3L74D

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 70
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l74D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l74D02
4NFGB 2JQRA 3RMZA 2XTSB 4P4QB 1A56A 1QN2A 3WFCC 1L0ND 1N9CA 3CXHW 3M97X 1KV9A 3NBSA 3ZIYA 2AXTV 2QJYB 1CTZA 1YEBA 1F1CA 1N90A 2GC7D 2YK3A 2Y0CA 4RSZA 1FI7A 2L91A 3CXHD 2N18C 1I6EA 2B0ZB 2V08A 5DFSA 1HZVA 2C9XB 1OAEA 1CIGA 4K3IA 1H33B 1I5TA 3MK7B 1N15A 1LS9A 4FA9A 5B66V 3FWLA 4Q5PA 2ZONG 2KNCB 1KX7A 4EICA 2FWLA 1CIFA 4O1WA 3OA8A 1CSWA 1GQ1A 2BCCD 5IY51 1H32A 3L71D 1H9XA 3PHLA 1AOFA 4IL6V 1YTCA 4D6TD 3RLMA 3SXTA 1MG2D 5E79V 1YNRA 4YE1A 2YQBA 1NIRA 2YIUB 3DMIA 2N3BA 3HQ9A 5KAIV 1CRHA 1CO6A 3WC8A 1NNOA 5KKZB 2HV4A 1EZVD 1RAPA 2MHMA 2JWAA 4PWAA 3TDKA 2GC4D 1I54A 1CORA 1CIHA 2IBZD 4WQBA 1CRCA 3HQ8A 2N9IA 1I55A 1NMLA 2MTAC 2YCCA 2N3YA 2CE0A 4WQ8A 3ZOOA 1NU1D 1CYJA 4WQCA 3A0HV 1KYOW 1CSVA 1IO3A 1CYIA 1NTZD 4H0KA 1CCRA 5KLVD 1C6RA 4GEDB 1MG3D 2LIRA 1LMSA 1W2LA 1PPJD 3PH2B 4LJIA 1EB7A 2AI5A 1KYOD 1CIEA 1CRIA 1DW2A 1SQVD 2ZXYA 4MU8A 2B11B 4FA5A 2D0SA 1M6ZA 1CTYA 3KZIV 3X39A 2L4DA 3GG2A 1IQCA 1I8PA 3VNWA 1DIIC 1H31B 2QG4A 1WVEC 4PW9B 2BGVX 2C1DB 2DVHA 1E8EA 4PD4D 1HJ3A 4FA1A 1DW0A 1A8CA 1IRWA 1CC5A 1B7VA 3A9FA 4FB1A 2Q3EA 1A2SA 5CIFB 4AAMA 3SLEA 4WQDA 2C2CA 1OCDA 1NMIA 1NTKD 1CTJA 1SQQD 1CHIA 3WFBC 1CRJA 1H33A 1FHBA 1C2RA 3ZOXA 4N0KA 1FJ0A 2QJKB 4H0JA 1CEDA 1CRYA 5CIDB 2V07A 1KX2A 3BCCD 2B10B 1SQXD 2CXBA 1HZUA 2OZ1B 5CYTR 4EDFA 3HQ7A 1HH7A 1M70A 1IZL0 2A06D 1U74B 3TGUD 1QKSA 3CX5W 3CU4A 3H1KD 3O0RC 4FA4A 1LC2A 1CRGA 3L4OA 1WEJF 1HCMA 1KIBA 1FCDC 1L9JC 1C6OA 4A7PA 3H1HD 1AKKA 1BGYD 3CX5D 2O3JA 1SQBD 1RZ6A 1K3GA 2ZZS1 5B6QA 1DVHA 3PLNA 1ETPA 2D0WA 2QJPB 3ORVA 1AYGA 1C52A 2JTIB 2C1UA 4AANA 2PCCB 2K9JB 3ITKA 3HQ6A 3OCDA 1COTA 3ZOWA 3DR0A 1QL4A 3L72D 2CA4B 1J3SA 1BCCD 1L9BC 1YIQA 4AAOA 2VHDA 1RAQA 1R0QA 1HJ5A 5DJQC 1HROA 4EIDA 1E2RA 4WQAA 1H31A 1F1FA 1C75A 1FI9A 4FAVA 1H1OA 1LC1A 4UB8V 3VRDA 2N9YB 1KB0A 3PTZA 4RJTA 1I8OA 1C7MA 4PJ0V 3ZCFA 1FI3A 2B12B 2BPBB 4UB6V 3H1ID 1GDVA 1C6SA 2PACA 1BL9A 1ZRTD 1S6VB 3CP5A 5CIEB 1HRCA 1HJ4A 2OZ1A 3RN0A 3TYIA 3H1JD 1YEAA 1AOQA 3C2CA 2EXVA 4DY9A 1L0LD 1NTMD 4U3FD 3CWBD 3O20A 5CIHB 3L74D 4EIFA 2BCNB 4O1QA 3O1YA 2BH5X 4GYDA 1RZ5A 1LFMA 1DIQC 1CHHA 4WQ7A 3PRJA 1CXAA 4L1QA 4XXLA 3SVWA 5DJQB 5CICB 1CSXA 3L75D 3ZBMA 451CA 2KS1A 2FRCA 1YFCA 1C2NA 1GKSA 3WFDC 2DGEA 1DW3A 155CA 2RMZA 351CA 2PCBB 5CIBB 5DF5A 5C0ZA 2ZBOA 1YCCA 5EXQA 2CE1A 2ORLA 5B5EV 1DW1A 3RN1A 1CHJA 1JDLA 4J20A 3OA8B 1I6DA 3NWVA 2GIWA 1DVVA 1H32B 1PP9D 5GTHV 2Y0DA 1YICA 3VMAA 4WQEA 2C1VA 3SWSA 1GIWA 5KAFV 3H1LD 3WUIA 1DT1A 5KLIB 4JCGA 3CYTI 3ZOYA 3DP5A 2FYUD 3KHUA 2C8SA 2FYNB 4EIEA 2Y0EA 5GTIV 1MZ4A 1SQPD 5AURA 4WQ9A 3WU2V 1ZZHA 3MK7C 3SJLA 1CXCA 2N9JA 1H9YA 3TF5A 1CCHA 5CIGB 2AIUA 3JBTB 1CSUA 3VYMA 1M60A 3PXWA 2C1DA 2BH4X 1S5LV 1FOCA 3A0BV 5H2FV 3OCDB 4V2KA 1QL3A 3GW6A 4AALA 1E29A 2N18B 3L70D 1GJQA 4XYDB 4QAOA 4L3HA 2GB8B 4FANA 1CNOA 5TISV 1IRVA 1GU2A 1KB9D 3WFEC 3L73D 4L3GA 2ZOOA 5C9MA 1QYZA 4KMGA 3PXSA 4Y5RA 3NBTA 1U75B 1VYDA 4AX3A 2LITA 2BLFB 1CYCA 3O5CA 1N50A 2CA3B 1W5CT 1BE3D 3PXTA 2I8FA 1K3HA 3L4MA 1P84D 2RN0A 2B4ZA 5TJHA
chains in the Genus database with same CATH superfamily
1EZVI 4P4QB 1A56A 1QN2A 1LTIC 1N9CA 2W8ZA 1KV9A 3NBSA 3ZIYA 2OTJP 3V2RA 4OWFA 3R4YA 5APSA 4WVZA 1PGOA 3L70G 4LLHA 4WY4C 2XDJA 2G3AA 3CC4P 1ZLLA 3U59A 3CXHD 2B0ZB 5DFSA 1MFTA 2ZXEB 2QRXA 2IYPA 1YQ3C 1VDFA 3KZIH 1KYOE 3NMDA 3TNUA 1LTJA 1H0TA 1NWQA 5AW8B 2KNCB 2CPSA 1RE3A 2FWLA 1CIFA 1A02J 2ZVOB 1H9XA 1SQVK 3G9RA 4IL6V 3L73J 4D6TD 3RLMA 2O01H 4YE1A 1NIRA 4PD4I 1VQ5P 4HYTB 3G3ZA 1HWTC 1BE3J 1RF0A 2O1KA 2HV4A 1RAPA 1VQ8P 2GC4D 2YMYA 4IL6E 2QJKC 4WQBA 1S2EA 1IFPA 2QIWA 2IPPA 1URQC 2MTAC 2R5DA 5BU8B 1K04A 2N3YA 1NTKK 2BEQD 3HD7D 3H25A 5AW5B 2WSFJ 4H0KA 1IFNA 5KLVD 5AVZB 2FY8A 1OW8A 1GK4A 3AEFC 2Q5UA 3QWOC 1KN7A 2NPSD 2AI5A 2HYNA 3H1HG 1KYOD 1CRIA 2B11B 2KOGA 1KILC 2C9LY 1LTTC 2AEMA 3L75E 2BCCJ 3L71J 5KKZC 1KILD 3VNWA 4W80A 2A45G 2QG4A 3H32B 3CX5I 2BGVX 1HJ3A 3MGNA 1VQ6P 1A8CA 1CC5A 3A9FA 1FU1A 1A2SA 3SLEA 1N73B 4WQDA 2C2CA 3L72G 3M9QA 1ZN5A 1VQOP 1CI6B 1PPJG 3MUDC 1YJNP 3HE5A 1YIJP 1TU3F 3UIAA 1PP9E 1CHIA 3B5NB 1FZEA 1H33A 1SQVG 1C2RA 2E76B 3OA7A 4W7ZA 1OW6A 3VP8A 2Z5HA 1GW3A 1CEDA 3B8EB 5CIDB 4GIFA 2VRSA 2WSCJ 2B10B 1U7JA 4QMAA 1HZUA 1X8YA 5CYTR 4EDFA 1YTZT 1K05A 1IZL0 3E1RA 2E74D 2ZAEB 2OTKE 1MUUA 3H1KD 3RBZA 1YQ4C 1RH5B 1S4XA 1NTKG 3LW5J 1CRGA 3L4OA 1WEJF 1HCMA 1FCDC 4ZKPA 5C39A 3H1HD 1JMBA 1BGYD 3H1IE 1RZ6A 1GL2C 4PV1D 1FDMA 5B6QA 1DVHA 1AQTA 1ZRTE 2E5YA 4H44C 3VOPA 2QJPB 1HJ0A 2M3BA 2V4HA 2E75D 2C1UA 2FXOA 4H0LD 2PCCB 2K9JB 1P84I 3FGAD 1FZAA 1DD3A 3USSA 1HF9A 3OCDA 4JQ0D 4ZKUA 3ZOWA 1YHQP 3L35A 3L72D 2PP6A 1W2BO 1PZQA 1L9BC 2ZFCA 1M1KQ 1SS1A 1OIPA 2MJZA 1L0NK 1JCCA 1L0LK 3C9IA 2DW3A 1JY3P 3D71A 2YKOA 2N1TA 1GU4A 3FX0A 1JY2P 1FI9A 3TGUJ 1HVVA 2YXRB 4AUWA 4UB8V 3VRDA 3BATA 1KB0A 3PTZA 1G2CB 4RJTA 5AVWB 1FI3A 2B12B 1N7SC 4UB6V 3H1ID 2BCCE 3L71E 3SWYA 1WT6A 4H13B 2R3SA 3NXSA 1ZRTD 2FFDA 2FXMA 3CP5A 3AEAC 3G4SP 1IC2A 3H1LE 2FYNC 2Z5IA 2XNXA 4L76A 1EZVE 3RN0A 4UB6E 1KMIZ 1YEAA 2GA1A 1HBWA 2EXVA 4DY9A 5AW3B 1LT9A 2IZ0A 1IJDB 4C7RA 3O1YA 2BH5X 2J5UA 2K37A 4IL6X 4L1QA 1VF5B 4XXLA 2KK7A 1EDLA 5DJQB 2V7QH 1CSXA 3ZBMA 451CA 1OZHA 3T97A 1GKSA 1KV4A 4MN4C 155CA 1FBMA 2WPSA 3U1CA 1KFNA 2N9BA 351CA 1R5LA 1KB9I 5CIBB 3BASA 2D2CC 3H1JG 2ZBOA 5EXQA 3CC2P 2CE1A 3LIDA 1L0NG 1DW1A 3HE4B 1L0LG 3CWBG 4J20A 3AE2C 3L74G 3OA8B 1DVVA 1M8OB 3W67A 4HH2A 1K8AQ 1KYOH 4WY4A 3SWSA 3CCJP 3H1LD 3WUIA 4I6MC 1DT1A 2YKPA 2LKMA 3RK3D 3GF7A 2KLUA 4JPZB 4OVNF 5CCHC 3DP5A 1JO5A 2XNDH 2Y0EA 3B5ND 4EIJA 5GTIV 2E76D 4U3FJ 1CCHA 2AIUA 3JBTB 1S9KE 3HUSB 2C1DA 1S5LV 1FOCA 3RK2C 5H2FV 1M7LA 3AE4C 2WTYA 1QL3A 1E29A 1S1CX 2R3CA 1GZLA 1ZXGA 2H8PD 5TISV 1EXIA 4EYYQ 5C9MA 4KMGA 1IFMA 5AW6B 3VMXA 3Q3DA 5H2FE 3HD7A 2XU6A 2J58A 5CJ4A 1DEBA 3PXTA 1ZMEC 2P1JA 3JSVC 2RN0A 4NFGB 5TISE 1JNMA 1RHZB 4N78E 2JQRA 1FZGA 3O6QB 4OGQD 2IFMA 1MV8A 1L0ND 3CXHW 2IZ1A 4LC1A 1YEBA 2A45I 2FYUJ 5APXA 4TT3H 1NTZE 2L91A 1KILA 1PGPA 1I6EA 2C9XB 1URQB 1SP4A 3MK7B 2KB7P 1LS9A 4FA9A 5KLVK 5B66V 1OWAA 1OFCX 2LXBA 5APTA 4Q5PA 2JWDA 2ZONG 2B87B 3L4FA 4O1WA 3L70J 1YJWP 1J1DC 1SFCB 1H32A 3PHLA 2P2UA 4I7ZB 1AOFA 2H43A 2WITA 1YTCA 1CW5A 4L74A 4C46A 5B66E 3SWKA 1Y9BA 3WC8A 1NNOA 5KKZB 4N78D 2MHMA 2JWAA 1SQXG 4H13D 2JP3A 3OW2O 1T2KC 1CRCA 4ZNCA 2N9IA 1SLQA 3CCUP 5DJUB 2YCCA 1L2PA 3CC7P 3V2NA 1NU1D 3RL0B 1KYOW 2M5AB 1CSVA 2Y9YA 4U7JA 2OYHA 1IO3A 1NTZD 3BCCE 3N7NA 1NKZB 2LIRA 2W83C 1D7MA 1NTME 4D6TG 1W2LA 1HGZA 4U3FE 2KP8A 2A06E 1LT9C 1QLED 1GDTA 3LIEA 1LP1A 2ZXYA 2KSJA 5KJ7D 3VTPC 4EOTA 3AE9C 3CCLP 2HPCA 2YIUC 1CTYA 3A5TA 2H88C 1NGMB 1HGVA 1R8EA 1RQVA 1QX8A 1JTHA 1BSNA 1AVYA 1E8EA 4FA1A 1SQBE 3H1HJ 5M1BA 5CIFB 1Y47A 5KLVG 4R4MA 5KAFH 1FZFA 4BRYA 1SQQD 1ZP0C 2NRGA 1GL2B 2YO3A 3VP9A 3Q5PA 3ZOXA 1CZQA 4C7NB 2P67A 4KT0J 1ZR2A 2KZJA 2YO2A 1CRYA 1LWUC 1H8AA 4YPCA 3BCCD 1SQXD 3BVHA 1FDOA 3L72J 2OZ1B 1SQPE 3HQ7A 1HH7A 2A06D 3C8VA 2BASA 1NYHA 1U74B 4UB8H 4NPFX 1JM0A 1N7SA 3A3YB 3O0RC 1SQVJ 3P8MC 4UB6H 1BDCA 1EQ7A 2Y9ZA 1FE6A 1KIBA 1L9JC 1C6OA 2K3RA 5AW9B 1AQ5A 1KB9E 1SQBD 1HTLC 4L73A 3CCVP 2HODA 3PJSK 3TNUB 1NJIQ 1LTJB 1H0TB 3HD7C 3ORVA 1AYGA 1S3JA 1AVOA 1NTKJ 4AANA 1PGQA 1QL2A 1L4AB 5APWA 4L75A 4BXLA 1UIIA 3H1KG 2XKMA 2NPSC 2H89C 1CSBA 3IFMA 1QL4A 3LW5H 1K9MQ 1J3SA 5CCGD 3L75G 3V6IA 1KZUB 5AVSB 3MTUE 1BGYG 3CD6P 1Q90D 3CL3D 1M56D 1YI2P 3A7OA 3Q5SA 2WSEH 1F1FA 1C75A 1H1OA 3M0AA 3RL0g 1PP9G 1PIXA 1I8OA 1NKNA 3ZCFA 4AQRD 1SFCD 5BU5A 1MZ9A 2K1AA 1C6SA 1GK6A 3B5NA 3KYQA 2PACA 5CCHA 2NZ2A 3AEGC 1FZCC 3V5BA 1JCDA 2P10A 5GTIH 2SPZA 2IBZE 2E74C 5CMZA 5CIHB 1S5LH 4EIFA 3GHGA 1BCCJ 2O01J 4AYCA 3RL0D 2BCNB 5H2FH 2QE7H 1NH4A 3WUUA 3H1IG 3HE5B 3CX5H 2OYHC 1DIQC 4WQ7A 2Q6QA 3PRJA 3AE6C 3O8ZA 3SVWA 2KXPB 5TISH 5CICB 2ZJSE 1UIXA 3L75D 2HG5D 2KS1A 1YFCA 1C2NA 3WFDC 4PV1C 1SQVE 1ZR4A 1DW3A 3S1KA 3AEEC 1W5CE 3II6A 3L73E 2ZT9B 5C0ZA 3L36A 2E75C 4H0LC 3RN1A 1GMJA 1CHJA 2Q3IA 1S72P 1BE3E 3CCSP 1KORA 3NWVA 2POHA 1PP9D 3KDPB 4BWNA 5GTHV 2Y0DA 1HUCA 5KAFV 1G1IA 1FJPA 4JCGA 1IZNB 3F89A 1DX7A 3ZOYA 2UWJE 2P7JA 3KHUA 3H1JJ 3WUVA 1L0LJ 5AVXB 4WBAA 4ZMDA 3CWBJ 5GTHE 3L74J 2N9JA 5B66H 5CIGB 3CXHI 3M9BA 3VYMA 5KAFE 3D0WA 5CJ0A 1RF1A 1OVVA 3A0BV 1GU5A 3HTKA 3OCDB 1QGKB 4V2KA 1GJQA 4XYDB 4QAOA 1LTAC 1Y8AA 3H1LG 4DJGA 3WFEC 3L73D 1T3JA 2AEJA 2ZOOA 2QVAA 4Y5RA 4AX3A 2LITA 3O5CA 3W68A 3A0BE 1IO4A 4UB8E 5AW0B 1BE3D 2N1TB 2OQQA 4KJMA 2I8FA 3L4MA 3Q2YA 4B86A 1YBKA 2AEFA 3RMZA 1N8RQ 2PFXA 1DIPA 4O9BA 1EDKA 1USEA 2QJYB 3EQ2A 1CTZA 1F1CA 2W6AA 1N90A 2GC7D 1L4AD 1G1JA 2YK3A 2J59M 4IFMA 1FI7A 3AEBC 2FFDB 1KQGB 2V08A 1BCCE 1NU1K 1T8ZA 1OAEA 1CIGA 1N86A 1N15A 1NTZK 1KYOI 2C9NY 5AVQB 3FWLA 3HE4A 4Y99B 4XFJA 1KX7A 4JYBA 3OA8A 1GQ1A 2BCCD 5APUA 3L71D 4RESB 2FBWC 3EFGA 5E79V 1YNRA 2YQBA 2PAJA 3RK3C 1ZOYC 1A02F 4PD4E 2YIUB 1EDIA 1CRHA 1J1EB 1MKMA 3QH9A 3B5NC 3T97B 1EZVD 5AVYB 1LWUA 2E76C 4GODA 1I54A 1CORA 3HUSA 1I55A 3OAKA 2XZRA 5AW1B 3EWKA 3ZOOA 1CYJA 4WQCA 1SQQK 3A0HV 1NHLA 2ITAA 3H1JE 2E42A 1EDJA 1CCRA 1C6RA 2OYIA 1MG3D 1KB9H 1LMSA 1L0LE 1KTMA 3WMM0 2HFED 5AVTB 1RQUA 1EB7A 3L74E 2YNYA 4WY4B 1AJYA 3GHGC 4K3AA 1CIEA 1IFIA 1SQXK 1NAYA 5GTIE 3TGUE 1NTMK 3JC22 4MU8A 1VQMP 2OTLP 1M57D 3A0HE 3SWFA 4CPGA 2KLVA 1IK7A 4IFFA 2R32A 1AFOA 3X39A 1S5LE 1Q81Q 3A2AA 1JOCA 3D6YA 3GG2A 4W7YA 3AE3C 1IQCA 2Q9IA 2WPQA 3O6QA 3CLQA 1H31B 1E79H 3CX5E 4D6TJ 2C1DB 1NU1G 2DVHA 2KIKA 4PD4D 4OGQC 5CCGA 1B7VA 2Q3EA 2QJPC 1NTZG 4AAMA 1DD4A 2NPSA 1MFZA 4LGDE 1VQPP 1OCDA 3AECC 1SQBK 1NAFA 1NMIA 2V7QJ 2MKVA 3WFBC 4GOEA 1CRJA 1FHBA 4JBZA 1JUNA 1Q86Q 1FJ0A 1M90Q 2QJKB 3HD7B 1QVGO 1S9KD 3AE7C 2V07A 1KX2A 3AE8C 2JO1A 3G71P 5KLVJ 2CXBA 2PRRA 3SFDC 1M70A 1J2JB 3TGUD 3GF3A 4FA4A 1SQPK 1RF1C 2QM8A 1JY3O 1JMMA 1SQQG 1GW4A 4NPDA 1JY2O 2ZVNB 2RKLA 1FZCA 1KILB 4A7PA 1AKKA 3S9OA 1VL2A 2WVRA 3PH0A 3CX5D 4H13C 2O3JA 2WT7B 3V4WA 1W2EA 2ZZS1 3BCCG 1PV3A 2B4ZA 3P8CE 3PLNA 3FWNA 1NTMG 2M5AA 2I1KA 3CCQP 1X0TA 3IN6A 3M9HA 3P32A 1BDDA 2A06G 1P84E 4YXDC 3JCUE 1YTZI 2FXPA 3DR0A 3SSUA 1M1JA 2CA4B 1N7LA 3TYYA 5KJ7C 1AV1A 1T3UA 1R0QA 5DJQC 2FKWB 5AVUB 4EIDA 2IFNA 2ZYGA 3MHVA 1SQBG 2E74B 1E2RA 4WQAA 1VF5D 4IFDK 1X79B 3U1AA 3H1KJ 1LC1A 2WSSH 4OH8B 4Y28J 3WUTA 3NFQA 2WSFH 3M91A 1IFJA 1BGYJ 5GTHH 1VQ4P 2O01N 2W6JH 2JKVA 3TSIA 2QA4P 1LP1B 3N4XA 3F5HA 3CI9A 4ASVA 1VQ7P 4K35A 4N6JA 2B9BA 1SQPG 2HPCB 1HRCA 4H0LB 1HJ4A 1JTHB 2OZ1A 4H44B 1PP9J 1JY3N 2FYUE 2KNCA 1AOQA 1JY2N 5KTBA 1NTMD 3HUSC 4U3FD 3O20A 5APQA 4GT1A 1NO4A 2ZYAA 3A0BH 2KI7B 2M8RA 1X22A 4GYDA 1RZ5A 4BRYB 5KLVE 1CHHA 4GOFA 1CXAA 1ZW0A 2OYIC 1FAVA 4WY4D 5DJTB 3ZDMA 3L70E 1K73Q 2DGEA 2WZ7A 1HJBA 3H6PA 3EFFK 1RE4C 3VYIA 3CMEP 2WSCH 2K9YA 3AE1C 1LGHB 5B5EV 3H1IJ 1L4AA 1DEEG 1KILE 1JDLA 1KD1Q 1N7SB 1YICA 5CCGC 3VMAA 4WQEA 2C1VA 1GIWA 1S5LX 3CMAP 4I2LC 2WQYC 2FYUD 5B5EE 3B71A 1OVUA 2FYNB 2QM7A 3HRNA 2LR2A 1MZ4A 1SQPD 5AURA 1WMKA 2HODB 3WU2V 4KHXA 3MK7C 4N3YB 4PD4H 1M60A 3I56P 1URQD 3KPEA 3P7KA 3H32A 3PXWA 4RO0A 2BH4X 4M3LA 1PL5A 2M3EA 3CCEP 2CK3H 3OJAB 1VQKP 2ZXXA 1SFCC 2Q7CA 1N73A 3L70D 4I7ZC 3AEDC 1CI6A 3VN0A 1KQFB 3WU2E 5E79H 3KXDA 1U7MA 3H1KE 1IFDA 1GU2A 1KB9D 4L3GA 2B88A 3NBTA 1U75B 1VYDA 2ZYDA 1FJKA 5BVZA 2BLFB 1CYCA 2IBZG 2CA3B 5KLIC 1W5CT 3H1HE 2D2CB 1XTCC 1BGYE 2OYOA 2HR3A 3BRTB 4XA4A 2GM4A 5AVVB 3VMZA 3RK3B 2XTSB 2JR8A 3RL0C 3A0HH 3WFCC 3H1LJ 4HJGH 3M97X 3V2QA 2JJLA 3VMYA 2IDBA 2AXTV 3D70A 4ASWA 5AW2B 3RGUA 2Y0CA 4RSZA 2XV5A 3L73G 2N18C 3L72E 1HZVA 1M1JC 4EI2A 1QVFO 1PPJE 4K3IA 1H33B 1I5TA 4GKGA 2WPVB 1T6AA 2AXTE 1BE3G 3IF4A 1H89A 2KZIA 4IOIH 1GD2E 4EICA 3RK2B 1CSWA 3V2PA 5IY51 3GHGB 2P58A 4WB4A 2C0XA 5EFWB 2K9JA 3M0DA 4PJ0H 1NOHA 1XTGB 2W90A 3SXTA 1MG2D 2I8DA 4XE5B 4YXWH 1IK9A 3CPWO 3DMIA 2N3BA 1OXZA 3D6ZA 3HQ9A 5KAIV 3IAOA 1CO6A 2JEEA 2YMKA 3E7KA 3Q5RA 2KS1B 1JB0J 2WSEJ 4PWAA 1NTKE 5CBOA 3TDKA 1KC8Q 5K5GB 4OGQB 3C1LA 1CIHA 2IBZD 3HQ8A 1GL2D 3GLMA 4JYCA 1NMLA 1L0NJ 2R5BA 1LNQA 2CE0A 4WQ8A 4H44D 2HLOA 5KAIE 1GTWA 2BCCG 1CYIA 3L71G 1G2CA 5L8RJ 4GEDB 1R5SA 1YYCA 1OX3A 1PPJD 3PH2B 1OW7A 4LJIA 2PGDA 5APVA 2KSEA 1FDIA 1DW2A 2OARA 1SQVD 4I1LA 4FA5A 1P84H 2D0SA 1M6ZA 1EZVG 3KZIV 3S4RA 1ZV8A 2L4DA 3JCUH 2KYVA 4NPEA 2W27A 3Q1MA 1E5WA 4Z1MH 1I8PA 1KQLA 1DIIC 1J1DB 1LTJC 1WVEC 4PW9B 1FS0E 1RF1B 3G6EP 1DW0A 1IRWA 4FB1A 1RY3A 1RE3C 1VPCA 3HTKB 3KZIE 3CXHH 1BCCG 3E1IA 1L4AC 1YITP 1NTKD 5KJ7A 1CTJA 1N7SD 2KUBA 4N0KA 1EC5A 2WPRA 3RK3E 1DH3A 1RF0C 4H0JA 1NU1J 5APYA 3MIWA 1NTZJ 2BEZF 1USDA 1KFMA 1QKSA 3CX5W 3CU4A 2WWWA 1OVRA 4DZOA 1LT9B 3CCRP 1Q7YQ 1LC2A 2FYZA 3RBXA 1N73C 1LTSC 1U57A 5CHXA 3R2PA 5AVRB 4YTPC 1K3GA 4DT0A 3L37A 3AE5C 2QSIA 1ETPA 3FXDA 4GDOA 2D0WA 2D2CD 5E79E 1C52A 1FOSE 2JTIB 1SQQJ 3ITKA 3HQ6A 3TGUG 1COTA 1Q2NA 1L0NE 3V4QA 2LXCB 1BCCD 1YIQA 4JF7A 4AAOA 3CWBE 1YJ9P 1PFIA 2VHDA 3BCCJ 1SQXJ 1RAQA 1HJ5A 2CPBA 1LTBC 1OMIA 2IX7C 1HROA 1NTMJ 5CCHD 1LWUB 4DOJA 1NVOA 1VQLP 1RE4A 1EXJA 1H31A 2GUSA 3MZWB 4RKUJ 4TLFA 2B89A 2ZT9C 4FAVA 3I5CA 5B5EH 2N9YB 4IL6H 2OYIB 2AXCA 1H88A 1Z56A 5CBNA 1C7MA 2ZT9D 3RK2D 4PJ0V 2BPBB 1PGJA 1GDVA 2YKQA 3M0DC 1SQBJ 1FC2C 4HB1A 1BL9A 1Q82Q 1URQA 1S6VB 2E43A 3IR9A 5CIEB 4WWIA 3PP5A 4HKZH 5AW4B 4PJ0E 2IYOA 3TYIA 3H1JD 3WU2H 2C0WA 2B87A 2IBZI 3C2CA 3KQGA 1L0LD 1VQNP 3CWBD 1SFCA 3L74D 2I1JA 1NU1E 2NPSB 2FYUK 4O1QA 3NTNA 4R4LA 1LFMA 1SQPJ 1X9VA 1N2DC 1LTGC 2WT7A 2FRCA 3BRVB 2RMZA 2A45H 4DCKA 2PCBB 2QEXP 5DF5A 2N1TC 3MP7B 3I55P 2WMMA 1YCCA 2ORLA 3MUDA 2H7HA 4U3FG 1BSHA 1AA0A 2N1TD 1WRGA 2Q1KA 1I6DA 2E5TA 2GIWA 1H32B 2JDIH 2YXQB 2AXTH 2QJYC 2OGUA 5KLIB 2O1JA 1FZCB 3CYTI 3TK1A 1SQQE 1QL1A 3ABVC 2C8SA 2FFDC 4EIEA 1VF5C 3M06A 2R44A 1QEXA 1FOSF 4WQ9A 1ZZHA 3SJLA 1CXCA 1H9YA 3TF5A 1T2KD 3CXHE 1CSUA 3GMAA 1LT1A 2RH0A 1HH0A 4Y99C 1SQXE 2GUVA 2G8YA 3SFEC 1KQSO 3GW6A 4AALA 2K88A 2OYHB 3MD0A 2N18B 3L75J 1M1JB 4L3HA 2GB8B 4FANA 1CNOA 1IRVA 1GL2A 1SVFA 5KAIH 1QYZA 3PXSA 4PV1B 2FYUG 1JEKA 1FZBA 1J1EC 4C7NA 4D6TE 2W6BA 3FXEA 1N50A 3P8CD 2L5GB 5AW7B 2M0BA 1LJ2A 3CCMP 2E75B 1K3HA 3K5BA 2Z4EA 1VQ9P 1P84D 3B4SA 5TJHA
chains in the Genus database with same CATH topology
4NFGB 2JQRA 3RMZA 2XTSB 4P4QB 1A56A 1QN2A 3WFCC 1L0ND 1N9CA 3CXHW 3M97X 1KV9A 3NBSA 3ZIYA 2AXTV 2QJYB 1CTZA 1YEBA 1F1CA 1N90A 2GC7D 2YK3A 2Y0CA 4RSZA 1FI7A 2L91A 3CXHD 2N18C 1I6EA 2B0ZB 2V08A 5DFSA 1HZVA 2C9XB 1OAEA 1CIGA 4K3IA 1H33B 1I5TA 3MK7B 1N15A 1LS9A 4FA9A 5B66V 3FWLA 4Q5PA 2ZONG 2KNCB 1KX7A 4EICA 2FWLA 1CIFA 4O1WA 3OA8A 1CSWA 1GQ1A 2BCCD 5IY51 1H32A 3L71D 1H9XA 3PHLA 1AOFA 4IL6V 1YTCA 4D6TD 3RLMA 3SXTA 1MG2D 5E79V 1YNRA 4YE1A 2YQBA 1NIRA 2YIUB 3DMIA 2N3BA 3HQ9A 5KAIV 1CRHA 1CO6A 3WC8A 1NNOA 5KKZB 2HV4A 1EZVD 1RAPA 2MHMA 2JWAA 4PWAA 3TDKA 2GC4D 1I54A 1CORA 1CIHA 2IBZD 4WQBA 1CRCA 3HQ8A 2N9IA 1I55A 1NMLA 2MTAC 2YCCA 2N3YA 2CE0A 4WQ8A 3ZOOA 1NU1D 1CYJA 4WQCA 3A0HV 1KYOW 1CSVA 1IO3A 1CYIA 1NTZD 4H0KA 1CCRA 5KLVD 1C6RA 4GEDB 1MG3D 2LIRA 1LMSA 1W2LA 1PPJD 3PH2B 4LJIA 1EB7A 2AI5A 1KYOD 1CIEA 1CRIA 1DW2A 1SQVD 2ZXYA 4MU8A 2B11B 4FA5A 2D0SA 1M6ZA 1CTYA 3KZIV 3X39A 2L4DA 3GG2A 1IQCA 1I8PA 3VNWA 1DIIC 1H31B 2QG4A 1WVEC 4PW9B 2BGVX 2C1DB 2DVHA 1E8EA 4PD4D 1HJ3A 4FA1A 1DW0A 1A8CA 1IRWA 1CC5A 1B7VA 3A9FA 4FB1A 2Q3EA 1A2SA 5CIFB 4AAMA 3SLEA 4WQDA 2C2CA 1OCDA 1NMIA 1NTKD 1CTJA 1SQQD 1CHIA 3WFBC 1CRJA 1H33A 1FHBA 1C2RA 3ZOXA 4N0KA 1FJ0A 2QJKB 4H0JA 1CEDA 1CRYA 5CIDB 2V07A 1KX2A 3BCCD 2B10B 1SQXD 2CXBA 1HZUA 2OZ1B 5CYTR 4EDFA 3HQ7A 1HH7A 1M70A 1IZL0 2A06D 1U74B 3TGUD 1QKSA 3CX5W 3CU4A 3H1KD 3O0RC 4FA4A 1LC2A 1CRGA 3L4OA 1WEJF 1HCMA 1KIBA 1FCDC 1L9JC 1C6OA 4A7PA 3H1HD 1AKKA 1BGYD 3CX5D 2O3JA 1SQBD 1RZ6A 1K3GA 2ZZS1 5B6QA 1DVHA 3PLNA 1ETPA 2D0WA 2QJPB 3ORVA 1AYGA 1C52A 2JTIB 2C1UA 4AANA 2PCCB 2K9JB 3ITKA 3HQ6A 3OCDA 1COTA 3ZOWA 3DR0A 1QL4A 3L72D 2CA4B 1J3SA 1BCCD 1L9BC 1YIQA 4AAOA 2VHDA 1RAQA 1R0QA 1HJ5A 5DJQC 1HROA 4EIDA 1E2RA 4WQAA 1H31A 1F1FA 1C75A 1FI9A 4FAVA 1H1OA 1LC1A 4UB8V 3VRDA 2N9YB 1KB0A 3PTZA 4RJTA 1I8OA 1C7MA 4PJ0V 3ZCFA 1FI3A 2B12B 2BPBB 4UB6V 3H1ID 1GDVA 1C6SA 2PACA 1BL9A 1ZRTD 1S6VB 3CP5A 5CIEB 1HRCA 1HJ4A 2OZ1A 3RN0A 3TYIA 3H1JD 1YEAA 1AOQA 3C2CA 2EXVA 4DY9A 1L0LD 1NTMD 4U3FD 3CWBD 3O20A 5CIHB 3L74D 4EIFA 2BCNB 4O1QA 3O1YA 2BH5X 4GYDA 1RZ5A 1LFMA 1DIQC 1CHHA 4WQ7A 3PRJA 1CXAA 4L1QA 4XXLA 3SVWA 5DJQB 5CICB 1CSXA 3L75D 3ZBMA 451CA 2KS1A 2FRCA 1YFCA 1C2NA 1GKSA 3WFDC 2DGEA 1DW3A 155CA 2RMZA 351CA 2PCBB 5CIBB 5DF5A 5C0ZA 2ZBOA 1YCCA 5EXQA 2CE1A 2ORLA 5B5EV 1DW1A 3RN1A 1CHJA 1JDLA 4J20A 3OA8B 1I6DA 3NWVA 2GIWA 1DVVA 1H32B 1PP9D 5GTHV 2Y0DA 1YICA 3VMAA 4WQEA 2C1VA 3SWSA 1GIWA 5KAFV 3H1LD 3WUIA 1DT1A 5KLIB 4JCGA 3CYTI 3ZOYA 3DP5A 2FYUD 3KHUA 2C8SA 2FYNB 4EIEA 2Y0EA 5GTIV 1MZ4A 1SQPD 5AURA 4WQ9A 3WU2V 1ZZHA 3MK7C 3SJLA 1CXCA 2N9JA 1H9YA 3TF5A 1CCHA 5CIGB 2AIUA 3JBTB 1CSUA 3VYMA 1M60A 3PXWA 2C1DA 2BH4X 1S5LV 1FOCA 3A0BV 5H2FV 3OCDB 4V2KA 1QL3A 3GW6A 4AALA 1E29A 2N18B 3L70D 1GJQA 4XYDB 4QAOA 4L3HA 2GB8B 4FANA 1CNOA 5TISV 1IRVA 1GU2A 1KB9D 3WFEC 3L73D 4L3GA 2ZOOA 5C9MA 1QYZA 4KMGA 3PXSA 4Y5RA 3NBTA 1U75B 1VYDA 4AX3A 2LITA 2BLFB 1CYCA 3O5CA 1N50A 2CA3B 1W5CT 1BE3D 3PXTA 2I8FA 1K3HA 3L4MA 1P84D 2RN0A 2B4ZA 5TJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFG B;  2JQR A;  3RMZ A;  2XTS B;  4P4Q B;  1A56 A;  1QN2 A;  3WFC C;  1L0N D;  1N9C A;  3CXH W;  3M97 X;  1KV9 A;  3NBS A;  3ZIY A;  2AXT V;  2QJY B;  1CTZ A;  1YEB A;  1F1C A;  1N90 A;  2GC7 D;  2YK3 A;  2Y0C A;  4RSZ A;  1FI7 A;  2L91 A;  3CXH D;  2N18 C;  1I6E A;  2B0Z B;  2V08 A;  5DFS A;  1HZV A;  2C9X B;  1OAE A;  1CIG A;  4K3I A;  1H33 B;  1I5T A;  3MK7 B;  1N15 A;  1LS9 A;  4FA9 A;  5B66 V;  3FWL A;  4Q5P A;  2ZON G;  2KNC B;  1KX7 A;  4EIC A;  2FWL A;  1CIF A;  4O1W A;  3OA8 A;  1CSW A;  1GQ1 A;  2BCC D;  5IY5 1;  1H32 A;  3L71 D;  1H9X A;  3PHL A;  1AOF A;  4IL6 V;  1YTC A;  4D6T D;  3RLM A;  3SXT A;  1MG2 D;  5E79 V;  1YNR A;  4YE1 A;  2YQB A;  1NIR A;  2YIU B;  3DMI A;  2N3B A;  3HQ9 A;  5KAI V;  1CRH A;  1CO6 A;  3WC8 A;  1NNO A;  5KKZ B;  2HV4 A;  1EZV D;  1RAP A;  2MHM A;  2JWA A;  4PWA A;  3TDK A;  2GC4 D;  1I54 A;  1COR A;  1CIH A;  2IBZ D;  4WQB A;  1CRC A;  3HQ8 A;  2N9I A;  1I55 A;  1NML A;  2MTA C;  2YCC A;  2N3Y A;  2CE0 A;  4WQ8 A;  3ZOO A;  1NU1 D;  1CYJ A;  4WQC A;  3A0H V;  1KYO W;  1CSV A;  1IO3 A;  1CYI A;  1NTZ D;  4H0K A;  1CCR A;  5KLV D;  1C6R A;  4GED B;  1MG3 D;  2LIR A;  1LMS A;  1W2L A;  1PPJ D;  3PH2 B;  4LJI A;  1EB7 A;  2AI5 A;  1KYO D;  1CIE A;  1CRI A;  1DW2 A;  1SQV D;  2ZXY A;  4MU8 A;  2B11 B;  4FA5 A;  2D0S A;  1M6Z A;  1CTY A;  3KZI V;  3X39 A;  2L4D A;  3GG2 A;  1IQC A;  1I8P A;  3VNW A;  1DII C;  1H31 B;  2QG4 A;  1WVE C;  4PW9 B;  2BGV X;  2C1D B;  2DVH A;  1E8E A;  4PD4 D;  1HJ3 A;  4FA1 A;  1DW0 A;  1A8C A;  1IRW A;  1CC5 A;  1B7V A;  3A9F A;  4FB1 A;  2Q3E A;  1A2S A;  5CIF B;  4AAM A;  3SLE A;  4WQD A;  2C2C A;  1OCD A;  1NMI A;  1NTK D;  1CTJ A;  1SQQ D;  1CHI A;  3WFB C;  1CRJ A;  1H33 A;  1FHB A;  1C2R A;  3ZOX A;  4N0K A;  1FJ0 A;  2QJK B;  4H0J A;  1CED A;  1CRY A;  5CID B;  2V07 A;  1KX2 A;  3BCC D;  2B10 B;  1SQX D;  2CXB A;  1HZU A;  2OZ1 B;  5CYT R;  4EDF A;  3HQ7 A;  1HH7 A;  1M70 A;  1IZL 0;  2A06 D;  1U74 B;  3TGU D;  1QKS A;  3CX5 W;  3CU4 A;  3H1K D;  3O0R C;  4FA4 A;  1LC2 A;  1CRG A;  3L4O A;  1WEJ F;  1HCM A;  1KIB A;  1FCD C;  1L9J C;  1C6O A;  4A7P A;  3H1H D;  1AKK A;  1BGY D;  3CX5 D;  2O3J A;  1SQB D;  1RZ6 A;  1K3G A;  2ZZS 1;  5B6Q A;  1DVH A;  3PLN A;  1ETP A;  2D0W A;  2QJP B;  3ORV A;  1AYG A;  1C52 A;  2JTI B;  2C1U A;  4AAN A;  2PCC B;  2K9J B;  3ITK A;  3HQ6 A;  3OCD A;  1COT A;  3ZOW A;  3DR0 A;  1QL4 A;  3L72 D;  2CA4 B;  1J3S A;  1BCC D;  1L9B C;  1YIQ A;  4AAO A;  2VHD A;  1RAQ A;  1R0Q A;  1HJ5 A;  5DJQ C;  1HRO A;  4EID A;  1E2R A;  4WQA A;  1H31 A;  1F1F A;  1C75 A;  1FI9 A;  4FAV A;  1H1O A;  1LC1 A;  4UB8 V;  3VRD A;  2N9Y B;  1KB0 A;  3PTZ A;  4RJT A;  1I8O A;  1C7M A;  4PJ0 V;  3ZCF A;  1FI3 A;  2B12 B;  2BPB B;  4UB6 V;  3H1I D;  1GDV A;  1C6S A;  2PAC A;  1BL9 A;  1ZRT D;  1S6V B;  3CP5 A;  5CIE B;  1HRC A;  1HJ4 A;  2OZ1 A;  3RN0 A;  3TYI A;  3H1J D;  1YEA A;  1AOQ A;  3C2C A;  2EXV A;  4DY9 A;  1L0L D;  1NTM D;  4U3F D;  3CWB D;  3O20 A;  5CIH B;  3L74 D;  4EIF A;  2BCN B;  4O1Q A;  3O1Y A;  2BH5 X;  4GYD A;  1RZ5 A;  1LFM A;  1DIQ C;  1CHH A;  4WQ7 A;  3PRJ A;  1CXA A;  4L1Q A;  4XXL A;  3SVW A;  5DJQ B;  5CIC B;  1CSX A;  3L75 D;  3ZBM A;  451C A;  2KS1 A;  2FRC A;  1YFC A;  1C2N A;  1GKS A;  3WFD C;  2DGE A;  1DW3 A;  155C A;  2RMZ A;  351C A;  2PCB B;  5CIB B;  5DF5 A;  5C0Z A;  2ZBO A;  1YCC A;  5EXQ A;  2CE1 A;  2ORL A;  5B5E V;  1DW1 A;  3RN1 A;  1CHJ A;  1JDL A;  4J20 A;  3OA8 B;  1I6D A;  3NWV A;  2GIW A;  1DVV A;  1H32 B;  1PP9 D;  5GTH V;  2Y0D A;  1YIC A;  3VMA A;  4WQE A;  2C1V A;  3SWS A;  1GIW A;  5KAF V;  3H1L D;  3WUI A;  1DT1 A;  5KLI B;  4JCG A;  3CYT I;  3ZOY A;  3DP5 A;  2FYU D;  3KHU A;  2C8S A;  2FYN B;  4EIE A;  2Y0E A;  5GTI V;  1MZ4 A;  1SQP D;  5AUR A;  4WQ9 A;  3WU2 V;  1ZZH A;  3MK7 C;  3SJL A;  1CXC A;  2N9J A;  1H9Y A;  3TF5 A;  1CCH A;  5CIG B;  2AIU A;  3JBT B;  1CSU A;  3VYM A;  1M60 A;  3PXW A;  2C1D A;  2BH4 X;  1S5L V;  1FOC A;  3A0B V;  5H2F V;  3OCD B;  4V2K A;  1QL3 A;  3GW6 A;  4AAL A;  1E29 A;  2N18 B;  3L70 D;  1GJQ A;  4XYD B;  4QAO A;  4L3H A;  2GB8 B;  4FAN A;  1CNO A;  5TIS V;  1IRV A;  1GU2 A;  1KB9 D;  3WFE C;  3L73 D;  4L3G A;  2ZOO A;  5C9M A;  1QYZ A;  4KMG A;  3PXS A;  4Y5R A;  3NBT A;  1U75 B;  1VYD A;  4AX3 A;  2LIT A;  2BLF B;  1CYC A;  3O5C A;  1N50 A;  2CA3 B;  1W5C T;  1BE3 D;  3PXT A;  2I8F A;  1K3H A;  3L4M A;  1P84 D;  2RN0 A;  2B4Z A;  5TJH A; 
#chains in the Genus database with same CATH topology
 1EZV I;  4P4Q B;  1A56 A;  1QN2 A;  1LTI C;  1N9C A;  2W8Z A;  1KV9 A;  3NBS A;  3ZIY A;  2OTJ P;  3V2R A;  4OWF A;  3R4Y A;  5APS A;  4WVZ A;  1PGO A;  3L70 G;  4LLH A;  4WY4 C;  2XDJ A;  2G3A A;  3CC4 P;  1ZLL A;  3U59 A;  3CXH D;  2B0Z B;  5DFS A;  1MFT A;  2ZXE B;  2QRX A;  2IYP A;  1YQ3 C;  1VDF A;  3KZI H;  1KYO E;  3NMD A;  3TNU A;  1LTJ A;  1H0T A;  1NWQ A;  5AW8 B;  2KNC B;  2CPS A;  1RE3 A;  2FWL A;  1CIF A;  1A02 J;  2ZVO B;  1H9X A;  1SQV K;  3G9R A;  4IL6 V;  3L73 J;  4D6T D;  3RLM A;  2O01 H;  4YE1 A;  1NIR A;  4PD4 I;  1VQ5 P;  4HYT B;  3G3Z A;  1HWT C;  1BE3 J;  1RF0 A;  2O1K A;  2HV4 A;  1RAP A;  1VQ8 P;  2GC4 D;  2YMY A;  4IL6 E;  2QJK C;  4WQB A;  1S2E A;  1IFP A;  2QIW A;  2IPP A;  1URQ C;  2MTA C;  2R5D A;  5BU8 B;  1K04 A;  2N3Y A;  1NTK K;  2BEQ D;  3HD7 D;  3H25 A;  5AW5 B;  2WSF J;  4H0K A;  1IFN A;  5KLV D;  5AVZ B;  2FY8 A;  1OW8 A;  1GK4 A;  3AEF C;  2Q5U A;  3QWO C;  1KN7 A;  2NPS D;  2AI5 A;  2HYN A;  3H1H G;  1KYO D;  1CRI A;  2B11 B;  2KOG A;  1KIL C;  2C9L Y;  1LTT C;  2AEM A;  3L75 E;  2BCC J;  3L71 J;  5KKZ C;  1KIL D;  3VNW A;  4W80 A;  2A45 G;  2QG4 A;  3H32 B;  3CX5 I;  2BGV X;  1HJ3 A;  3MGN A;  1VQ6 P;  1A8C A;  1CC5 A;  3A9F A;  1FU1 A;  1A2S A;  3SLE A;  1N73 B;  4WQD A;  2C2C A;  3L72 G;  3M9Q A;  1ZN5 A;  1VQO P;  1CI6 B;  1PPJ G;  3MUD C;  1YJN P;  3HE5 A;  1YIJ P;  1TU3 F;  3UIA A;  1PP9 E;  1CHI A;  3B5N B;  1FZE A;  1H33 A;  1SQV G;  1C2R A;  2E76 B;  3OA7 A;  4W7Z A;  1OW6 A;  3VP8 A;  2Z5H A;  1GW3 A;  1CED A;  3B8E B;  5CID B;  4GIF A;  2VRS A;  2WSC J;  2B10 B;  1U7J A;  4QMA A;  1HZU A;  1X8Y A;  5CYT R;  4EDF A;  1YTZ T;  1K05 A;  1IZL 0;  3E1R A;  2E74 D;  2ZAE B;  2OTK E;  1MUU A;  3H1K D;  3RBZ A;  1YQ4 C;  1RH5 B;  1S4X A;  1NTK G;  3LW5 J;  1CRG A;  3L4O A;  1WEJ F;  1HCM A;  1FCD C;  4ZKP A;  5C39 A;  3H1H D;  1JMB A;  1BGY D;  3H1I E;  1RZ6 A;  1GL2 C;  4PV1 D;  1FDM A;  5B6Q A;  1DVH A;  1AQT A;  1ZRT E;  2E5Y A;  4H44 C;  3VOP A;  2QJP B;  1HJ0 A;  2M3B A;  2V4H A;  2E75 D;  2C1U A;  2FXO A;  4H0L D;  2PCC B;  2K9J B;  1P84 I;  3FGA D;  1FZA A;  1DD3 A;  3USS A;  1HF9 A;  3OCD A;  4JQ0 D;  4ZKU A;  3ZOW A;  1YHQ P;  3L35 A;  3L72 D;  2PP6 A;  1W2B O;  1PZQ A;  1L9B C;  2ZFC A;  1M1K Q;  1SS1 A;  1OIP A;  2MJZ A;  1L0N K;  1JCC A;  1L0L K;  3C9I A;  2DW3 A;  1JY3 P;  3D71 A;  2YKO A;  2N1T A;  1GU4 A;  3FX0 A;  1JY2 P;  1FI9 A;  3TGU J;  1HVV A;  2YXR B;  4AUW A;  4UB8 V;  3VRD A;  3BAT A;  1KB0 A;  3PTZ A;  1G2C B;  4RJT A;  5AVW B;  1FI3 A;  2B12 B;  1N7S C;  4UB6 V;  3H1I D;  2BCC E;  3L71 E;  3SWY A;  1WT6 A;  4H13 B;  2R3S A;  3NXS A;  1ZRT D;  2FFD A;  2FXM A;  3CP5 A;  3AEA C;  3G4S P;  1IC2 A;  3H1L E;  2FYN C;  2Z5I A;  2XNX A;  4L76 A;  1EZV E;  3RN0 A;  4UB6 E;  1KMI Z;  1YEA A;  2GA1 A;  1HBW A;  2EXV A;  4DY9 A;  5AW3 B;  1LT9 A;  2IZ0 A;  1IJD B;  4C7R A;  3O1Y A;  2BH5 X;  2J5U A;  2K37 A;  4IL6 X;  4L1Q A;  1VF5 B;  4XXL A;  2KK7 A;  1EDL A;  5DJQ B;  2V7Q H;  1CSX A;  3ZBM A;  451C A;  1OZH A;  3T97 A;  1GKS A;  1KV4 A;  4MN4 C;  155C A;  1FBM A;  2WPS A;  3U1C A;  1KFN A;  2N9B A;  351C A;  1R5L A;  1KB9 I;  5CIB B;  3BAS A;  2D2C C;  3H1J G;  2ZBO A;  5EXQ A;  3CC2 P;  2CE1 A;  3LID A;  1L0N G;  1DW1 A;  3HE4 B;  1L0L G;  3CWB G;  4J20 A;  3AE2 C;  3L74 G;  3OA8 B;  1DVV A;  1M8O B;  3W67 A;  4HH2 A;  1K8A Q;  1KYO H;  4WY4 A;  3SWS A;  3CCJ P;  3H1L D;  3WUI A;  4I6M C;  1DT1 A;  2YKP A;  2LKM A;  3RK3 D;  3GF7 A;  2KLU A;  4JPZ B;  4OVN F;  5CCH C;  3DP5 A;  1JO5 A;  2XND H;  2Y0E A;  3B5N D;  4EIJ A;  5GTI V;  2E76 D;  4U3F J;  1CCH A;  2AIU A;  3JBT B;  1S9K E;  3HUS B;  2C1D A;  1S5L V;  1FOC A;  3RK2 C;  5H2F V;  1M7L A;  3AE4 C;  2WTY A;  1QL3 A;  1E29 A;  1S1C X;  2R3C A;  1GZL A;  1ZXG A;  2H8P D;  5TIS V;  1EXI A;  4EYY Q;  5C9M A;  4KMG A;  1IFM A;  5AW6 B;  3VMX A;  3Q3D A;  5H2F E;  3HD7 A;  2XU6 A;  2J58 A;  5CJ4 A;  1DEB A;  3PXT A;  1ZME C;  2P1J A;  3JSV C;  2RN0 A;  4NFG B;  5TIS E;  1JNM A;  1RHZ B;  4N78 E;  2JQR A;  1FZG A;  3O6Q B;  4OGQ D;  2IFM A;  1MV8 A;  1L0N D;  3CXH W;  2IZ1 A;  4LC1 A;  1YEB A;  2A45 I;  2FYU J;  5APX A;  4TT3 H;  1NTZ E;  2L91 A;  1KIL A;  1PGP A;  1I6E A;  2C9X B;  1URQ B;  1SP4 A;  3MK7 B;  2KB7 P;  1LS9 A;  4FA9 A;  5KLV K;  5B66 V;  1OWA A;  1OFC X;  2LXB A;  5APT A;  4Q5P A;  2JWD A;  2ZON G;  2B87 B;  3L4F A;  4O1W A;  3L70 J;  1YJW P;  1J1D C;  1SFC B;  1H32 A;  3PHL A;  2P2U A;  4I7Z B;  1AOF A;  2H43 A;  2WIT A;  1YTC A;  1CW5 A;  4L74 A;  4C46 A;  5B66 E;  3SWK A;  1Y9B A;  3WC8 A;  1NNO A;  5KKZ B;  4N78 D;  2MHM A;  2JWA A;  1SQX G;  4H13 D;  2JP3 A;  3OW2 O;  1T2K C;  1CRC A;  4ZNC A;  2N9I A;  1SLQ A;  3CCU P;  5DJU B;  2YCC A;  1L2P A;  3CC7 P;  3V2N A;  1NU1 D;  3RL0 B;  1KYO W;  2M5A B;  1CSV A;  2Y9Y A;  4U7J A;  2OYH A;  1IO3 A;  1NTZ D;  3BCC E;  3N7N A;  1NKZ B;  2LIR A;  2W83 C;  1D7M A;  1NTM E;  4D6T G;  1W2L A;  1HGZ A;  4U3F E;  2KP8 A;  2A06 E;  1LT9 C;  1QLE D;  1GDT A;  3LIE A;  1LP1 A;  2ZXY A;  2KSJ A;  5KJ7 D;  3VTP C;  4EOT A;  3AE9 C;  3CCL P;  2HPC A;  2YIU C;  1CTY A;  3A5T A;  2H88 C;  1NGM B;  1HGV A;  1R8E A;  1RQV A;  1QX8 A;  1JTH A;  1BSN A;  1AVY A;  1E8E A;  4FA1 A;  1SQB E;  3H1H J;  5M1B A;  5CIF B;  1Y47 A;  5KLV G;  4R4M A;  5KAF H;  1FZF A;  4BRY A;  1SQQ D;  1ZP0 C;  2NRG A;  1GL2 B;  2YO3 A;  3VP9 A;  3Q5P A;  3ZOX A;  1CZQ A;  4C7N B;  2P67 A;  4KT0 J;  1ZR2 A;  2KZJ A;  2YO2 A;  1CRY A;  1LWU C;  1H8A A;  4YPC A;  3BCC D;  1SQX D;  3BVH A;  1FDO A;  3L72 J;  2OZ1 B;  1SQP E;  3HQ7 A;  1HH7 A;  2A06 D;  3C8V A;  2BAS A;  1NYH A;  1U74 B;  4UB8 H;  4NPF X;  1JM0 A;  1N7S A;  3A3Y B;  3O0R C;  1SQV J;  3P8M C;  4UB6 H;  1BDC A;  1EQ7 A;  2Y9Z A;  1FE6 A;  1KIB A;  1L9J C;  1C6O A;  2K3R A;  5AW9 B;  1AQ5 A;  1KB9 E;  1SQB D;  1HTL C;  4L73 A;  3CCV P;  2HOD A;  3PJS K;  3TNU B;  1NJI Q;  1LTJ B;  1H0T B;  3HD7 C;  3ORV A;  1AYG A;  1S3J A;  1AVO A;  1NTK J;  4AAN A;  1PGQ A;  1QL2 A;  1L4A B;  5APW A;  4L75 A;  4BXL A;  1UII A;  3H1K G;  2XKM A;  2NPS C;  2H89 C;  1CSB A;  3IFM A;  1QL4 A;  3LW5 H;  1K9M Q;  1J3S A;  5CCG D;  3L75 G;  3V6I A;  1KZU B;  5AVS B;  3MTU E;  1BGY G;  3CD6 P;  1Q90 D;  3CL3 D;  1M56 D;  1YI2 P;  3A7O A;  3Q5S A;  2WSE H;  1F1F A;  1C75 A;  1H1O A;  3M0A A;  3RL0 g;  1PP9 G;  1PIX A;  1I8O A;  1NKN A;  3ZCF A;  4AQR D;  1SFC D;  5BU5 A;  1MZ9 A;  2K1A A;  1C6S A;  1GK6 A;  3B5N A;  3KYQ A;  2PAC A;  5CCH A;  2NZ2 A;  3AEG C;  1FZC C;  3V5B A;  1JCD A;  2P10 A;  5GTI H;  2SPZ A;  2IBZ E;  2E74 C;  5CMZ A;  5CIH B;  1S5L H;  4EIF A;  3GHG A;  1BCC J;  2O01 J;  4AYC A;  3RL0 D;  2BCN B;  5H2F H;  2QE7 H;  1NH4 A;  3WUU A;  3H1I G;  3HE5 B;  3CX5 H;  2OYH C;  1DIQ C;  4WQ7 A;  2Q6Q A;  3PRJ A;  3AE6 C;  3O8Z A;  3SVW A;  2KXP B;  5TIS H;  5CIC B;  2ZJS E;  1UIX A;  3L75 D;  2HG5 D;  2KS1 A;  1YFC A;  1C2N A;  3WFD C;  4PV1 C;  1SQV E;  1ZR4 A;  1DW3 A;  3S1K A;  3AEE C;  1W5C E;  3II6 A;  3L73 E;  2ZT9 B;  5C0Z A;  3L36 A;  2E75 C;  4H0L C;  3RN1 A;  1GMJ A;  1CHJ A;  2Q3I A;  1S72 P;  1BE3 E;  3CCS P;  1KOR A;  3NWV A;  2POH A;  1PP9 D;  3KDP B;  4BWN A;  5GTH V;  2Y0D A;  1HUC A;  5KAF V;  1G1I A;  1FJP A;  4JCG A;  1IZN B;  3F89 A;  1DX7 A;  3ZOY A;  2UWJ E;  2P7J A;  3KHU A;  3H1J J;  3WUV A;  1L0L J;  5AVX B;  4WBA A;  4ZMD A;  3CWB J;  5GTH E;  3L74 J;  2N9J A;  5B66 H;  5CIG B;  3CXH I;  3M9B A;  3VYM A;  5KAF E;  3D0W A;  5CJ0 A;  1RF1 A;  1OVV A;  3A0B V;  1GU5 A;  3HTK A;  3OCD B;  1QGK B;  4V2K A;  1GJQ A;  4XYD B;  4QAO A;  1LTA C;  1Y8A A;  3H1L G;  4DJG A;  3WFE C;  3L73 D;  1T3J A;  2AEJ A;  2ZOO A;  2QVA A;  4Y5R A;  4AX3 A;  2LIT A;  3O5C A;  3W68 A;  3A0B E;  1IO4 A;  4UB8 E;  5AW0 B;  1BE3 D;  2N1T B;  2OQQ A;  4KJM A;  2I8F A;  3L4M A;  3Q2Y A;  4B86 A;  1YBK A;  2AEF A;  3RMZ A;  1N8R Q;  2PFX A;  1DIP A;  4O9B A;  1EDK A;  1USE A;  2QJY B;  3EQ2 A;  1CTZ A;  1F1C A;  2W6A A;  1N90 A;  2GC7 D;  1L4A D;  1G1J A;  2YK3 A;  2J59 M;  4IFM A;  1FI7 A;  3AEB C;  2FFD B;  1KQG B;  2V08 A;  1BCC E;  1NU1 K;  1T8Z A;  1OAE A;  1CIG A;  1N86 A;  1N15 A;  1NTZ K;  1KYO I;  2C9N Y;  5AVQ B;  3FWL A;  3HE4 A;  4Y99 B;  4XFJ A;  1KX7 A;  4JYB A;  3OA8 A;  1GQ1 A;  2BCC D;  5APU A;  3L71 D;  4RES B;  2FBW C;  3EFG A;  5E79 V;  1YNR A;  2YQB A;  2PAJ A;  3RK3 C;  1ZOY C;  1A02 F;  4PD4 E;  2YIU B;  1EDI A;  1CRH A;  1J1E B;  1MKM A;  3QH9 A;  3B5N C;  3T97 B;  1EZV D;  5AVY B;  1LWU A;  2E76 C;  4GOD A;  1I54 A;  1COR A;  3HUS A;  1I55 A;  3OAK A;  2XZR A;  5AW1 B;  3EWK A;  3ZOO A;  1CYJ A;  4WQC A;  1SQQ K;  3A0H V;  1NHL A;  2ITA A;  3H1J E;  2E42 A;  1EDJ A;  1CCR A;  1C6R A;  2OYI A;  1MG3 D;  1KB9 H;  1LMS A;  1L0L E;  1KTM A;  3WMM 0;  2HFE D;  5AVT B;  1RQU A;  1EB7 A;  3L74 E;  2YNY A;  4WY4 B;  1AJY A;  3GHG C;  4K3A A;  1CIE A;  1IFI A;  1SQX K;  1NAY A;  5GTI E;  3TGU E;  1NTM K;  3JC2 2;  4MU8 A;  1VQM P;  2OTL P;  1M57 D;  3A0H E;  3SWF A;  4CPG A;  2KLV A;  1IK7 A;  4IFF A;  2R32 A;  1AFO A;  3X39 A;  1S5L E;  1Q81 Q;  3A2A A;  1JOC A;  3D6Y A;  3GG2 A;  4W7Y A;  3AE3 C;  1IQC A;  2Q9I A;  2WPQ A;  3O6Q A;  3CLQ A;  1H31 B;  1E79 H;  3CX5 E;  4D6T J;  2C1D B;  1NU1 G;  2DVH A;  2KIK A;  4PD4 D;  4OGQ C;  5CCG A;  1B7V A;  2Q3E A;  2QJP C;  1NTZ G;  4AAM A;  1DD4 A;  2NPS A;  1MFZ A;  4LGD E;  1VQP P;  1OCD A;  3AEC C;  1SQB K;  1NAF A;  1NMI A;  2V7Q J;  2MKV A;  3WFB C;  4GOE A;  1CRJ A;  1FHB A;  4JBZ A;  1JUN A;  1Q86 Q;  1FJ0 A;  1M90 Q;  2QJK B;  3HD7 B;  1QVG O;  1S9K D;  3AE7 C;  2V07 A;  1KX2 A;  3AE8 C;  2JO1 A;  3G71 P;  5KLV J;  2CXB A;  2PRR A;  3SFD C;  1M70 A;  1J2J B;  3TGU D;  3GF3 A;  4FA4 A;  1SQP K;  1RF1 C;  2QM8 A;  1JY3 O;  1JMM A;  1SQQ G;  1GW4 A;  4NPD A;  1JY2 O;  2ZVN B;  2RKL A;  1FZC A;  1KIL B;  4A7P A;  1AKK A;  3S9O A;  1VL2 A;  2WVR A;  3PH0 A;  3CX5 D;  4H13 C;  2O3J A;  2WT7 B;  3V4W A;  1W2E A;  2ZZS 1;  3BCC G;  1PV3 A;  2B4Z A;  3P8C E;  3PLN A;  3FWN A;  1NTM G;  2M5A A;  2I1K A;  3CCQ P;  1X0T A;  3IN6 A;  3M9H A;  3P32 A;  1BDD A;  2A06 G;  1P84 E;  4YXD C;  3JCU E;  1YTZ I;  2FXP A;  3DR0 A;  3SSU A;  1M1J A;  2CA4 B;  1N7L A;  3TYY A;  5KJ7 C;  1AV1 A;  1T3U A;  1R0Q A;  5DJQ C;  2FKW B;  5AVU B;  4EID A;  2IFN A;  2ZYG A;  3MHV A;  1SQB G;  2E74 B;  1E2R A;  4WQA A;  1VF5 D;  4IFD K;  1X79 B;  3U1A A;  3H1K J;  1LC1 A;  2WSS H;  4OH8 B;  4Y28 J;  3WUT A;  3NFQ A;  2WSF H;  3M91 A;  1IFJ A;  1BGY J;  5GTH H;  1VQ4 P;  2O01 N;  2W6J H;  2JKV A;  3TSI A;  2QA4 P;  1LP1 B;  3N4X A;  3F5H A;  3CI9 A;  4ASV A;  1VQ7 P;  4K35 A;  4N6J A;  2B9B A;  1SQP G;  2HPC B;  1HRC A;  4H0L B;  1HJ4 A;  1JTH B;  2OZ1 A;  4H44 B;  1PP9 J;  1JY3 N;  2FYU E;  2KNC A;  1AOQ A;  1JY2 N;  5KTB A;  1NTM D;  3HUS C;  4U3F D;  3O20 A;  5APQ A;  4GT1 A;  1NO4 A;  2ZYA A;  3A0B H;  2KI7 B;  2M8R A;  1X22 A;  4GYD A;  1RZ5 A;  4BRY B;  5KLV E;  1CHH A;  4GOF A;  1CXA A;  1ZW0 A;  2OYI C;  1FAV A;  4WY4 D;  5DJT B;  3ZDM A;  3L70 E;  1K73 Q;  2DGE A;  2WZ7 A;  1HJB A;  3H6P A;  3EFF K;  1RE4 C;  3VYI A;  3CME P;  2WSC H;  2K9Y A;  3AE1 C;  1LGH B;  5B5E V;  3H1I J;  1L4A A;  1DEE G;  1KIL E;  1JDL A;  1KD1 Q;  1N7S B;  1YIC A;  5CCG C;  3VMA A;  4WQE A;  2C1V A;  1GIW A;  1S5L X;  3CMA P;  4I2L C;  2WQY C;  2FYU D;  5B5E E;  3B71 A;  1OVU A;  2FYN B;  2QM7 A;  3HRN A;  2LR2 A;  1MZ4 A;  1SQP D;  5AUR A;  1WMK A;  2HOD B;  3WU2 V;  4KHX A;  3MK7 C;  4N3Y B;  4PD4 H;  1M60 A;  3I56 P;  1URQ D;  3KPE A;  3P7K A;  3H32 A;  3PXW A;  4RO0 A;  2BH4 X;  4M3L A;  1PL5 A;  2M3E A;  3CCE P;  2CK3 H;  3OJA B;  1VQK P;  2ZXX A;  1SFC C;  2Q7C A;  1N73 A;  3L70 D;  4I7Z C;  3AED C;  1CI6 A;  3VN0 A;  1KQF B;  3WU2 E;  5E79 H;  3KXD A;  1U7M A;  3H1K E;  1IFD A;  1GU2 A;  1KB9 D;  4L3G A;  2B88 A;  3NBT A;  1U75 B;  1VYD A;  2ZYD A;  1FJK A;  5BVZ A;  2BLF B;  1CYC A;  2IBZ G;  2CA3 B;  5KLI C;  1W5C T;  3H1H E;  2D2C B;  1XTC C;  1BGY E;  2OYO A;  2HR3 A;  3BRT B;  4XA4 A;  2GM4 A;  5AVV B;  3VMZ A;  3RK3 B;  2XTS B;  2JR8 A;  3RL0 C;  3A0H H;  3WFC C;  3H1L J;  4HJG H;  3M97 X;  3V2Q A;  2JJL A;  3VMY A;  2IDB A;  2AXT V;  3D70 A;  4ASW A;  5AW2 B;  3RGU A;  2Y0C A;  4RSZ A;  2XV5 A;  3L73 G;  2N18 C;  3L72 E;  1HZV A;  1M1J C;  4EI2 A;  1QVF O;  1PPJ E;  4K3I A;  1H33 B;  1I5T A;  4GKG A;  2WPV B;  1T6A A;  2AXT E;  1BE3 G;  3IF4 A;  1H89 A;  2KZI A;  4IOI H;  1GD2 E;  4EIC A;  3RK2 B;  1CSW A;  3V2P A;  5IY5 1;  3GHG B;  2P58 A;  4WB4 A;  2C0X A;  5EFW B;  2K9J A;  3M0D A;  4PJ0 H;  1NOH A;  1XTG B;  2W90 A;  3SXT A;  1MG2 D;  2I8D A;  4XE5 B;  4YXW H;  1IK9 A;  3CPW O;  3DMI A;  2N3B A;  1OXZ A;  3D6Z A;  3HQ9 A;  5KAI V;  3IAO A;  1CO6 A;  2JEE A;  2YMK A;  3E7K A;  3Q5R A;  2KS1 B;  1JB0 J;  2WSE J;  4PWA A;  1NTK E;  5CBO A;  3TDK A;  1KC8 Q;  5K5G B;  4OGQ B;  3C1L A;  1CIH A;  2IBZ D;  3HQ8 A;  1GL2 D;  3GLM A;  4JYC A;  1NML A;  1L0N J;  2R5B A;  1LNQ A;  2CE0 A;  4WQ8 A;  4H44 D;  2HLO A;  5KAI E;  1GTW A;  2BCC G;  1CYI A;  3L71 G;  1G2C A;  5L8R J;  4GED B;  1R5S A;  1YYC A;  1OX3 A;  1PPJ D;  3PH2 B;  1OW7 A;  4LJI A;  2PGD A;  5APV A;  2KSE A;  1FDI A;  1DW2 A;  2OAR A;  1SQV D;  4I1L A;  4FA5 A;  1P84 H;  2D0S A;  1M6Z A;  1EZV G;  3KZI V;  3S4R A;  1ZV8 A;  2L4D A;  3JCU H;  2KYV A;  4NPE A;  2W27 A;  3Q1M A;  1E5W A;  4Z1M H;  1I8P A;  1KQL A;  1DII C;  1J1D B;  1LTJ C;  1WVE C;  4PW9 B;  1FS0 E;  1RF1 B;  3G6E P;  1DW0 A;  1IRW A;  4FB1 A;  1RY3 A;  1RE3 C;  1VPC A;  3HTK B;  3KZI E;  3CXH H;  1BCC G;  3E1I A;  1L4A C;  1YIT P;  1NTK D;  5KJ7 A;  1CTJ A;  1N7S D;  2KUB A;  4N0K A;  1EC5 A;  2WPR A;  3RK3 E;  1DH3 A;  1RF0 C;  4H0J A;  1NU1 J;  5APY A;  3MIW A;  1NTZ J;  2BEZ F;  1USD A;  1KFM A;  1QKS A;  3CX5 W;  3CU4 A;  2WWW A;  1OVR A;  4DZO A;  1LT9 B;  3CCR P;  1Q7Y Q;  1LC2 A;  2FYZ A;  3RBX A;  1N73 C;  1LTS C;  1U57 A;  5CHX A;  3R2P A;  5AVR B;  4YTP C;  1K3G A;  4DT0 A;  3L37 A;  3AE5 C;  2QSI A;  1ETP A;  3FXD A;  4GDO A;  2D0W A;  2D2C D;  5E79 E;  1C52 A;  1FOS E;  2JTI B;  1SQQ J;  3ITK A;  3HQ6 A;  3TGU G;  1COT A;  1Q2N A;  1L0N E;  3V4Q A;  2LXC B;  1BCC D;  1YIQ A;  4JF7 A;  4AAO A;  3CWB E;  1YJ9 P;  1PFI A;  2VHD A;  3BCC J;  1SQX J;  1RAQ A;  1HJ5 A;  2CPB A;  1LTB C;  1OMI A;  2IX7 C;  1HRO A;  1NTM J;  5CCH D;  1LWU B;  4DOJ A;  1NVO A;  1VQL P;  1RE4 A;  1EXJ A;  1H31 A;  2GUS A;  3MZW B;  4RKU J;  4TLF A;  2B89 A;  2ZT9 C;  4FAV A;  3I5C A;  5B5E H;  2N9Y B;  4IL6 H;  2OYI B;  2AXC A;  1H88 A;  1Z56 A;  5CBN A;  1C7M A;  2ZT9 D;  3RK2 D;  4PJ0 V;  2BPB B;  1PGJ A;  1GDV A;  2YKQ A;  3M0D C;  1SQB J;  1FC2 C;  4HB1 A;  1BL9 A;  1Q82 Q;  1URQ A;  1S6V B;  2E43 A;  3IR9 A;  5CIE B;  4WWI A;  3PP5 A;  4HKZ H;  5AW4 B;  4PJ0 E;  2IYO A;  3TYI A;  3H1J D;  3WU2 H;  2C0W A;  2B87 A;  2IBZ I;  3C2C A;  3KQG A;  1L0L D;  1VQN P;  3CWB D;  1SFC A;  3L74 D;  2I1J A;  1NU1 E;  2NPS B;  2FYU K;  4O1Q A;  3NTN A;  4R4L A;  1LFM A;  1SQP J;  1X9V A;  1N2D C;  1LTG C;  2WT7 A;  2FRC A;  3BRV B;  2RMZ A;  2A45 H;  4DCK A;  2PCB B;  2QEX P;  5DF5 A;  2N1T C;  3MP7 B;  3I55 P;  2WMM A;  1YCC A;  2ORL A;  3MUD A;  2H7H A;  4U3F G;  1BSH A;  1AA0 A;  2N1T D;  1WRG A;  2Q1K A;  1I6D A;  2E5T A;  2GIW A;  1H32 B;  2JDI H;  2YXQ B;  2AXT H;  2QJY C;  2OGU A;  5KLI B;  2O1J A;  1FZC B;  3CYT I;  3TK1 A;  1SQQ E;  1QL1 A;  3ABV C;  2C8S A;  2FFD C;  4EIE A;  1VF5 C;  3M06 A;  2R44 A;  1QEX A;  1FOS F;  4WQ9 A;  1ZZH A;  3SJL A;  1CXC A;  1H9Y A;  3TF5 A;  1T2K D;  3CXH E;  1CSU A;  3GMA A;  1LT1 A;  2RH0 A;  1HH0 A;  4Y99 C;  1SQX E;  2GUV A;  2G8Y A;  3SFE C;  1KQS O;  3GW6 A;  4AAL A;  2K88 A;  2OYH B;  3MD0 A;  2N18 B;  3L75 J;  1M1J B;  4L3H A;  2GB8 B;  4FAN A;  1CNO A;  1IRV A;  1GL2 A;  1SVF A;  5KAI H;  1QYZ A;  3PXS A;  4PV1 B;  2FYU G;  1JEK A;  1FZB A;  1J1E C;  4C7N A;  4D6T E;  2W6B A;  3FXE A;  1N50 A;  3P8C D;  2L5G B;  5AW7 B;  2M0B A;  1LJ2 A;  3CCM P;  2E75 B;  1K3H A;  3K5B A;  2Z4E A;  1VQ9 P;  1P84 D;  3B4S A;  5TJH A; 
#chains in the Genus database with same CATH homology
 4NFG B;  2JQR A;  3RMZ A;  2XTS B;  4P4Q B;  1A56 A;  1QN2 A;  3WFC C;  1L0N D;  1N9C A;  3CXH W;  3M97 X;  1KV9 A;  3NBS A;  3ZIY A;  2AXT V;  2QJY B;  1CTZ A;  1YEB A;  1F1C A;  1N90 A;  2GC7 D;  2YK3 A;  2Y0C A;  4RSZ A;  1FI7 A;  2L91 A;  3CXH D;  2N18 C;  1I6E A;  2B0Z B;  2V08 A;  5DFS A;  1HZV A;  2C9X B;  1OAE A;  1CIG A;  4K3I A;  1H33 B;  1I5T A;  3MK7 B;  1N15 A;  1LS9 A;  4FA9 A;  5B66 V;  3FWL A;  4Q5P A;  2ZON G;  2KNC B;  1KX7 A;  4EIC A;  2FWL A;  1CIF A;  4O1W A;  3OA8 A;  1CSW A;  1GQ1 A;  2BCC D;  5IY5 1;  1H32 A;  3L71 D;  1H9X A;  3PHL A;  1AOF A;  4IL6 V;  1YTC A;  4D6T D;  3RLM A;  3SXT A;  1MG2 D;  5E79 V;  1YNR A;  4YE1 A;  2YQB A;  1NIR A;  2YIU B;  3DMI A;  2N3B A;  3HQ9 A;  5KAI V;  1CRH A;  1CO6 A;  3WC8 A;  1NNO A;  5KKZ B;  2HV4 A;  1EZV D;  1RAP A;  2MHM A;  2JWA A;  4PWA A;  3TDK A;  2GC4 D;  1I54 A;  1COR A;  1CIH A;  2IBZ D;  4WQB A;  1CRC A;  3HQ8 A;  2N9I A;  1I55 A;  1NML A;  2MTA C;  2YCC A;  2N3Y A;  2CE0 A;  4WQ8 A;  3ZOO A;  1NU1 D;  1CYJ A;  4WQC A;  3A0H V;  1KYO W;  1CSV A;  1IO3 A;  1CYI A;  1NTZ D;  4H0K A;  1CCR A;  5KLV D;  1C6R A;  4GED B;  1MG3 D;  2LIR A;  1LMS A;  1W2L A;  1PPJ D;  3PH2 B;  4LJI A;  1EB7 A;  2AI5 A;  1KYO D;  1CIE A;  1CRI A;  1DW2 A;  1SQV D;  2ZXY A;  4MU8 A;  2B11 B;  4FA5 A;  2D0S A;  1M6Z A;  1CTY A;  3KZI V;  3X39 A;  2L4D A;  3GG2 A;  1IQC A;  1I8P A;  3VNW A;  1DII C;  1H31 B;  2QG4 A;  1WVE C;  4PW9 B;  2BGV X;  2C1D B;  2DVH A;  1E8E A;  4PD4 D;  1HJ3 A;  4FA1 A;  1DW0 A;  1A8C A;  1IRW A;  1CC5 A;  1B7V A;  3A9F A;  4FB1 A;  2Q3E A;  1A2S A;  5CIF B;  4AAM A;  3SLE A;  4WQD A;  2C2C A;  1OCD A;  1NMI A;  1NTK D;  1CTJ A;  1SQQ D;  1CHI A;  3WFB C;  1CRJ A;  1H33 A;  1FHB A;  1C2R A;  3ZOX A;  4N0K A;  1FJ0 A;  2QJK B;  4H0J A;  1CED A;  1CRY A;  5CID B;  2V07 A;  1KX2 A;  3BCC D;  2B10 B;  1SQX D;  2CXB A;  1HZU A;  2OZ1 B;  5CYT R;  4EDF A;  3HQ7 A;  1HH7 A;  1M70 A;  1IZL 0;  2A06 D;  1U74 B;  3TGU D;  1QKS A;  3CX5 W;  3CU4 A;  3H1K D;  3O0R C;  4FA4 A;  1LC2 A;  1CRG A;  3L4O A;  1WEJ F;  1HCM A;  1KIB A;  1FCD C;  1L9J C;  1C6O A;  4A7P A;  3H1H D;  1AKK A;  1BGY D;  3CX5 D;  2O3J A;  1SQB D;  1RZ6 A;  1K3G A;  2ZZS 1;  5B6Q A;  1DVH A;  3PLN A;  1ETP A;  2D0W A;  2QJP B;  3ORV A;  1AYG A;  1C52 A;  2JTI B;  2C1U A;  4AAN A;  2PCC B;  2K9J B;  3ITK A;  3HQ6 A;  3OCD A;  1COT A;  3ZOW A;  3DR0 A;  1QL4 A;  3L72 D;  2CA4 B;  1J3S A;  1BCC D;  1L9B C;  1YIQ A;  4AAO A;  2VHD A;  1RAQ A;  1R0Q A;  1HJ5 A;  5DJQ C;  1HRO A;  4EID A;  1E2R A;  4WQA A;  1H31 A;  1F1F A;  1C75 A;  1FI9 A;  4FAV A;  1H1O A;  1LC1 A;  4UB8 V;  3VRD A;  2N9Y B;  1KB0 A;  3PTZ A;  4RJT A;  1I8O A;  1C7M A;  4PJ0 V;  3ZCF A;  1FI3 A;  2B12 B;  2BPB B;  4UB6 V;  3H1I D;  1GDV A;  1C6S A;  2PAC A;  1BL9 A;  1ZRT D;  1S6V B;  3CP5 A;  5CIE B;  1HRC A;  1HJ4 A;  2OZ1 A;  3RN0 A;  3TYI A;  3H1J D;  1YEA A;  1AOQ A;  3C2C A;  2EXV A;  4DY9 A;  1L0L D;  1NTM D;  4U3F D;  3CWB D;  3O20 A;  5CIH B;  3L74 D;  4EIF A;  2BCN B;  4O1Q A;  3O1Y A;  2BH5 X;  4GYD A;  1RZ5 A;  1LFM A;  1DIQ C;  1CHH A;  4WQ7 A;  3PRJ A;  1CXA A;  4L1Q A;  4XXL A;  3SVW A;  5DJQ B;  5CIC B;  1CSX A;  3L75 D;  3ZBM A;  451C A;  2KS1 A;  2FRC A;  1YFC A;  1C2N A;  1GKS A;  3WFD C;  2DGE A;  1DW3 A;  155C A;  2RMZ A;  351C A;  2PCB B;  5CIB B;  5DF5 A;  5C0Z A;  2ZBO A;  1YCC A;  5EXQ A;  2CE1 A;  2ORL A;  5B5E V;  1DW1 A;  3RN1 A;  1CHJ A;  1JDL A;  4J20 A;  3OA8 B;  1I6D A;  3NWV A;  2GIW A;  1DVV A;  1H32 B;  1PP9 D;  5GTH V;  2Y0D A;  1YIC A;  3VMA A;  4WQE A;  2C1V A;  3SWS A;  1GIW A;  5KAF V;  3H1L D;  3WUI A;  1DT1 A;  5KLI B;  4JCG A;  3CYT I;  3ZOY A;  3DP5 A;  2FYU D;  3KHU A;  2C8S A;  2FYN B;  4EIE A;  2Y0E A;  5GTI V;  1MZ4 A;  1SQP D;  5AUR A;  4WQ9 A;  3WU2 V;  1ZZH A;  3MK7 C;  3SJL A;  1CXC A;  2N9J A;  1H9Y A;  3TF5 A;  1CCH A;  5CIG B;  2AIU A;  3JBT B;  1CSU A;  3VYM A;  1M60 A;  3PXW A;  2C1D A;  2BH4 X;  1S5L V;  1FOC A;  3A0B V;  5H2F V;  3OCD B;  4V2K A;  1QL3 A;  3GW6 A;  4AAL A;  1E29 A;  2N18 B;  3L70 D;  1GJQ A;  4XYD B;  4QAO A;  4L3H A;  2GB8 B;  4FAN A;  1CNO A;  5TIS V;  1IRV A;  1GU2 A;  1KB9 D;  3WFE C;  3L73 D;  4L3G A;  2ZOO A;  5C9M A;  1QYZ A;  4KMG A;  3PXS A;  4Y5R A;  3NBT A;  1U75 B;  1VYD A;  4AX3 A;  2LIT A;  2BLF B;  1CYC A;  3O5C A;  1N50 A;  2CA3 B;  1W5C T;  1BE3 D;  3PXT A;  2I8F A;  1K3H A;  3L4M A;  1P84 D;  2RN0 A;  2B4Z A;  5TJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...