YIU C;  4DT0 A;  3PJS K;  1VQP P;  1LJ2 A;  2CA3 B;  3LIE A;  1IJD B;  1BE3 D;  3L35 A;  2CE0 A;  2QJP C;  2WZ7 A;  1LTJ B;  4DY9 A;  2H43 A;  1A56 A;  5CYT R;  1EZV I;  4TT3 H;  1DT1 A;  2KZI A;  2ZYA A;  2N9J A;  3NWV A;  3HTK A;  1MG3 D;  1AQ5 A;  1SQQ D;  3I55 P;  2J59 M;  2E76 C;  5TIS V;  2V4H A;  1NTZ J;  4EIE A;  3AEC C;  3ZOY A;  1CI6 B;  3HTK B;  1JB0 J;  2QSI A;  1S5L V;  3P8C D;  1CHJ A;  3RBZ A;  3MD0 A;  5AVV B;  1PIX A;  1GIW A;  1L4A A;  1AOQ A;  5AW9 B;  2B10 B;  1VF5 B;  1H33 A;  3ABV C;  5AVU B;  3MIW A;  2QA4 P;  4LGD E;  1BGY J;  2A45 H;  4M3L A;  3D70 A;  1HJ0 A;  1L4A B;  3L70 E;  3GLM A;  2G3A A;  2KZJ A;  3AEB C;  4EIJ A;  2ZYD A;  2N1T C;  2QEX P;  3CX5 W;  1RF1 A;  3L4F A;  1CYC A;  5AW7 B;  1U75 B;  4I7Z B;  1JMM A;  1BCC D;  5DJT B;  2Q9I A;  1YIC A;  3GW6 A;  3HQ8 A;  1RF1 B;  1OX3 A;  2M3E A;  4H44 B;  1CRY A;  2W6A A;  1T3U A;  3CME P;  1RZ5 A;  4Y99 B;  2A06 E;  5GTH V;  1PP9 D;  3L70 G;  2R5D A;  2OYI C;  4Y28 J;  5KLV D;  1NU1 D;  1RE4 A;  1YEB A;  1WVE C;  3L71 E;  2N9I A;  3CI9 A;  3O20 A;  4PV1 C;  3JC2 2;  3E7K A;  1KFM A;  3L37 A;  4C7R A;  4U3F D;  5IY5 1;  3OCD A;  3B4S A;  5KKZ B;  2JQR A;  4GDO A;  2IFN A;  2FRC A;  1DD3 A;  1FZC A;  2E5T A;  4IOI H;  1VQN P;  5EFW B;  1ZRT D;  2WSF J;  1N8R Q;  1VQ9 P;  2K37 A;  2YQB A;  5KJ7 C;  5CHX A;  4EOT A;  2I1K A;  2XV5 A;  3L71 G;  2C8S A;  4XYD B;  4CPG A;  3CC2 P;  1G2C A;  1SQV G;  1CZQ A;  1PPJ E;  1J1D C;  3B5N D;  1QVF O;  4OGQ D;  1FOC A;  3CP5 A;  3RL0 D;  1X9V A;  1FJK A;  2HYN A;  4N6J A;  1EC5 A;  1G2C B;  4GOD A;  4WQB A;  3ITK A;  1GJQ A;  3W67 A;  2Z5H A;  3H1I J;  4O1W A;  4FB1 A;  1CIG A;  1PPJ G;  1HJ4 A;  4ZKU A;  1CSU A;  4LJI A;  4IL6 X;  2N9Y B;  5H2F E;  3M9Q A;  2DVH A;  3MP7 B;  3L74 J;  1GL2 D;  3IN6 A;  4WVZ A;  4OVN F;  1KIL A;  1T8Z A;  2OTK E;  3P8M C;  1WRG A;  2POH A;  5B66 E;  1H0T A;  3SFE C;  1RAQ A;  3G6E P;  2HOD A;  2AXT H;  4HYT B;  2OZ1 A;  1FDI A;  2E75 D;  1VDF A;  2WSC H;  5DFS A;  2R32 A;  3EQ2 A;  1N86 A;  1NH4 A;  1FS0 E;  1HGV A;  2HOD B;  4L1Q A;  1W2E A;  1Q82 Q;  2OZ1 B;  3GHG C;  3WFB C;  1LTB C;  1LC2 A;  3QWO C;  1AYG A;  3H32 A;  5GTI H;  2C9X B;  2CK3 H;  1K73 Q;  1PL5 A;  5DF5 A;  1KYO W;  3TYY A;  1R0Q A;  2YXR B;  3H32 B;  1JM0 A;  1GZL A;  3B5N A;  451C A;  3H1H E;  3FWL A;  3FWN A;  3G3Z A;  4OH8 B;  5AW0 B;  5CCG A;  4N3Y B;  3VYM A;  2P10 A;  5CBO A;  3B5N B;  1N7S A;  4OGQ B;  5AVW B;  4D6T J;  4K3I A;  3RL0 B;  2YCC A;  4Y5R A;  2O01 J;  1AVO A;  3OAK A;  2KP8 A;  4RES B;  1N7S B;  1GKS A;  1IO4 A;  1CO6 A;  3ZOW A;  2W83 C;  1W2B O;  3KZI E;  1Q90 D;  2KNC A;  3H1H G;  2GUS A;  3L70 D;  1S9K E;  1K8A Q;  1EDL A;  1ZLL A;  3SSU A;  2G8Y A;  1GL2 A;  2KNC B;  3RK2 C;  2OGU A;  3MK7 B;  2IZ1 A;  3Q2Y A;  2E74 D;  2XTS B;  1GK4 A;  1GL2 B;  2B89 A;  4L74 A;  3WU2 V;  1OIP A;  2KS1 A;  4B86 A;  1HJ5 A;  1SQQ K;  3DR0 A;  1MKM A;  1VQ5 P;  1DD4 A;  3TNU B;  2R5B A;  1AA0 A;  2D0S A;  2KS1 B;  1NTK E;  1QN2 A;  4N78 E;  1FOS F;  3VMX A;  3A2A A;  1SQV D;  3NMD A;  2GIW A;  1IC2 A;  1NAF A;  2V7Q H;  2AEM A;  1FI9 A;  4GT1 A;  1S72 P;  5H2F V;  5CIB B;  3Q1M A;  1S4X A;  1M57 D;  4R4L A;  1R8E A;  2MKV A;  1NTK G;  2C1V A;  5B66 V;  3FGA D;  1JO5 A;  2C1D A;  1PPJ D;  4RSZ A;  2XND H;  4XA4 A;  1DEE G;  2O01 N;  1J1E B;  1NHL A;  4KT0 J;  3WC8 A;  2RN0 A;  3WFD C;  3CPW O;  3AE8 C;  3BVH A;  2IZ0 A;  3AED C;  3C8V A;  1DX7 A;  2H89 C;  2QE7 H;  4KMG A;  1MUU A;  3HUS A;  5KLV K;  1NU1 K;  2Q3I A;  1USE A;  3CXH D;  3PRJ A;  3CX5 E;  1CRI A;  1N2D C;  1OWA A;  5B5E E;  5E79 E;  1GDT A;  3HUS B;  3ZOX A;  3MHV A;  1SQQ J;  1N73 B;  2I8D A;  2AXC A;  1EXI A;  1NKZ B;  3PXS A;  3M97 X;  2E74 B;  4W7Z A;  3RGU A;  1K05 A;  3FXE A;  2PGD A;  3VP9 A;  5KAF H;  1M8O B;  2CPB A;  2M8R A;  3MGN A;  1ZV8 A;  1CXC A;  2Y0C A;  3KZI V;  1IK7 A;  2K3R A;  1CSV A;  3V2Q A;  1OXZ A;  1U7J A;  3RMZ A;  1CNO A;  5TJH A;  3HD7 C;  2MJZ A;  1PFI A;  2C0X A;  1YFC A;  1T6A A;  3TGU E;  1OAE A;  1BCC J;  1DVH A;  1OW7 A;  2YXQ B;  1JY2 P;  4QMA A;  3USS A;  4AAO A;  1EB7 A;  2ZVO B;  2FYN C;  1C7M A;  3P7K A;  1X79 B;  3M0A A;  1PP9 J;  1P84 I;  5AW1 B;  3O6Q A;  5APQ A;  1I6D A;  5KLV J;  1NU1 J;  3CWB E;  3TGU G;  2LXB A;  2V7Q J;  2NPS A;  1OZH A;  3O6Q B;  4U3F J;  1Z56 A;  4MN4 C;  2FFD A;  1U57 A;  2Z5I A;  2QJY B;  2OTJ P;  4OWF A;  3TDK A;  2L5G B;  1JDL A;  2WMM A;  4PJ0 V;  1S2E A;  1S9K D;  2FFD B;  2OYH C;  3MUD C;  1K3H A;  2JR8 A;  4PD4 I;  2WWW A;  3SWY A;  2KUB A;  4ASW A;  4ZKP A;  3CWB G;  2ZXX A;  3M9B A;  3NXS A;  3H1L E;  3SWF A;  2XKM A;  5APS A;  3A0B E;  3AEG C;  3L36 A;  3L72 E;  1P84 H;  2YIU B;  1DW1 A;  1YTC A;  3H1J J;  4PV1 D;  3PXW A;  1CIE A;  3E1R A;  1I8P A;  3A0H H;  5L8R J;  1NTK D;  4N78 D;  1XTC C;  1KX2 A;  3C9I A;  2P67 A;  4H0J A;  3A9F A;  3H1L G;  5B5E V;  5E79 V;  2PAC A;  3F89 A;  3L72 G;  5KJ7 D;  2AEF A;  1YJN P;  3WFE C;  3CCV P;  3HQ6 A;  1KYO E;  2O3J A;  2D0W A;  4PD4 H;  1SFC A;  5CCH C;  4JQ0 D;  1QL3 A;  1NVO A;  2P1J A;  1LC1 A;  2C1U A;  2ZT9 C;  4YE1 A;  1AKK A;  4JCG A;  1ZN5 A;  1I5T A;  4N0K A;  1LTA C;  2GM4 A;  1DII C;  5KAI H;  1KD1 Q;  1LTT C;  5CIG B;  4L73 A;  1CSW A;  4EDF A;  2HR3 A;  1URQ C;  1FJP A;  2ZZS 1;  1HJ3 A;  2V07 A;  2WSF H;  1GD2 E;  4UB6 E;  1SQV K;  3O5C A;  3I56 P;  3C2C A;  1LTI C;  2ORL A;  1HRC A;  3CXH H;  1LTJ A;  2M5A B;  2A45 I;  1CSX A;  4RO0 A;  2H88 C;  4Q5P A;  4EIF A;  3AE5 C;  1KZU B;  4WQE A;  4U7J A;  4I6M C;  1HBW A;  1KB9 I;  5APV A;  2I1J A;  4H0L C;  4JYC A;  5AVS B;  1KIB A;  2WT7 A;  3TSI A;  4KJM A;  1FU1 A;  1CI6 A;  2QIW A;  4L3G A;  3RK3 D;  2WT7 B;  4L76 A;  1LT1 A;  2IDB A;  1A02 J;  2KYV A;  2H8P D;  2BGV X;  3L70 J;  4C46 A;  1CW5 A;  1HF9 A;  4FA9 A;  1SQB E;  4HH2 A;  1SQX E;  1C2R A;  3CCJ P;  1K9M Q;  2WQY C;  2KLV A;  5KTB A;  1FDM A;  3A0B V;  2P7J A;  4IL6 H;  1KQG B;  1KB9 H;  1G1I A;  4QAO A;  4GOE A;  2IBZ E;  3SWS A;  1HTL C;  351C A;  2IPP A;  5APX A;  1SQB G;  3CWB D;  2GC4 D;  1JOC A;  1SQP E;  1SQV J;  1SQX G;  2XZR A;  1T2K C;  4H13 C;  1FI3 A;  5CIH B;  2YO2 A;  3VTP C;  4DJG A;  1VL2 A;  3GG2 A;  4EIC A;  4DZO A;  4UB8 H;  1FC2 C;  2ZON G;  3P32 A;  1XTG B;  2KXP B;  3HQ7 A;  3D71 A;  1LWU C;  1CRC A;  1A02 F;  2IBZ G;  2GA1 A;  1M1J C;  1OCD A;  4HJG H;  4R4M A;  3N7N A;  1SQP G;  5KLI B;  2W6B A;  3G4S P;  1FAV A;  4WY4 D;  3H1L D;  1IFJ A;  2Q6Q A;  2JTI B;  1M7L A;  2O01 H;  2RMZ A;  3L72 D;  2QJK C;  2A06 G;  3L75 E;  1EQ7 A;  1BL9 A;  3A5T A;  3CC7 P;  1G1J A;  2VHD A;  2E43 A;  3WUI A;  2JKV A;  2JO1 A;  4K35 A;  3BCC E;  1NML A;  3GHG B;  3MTU E;  3RK3 B;  1RH5 B;  2LIT A;  3ZOO A;  2LR2 A;  2N18 C;  1YIJ P;  1UIX A;  2HV4 A;  3R2P A;  3WU2 E;  1NWQ A;  4UB6 V;  2P58 A;  1BSH A;  1PV3 A;  1DIP A;  3H1J D;  2Y9Z A;  2I8F A;  2IX7 C;  3L75 G;  1VF5 C;  3AE4 C;  3L4M A;  5AUR A;  4WB4 A;  1HZV A;  1Y8A A;  1KOR A;  1ZOY C;  2AEJ A;  3BCC G;  4WQC A;  1LFM A;  1AQT A;  3TK1 A;  4A7P A;  2CA4 B;  3F5H A;  1YJW P;  4W80 A;  1RF1 C;  2BLF B;  3FXD A;  1RF0 A;  4Y99 C;  2WSE J;  1K04 A;  1PGO A;  2K9Y A;  1JTH A;  1NTM E;  1KQF B;  1NTK K;  2GUV A;  1YI2 P;  2NRG A;  3V4W A;  1WEJ F;  1JTH B;  4YTP C;  4WY4 A;  3IFM A;  1QL4 A;  1X8Y A;  3H1H J;  5BVZ A;  1LS9 A;  1CTJ A;  1GW4 A;  2XDJ A;  1RE4 C;  1OW6 A;  4BWN A;  2WPV B;  4WY4 B;  2IYP A;  1JY3 P;  1SP4 A;  3G71 P;  2C0W A;  1NTM G;  5CBN A;  1QVG O;  3S4R A;  4V2K A;  3JCU H;  2WSS H;  4MU8 A;  4FA1 A;  1BDC A;  3O1Y A;  3L74 E;  1FZC C;  1FI7 A;  2HG5 D;  1MZ9 A;  3HD7 D;  2R3C A;  1QGK B;  4H0K A;  3N4X A;  3LW5 J;  3CCR P;  1H1O A;  2XNX A;  2C9L Y;  1SQX D;  3EFF K;  5EXQ A;  5AVX B;  1EZV E;  1HVV A;  3O8Z A;  4K3A A;  1T3J A;  2ZYG A;  3U59 A;  3AE9 C;  3SFD C;  4WWI A;  1NYH A;  2AI5 A;  3NFQ A;  1LT9 A;  1L0L E;  3AEF C;  3L73 E;  3CMA P;  2IBZ D;  1F1C A;  1S3J A;  1S1C X;  2B88 A;  4DOJ A;  1NTK J;  1RE3 C;  4RKU J;  1QLE D;  1LT9 B;  1OW8 A;  2V08 A;  1Y47 A;  1SQP D;  1E8E A;  3SLE A;  4DCK A;  3K5B A;  1EZV G;  1JCD A;  4AYC A;  3TNU A;  1S6V B;  2FXO A;  2A06 D;  4LC1 A;  4EI2 A;  1AJY A; 
#chains in the Genus database with same CATH homology
 1C7M A;  4PWA A;  2ZXY A;  3TYI A;  2CA3 B;  3PLN A;  3L71 D;  1I6D A;  1BE3 D;  2CE0 A;  1FHB A;  4DY9 A;  2LIR A;  1A56 A;  5CYT R;  1CXA A;  3VMA A;  1E29 A;  1DT1 A;  1CTY A;  1CCR A;  1KX7 A;  2N9J A;  2QJY B;  3L75 D;  3NWV A;  4XXL A;  1MG3 D;  3TDK A;  1SQQ D;  1JDL A;  4PJ0 V;  1COT A;  1CHH A;  2FYU D;  5TIS V;  4EIE A;  3BCC D;  3ZOY A;  2L4D A;  1K3H A;  1CED A;  1S5L V;  1CHJ A;  2B12 B;  1GIW A;  3KHU A;  1AOQ A;  2B0Z B;  2B10 B;  4AAN A;  1H33 A;  5DJQ B;  2EXV A;  1YNR A;  2YIU B;  1DW1 A;  1YTC A;  2FYN B;  1K3G A;  3PXT A;  3PXW A;  1W2L A;  1CIE A;  1I8P A;  1C75 A;  1NTK D;  3CX5 W;  1KX2 A;  1CYC A;  1U75 B;  1BCC D;  1FJ0 A;  1YCC A;  3A9F A;  4H0J A;  5B5E V;  1YIC A;  5E79 V;  3MK7 C;  3HQ8 A;  3GW6 A;  2PAC A;  2YK3 A;  1COR A;  1CRY A;  3VNW A;  1RZ5 A;  3WFE C;  1SQB D;  3HQ6 A;  1H31 A;  2O3J A;  5GTH V;  3ZIY A;  1DVV A;  2D0W A;  1PP9 D;  5C0Z A;  1NTM D;  1AOF A;  3A0H V;  5KLV D;  1L9B C;  1QL3 A;  1NU1 D;  1H31 B;  1YEB A;  1WVE C;  1GDV A;  2N9I A;  3O20 A;  4WQA A;  1MG2 D;  3X39 A;  1LC1 A;  2C1U A;  4YE1 A;  1AKK A;  4JCG A;  1CYJ A;  4U3F D;  5IY5 1;  4AX3 A;  1I5T A;  3OCD A;  3PH2 B;  1C6S A;  5KKZ B;  1H32 A;  2JQR A;  2FRC A;  4N0K A;  1DII C;  3DMI A;  5CIG B;  1CIF A;  1DIQ C;  1CSW A;  1DW0 A;  1H32 B;  4EDF A;  1NTZ D;  1GQ1 A;  1ZRT D;  2ZZS 1;  2YQB A;  1HJ3 A;  2N3B A;  2V07 A;  3SJL A;  2C8S A;  4XYD B;  3O5C A;  1J3S A;  3H1H D;  3C2C A;  2ORL A;  1FOC A;  1HRC A;  2BH4 X;  1M6Z A;  2DGE A;  3CP5 A;  1P84 D;  1CSX A;  2MTA C;  4Q5P A;  4EIF A;  1BGY D;  3NBT A;  4WQE A;  5KAI V;  4WQB A;  3ITK A;  4EID A;  1W5C T;  1GJQ A;  1IQC A;  155C A;  4WQD A;  3L4O A;  1KIB A;  4O1W A;  3PHL A;  4FB1 A;  2PCC B;  1EZV D;  1CIH A;  1CIG A;  3CXH W;  4L3G A;  1NIR A;  1HJ4 A;  1CSU A;  1C6O A;  1L0L D;  3L73 D;  4LJI A;  2BGV X;  2N9Y B;  3SXT A;  1M60 A;  1I6E A;  4FA4 A;  2DVH A;  4PD4 D;  4FA9 A;  1HCM A;  1C2R A;  2QG4 A;  3RN0 A;  3O0R C;  4O1Q A;  4L3H A;  1RAQ A;  2FWL A;  3A0B V;  2BH5 X;  1IO3 A;  2OZ1 A;  1RAP A;  1CTZ A;  4QAO A;  2QJP B;  1IRW A;  5DFS A;  3SWS A;  2C1D B;  4L1Q A;  351C A;  2OZ1 B;  3HQ9 A;  1VYD A;  3WFB C;  4WQ7 A;  1LC2 A;  4NFG B;  1DW3 A;  3CWB D;  2GC4 D;  3ZBM A;  4FAV A;  5B6Q A;  1AYG A;  1C52 A;  2C9X B;  1E2R A;  1CRJ A;  1F1F A;  4FAN A;  1FI3 A;  5CIH B;  1L0N D;  3GG2 A;  4EIC A;  5DF5 A;  1IZL 0;  1KYO W;  2ZON G;  1QKS A;  1R0Q A;  2AXT V;  1LMS A;  4IL6 V;  1L9J C;  451C A;  3HQ7 A;  1A8C A;  3FWL A;  1CRC A;  1H9X A;  1HZU A;  1FCD C;  3VYM A;  2BCN B;  1HH7 A;  1OCD A;  3H1I D;  4K3I A;  5KLI B;  2YCC A;  4GED B;  4Y5R A;  5GTI V;  3H1L D;  2GB8 B;  2JTI B;  2ZOO A;  2RMZ A;  1GKS A;  3L72 D;  4WQ8 A;  1CC5 A;  1CO6 A;  4UB8 V;  1CRG A;  3ZOW A;  3SVW A;  1BL9 A;  5CID B;  1CHI A;  2VHD A;  3L70 D;  3WUI A;  1HRO A;  4GYD A;  1CYI A;  3L74 D;  3CX5 D;  1NML A;  2LIT A;  3NBS A;  3ZOO A;  2KNC B;  1N15 A;  2N18 C;  1B7V A;  3MK7 B;  2HV4 A;  2Y0E A;  4UB6 V;  1M70 A;  2XTS B;  2BPB B;  2Y0D A;  3ZCF A;  3PTZ A;  3H1J D;  1C6R A;  3WU2 V;  2I8F A;  4RJT A;  2KS1 A;  1KB9 D;  1HJ5 A;  1N50 A;  3DR0 A;  3L4M A;  5DJQ C;  5AUR A;  3JBT B;  1HZV A;  2D0S A;  1QN2 A;  3ORV A;  4WQC A;  1LFM A;  1SQV D;  4A7P A;  1I54 A;  2GIW A;  2CA4 B;  2QJK B;  3TF5 A;  1FI9 A;  3H1K D;  3CU4 A;  5H2F V;  2BCC D;  2BLF B;  1QYZ A;  2B4Z A;  3TGU D;  5CIB B;  1I55 A;  2ZBO A;  5C9M A;  2C1V A;  5B66 V;  5CIE B;  5CIF B;  2N18 B;  3WFC C;  2K9J B;  1DW2 A;  2C1D A;  3RLM A;  4D6T D;  1WEJ F;  1PPJ D;  1MZ4 A;  4RSZ A;  3RN1 A;  1QL4 A;  1LS9 A;  1CTJ A;  3WC8 A;  2RN0 A;  3WFD C;  4KMG A;  1CCH A;  2CE1 A;  1A2S A;  4V2K A;  1H33 B;  1KB0 A;  4MU8 A;  4FA1 A;  2Q3E A;  3CXH D;  3O1Y A;  3PRJ A;  1FI7 A;  1CRI A;  4PW9 B;  4FA5 A;  3ZOX A;  1CRH A;  4H0K A;  1N90 A;  1NMI A;  1U74 B;  1ETP A;  2CXB A;  1N9C A;  2GC7 D;  1H1O A;  3PXS A;  3M97 X;  1I8O A;  1SQX D;  5EXQ A;  2JWA A;  1C2N A;  1IRV A;  2C2C A;  4WQ9 A;  1YEA A;  1H9Y A;  3VRD A;  1KV9 A;  5CIC B;  4J20 A;  4AAM A;  2AI5 A;  1NNO A;  1CXC A;  2Y0C A;  3KZI V;  1CSV A;  3OA8 A;  3RMZ A;  2B11 B;  2IBZ D;  1CNO A;  1F1C A;  5TJH A;  1ZZH A;  1RZ6 A;  2V08 A;  2N3Y A;  3CYT I;  3OA8 B;  1SQP D;  1YFC A;  1E8E A;  1OAE A;  3SLE A;  2PCB B;  3OCD B;  1YIQ A;  3DP5 A;  2MHM A;  4AAL A;  1DVH A;  5KAF V;  2L91 A;  1S6V B;  1KYO D;  2A06 D;  4P4Q B;  4AAO A;  1EB7 A;  1GU2 A;  2AIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...