3L75D

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 71
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l75D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l75D02
2CE0A 2CXBA 2N18C 3OCDA 1L0LD 1DVVA 3WU2V 2B4ZA 2YCCA 2CA4B 4FA5A 3ZOWA 2ZXYA 2C1VA 1LC2A 1GU2A 3PH2B 2KNCB 1KIBA 2BGVX 1I5TA 3CP5A 1CRJA 2ORLA 2BCCD 1FI9A 1CTYA 5TJHA 3A0HV 2JTIB 1H33B 3RMZA 4FAVA 1DW1A 2GIWA 4PJ0V 1WVEC 4L1QA 3CXHD 1YICA 2OZ1B 2HV4A 5GTHV 1CRCA 1YNRA 5CIDB 1EZVD 1CIFA 3BCCD 4FA9A 2K9JB 2CA3B 3PRJA 3L70D 5KAIV 1M6ZA 2KS1A 2LITA 3TGUD 5CIBB 5IY51 1FCDC 1R0QA 1CIGA 3H1ID 1E2RA 3L71D 1L9JC 1NTZD 3OA8B 2BH5X 2DVHA 3HQ6A 1H33A 2FYUD 4YE1A 3SXTA 5TISV 1IRVA 4KMGA 1WEJF 2AI5A 1U74B 1YEAA 2FYNB 2XTSB 3GG2A 2L91A 3PHLA 2PCCB 4AALA 2C1DA 1BL9A 5KLIB 1H9XA 1CSWA 3O0RC 1A2SA 3TF5A 1I6EA 4UB8V 1IZL0 4PW9B 3ORVA 1GDVA 3CXHW 3FWLA 2ZONG 1N90A 1FI7A 2ZBOA 5DJQB 3H1JD 1CIHA 3DP5A 2MTAC 1CRHA 3X39A 1FOCA 2Y0DA 4EIDA 2GC7D 1KYOD 5AURA 3L4OA 1A56A 1GQ1A 4WQEA 2Q3EA 3RN1A 3H1HD 4EDFA 1LC1A 3O1YA 1CRGA 3HQ8A 4WQ8A 4EICA 2VHDA 1HJ3A 1MG3D 2QJYB 1HJ4A 5CIHB 3L73D 4FA4A 4MU8A 2AXTV 1CRYA 1PPJD 3C2CA 3MK7B 5CIEB 1FHBA 1C75A 4XYDB 1BE3D 1LMSA 2RMZA 3GW6A 1C6OA 2BCNB 1AOQA 3L74D 3PXTA 4PWAA 4GYDA 3WC8A 1H32B 1I55A 1I8PA 1L9BC 3A0BV 1COTA 1BGYD 1J3SA 1CORA 3VRDA 3O5CA 4DY9A 3VYMA 1BCCD 2JWAA 2CE1A 1DIIC 1KYOW 1OCDA 3CYTI 1N50A 3HQ9A 4PD4D 3HQ7A 4H0JA 5B6QA 1CHJA 2BPBB 1CYCA 2V07A 2GB8B 2YIUB 2N18B 2QJKB 1HZUA 2N3BA 2N9IA 5KAFV 1IRWA 5CYTR 1W5CT 1YCCA 2O3JA 1AYGA 4N0KA 4AAMA 1AKKA 2N9YB 1NNOA 2OZ1A 5CIFB 1KX2A 1QL4A 3SJLA 4FANA 1AOFA 5H2FV 5CIGB 2B11B 1NU1D 1SQBD 4WQ7A 1CTZA 2IBZD 1NMLA 2PACA 3ZOXA 1I8OA 3L72D 1GIWA 4A7PA 1YFCA 3M97X 2N3YA 4WQDA 2C2CA 2V08A 3O20A 3A9FA 1HCMA 1SQXD 2FWLA 3DMIA 5C9MA 1HROA 1CCHA 1CEDA 1SQVD 3CU4A 3SLEA 1EB7A 3VNWA 1PP9D 3H1KD 3OA8A 1I54A 1DVHA 3PXWA 4JCGA 2Y0EA 1N9CA 3NBTA 1HH7A 2D0SA 1H9YA 5KKZB 3ZOYA 1K3GA 3RN0A 5CICB 2DGEA 1L0ND 4EIFA 2B12B 1C6SA 4AX3A 2YQBA 1A8CA 4V2KA 2C8SA 1LS9A 5DFSA 1RAPA 1CHHA 1MZ4A 2QJPB 1HRCA 1OAEA 1IO3A 3H1LD 1CCRA 3ITKA 2N9JA 3PLNA 1ZZHA 4RSZA 1CSUA 1W2LA 4GEDB 1S5LV 1KB9D 3PTZA 3ZOOA 4EIEA 1DW0A 4Q5PA 4P4QB 3KZIV 4LJIA 3WFCC 2YK3A 4AANA 3NBSA 2L4DA 1M70A 4WQ9A 4O1QA 2BH4X 5EXQA 3WFDC 1C2RA 2BLFB 4FB1A 1RZ6A 3ZCFA 1E29A 4J20A 1DIQC 3CX5D 1F1CA 1DW3A 4UB6V 2LIRA 1YTCA 3CWBD 4NFGB 1C7MA 2Y0CA 2PCBB 3L4MA 4WQCA 1F1FA 4L3HA 4IL6V 1H32A 2C9XB 1CYJA 3NWVA 1CTJA 1RZ5A 3TYIA 3PXSA 1FI3A 1C52A 4FA1A 5DJQC 2I8FA 1DT1A 1HZVA 1SQPD 2C1DB 3JBTB 1B7VA 1CC5A 1MG2D 1NTMD 1P84D 4QAOA 1CHIA 1NTKD 1CSXA 1GJQA 5C0ZA 1JDLA 1CXAA 1QYZA 1M60A 1K3HA 1C6RA 2D0WA 1H31B 3WFBC 1DW2A 1U75B 1YEBA 4Y5RA 1KV9A 2AIUA 4K3IA 4XXLA 4AAOA 5DF5A 1E8EA 1CRIA 2FRCA 1FJ0A 2B0ZB 1ZRTD 1GKSA 1S6VB 3TDKA 1QL3A 2C1UA 1QKSA 2MHMA 3MK7C 3CX5W 4L3GA 4D6TD 3VMAA 3SWSA 1H1OA 3WUIA 1NIRA 1VYDA 1QN2A 3RLMA 1N15A 1H31A 5B66V 3OCDB 1I6DA 1IQCA 451CA 1ETPA 1YIQA 1KX7A 2ZZS1 2RN0A 3WFEC 5E79V 1CIEA 1LFMA 1CYIA 3ZBMA 5KLVD 4U3FD 1CXCA 1CSVA 3ZIYA 5GTIV 2GC4D 1CNOA 2EXVA 4WQBA 3L75D 351CA 1HJ5A 4O1WA 4WQAA 3KHUA 2QG4A 4RJTA 2ZOOA 1C2NA 1KB0A 155CA 3SVWA 2B10B 5B5EV 1CO6A 1SQQD 1NMIA 1RAQA 2A06D 2JQRA 4H0KA 3DR0A
chains in the Genus database with same CATH superfamily
2CE0A 2CXBA 1OW8A 2N18C 3V5BA 5KJ7C 1EZVI 3HE4B 2FYUJ 1E5WA 5GTIH 2CA4B 2O01H 4DT0A 2KK7A 2C1VA 1LC2A 3PH2B 2KNCB 3B5ND 3D71A 2WPRA 1S5LH 2BCCD 3L73G 4LLHA 3LIDA 3RMZA 1GMJA 1JB0J 1L0LG 5KTBA 3WUUA 4H44D 2ZYDA 3CXHD 1YICA 2HV4A 1URQB 5GTHV 4OWFA 4TLFA 4CPGA 1K8AQ 2D2CD 5CJ4A 4ZMDA 2ZVOB 4C7NB 3K5BA 1RH5B 1MUUA 2K9JB 1LGHB 1MKMA 1AQTA 1FBMA 2W6JH 1FZGA 1NTZK 3AEFC 2IZ1A 4JYCA 2PP6A 3GHGA 2W83C 4HKZH 1L9JC 3GMAA 3OA8B 4N3YB 1M56D 3KQGA 1HGZA 1M1JC 2E42A 1H33A 3U1CA 3AEGC 1EZVG 2O1KA 2E75C 2WSCH 2E5YA 1WEJF 2AI5A 5KJ7D 1JTHA 1NH4A 3C1LA 3L73J 1W2BO 2QJPC 1YQ4C 2KB7P 1L0LJ 3PHLA 2WT7B 4AALA 4HB1A 2C1DA 5KLIB 1CSWA 3O0RC 4NPEA 1GW4A 5CMZA 3EQ2A 1BE3J 3TF5A 3ORVA 3D70A 3CCJP 1VDFA 3FWLA 4GKGA 1N2DC 1X8YA 3II6A 1QVGO 5DJQB 4B86A 4H13C 3X39A 1IO4A 1FZFA 1SQPE 4WQEA 2Q3EA 1S72P 1NTKE 3H1IE 3GHGC 1YI2P 3HQ8A 4OGQB 2W6AA 2FFDA 1IFMA 1CW5A 4XE5B 3H1JG 1MG3D 4L75A 1HJ4A 1SVFA 1KFNA 2WSFH 4DZOA 4FA4A 2CPSA 1LP1B 1FZCA 2AXCA 1PZQA 4PD4I 1A02J 1S3JA 3H1HG 2YXRB 1RE3A 1LMSA 1SQBJ 3CCQP 2XNDH 2PAJA 2AEMA 2B87A 3M0AA 1AOQA 1KYOH 1H32B 4IFMA 1I8PA 3R2PA 3NMDA 1SQXJ 4DY9A 2P1JA 2QM7A 5L8RJ 1CI6B 1BCCD 2IDBA 2NPSB 2JWAA 1NYHA 1YQ3C 1KYOW 1OCDA 3ABVC 2YNYA 3CYTI 4K35A 2C9NY 3L74G 3KZIE 2H8PD 1CYCA 2M5AB 4IFFA 1ZR4A 2FFDC 4Z1MH 2YO2A 1H89A 2N18B 3H1HJ 1U57A 1DD4A 2N9IA 2YO3A 3LW5H 2I1KA 2ZT9D 5GTHH 1MFTA 2P10A 1FZCC 2KSEA 4AAMA 1KORA 1K73Q 5CIFB 2JEEA 1AOFA 5AVYB 1NU1D 1CTZA 1IZNB 1WMKA 2IX7C 4JBZA 5DJUB 1H88A 5GTHE 1NVOA 3M97X 2V08A 2E5TA 2C0WA 3O20A 4AUWA 2BCCE 1S1CX 5C9MA 1HROA 1CEDA 1SQVD 3CU4A 1LTJA 1EB7A 3CXHE 1I54A 3OAKA 3L74J 1OWAA 2R32A 3L72G 3V2RA 3CCEP 1N9CA 3NBTA 1IFDA 2OARA 3B4SA 2YMKA 1K3GA 5AVUB 2DGEA 1L0ND 2B12B 1M1JB 2HLOA 3JC22 1N7SA 2YQBA 4V2KA 1VF5C 3MP7B 1MV8A 2E75B 1LJ2A 3C9IA 2FBWC 2V7QH 2Z5IA 1CHHA 2QJPB 1DEEG 2I8DA 1OW7A 1BDDA 1X9VA 2WQYC 1T3JA 1VQ4P 2HPCB 3ITKA 3CX5I 3N4XA 3CPWO 4RSZA 3HE5A 5CCGC 3RL0g 1SQPJ 3M0DC 3PTZA 3ZOOA 3CXHI 1NTKJ 3OW2O 1LTJC 3SWYA 1AQ5A 1K05A 4LJIA 4H13B 4RO0A 3B71A 3CI9A 3VMYA 3NBSA 3Q2YA 1ZN5A 4WQ9A 2R44A 2K9YA 4K3AA 1KQSO 2BH4X 5EXQA 1P84I 2Z4EA 1C2RA 2KXPB 3GHGB 3RL0C 1VQ6P 2JR8A 1HH0A 4UB6V 1N7SC 3CWBD 4NFGB 3H32A 4GDOA 3O6QA 1SFCC 1GL2C 1JTHB 4IL6V 3M9BA 1K04A 4OVNF 1KB9H 1RZ5A 3TYIA 5AW6B 4FA1A 3A0HE 1Q86Q 1HZVA 2C1DB 1MG2D 1CHIA 1CSXA 1EXJA 1ZP0C 4WY4A 1AVYA 1VQ5P 4KT0J 1C6RA 3JCUH 2NRGA 1KV9A 1BCCE 5DF5A 1NTMG 5K5GB 2K3RA 3RK2D 4IOIH 1S6VB 1OMIA 3MK7C 4EI2A 4L3GA 2FFDB 3RGUA 4D6TD 3CC2P 1NIRA 1Y47A 3PH0A 3BRVB 1FZCB 1H31A 5B66V 2ZVNB 3USSA 4YXWH 1DEBA 1IQCA 2KLUA 3M06A 2E74C 4U3FD 3ZDMA 1CSVA 5GTIV 2KYVA 1NU1E 3AE5C 3L75D 4ZKPA 2B87B 1H0TA 4O1WA 5AVZB 4WY4C 4RJTA 1S9KD 155CA 1Q7YQ 1LWUA 5AVQB 5B5EV 1SQQD 1SQVE 1RAQA 2A06D 4IFDK 5KLVG 2ITAA 5AW9B 3AEAC 1Q82Q 2YIUC 3OCDA 1ZR2A 1DVVA 3WU2V 3L37A 2B4ZA 2C9LY 1JNMA 1FOSF 1PGOA 2ZXYA 1JY2P 2P7JA 1GU2A 1OVVA 1KIBA 2BGVX 1L0NE 1VF5B 3CP5A 1E79H 3B5NA 1CRJA 2ZXEB 3F89A 5CHXA 2FXPA 4FAVA 2GIWA 2I1JA 4L1QA 2A45I 3V4WA 2WMMA 1KN7A 5CIDB 3BCCD 1KMIZ 2CA3B 5KAIV 1QLED 5CIBB 5IY51 4ZNCA 2P67A 1FCDC 3H1ID 1LTJB 3P8MC 1X22A 1LWUC 1NTZD 2PGDA 2BH5X 2DVHA 3CD6P 1YJWP 4YE1A 3P8CD 5AW5B 5TISV 1IRVA 1M7LA 4IL6H 3D6ZA 4UB6E 4KMGA 3L70G 2GUVA 1U74B 3RL0B 1GD2E 1IK7A 1ZLLA 1J1EC 2BEQD 3L71G 1N7SB 3B5NC 2PRRA 1N73A 2FYUG 1SFCB 1OIPA 1GL2B 3IR9A 3CWBE 1AFOA 4UB8V 2A45G 1IZL0 4PW9B 5H2FE 1GDVA 4HYTB 4M3LA 1N8RQ 4H44C 2H89C 2ZONG 3M91A 1NU1G 1N90A 2B9BA 2D2CC 1SS1A 1SLQA 3RBXA 1UIIA 3SSUA 1FOCA 3WMM0 2GC7D 1KYOD 1FOSE 2H43A 1G1JA 3VYIA 3O1YA 1USEA 1CRGA 3L70J 1QL1A 1KILD 4EICA 3NXSA 2VHDA 2R5DA 3A3YB 5B66H 1HJ3A 2Y9ZA 3HD7A 3L71J 4Y99C 1KQLA 2GUSA 1NJIQ 2AXTV 1PPJD 1IFNA 3MK7B 5CIEB 4I2LC 1X79B 4JYBA 4XYDB 1N73C 1NU1J 3H32B 4GOEA 4D6TE 3Q3DA 1JEKA 3PXTA 4PWAA 5GTIE 5B5EH 1KTMA 1L9BC 1BGYD 1T3UA 1J3SA 4EIJA 2E74B 3VYMA 1SQVJ 3WU2H 3B8EB 2CE1A 1S5LE 1DIIC 4U3FE 2IBZI 1BE3G 4KJMA 4L76A 4WY4B 3L75E 1CHJA 1NAYA 1NOHA 4BRYB 2BPBB 1EXIA 1S9KE 2V07A 3TNUA 4DCKA 1NO4A 1L0NJ 2YIUB 1SQQE 3TYYA 2A06E 5APVA 3CCVP 3L36A 1W5CT 1NNOA 2OZ1A 1USDA 4PV1D 3SJLA 4C7RA 2B11B 3FGAD 1OZHA 1G2CA 1QGKB 5KAIH 2J58A 1I8OA 2XDJA 2N3YA 2MKVA 4I6MC 3DMIA 1CCHA 4PD4H 1U7JA 1PP9D 3H1KD 5TISH 4EYYQ 1DVHA 1SQBG 2FKWB 2IBZG 1T2KD 1FE6A 3PXWA 1H0TB 3AEEC 3BCCE 1HH7A 1KZUB 3RN0A 1LT9B 1LWUB 1SQXG 4IL6X 2M0BA 1WRGA 1A8CA 1NTZE 4UB8H 3FWNA 1ZOYC 3P8CE 2ZT9C 1RAPA 1FS0E 3HD7D 4H0LD 1IFJA 1Q90D 1HF9A 1J1EB 2E76D 4OH8B 3RK3D 1IO3A 3H1LD 3B5NB 1CCRA 1GDTA 5AW3B 3I56P 2HODB 1RQUA 1W2LA 2RKLA 1KB9D 4H44B 1DW0A 3KYQA 4L73A 4P4QB 2D2CB 3BASA 2YK3A 3EFGA 1NHLA 4ZKUA 2AXTH 1HVVA 1J1DC 1KYOE 1SQQG 2FYNC 3ZCFA 2VRSA 1E29A 1PFIA 3HTKA 3OA7A 1L2PA 2XNXA 2SPZA 2LIRA 2NZ2A 1WT6A 1KILE 1YTZT 1C7MA 2E43A 4Y99B 3L4MA 1LTIC 4L3HA 2PFXA 2C9XB 1NTMK 4HJGH 1MFZA 3PXSA 1PPJE 1EC5A 3U59A 2I8FA 1DT1A 1R8EA 1N73B 3JBTB 1B7VA 1CC5A 4U3FJ 5BU8B 1JY2N 1GJQA 4LC1A 5C0ZA 1RE3C 2WVRA 1JDLA 1G1IA 3L75J 1FJPA 1QYZA 1KC8Q 1FDMA 3TSIA 2D0WA 2JP3A 2YKQA 1EDIA 2IYPA 1BGYE 1U75B 1CSBA 4NPDA 4Y5RA 1SQQJ 3CX5H 1JOCA 1JM0A 1SQPG 4XXLA 2FY8A 3AEBC 2OYIA 3UIAA 4QMAA 2IFMA 1NTKG 3H1IG 1FJ0A 1NAFA 3TDKA 4RESB 1OVRA 3CX5W 4WBAA 3VMAA 4I7ZC 1DX7A 2N9BA 1HJ0A 3D6YA 3SWFA 5KLVK 3RLMA 1P84H 1L4AD 4ASWA 2Q1KA 1JUNA 1ETPA 5E79V 3M9QA 1LFMA 3V2QA 3NFQA 3TK1A 1XTCC 1CNOA 351CA 1HJ5A 3EWKA 2XV5A 1C2NA 1KB0A 3BATA 3IAOA 2B10B 1W5CE 2QE7H 3I5CA 4NPFX 3H1IJ 2JQRA 3DR0A 1PP9E 1NTZJ 3H1KE 2QJKC 1L0LD 2OYIC 2YCCA 1AA0A 2N1TA 4FA5A 3ZOWA 3RK2C 1FJKA 3P32A 3TNUB 2FXOA 3O8ZA 1Y8AA 3Q1MA 2QIWA 2IYOA 5TJHA 2JTIB 1H33B 1AVOA 2WSEJ 2ZT9B 4PJ0V 2C0XA 2KUBA 2OZ1B 1KFMA 1JO5A 1JY3P 1G2CB 1YNRA 1EZVD 1CIFA 4FA9A 3HE4A 1DIPA 1PIXA 3RK3E 2Q3IA 3H1LE 2W90A 2Z5HA 4TT3H 4C46A 2BCCG 1NKNA 2W27A 2FYUK 5KKZC 1E2RA 2KNCA 1KB9E 2ZAEB 3P7KA 1VQ9P 4I1LA 3SXTA 5M1BA 5DJTB 4MN4C 1J1DB 2N1TC 1YEAA 2FYNB 3E1RA 3AE1C 3G4SP 2XTSB 2L91A 3CLQA 3JCUE 1LTAC 1EDLA 2PCCB 1VQMP 3MD0A 1BL9A 1LTGC 1FZEA 1QX8A 2K88A 1HTLC 1I6EA 3V2PA 2J59M 1BSNA 1HGVA 4WVZA 2RH0A 2WTYA 1FI7A 2BCCJ 2ZBOA 3H1JD 1CIHA 1BGYJ 3DP5A 3WUTA 3Q5RA 2G3AA 1YBKA 2Y0DA 4EIDA 1YYCA 1GQ1A 1FU1A 3C8VA 3VMXA 1IFPA 3RN1A 3H1HD 2A45H 2P58A 1LC1A 2WT7A 1KILA 1LTSC 2V4HA 3WUVA 3CC4P 1L0LK 1LNQA 3VP8A 2H88C 5E79H 1VQKP 1VPCA 4MU8A 1IJDB 1HBWA 3C2CA 2N1TD 1FHBA 1C75A 1FDIA 4I7ZB 2JDIH 2KSJA 5AW2B 1U7MA 2RMZA 4YTPC 1EDKA 4L74A 3GW6A 2Q6QA 1C6OA 2BCNB 3L74D 1A02F 2JKVA 2WITA 1FAVA 1I55A 1YHQP 2KP8A 1RF1A 1GTWA 2K1AA 1CORA 2G8YA 4JQ0D 4WB4A 2FYZA 2J5UA 3CCUP 1PP9J 2QEXP 3HUSA 2WPVB 1N50A 3HQ9A 4PD4D 5AVVB 2P2UA 4RKUJ 1KILC 3A0BH 4WWIA 1BCCG 2QJKB 3AE2C 4PJ0H 1BSHA 5AW8B 2OYIB 1SQBK 1IRWA 1Y9BA 1L0LE 4N0KA 2UWJE 1AKKA 2N9YB 3RK2B 2IZ0A 1URQD 3T97A 1QL4A 2NPSA 5CIGB 4WQ7A 1SQXK 3F5HA 4EOTA 3L72D 1PGQA 4A7PA 1YFCA 4BWNA 2M3EA 1FC2C 4WQDA 3H1LJ 3VOPA 4IL6E 4GODA 3A9FA 1HCMA 5CBNA 1RF1C 3SLEA 2JWDA 4AQRD 3MUDA 2Y0EA 1EZVE 3HUSC 3A2AA 2D0SA 1H9YA 5KKZB 4GT1A 1VQLP 3HE5B 2HFED 1BCCJ 3I55P 3G3ZA 4EIFA 1OXZA 1SQVG 5APYA 1C6SA 2JO1A 2C8SA 5BU5A 2BEZF 3CMEP 1LS9A 1M1KQ 5AVWB 5EFWB 1HRCA 2B89A 4PV1C 3SFEC 1VQOP 1OAEA 1L0NG 1M8OB 1GU4A 1PGPA 5B66E 2POHA 4JPZB 1CSUA 4GEDB 1LTBC 2HYNA 3O6QB 2Q7CA 2OYHA 4Q5PA 2ZYAA 4OGQD 3KZIV 2Q9IA 3WFCC 1Z56A 3MUDC 3H1JE 1M70A 5CJ0A 1T2KC 3BVHA 2QA4P 1GW3A 3W67A 2LKMA 1AJYA 1J2JB 5B5EE 2B88A 4W80A 2W8ZA 2LR2A 2HPCA 4Y28J 1Q81Q 5AVXB 2O01N 3H1HE 1KQGB 1DIQC 3CX5D 2ZJSE 1PL5A 2YXQB 3WU2E 3VMZA 5CCHD 1BDCA 5APUA 1EQ7A 1M90Q 4WQCA 2XKMA 2IFNA 1SQPK 3HD7C 1DD3A 1N7LA 4H0LC 4N78D 3NWVA 1NTKK 1C52A 2E76C 3RK3C 2NPSD 1NTMD 1P84D 4QAOA 2QM8A 3CWBG 3MIWA 3Q5PA 2OYHC 1RHZB 1YJ9P 4N6JA 3L74E 1H31B 2QVAA 2XZRA 2YKOA 5KAIE 3SFDC 1OX3A 2OTJP 3V4QA 2QJYC 1JY3N 1E8EA 3HRNA 2FRCA 3CL3D 1ZRTD 4PD4E 1D7MA 1QL3A 1QKSA 1HUCA 2WZ7A 1KILB 5TISE 3SWSA 2WSSH 1H1OA 4XFJA 1QN2A 3GF3A 3OCDB 1I6DA 451CA 1ZV8A 1L4AA 2BASA 2ZZS1 2RN0A 3CWBJ 1CYIA 5KLVD 1JY3O 1QL2A 3ZIYA 1HWTC 4D6TG 4UB8E 2EXVA 4WQBA 1X0TA 3L72E 1YITP 1JCDA 3KHUA 2LXBA 2ZYGA 1GZLA 5BVZA 1RF1B 3SVWA 3VTPC 3IF4A 1YIJP 2HG5D 4AYCA 3MGNA 4H0KA 1TU3F 2WSEH 4U3FG 2E75D 2ZFCA 3HUSB 3MHVA 3L75G 1S4XA 2FXMA 4HH2A 1T8ZA 5AW7B 4W7YA 1HJBA 1I5TA 1UIXA 2A06G 2ORLA 4W7ZA 4KHXA 2AXTE 1FI9A 1CTYA 3A0HV 1NWQA 3L4FA 1DW1A 1WVEC 3AE3C 4D6TJ 3KZIH 1L4AC 3T97B 4PV1B 3CCLP 3G6EP 1CRCA 1K9MQ 4XA4A 2O01J 4H13D 2M3BA 3PRJA 3H1JJ 3L70D 1M6ZA 2KS1A 2LITA 3TGUD 1AV1A 3S4RA 1R0QA 3BRTB 1CIGA 3D0WA 3L71D 3EFFK 5APQA 2CK3H 3AECC 3AEDC 3HQ6A 2FYUD 3V2NA 3N7NA 3CC7P 3BCCG 1S5LX 1KYOI 2R5BA 5APWA 4ASVA 3GG2A 2WWWA 3CXHH 4JF7A 3CCSP 3VP9A 1RE4A 5CCGA 4LGDE 1W2EA 1NTZG 2KOGA 3M0DA 3CX5E 2KZIA 1H9XA 1JY2O 3RBZA 1A2SA 1PGJA 5APXA 3HD7B 3CXHW 4H0LB 1LTTC 2WSCJ 2E76B 3RK3B 5AVRB 4N78E 2MTAC 1VQ7P 1CRHA 2JJLA 2R3SA 5AURA 3L4OA 1A56A 1NTME 1P84E 2OYHB 1CZQA 4EDFA 3A7OA 3BCCJ 1QVFO 5AW4B 3W68A 4WQ8A 3OJAB 2ZXXA 1SFCA 1GL2A 2OGUA 2QJYB 2AEFA 5CIHB 3L73D 2WPSA 1EDJA 3MZWB 1VQPP 1CRYA 1ZRTE 1RE4C 1DH3A 1BE3D 2AEJA 1KQFB 3L72J 1LT1A 4GYDA 1RQVA 3WC8A 1VL2A 3A0BV 1COTA 2WSFJ 3VRDA 1PPJG 1GK6A 3O5CA 4O9BA 1ZXGA 5KLVE 1IC2A 4GOFA 1T6AA 3HQ7A 1KV4A 4H0JA 5B6QA 1R5SA 2XU6A 3R4YA 1BGYG 2GB8B 1VF5D 3A0HH 3S1KA 3H6PA 1FZAA 3AE4C 1HZUA 3M9HA 2N3BA 3AE9C 1NU1K 5KAFV 5CYTR 1JMBA 1YCCA 2O3JA 1AYGA 1FDOA 1URQA 2KZJA 2W6BA 1KX2A 4FANA 5H2FV 1SQBD 1KD1Q 2IBZD 4YXDC 1NMLA 2PACA 3ZOXA 4C7NA 1GIWA 1SQVK 2K9JA 5CCGD 2C2CA 4BRYA 1MZ9A 1SQXD 2FWLA 2OTLP 2Y9YA 1L4AB 1RY3A 2H7HA 3LW5J 4GIFA 3VNWA 5APTA 3OA8A 1Q2NA 3IFMA 3V6IA 1L0NK 3PP5A 1GU5A 4JCGA 2WPQA 3AE6C 5C39A 2OQQA 3FXDA 3L70E 5AVSB 3RL0D 3ZOYA 2KI7B 3TGUE 5CICB 2YMYA 2IPPA 1KB9I 1NGMB 4YPCA 4AX3A 3G9RA 1N7SD 3KXDA 3L71E 1PP9G 1S2EA 4R4MA 3H1KG 1SFCD 5DFSA 1GL2D 2FYUE 1OVUA 2QSIA 1MZ4A 1URQC 3MTUE 1SP4A 3GLMA 3QWOC 3AE8C 3PJSK 3GF7A 3HTKB 2N9JA 2QRXA 3PLNA 3S9OA 1ZZHA 2Q5UA 1LT9A 2GA1A 5AVTB 1S5LV 5E79E 2K37A 1NTMJ 2GM4A 4EIEA 2V7QJ 1FZBA 3H25A 1NKZB 4U7JA 1IK9A 3L35A 1YJNP 3H1LG 4AANA 2L4DA 2KS1B 4O1QA 1YTZI 1LP1A 3WFDC 3H1KJ 3FX0A 1ZMEC 2BLFB 4FB1A 3U1AA 1RZ6A 3SWKA 4J20A 3CCMP 3A5TA 1RF0A 1F1CA 2HODA 1DW3A 5APSA 3NTNA 2O1JA 1YTCA 5AW0B 5KLIC 2Y0CA 5CCHA 2PCBB 4BXLA 1IFIA 1VQ8P 1F1FA 3L73E 1H32A 1CYJA 3FXEA 1CTJA 2E74D 1FI3A 2DW3A 5DJQC 3A0BE 1CI6A 3IN6A 1SQPD 4PJ0E 1ZW0A 2KIKA 5KLVJ 1PV3A 3VN0A 1NTKD 1BE3E 4UB6H 4WY4D 2L5GB 1LT9C 1CXAA 1M60A 1K3HA 5CBOA 2M5AA 4OGQC 3WFBC 3E1IA 1N86A 1DW2A 1YEBA 5KAFH 2AIUA 2OYOA 3TGUG 5KJ7A 4K3IA 1H8AA 2LXCB 2CPBA 4AAOA 3Q5SA 1CRIA 3JSVC 5H2FH 3G71P 2B0ZB 1GKSA 1M57D 2C1UA 2MHMA 5AW1B 5KAFE 2R3CA 4R4LA 1R5LA 4DJGA 1RF0C 1OFCX 1OW6A 3KPEA 1GK4A 2HR3A 3WUIA 1XTGB 5CCHC 3CCRP 1VYDA 2YKPA 3KDPB 3E7KA 1N15A 3CMAP 1YIQA 1KX7A 3WFEC 4DOJA 1CIEA 2N1TB 3ZBMA 1CXCA 1QEXA 1VQNP 1SQBE 2KLVA 2GC4D 2NPSC 2IBZE 2MJZA 2OTKE 1SQQK 4WQAA 2QG4A 2ZOOA 3LIEA 3TGUJ 1JMMA 1SQXE 1CO6A 2M8RA 1JCCA 1NMIA 1M1JA 3QH9A 3AE7C
chains in the Genus database with same CATH topology
2CE0A 2CXBA 2N18C 3OCDA 1L0LD 1DVVA 3WU2V 2B4ZA 2YCCA 2CA4B 4FA5A 3ZOWA 2ZXYA 2C1VA 1LC2A 1GU2A 3PH2B 2KNCB 1KIBA 2BGVX 1I5TA 3CP5A 1CRJA 2ORLA 2BCCD 1FI9A 1CTYA 5TJHA 3A0HV 2JTIB 1H33B 3RMZA 4FAVA 1DW1A 2GIWA 4PJ0V 1WVEC 4L1QA 3CXHD 1YICA 2OZ1B 2HV4A 5GTHV 1CRCA 1YNRA 5CIDB 1EZVD 1CIFA 3BCCD 4FA9A 2K9JB 2CA3B 3PRJA 3L70D 5KAIV 1M6ZA 2KS1A 2LITA 3TGUD 5CIBB 5IY51 1FCDC 1R0QA 1CIGA 3H1ID 1E2RA 3L71D 1L9JC 1NTZD 3OA8B 2BH5X 2DVHA 3HQ6A 1H33A 2FYUD 4YE1A 3SXTA 5TISV 1IRVA 4KMGA 1WEJF 2AI5A 1U74B 1YEAA 2FYNB 2XTSB 3GG2A 2L91A 3PHLA 2PCCB 4AALA 2C1DA 1BL9A 5KLIB 1H9XA 1CSWA 3O0RC 1A2SA 3TF5A 1I6EA 4UB8V 1IZL0 4PW9B 3ORVA 1GDVA 3CXHW 3FWLA 2ZONG 1N90A 1FI7A 2ZBOA 5DJQB 3H1JD 1CIHA 3DP5A 2MTAC 1CRHA 3X39A 1FOCA 2Y0DA 4EIDA 2GC7D 1KYOD 5AURA 3L4OA 1A56A 1GQ1A 4WQEA 2Q3EA 3RN1A 3H1HD 4EDFA 1LC1A 3O1YA 1CRGA 3HQ8A 4WQ8A 4EICA 2VHDA 1HJ3A 1MG3D 2QJYB 1HJ4A 5CIHB 3L73D 4FA4A 4MU8A 2AXTV 1CRYA 1PPJD 3C2CA 3MK7B 5CIEB 1FHBA 1C75A 4XYDB 1BE3D 1LMSA 2RMZA 3GW6A 1C6OA 2BCNB 1AOQA 3L74D 3PXTA 4PWAA 4GYDA 3WC8A 1H32B 1I55A 1I8PA 1L9BC 3A0BV 1COTA 1BGYD 1J3SA 1CORA 3VRDA 3O5CA 4DY9A 3VYMA 1BCCD 2JWAA 2CE1A 1DIIC 1KYOW 1OCDA 3CYTI 1N50A 3HQ9A 4PD4D 3HQ7A 4H0JA 5B6QA 1CHJA 2BPBB 1CYCA 2V07A 2GB8B 2YIUB 2N18B 2QJKB 1HZUA 2N3BA 2N9IA 5KAFV 1IRWA 5CYTR 1W5CT 1YCCA 2O3JA 1AYGA 4N0KA 4AAMA 1AKKA 2N9YB 1NNOA 2OZ1A 5CIFB 1KX2A 1QL4A 3SJLA 4FANA 1AOFA 5H2FV 5CIGB 2B11B 1NU1D 1SQBD 4WQ7A 1CTZA 2IBZD 1NMLA 2PACA 3ZOXA 1I8OA 3L72D 1GIWA 4A7PA 1YFCA 3M97X 2N3YA 4WQDA 2C2CA 2V08A 3O20A 3A9FA 1HCMA 1SQXD 2FWLA 3DMIA 5C9MA 1HROA 1CCHA 1CEDA 1SQVD 3CU4A 3SLEA 1EB7A 3VNWA 1PP9D 3H1KD 3OA8A 1I54A 1DVHA 3PXWA 4JCGA 2Y0EA 1N9CA 3NBTA 1HH7A 2D0SA 1H9YA 5KKZB 3ZOYA 1K3GA 3RN0A 5CICB 2DGEA 1L0ND 4EIFA 2B12B 1C6SA 4AX3A 2YQBA 1A8CA 4V2KA 2C8SA 1LS9A 5DFSA 1RAPA 1CHHA 1MZ4A 2QJPB 1HRCA 1OAEA 1IO3A 3H1LD 1CCRA 3ITKA 2N9JA 3PLNA 1ZZHA 4RSZA 1CSUA 1W2LA 4GEDB 1S5LV 1KB9D 3PTZA 3ZOOA 4EIEA 1DW0A 4Q5PA 4P4QB 3KZIV 4LJIA 3WFCC 2YK3A 4AANA 3NBSA 2L4DA 1M70A 4WQ9A 4O1QA 2BH4X 5EXQA 3WFDC 1C2RA 2BLFB 4FB1A 1RZ6A 3ZCFA 1E29A 4J20A 1DIQC 3CX5D 1F1CA 1DW3A 4UB6V 2LIRA 1YTCA 3CWBD 4NFGB 1C7MA 2Y0CA 2PCBB 3L4MA 4WQCA 1F1FA 4L3HA 4IL6V 1H32A 2C9XB 1CYJA 3NWVA 1CTJA 1RZ5A 3TYIA 3PXSA 1FI3A 1C52A 4FA1A 5DJQC 2I8FA 1DT1A 1HZVA 1SQPD 2C1DB 3JBTB 1B7VA 1CC5A 1MG2D 1NTMD 1P84D 4QAOA 1CHIA 1NTKD 1CSXA 1GJQA 5C0ZA 1JDLA 1CXAA 1QYZA 1M60A 1K3HA 1C6RA 2D0WA 1H31B 3WFBC 1DW2A 1U75B 1YEBA 4Y5RA 1KV9A 2AIUA 4K3IA 4XXLA 4AAOA 5DF5A 1E8EA 1CRIA 2FRCA 1FJ0A 2B0ZB 1ZRTD 1GKSA 1S6VB 3TDKA 1QL3A 2C1UA 1QKSA 2MHMA 3MK7C 3CX5W 4L3GA 4D6TD 3VMAA 3SWSA 1H1OA 3WUIA 1NIRA 1VYDA 1QN2A 3RLMA 1N15A 1H31A 5B66V 3OCDB 1I6DA 1IQCA 451CA 1ETPA 1YIQA 1KX7A 2ZZS1 2RN0A 3WFEC 5E79V 1CIEA 1LFMA 1CYIA 3ZBMA 5KLVD 4U3FD 1CXCA 1CSVA 3ZIYA 5GTIV 2GC4D 1CNOA 2EXVA 4WQBA 3L75D 351CA 1HJ5A 4O1WA 4WQAA 3KHUA 2QG4A 4RJTA 2ZOOA 1C2NA 1KB0A 155CA 3SVWA 2B10B 5B5EV 1CO6A 1SQQD 1NMIA 1RAQA 2A06D 2JQRA 4H0KA 3DR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE0 A;  2CXB A;  2N18 C;  3OCD A;  1L0L D;  1DVV A;  3WU2 V;  2B4Z A;  2YCC A;  2CA4 B;  4FA5 A;  3ZOW A;  2ZXY A;  2C1V A;  1LC2 A;  1GU2 A;  3PH2 B;  2KNC B;  1KIB A;  2BGV X;  1I5T A;  3CP5 A;  1CRJ A;  2ORL A;  2BCC D;  1FI9 A;  1CTY A;  5TJH A;  3A0H V;  2JTI B;  1H33 B;  3RMZ A;  4FAV A;  1DW1 A;  2GIW A;  4PJ0 V;  1WVE C;  4L1Q A;  3CXH D;  1YIC A;  2OZ1 B;  2HV4 A;  5GTH V;  1CRC A;  1YNR A;  5CID B;  1EZV D;  1CIF A;  3BCC D;  4FA9 A;  2K9J B;  2CA3 B;  3PRJ A;  3L70 D;  5KAI V;  1M6Z A;  2KS1 A;  2LIT A;  3TGU D;  5CIB B;  5IY5 1;  1FCD C;  1R0Q A;  1CIG A;  3H1I D;  1E2R A;  3L71 D;  1L9J C;  1NTZ D;  3OA8 B;  2BH5 X;  2DVH A;  3HQ6 A;  1H33 A;  2FYU D;  4YE1 A;  3SXT A;  5TIS V;  1IRV A;  4KMG A;  1WEJ F;  2AI5 A;  1U74 B;  1YEA A;  2FYN B;  2XTS B;  3GG2 A;  2L91 A;  3PHL A;  2PCC B;  4AAL A;  2C1D A;  1BL9 A;  5KLI B;  1H9X A;  1CSW A;  3O0R C;  1A2S A;  3TF5 A;  1I6E A;  4UB8 V;  1IZL 0;  4PW9 B;  3ORV A;  1GDV A;  3CXH W;  3FWL A;  2ZON G;  1N90 A;  1FI7 A;  2ZBO A;  5DJQ B;  3H1J D;  1CIH A;  3DP5 A;  2MTA C;  1CRH A;  3X39 A;  1FOC A;  2Y0D A;  4EID A;  2GC7 D;  1KYO D;  5AUR A;  3L4O A;  1A56 A;  1GQ1 A;  4WQE A;  2Q3E A;  3RN1 A;  3H1H D;  4EDF A;  1LC1 A;  3O1Y A;  1CRG A;  3HQ8 A;  4WQ8 A;  4EIC A;  2VHD A;  1HJ3 A;  1MG3 D;  2QJY B;  1HJ4 A;  5CIH B;  3L73 D;  4FA4 A;  4MU8 A;  2AXT V;  1CRY A;  1PPJ D;  3C2C A;  3MK7 B;  5CIE B;  1FHB A;  1C75 A;  4XYD B;  1BE3 D;  1LMS A;  2RMZ A;  3GW6 A;  1C6O A;  2BCN B;  1AOQ A;  3L74 D;  3PXT A;  4PWA A;  4GYD A;  3WC8 A;  1H32 B;  1I55 A;  1I8P A;  1L9B C;  3A0B V;  1COT A;  1BGY D;  1J3S A;  1COR A;  3VRD A;  3O5C A;  4DY9 A;  3VYM A;  1BCC D;  2JWA A;  2CE1 A;  1DII C;  1KYO W;  1OCD A;  3CYT I;  1N50 A;  3HQ9 A;  4PD4 D;  3HQ7 A;  4H0J A;  5B6Q A;  1CHJ A;  2BPB B;  1CYC A;  2V07 A;  2GB8 B;  2YIU B;  2N18 B;  2QJK B;  1HZU A;  2N3B A;  2N9I A;  5KAF V;  1IRW A;  5CYT R;  1W5C T;  1YCC A;  2O3J A;  1AYG A;  4N0K A;  4AAM A;  1AKK A;  2N9Y B;  1NNO A;  2OZ1 A;  5CIF B;  1KX2 A;  1QL4 A;  3SJL A;  4FAN A;  1AOF A;  5H2F V;  5CIG B;  2B11 B;  1NU1 D;  1SQB D;  4WQ7 A;  1CTZ A;  2IBZ D;  1NML A;  2PAC A;  3ZOX A;  1I8O A;  3L72 D;  1GIW A;  4A7P A;  1YFC A;  3M97 X;  2N3Y A;  4WQD A;  2C2C A;  2V08 A;  3O20 A;  3A9F A;  1HCM A;  1SQX D;  2FWL A;  3DMI A;  5C9M A;  1HRO A;  1CCH A;  1CED A;  1SQV D;  3CU4 A;  3SLE A;  1EB7 A;  3VNW A;  1PP9 D;  3H1K D;  3OA8 A;  1I54 A;  1DVH A;  3PXW A;  4JCG A;  2Y0E A;  1N9C A;  3NBT A;  1HH7 A;  2D0S A;  1H9Y A;  5KKZ B;  3ZOY A;  1K3G A;  3RN0 A;  5CIC B;  2DGE A;  1L0N D;  4EIF A;  2B12 B;  1C6S A;  4AX3 A;  2YQB A;  1A8C A;  4V2K A;  2C8S A;  1LS9 A;  5DFS A;  1RAP A;  1CHH A;  1MZ4 A;  2QJP B;  1HRC A;  1OAE A;  1IO3 A;  3H1L D;  1CCR A;  3ITK A;  2N9J A;  3PLN A;  1ZZH A;  4RSZ A;  1CSU A;  1W2L A;  4GED B;  1S5L V;  1KB9 D;  3PTZ A;  3ZOO A;  4EIE A;  1DW0 A;  4Q5P A;  4P4Q B;  3KZI V;  4LJI A;  3WFC C;  2YK3 A;  4AAN A;  3NBS A;  2L4D A;  1M70 A;  4WQ9 A;  4O1Q A;  2BH4 X;  5EXQ A;  3WFD C;  1C2R A;  2BLF B;  4FB1 A;  1RZ6 A;  3ZCF A;  1E29 A;  4J20 A;  1DIQ C;  3CX5 D;  1F1C A;  1DW3 A;  4UB6 V;  2LIR A;  1YTC A;  3CWB D;  4NFG B;  1C7M A;  2Y0C A;  2PCB B;  3L4M A;  4WQC A;  1F1F A;  4L3H A;  4IL6 V;  1H32 A;  2C9X B;  1CYJ A;  3NWV A;  1CTJ A;  1RZ5 A;  3TYI A;  3PXS A;  1FI3 A;  1C52 A;  4FA1 A;  5DJQ C;  2I8F A;  1DT1 A;  1HZV A;  1SQP D;  2C1D B;  3JBT B;  1B7V A;  1CC5 A;  1MG2 D;  1NTM D;  1P84 D;  4QAO A;  1CHI A;  1NTK D;  1CSX A;  1GJQ A;  5C0Z A;  1JDL A;  1CXA A;  1QYZ A;  1M60 A;  1K3H A;  1C6R A;  2D0W A;  1H31 B;  3WFB C;  1DW2 A;  1U75 B;  1YEB A;  4Y5R A;  1KV9 A;  2AIU A;  4K3I A;  4XXL A;  4AAO A;  5DF5 A;  1E8E A;  1CRI A;  2FRC A;  1FJ0 A;  2B0Z B;  1ZRT D;  1GKS A;  1S6V B;  3TDK A;  1QL3 A;  2C1U A;  1QKS A;  2MHM A;  3MK7 C;  3CX5 W;  4L3G A;  4D6T D;  3VMA A;  3SWS A;  1H1O A;  3WUI A;  1NIR A;  1VYD A;  1QN2 A;  3RLM A;  1N15 A;  1H31 A;  5B66 V;  3OCD B;  1I6D A;  1IQC A;  451C A;  1ETP A;  1YIQ A;  1KX7 A;  2ZZS 1;  2RN0 A;  3WFE C;  5E79 V;  1CIE A;  1LFM A;  1CYI A;  3ZBM A;  5KLV D;  4U3F D;  1CXC A;  1CSV A;  3ZIY A;  5GTI V;  2GC4 D;  1CNO A;  2EXV A;  4WQB A;  3L75 D;  351C A;  1HJ5 A;  4O1W A;  4WQA A;  3KHU A;  2QG4 A;  4RJT A;  2ZOO A;  1C2N A;  1KB0 A;  155C A;  3SVW A;  2B10 B;  5B5E V;  1CO6 A;  1SQQ D;  1NMI A;  1RAQ A;  2A06 D;  2JQR A;  4H0K A;  3DR0 A; 
#chains in the Genus database with same CATH topology
 2CE0 A;  2CXB A;  1OW8 A;  2N18 C;  3V5B A;  5KJ7 C;  1EZV I;  3HE4 B;  2FYU J;  1E5W A;  5GTI H;  2CA4 B;  2O01 H;  4DT0 A;  2KK7 A;  2C1V A;  1LC2 A;  3PH2 B;  2KNC B;  3B5N D;  3D71 A;  2WPR A;  1S5L H;  2BCC D;  3L73 G;  4LLH A;  3LID A;  3RMZ A;  1GMJ A;  1JB0 J;  1L0L G;  5KTB A;  3WUU A;  4H44 D;  2ZYD A;  3CXH D;  1YIC A;  2HV4 A;  1URQ B;  5GTH V;  4OWF A;  4TLF A;  4CPG A;  1K8A Q;  2D2C D;  5CJ4 A;  4ZMD A;  2ZVO B;  4C7N B;  3K5B A;  1RH5 B;  1MUU A;  2K9J B;  1LGH B;  1MKM A;  1AQT A;  1FBM A;  2W6J H;  1FZG A;  1NTZ K;  3AEF C;  2IZ1 A;  4JYC A;  2PP6 A;  3GHG A;  2W83 C;  4HKZ H;  1L9J C;  3GMA A;  3OA8 B;  4N3Y B;  1M56 D;  3KQG A;  1HGZ A;  1M1J C;  2E42 A;  1H33 A;  3U1C A;  3AEG C;  1EZV G;  2O1K A;  2E75 C;  2WSC H;  2E5Y A;  1WEJ F;  2AI5 A;  5KJ7 D;  1JTH A;  1NH4 A;  3C1L A;  3L73 J;  1W2B O;  2QJP C;  1YQ4 C;  2KB7 P;  1L0L J;  3PHL A;  2WT7 B;  4AAL A;  4HB1 A;  2C1D A;  5KLI B;  1CSW A;  3O0R C;  4NPE A;  1GW4 A;  5CMZ A;  3EQ2 A;  1BE3 J;  3TF5 A;  3ORV A;  3D70 A;  3CCJ P;  1VDF A;  3FWL A;  4GKG A;  1N2D C;  1X8Y A;  3II6 A;  1QVG O;  5DJQ B;  4B86 A;  4H13 C;  3X39 A;  1IO4 A;  1FZF A;  1SQP E;  4WQE A;  2Q3E A;  1S72 P;  1NTK E;  3H1I E;  3GHG C;  1YI2 P;  3HQ8 A;  4OGQ B;  2W6A A;  2FFD A;  1IFM A;  1CW5 A;  4XE5 B;  3H1J G;  1MG3 D;  4L75 A;  1HJ4 A;  1SVF A;  1KFN A;  2WSF H;  4DZO A;  4FA4 A;  2CPS A;  1LP1 B;  1FZC A;  2AXC A;  1PZQ A;  4PD4 I;  1A02 J;  1S3J A;  3H1H G;  2YXR B;  1RE3 A;  1LMS A;  1SQB J;  3CCQ P;  2XND H;  2PAJ A;  2AEM A;  2B87 A;  3M0A A;  1AOQ A;  1KYO H;  1H32 B;  4IFM A;  1I8P A;  3R2P A;  3NMD A;  1SQX J;  4DY9 A;  2P1J A;  2QM7 A;  5L8R J;  1CI6 B;  1BCC D;  2IDB A;  2NPS B;  2JWA A;  1NYH A;  1YQ3 C;  1KYO W;  1OCD A;  3ABV C;  2YNY A;  3CYT I;  4K35 A;  2C9N Y;  3L74 G;  3KZI E;  2H8P D;  1CYC A;  2M5A B;  4IFF A;  1ZR4 A;  2FFD C;  4Z1M H;  2YO2 A;  1H89 A;  2N18 B;  3H1H J;  1U57 A;  1DD4 A;  2N9I A;  2YO3 A;  3LW5 H;  2I1K A;  2ZT9 D;  5GTH H;  1MFT A;  2P10 A;  1FZC C;  2KSE A;  4AAM A;  1KOR A;  1K73 Q;  5CIF B;  2JEE A;  1AOF A;  5AVY B;  1NU1 D;  1CTZ A;  1IZN B;  1WMK A;  2IX7 C;  4JBZ A;  5DJU B;  1H88 A;  5GTH E;  1NVO A;  3M97 X;  2V08 A;  2E5T A;  2C0W A;  3O20 A;  4AUW A;  2BCC E;  1S1C X;  5C9M A;  1HRO A;  1CED A;  1SQV D;  3CU4 A;  1LTJ A;  1EB7 A;  3CXH E;  1I54 A;  3OAK A;  3L74 J;  1OWA A;  2R32 A;  3L72 G;  3V2R A;  3CCE P;  1N9C A;  3NBT A;  1IFD A;  2OAR A;  3B4S A;  2YMK A;  1K3G A;  5AVU B;  2DGE A;  1L0N D;  2B12 B;  1M1J B;  2HLO A;  3JC2 2;  1N7S A;  2YQB A;  4V2K A;  1VF5 C;  3MP7 B;  1MV8 A;  2E75 B;  1LJ2 A;  3C9I A;  2FBW C;  2V7Q H;  2Z5I A;  1CHH A;  2QJP B;  1DEE G;  2I8D A;  1OW7 A;  1BDD A;  1X9V A;  2WQY C;  1T3J A;  1VQ4 P;  2HPC B;  3ITK A;  3CX5 I;  3N4X A;  3CPW O;  4RSZ A;  3HE5 A;  5CCG C;  3RL0 g;  1SQP J;  3M0D C;  3PTZ A;  3ZOO A;  3CXH I;  1NTK J;  3OW2 O;  1LTJ C;  3SWY A;  1AQ5 A;  1K05 A;  4LJI A;  4H13 B;  4RO0 A;  3B71 A;  3CI9 A;  3VMY A;  3NBS A;  3Q2Y A;  1ZN5 A;  4WQ9 A;  2R44 A;  2K9Y A;  4K3A A;  1KQS O;  2BH4 X;  5EXQ A;  1P84 I;  2Z4E A;  1C2R A;  2KXP B;  3GHG B;  3RL0 C;  1VQ6 P;  2JR8 A;  1HH0 A;  4UB6 V;  1N7S C;  3CWB D;  4NFG B;  3H32 A;  4GDO A;  3O6Q A;  1SFC C;  1GL2 C;  1JTH B;  4IL6 V;  3M9B A;  1K04 A;  4OVN F;  1KB9 H;  1RZ5 A;  3TYI A;  5AW6 B;  4FA1 A;  3A0H E;  1Q86 Q;  1HZV A;  2C1D B;  1MG2 D;  1CHI A;  1CSX A;  1EXJ A;  1ZP0 C;  4WY4 A;  1AVY A;  1VQ5 P;  4KT0 J;  1C6R A;  3JCU H;  2NRG A;  1KV9 A;  1BCC E;  5DF5 A;  1NTM G;  5K5G B;  2K3R A;  3RK2 D;  4IOI H;  1S6V B;  1OMI A;  3MK7 C;  4EI2 A;  4L3G A;  2FFD B;  3RGU A;  4D6T D;  3CC2 P;  1NIR A;  1Y47 A;  3PH0 A;  3BRV B;  1FZC B;  1H31 A;  5B66 V;  2ZVN B;  3USS A;  4YXW H;  1DEB A;  1IQC A;  2KLU A;  3M06 A;  2E74 C;  4U3F D;  3ZDM A;  1CSV A;  5GTI V;  2KYV A;  1NU1 E;  3AE5 C;  3L75 D;  4ZKP A;  2B87 B;  1H0T A;  4O1W A;  5AVZ B;  4WY4 C;  4RJT A;  1S9K D;  155C A;  1Q7Y Q;  1LWU A;  5AVQ B;  5B5E V;  1SQQ D;  1SQV E;  1RAQ A;  2A06 D;  4IFD K;  5KLV G;  2ITA A;  5AW9 B;  3AEA C;  1Q82 Q;  2YIU C;  3OCD A;  1ZR2 A;  1DVV A;  3WU2 V;  3L37 A;  2B4Z A;  2C9L Y;  1JNM A;  1FOS F;  1PGO A;  2ZXY A;  1JY2 P;  2P7J A;  1GU2 A;  1OVV A;  1KIB A;  2BGV X;  1L0N E;  1VF5 B;  3CP5 A;  1E79 H;  3B5N A;  1CRJ A;  2ZXE B;  3F89 A;  5CHX A;  2FXP A;  4FAV A;  2GIW A;  2I1J A;  4L1Q A;  2A45 I;  3V4W A;  2WMM A;  1KN7 A;  5CID B;  3BCC D;  1KMI Z;  2CA3 B;  5KAI V;  1QLE D;  5CIB B;  5IY5 1;  4ZNC A;  2P67 A;  1FCD C;  3H1I D;  1LTJ B;  3P8M C;  1X22 A;  1LWU C;  1NTZ D;  2PGD A;  2BH5 X;  2DVH A;  3CD6 P;  1YJW P;  4YE1 A;  3P8C D;  5AW5 B;  5TIS V;  1IRV A;  1M7L A;  4IL6 H;  3D6Z A;  4UB6 E;  4KMG A;  3L70 G;  2GUV A;  1U74 B;  3RL0 B;  1GD2 E;  1IK7 A;  1ZLL A;  1J1E C;  2BEQ D;  3L71 G;  1N7S B;  3B5N C;  2PRR A;  1N73 A;  2FYU G;  1SFC B;  1OIP A;  1GL2 B;  3IR9 A;  3CWB E;  1AFO A;  4UB8 V;  2A45 G;  1IZL 0;  4PW9 B;  5H2F E;  1GDV A;  4HYT B;  4M3L A;  1N8R Q;  4H44 C;  2H89 C;  2ZON G;  3M91 A;  1NU1 G;  1N90 A;  2B9B A;  2D2C C;  1SS1 A;  1SLQ A;  3RBX A;  1UII A;  3SSU A;  1FOC A;  3WMM 0;  2GC7 D;  1KYO D;  1FOS E;  2H43 A;  1G1J A;  3VYI A;  3O1Y A;  1USE A;  1CRG A;  3L70 J;  1QL1 A;  1KIL D;  4EIC A;  3NXS A;  2VHD A;  2R5D A;  3A3Y B;  5B66 H;  1HJ3 A;  2Y9Z A;  3HD7 A;  3L71 J;  4Y99 C;  1KQL A;  2GUS A;  1NJI Q;  2AXT V;  1PPJ D;  1IFN A;  3MK7 B;  5CIE B;  4I2L C;  1X79 B;  4JYB A;  4XYD B;  1N73 C;  1NU1 J;  3H32 B;  4GOE A;  4D6T E;  3Q3D A;  1JEK A;  3PXT A;  4PWA A;  5GTI E;  5B5E H;  1KTM A;  1L9B C;  1BGY D;  1T3U A;  1J3S A;  4EIJ A;  2E74 B;  3VYM A;  1SQV J;  3WU2 H;  3B8E B;  2CE1 A;  1S5L E;  1DII C;  4U3F E;  2IBZ I;  1BE3 G;  4KJM A;  4L76 A;  4WY4 B;  3L75 E;  1CHJ A;  1NAY A;  1NOH A;  4BRY B;  2BPB B;  1EXI A;  1S9K E;  2V07 A;  3TNU A;  4DCK A;  1NO4 A;  1L0N J;  2YIU B;  1SQQ E;  3TYY A;  2A06 E;  5APV A;  3CCV P;  3L36 A;  1W5C T;  1NNO A;  2OZ1 A;  1USD A;  4PV1 D;  3SJL A;  4C7R A;  2B11 B;  3FGA D;  1OZH A;  1G2C A;  1QGK B;  5KAI H;  2J58 A;  1I8O A;  2XDJ A;  2N3Y A;  2MKV A;  4I6M C;  3DMI A;  1CCH A;  4PD4 H;  1U7J A;  1PP9 D;  3H1K D;  5TIS H;  4EYY Q;  1DVH A;  1SQB G;  2FKW B;  2IBZ G;  1T2K D;  1FE6 A;  3PXW A;  1H0T B;  3AEE C;  3BCC E;  1HH7 A;  1KZU B;  3RN0 A;  1LT9 B;  1LWU B;  1SQX G;  4IL6 X;  2M0B A;  1WRG A;  1A8C A;  1NTZ E;  4UB8 H;  3FWN A;  1ZOY C;  3P8C E;  2ZT9 C;  1RAP A;  1FS0 E;  3HD7 D;  4H0L D;  1IFJ A;  1Q90 D;  1HF9 A;  1J1E B;  2E76 D;  4OH8 B;  3RK3 D;  1IO3 A;  3H1L D;  3B5N B;  1CCR A;  1GDT A;  5AW3 B;  3I56 P;  2HOD B;  1RQU A;  1W2L A;  2RKL A;  1KB9 D;  4H44 B;  1DW0 A;  3KYQ A;  4L73 A;  4P4Q B;  2D2C B;  3BAS A;  2YK3 A;  3EFG A;  1NHL A;  4ZKU A;  2AXT H;  1HVV A;  1J1D C;  1KYO E;  1SQQ G;  2FYN C;  3ZCF A;  2VRS A;  1E29 A;  1PFI A;  3HTK A;  3OA7 A;  1L2P A;  2XNX A;  2SPZ A;  2LIR A;  2NZ2 A;  1WT6 A;  1KIL E;  1YTZ T;  1C7M A;  2E43 A;  4Y99 B;  3L4M A;  1LTI C;  4L3H A;  2PFX A;  2C9X B;  1NTM K;  4HJG H;  1MFZ A;  3PXS A;  1PPJ E;  1EC5 A;  3U59 A;  2I8F A;  1DT1 A;  1R8E A;  1N73 B;  3JBT B;  1B7V A;  1CC5 A;  4U3F J;  5BU8 B;  1JY2 N;  1GJQ A;  4LC1 A;  5C0Z A;  1RE3 C;  2WVR A;  1JDL A;  1G1I A;  3L75 J;  1FJP A;  1QYZ A;  1KC8 Q;  1FDM A;  3TSI A;  2D0W A;  2JP3 A;  2YKQ A;  1EDI A;  2IYP A;  1BGY E;  1U75 B;  1CSB A;  4NPD A;  4Y5R A;  1SQQ J;  3CX5 H;  1JOC A;  1JM0 A;  1SQP G;  4XXL A;  2FY8 A;  3AEB C;  2OYI A;  3UIA A;  4QMA A;  2IFM A;  1NTK G;  3H1I G;  1FJ0 A;  1NAF A;  3TDK A;  4RES B;  1OVR A;  3CX5 W;  4WBA A;  3VMA A;  4I7Z C;  1DX7 A;  2N9B A;  1HJ0 A;  3D6Y A;  3SWF A;  5KLV K;  3RLM A;  1P84 H;  1L4A D;  4ASW A;  2Q1K A;  1JUN A;  1ETP A;  5E79 V;  3M9Q A;  1LFM A;  3V2Q A;  3NFQ A;  3TK1 A;  1XTC C;  1CNO A;  351C A;  1HJ5 A;  3EWK A;  2XV5 A;  1C2N A;  1KB0 A;  3BAT A;  3IAO A;  2B10 B;  1W5C E;  2QE7 H;  3I5C A;  4NPF X;  3H1I J;  2JQR A;  3DR0 A;  1PP9 E;  1NTZ J;  3H1K E;  2QJK C;  1L0L D;  2OYI C;  2YCC A;  1AA0 A;  2N1T A;  4FA5 A;  3ZOW A;  3RK2 C;  1FJK A;  3P32 A;  3TNU B;  2FXO A;  3O8Z A;  1Y8A A;  3Q1M A;  2QIW A;  2IYO A;  5TJH A;  2JTI B;  1H33 B;  1AVO A;  2WSE J;  2ZT9 B;  4PJ0 V;  2C0X A;  2KUB A;  2OZ1 B;  1KFM A;  1JO5 A;  1JY3 P;  1G2C B;  1YNR A;  1EZV D;  1CIF A;  4FA9 A;  3HE4 A;  1DIP A;  1PIX A;  3RK3 E;  2Q3I A;  3H1L E;  2W90 A;  2Z5H A;  4TT3 H;  4C46 A;  2BCC G;  1NKN A;  2W27 A;  2FYU K;  5KKZ C;  1E2R A;  2KNC A;  1KB9 E;  2ZAE B;  3P7K A;  1VQ9 P;  4I1L A;  3SXT A;  5M1B A;  5DJT B;  4MN4 C;  1J1D B;  2N1T C;  1YEA A;  2FYN B;  3E1R A;  3AE1 C;  3G4S P;  2XTS B;  2L91 A;  3CLQ A;  3JCU E;  1LTA C;  1EDL A;  2PCC B;  1VQM P;  3MD0 A;  1BL9 A;  1LTG C;  1FZE A;  1QX8 A;  2K88 A;  1HTL C;  1I6E A;  3V2P A;  2J59 M;  1BSN A;  1HGV A;  4WVZ A;  2RH0 A;  2WTY A;  1FI7 A;  2BCC J;  2ZBO A;  3H1J D;  1CIH A;  1BGY J;  3DP5 A;  3WUT A;  3Q5R A;  2G3A A;  1YBK A;  2Y0D A;  4EID A;  1YYC A;  1GQ1 A;  1FU1 A;  3C8V A;  3VMX A;  1IFP A;  3RN1 A;  3H1H D;  2A45 H;  2P58 A;  1LC1 A;  2WT7 A;  1KIL A;  1LTS C;  2V4H A;  3WUV A;  3CC4 P;  1L0L K;  1LNQ A;  3VP8 A;  2H88 C;  5E79 H;  1VQK P;  1VPC A;  4MU8 A;  1IJD B;  1HBW A;  3C2C A;  2N1T D;  1FHB A;  1C75 A;  1FDI A;  4I7Z B;  2JDI H;  2KSJ A;  5AW2 B;  1U7M A;  2RMZ A;  4YTP C;  1EDK A;  4L74 A;  3GW6 A;  2Q6Q A;  1C6O A;  2BCN B;  3L74 D;  1A02 F;  2JKV A;  2WIT A;  1FAV A;  1I55 A;  1YHQ P;  2KP8 A;  1RF1 A;  1GTW A;  2K1A A;  1COR A;  2G8Y A;  4JQ0 D;  4WB4 A;  2FYZ A;  2J5U A;  3CCU P;  1PP9 J;  2QEX P;  3HUS A;  2WPV B;  1N50 A;  3HQ9 A;  4PD4 D;  5AVV B;  2P2U A;  4RKU J;  1KIL C;  3A0B H;  4WWI A;  1BCC G;  2QJK B;  3AE2 C;  4PJ0 H;  1BSH A;  5AW8 B;  2OYI B;  1SQB K;  1IRW A;  1Y9B A;  1L0L E;  4N0K A;  2UWJ E;  1AKK A;  2N9Y B;  3RK2 B;  2IZ0 A;  1URQ D;  3T97 A;  1QL4 A;  2NPS A;  5CIG B;  4WQ7 A;  1SQX K;  3F5H A;  4EOT A;  3L72 D;  1PGQ A;  4A7P A;  1YFC A;  4BWN A;  2M3E A;  1FC2 C;  4WQD A;  3H1L J;  3VOP A;  4IL6 E;  4GOD A;  3A9F A;  1HCM A;  5CBN A;  1RF1 C;  3SLE A;  2JWD A;  4AQR D;  3MUD A;  2Y0E A;  1EZV E;  3HUS C;  3A2A A;  2D0S A;  1H9Y A;  5KKZ B;  4GT1 A;  1VQL P;  3HE5 B;  2HFE D;  1BCC J;  3I55 P;  3G3Z A;  4EIF A;  1OXZ A;  1SQV G;  5APY A;  1C6S A;  2JO1 A;  2C8S A;  5BU5 A;  2BEZ F;  3CME P;  1LS9 A;  1M1K Q;  5AVW B;  5EFW B;  1HRC A;  2B89 A;  4PV1 C;  3SFE C;  1VQO P;  1OAE A;  1L0N G;  1M8O B;  1GU4 A;  1PGP A;  5B66 E;  2POH A;  4JPZ B;  1CSU A;  4GED B;  1LTB C;  2HYN A;  3O6Q B;  2Q7C A;  2OYH A;  4Q5P A;  2ZYA A;  4OGQ D;  3KZI V;  2Q9I A;  3WFC C;  1Z56 A;  3MUD C;  3H1J E;  1M70 A;  5CJ0 A;  1T2K C;  3BVH A;  2QA4 P;  1GW3 A;  3W67 A;  2LKM A;  1AJY A;  1J2J B;  5B5E E;  2B88 A;  4W80 A;  2W8Z A;  2LR2 A;  2HPC A;  4Y28 J;  1Q81 Q;  5AVX B;  2O01 N;  3H1H E;  1KQG B;  1DIQ C;  3CX5 D;  2ZJS E;  1PL5 A;  2YXQ B;  3WU2 E;  3VMZ A;  5CCH D;  1BDC A;  5APU A;  1EQ7 A;  1M90 Q;  4WQC A;  2XKM A;  2IFN A;  1SQP K;  3HD7 C;  1DD3 A;  1N7L A;  4H0L C;  4N78 D;  3NWV A;  1NTK K;  1C52 A;  2E76 C;  3RK3 C;  2NPS D;  1NTM D;  1P84 D;  4QAO A;  2QM8 A;  3CWB G;  3MIW A;  3Q5P A;  2OYH C;  1RHZ B;  1YJ9 P;  4N6J A;  3L74 E;  1H31 B;  2QVA A;  2XZR A;  2YKO A;  5KAI E;  3SFD C;  1OX3 A;  2OTJ P;  3V4Q A;  2QJY C;  1JY3 N;  1E8E A;  3HRN A;  2FRC A;  3CL3 D;  1ZRT D;  4PD4 E;  1D7M A;  1QL3 A;  1QKS A;  1HUC A;  2WZ7 A;  1KIL B;  5TIS E;  3SWS A;  2WSS H;  1H1O A;  4XFJ A;  1QN2 A;  3GF3 A;  3OCD B;  1I6D A;  451C A;  1ZV8 A;  1L4A A;  2BAS A;  2ZZS 1;  2RN0 A;  3CWB J;  1CYI A;  5KLV D;  1JY3 O;  1QL2 A;  3ZIY A;  1HWT C;  4D6T G;  4UB8 E;  2EXV A;  4WQB A;  1X0T A;  3L72 E;  1YIT P;  1JCD A;  3KHU A;  2LXB A;  2ZYG A;  1GZL A;  5BVZ A;  1RF1 B;  3SVW A;  3VTP C;  3IF4 A;  1YIJ P;  2HG5 D;  4AYC A;  3MGN A;  4H0K A;  1TU3 F;  2WSE H;  4U3F G;  2E75 D;  2ZFC A;  3HUS B;  3MHV A;  3L75 G;  1S4X A;  2FXM A;  4HH2 A;  1T8Z A;  5AW7 B;  4W7Y A;  1HJB A;  1I5T A;  1UIX A;  2A06 G;  2ORL A;  4W7Z A;  4KHX A;  2AXT E;  1FI9 A;  1CTY A;  3A0H V;  1NWQ A;  3L4F A;  1DW1 A;  1WVE C;  3AE3 C;  4D6T J;  3KZI H;  1L4A C;  3T97 B;  4PV1 B;  3CCL P;  3G6E P;  1CRC A;  1K9M Q;  4XA4 A;  2O01 J;  4H13 D;  2M3B A;  3PRJ A;  3H1J J;  3L70 D;  1M6Z A;  2KS1 A;  2LIT A;  3TGU D;  1AV1 A;  3S4R A;  1R0Q A;  3BRT B;  1CIG A;  3D0W A;  3L71 D;  3EFF K;  5APQ A;  2CK3 H;  3AEC C;  3AED C;  3HQ6 A;  2FYU D;  3V2N A;  3N7N A;  3CC7 P;  3BCC G;  1S5L X;  1KYO I;  2R5B A;  5APW A;  4ASV A;  3GG2 A;  2WWW A;  3CXH H;  4JF7 A;  3CCS P;  3VP9 A;  1RE4 A;  5CCG A;  4LGD E;  1W2E A;  1NTZ G;  2KOG A;  3M0D A;  3CX5 E;  2KZI A;  1H9X A;  1JY2 O;  3RBZ A;  1A2S A;  1PGJ A;  5APX A;  3HD7 B;  3CXH W;  4H0L B;  1LTT C;  2WSC J;  2E76 B;  3RK3 B;  5AVR B;  4N78 E;  2MTA C;  1VQ7 P;  1CRH A;  2JJL A;  2R3S A;  5AUR A;  3L4O A;  1A56 A;  1NTM E;  1P84 E;  2OYH B;  1CZQ A;  4EDF A;  3A7O A;  3BCC J;  1QVF O;  5AW4 B;  3W68 A;  4WQ8 A;  3OJA B;  2ZXX A;  1SFC A;  1GL2 A;  2OGU A;  2QJY B;  2AEF A;  5CIH B;  3L73 D;  2WPS A;  1EDJ A;  3MZW B;  1VQP P;  1CRY A;  1ZRT E;  1RE4 C;  1DH3 A;  1BE3 D;  2AEJ A;  1KQF B;  3L72 J;  1LT1 A;  4GYD A;  1RQV A;  3WC8 A;  1VL2 A;  3A0B V;  1COT A;  2WSF J;  3VRD A;  1PPJ G;  1GK6 A;  3O5C A;  4O9B A;  1ZXG A;  5KLV E;  1IC2 A;  4GOF A;  1T6A A;  3HQ7 A;  1KV4 A;  4H0J A;  5B6Q A;  1R5S A;  2XU6 A;  3R4Y A;  1BGY G;  2GB8 B;  1VF5 D;  3A0H H;  3S1K A;  3H6P A;  1FZA A;  3AE4 C;  1HZU A;  3M9H A;  2N3B A;  3AE9 C;  1NU1 K;  5KAF V;  5CYT R;  1JMB A;  1YCC A;  2O3J A;  1AYG A;  1FDO A;  1URQ A;  2KZJ A;  2W6B A;  1KX2 A;  4FAN A;  5H2F V;  1SQB D;  1KD1 Q;  2IBZ D;  4YXD C;  1NML A;  2PAC A;  3ZOX A;  4C7N A;  1GIW A;  1SQV K;  2K9J A;  5CCG D;  2C2C A;  4BRY A;  1MZ9 A;  1SQX D;  2FWL A;  2OTL P;  2Y9Y A;  1L4A B;  1RY3 A;  2H7H A;  3LW5 J;  4GIF A;  3VNW A;  5APT A;  3OA8 A;  1Q2N A;  3IFM A;  3V6I A;  1L0N K;  3PP5 A;  1GU5 A;  4JCG A;  2WPQ A;  3AE6 C;  5C39 A;  2OQQ A;  3FXD A;  3L70 E;  5AVS B;  3RL0 D;  3ZOY A;  2KI7 B;  3TGU E;  5CIC B;  2YMY A;  2IPP A;  1KB9 I;  1NGM B;  4YPC A;  4AX3 A;  3G9R A;  1N7S D;  3KXD A;  3L71 E;  1PP9 G;  1S2E A;  4R4M A;  3H1K G;  1SFC D;  5DFS A;  1GL2 D;  2FYU E;  1OVU A;  2QSI A;  1MZ4 A;  1URQ C;  3MTU E;  1SP4 A;  3GLM A;  3QWO C;  3AE8 C;  3PJS K;  3GF7 A;  3HTK B;  2N9J A;  2QRX A;  3PLN A;  3S9O A;  1ZZH A;  2Q5U A;  1LT9 A;  2GA1 A;  5AVT B;  1S5L V;  5E79 E;  2K37 A;  1NTM J;  2GM4 A;  4EIE A;  2V7Q J;  1FZB A;  3H25 A;  1NKZ B;  4U7J A;  1IK9 A;  3L35 A;  1YJN P;  3H1L G;  4AAN A;  2L4D A;  2KS1 B;  4O1Q A;  1YTZ I;  1LP1 A;  3WFD C;  3H1K J;  3FX0 A;  1ZME C;  2BLF B;  4FB1 A;  3U1A A;  1RZ6 A;  3SWK A;  4J20 A;  3CCM P;  3A5T A;  1RF0 A;  1F1C A;  2HOD A;  1DW3 A;  5APS A;  3NTN A;  2O1J A;  1YTC A;  5AW0 B;  5KLI C;  2Y0C A;  5CCH A;  2PCB B;  4BXL A;  1IFI A;  1VQ8 P;  1F1F A;  3L73 E;  1H32 A;  1CYJ A;  3FXE A;  1CTJ A;  2E74 D;  1FI3 A;  2DW3 A;  5DJQ C;  3A0B E;  1CI6 A;  3IN6 A;  1SQP D;  4PJ0 E;  1ZW0 A;  2KIK A;  5KLV J;  1PV3 A;  3VN0 A;  1NTK D;  1BE3 E;  4UB6 H;  4WY4 D;  2L5G B;  1LT9 C;  1CXA A;  1M60 A;  1K3H A;  5CBO A;  2M5A A;  4OGQ C;  3WFB C;  3E1I A;  1N86 A;  1DW2 A;  1YEB A;  5KAF H;  2AIU A;  2OYO A;  3TGU G;  5KJ7 A;  4K3I A;  1H8A A;  2LXC B;  2CPB A;  4AAO A;  3Q5S A;  1CRI A;  3JSV C;  5H2F H;  3G71 P;  2B0Z B;  1GKS A;  1M57 D;  2C1U A;  2MHM A;  5AW1 B;  5KAF E;  2R3C A;  4R4L A;  1R5L A;  4DJG A;  1RF0 C;  1OFC X;  1OW6 A;  3KPE A;  1GK4 A;  2HR3 A;  3WUI A;  1XTG B;  5CCH C;  3CCR P;  1VYD A;  2YKP A;  3KDP B;  3E7K A;  1N15 A;  3CMA P;  1YIQ A;  1KX7 A;  3WFE C;  4DOJ A;  1CIE A;  2N1T B;  3ZBM A;  1CXC A;  1QEX A;  1VQN P;  1SQB E;  2KLV A;  2GC4 D;  2NPS C;  2IBZ E;  2MJZ A;  2OTK E;  1SQQ K;  4WQA A;  2QG4 A;  2ZOO A;  3LIE A;  3TGU J;  1JMM A;  1SQX E;  1CO6 A;  2M8R A;  1JCC A;  1NMI A;  1M1J A;  3QH9 A;  3AE7 C; 
#chains in the Genus database with same CATH homology
 2CE0 A;  2CXB A;  2N18 C;  3OCD A;  1L0L D;  1DVV A;  3WU2 V;  2B4Z A;  2YCC A;  2CA4 B;  4FA5 A;  3ZOW A;  2ZXY A;  2C1V A;  1LC2 A;  1GU2 A;  3PH2 B;  2KNC B;  1KIB A;  2BGV X;  1I5T A;  3CP5 A;  1CRJ A;  2ORL A;  2BCC D;  1FI9 A;  1CTY A;  5TJH A;  3A0H V;  2JTI B;  1H33 B;  3RMZ A;  4FAV A;  1DW1 A;  2GIW A;  4PJ0 V;  1WVE C;  4L1Q A;  3CXH D;  1YIC A;  2OZ1 B;  2HV4 A;  5GTH V;  1CRC A;  1YNR A;  5CID B;  1EZV D;  1CIF A;  3BCC D;  4FA9 A;  2K9J B;  2CA3 B;  3PRJ A;  3L70 D;  5KAI V;  1M6Z A;  2KS1 A;  2LIT A;  3TGU D;  5CIB B;  5IY5 1;  1FCD C;  1R0Q A;  1CIG A;  3H1I D;  1E2R A;  3L71 D;  1L9J C;  1NTZ D;  3OA8 B;  2BH5 X;  2DVH A;  3HQ6 A;  1H33 A;  2FYU D;  4YE1 A;  3SXT A;  5TIS V;  1IRV A;  4KMG A;  1WEJ F;  2AI5 A;  1U74 B;  1YEA A;  2FYN B;  2XTS B;  3GG2 A;  2L91 A;  3PHL A;  2PCC B;  4AAL A;  2C1D A;  1BL9 A;  5KLI B;  1H9X A;  1CSW A;  3O0R C;  1A2S A;  3TF5 A;  1I6E A;  4UB8 V;  1IZL 0;  4PW9 B;  3ORV A;  1GDV A;  3CXH W;  3FWL A;  2ZON G;  1N90 A;  1FI7 A;  2ZBO A;  5DJQ B;  3H1J D;  1CIH A;  3DP5 A;  2MTA C;  1CRH A;  3X39 A;  1FOC A;  2Y0D A;  4EID A;  2GC7 D;  1KYO D;  5AUR A;  3L4O A;  1A56 A;  1GQ1 A;  4WQE A;  2Q3E A;  3RN1 A;  3H1H D;  4EDF A;  1LC1 A;  3O1Y A;  1CRG A;  3HQ8 A;  4WQ8 A;  4EIC A;  2VHD A;  1HJ3 A;  1MG3 D;  2QJY B;  1HJ4 A;  5CIH B;  3L73 D;  4FA4 A;  4MU8 A;  2AXT V;  1CRY A;  1PPJ D;  3C2C A;  3MK7 B;  5CIE B;  1FHB A;  1C75 A;  4XYD B;  1BE3 D;  1LMS A;  2RMZ A;  3GW6 A;  1C6O A;  2BCN B;  1AOQ A;  3L74 D;  3PXT A;  4PWA A;  4GYD A;  3WC8 A;  1H32 B;  1I55 A;  1I8P A;  1L9B C;  3A0B V;  1COT A;  1BGY D;  1J3S A;  1COR A;  3VRD A;  3O5C A;  4DY9 A;  3VYM A;  1BCC D;  2JWA A;  2CE1 A;  1DII C;  1KYO W;  1OCD A;  3CYT I;  1N50 A;  3HQ9 A;  4PD4 D;  3HQ7 A;  4H0J A;  5B6Q A;  1CHJ A;  2BPB B;  1CYC A;  2V07 A;  2GB8 B;  2YIU B;  2N18 B;  2QJK B;  1HZU A;  2N3B A;  2N9I A;  5KAF V;  1IRW A;  5CYT R;  1W5C T;  1YCC A;  2O3J A;  1AYG A;  4N0K A;  4AAM A;  1AKK A;  2N9Y B;  1NNO A;  2OZ1 A;  5CIF B;  1KX2 A;  1QL4 A;  3SJL A;  4FAN A;  1AOF A;  5H2F V;  5CIG B;  2B11 B;  1NU1 D;  1SQB D;  4WQ7 A;  1CTZ A;  2IBZ D;  1NML A;  2PAC A;  3ZOX A;  1I8O A;  3L72 D;  1GIW A;  4A7P A;  1YFC A;  3M97 X;  2N3Y A;  4WQD A;  2C2C A;  2V08 A;  3O20 A;  3A9F A;  1HCM A;  1SQX D;  2FWL A;  3DMI A;  5C9M A;  1HRO A;  1CCH A;  1CED A;  1SQV D;  3CU4 A;  3SLE A;  1EB7 A;  3VNW A;  1PP9 D;  3H1K D;  3OA8 A;  1I54 A;  1DVH A;  3PXW A;  4JCG A;  2Y0E A;  1N9C A;  3NBT A;  1HH7 A;  2D0S A;  1H9Y A;  5KKZ B;  3ZOY A;  1K3G A;  3RN0 A;  5CIC B;  2DGE A;  1L0N D;  4EIF A;  2B12 B;  1C6S A;  4AX3 A;  2YQB A;  1A8C A;  4V2K A;  2C8S A;  1LS9 A;  5DFS A;  1RAP A;  1CHH A;  1MZ4 A;  2QJP B;  1HRC A;  1OAE A;  1IO3 A;  3H1L D;  1CCR A;  3ITK A;  2N9J A;  3PLN A;  1ZZH A;  4RSZ A;  1CSU A;  1W2L A;  4GED B;  1S5L V;  1KB9 D;  3PTZ A;  3ZOO A;  4EIE A;  1DW0 A;  4Q5P A;  4P4Q B;  3KZI V;  4LJI A;  3WFC C;  2YK3 A;  4AAN A;  3NBS A;  2L4D A;  1M70 A;  4WQ9 A;  4O1Q A;  2BH4 X;  5EXQ A;  3WFD C;  1C2R A;  2BLF B;  4FB1 A;  1RZ6 A;  3ZCF A;  1E29 A;  4J20 A;  1DIQ C;  3CX5 D;  1F1C A;  1DW3 A;  4UB6 V;  2LIR A;  1YTC A;  3CWB D;  4NFG B;  1C7M A;  2Y0C A;  2PCB B;  3L4M A;  4WQC A;  1F1F A;  4L3H A;  4IL6 V;  1H32 A;  2C9X B;  1CYJ A;  3NWV A;  1CTJ A;  1RZ5 A;  3TYI A;  3PXS A;  1FI3 A;  1C52 A;  4FA1 A;  5DJQ C;  2I8F A;  1DT1 A;  1HZV A;  1SQP D;  2C1D B;  3JBT B;  1B7V A;  1CC5 A;  1MG2 D;  1NTM D;  1P84 D;  4QAO A;  1CHI A;  1NTK D;  1CSX A;  1GJQ A;  5C0Z A;  1JDL A;  1CXA A;  1QYZ A;  1M60 A;  1K3H A;  1C6R A;  2D0W A;  1H31 B;  3WFB C;  1DW2 A;  1U75 B;  1YEB A;  4Y5R A;  1KV9 A;  2AIU A;  4K3I A;  4XXL A;  4AAO A;  5DF5 A;  1E8E A;  1CRI A;  2FRC A;  1FJ0 A;  2B0Z B;  1ZRT D;  1GKS A;  1S6V B;  3TDK A;  1QL3 A;  2C1U A;  1QKS A;  2MHM A;  3MK7 C;  3CX5 W;  4L3G A;  4D6T D;  3VMA A;  3SWS A;  1H1O A;  3WUI A;  1NIR A;  1VYD A;  1QN2 A;  3RLM A;  1N15 A;  1H31 A;  5B66 V;  3OCD B;  1I6D A;  1IQC A;  451C A;  1ETP A;  1YIQ A;  1KX7 A;  2ZZS 1;  2RN0 A;  3WFE C;  5E79 V;  1CIE A;  1LFM A;  1CYI A;  3ZBM A;  5KLV D;  4U3F D;  1CXC A;  1CSV A;  3ZIY A;  5GTI V;  2GC4 D;  1CNO A;  2EXV A;  4WQB A;  3L75 D;  351C A;  1HJ5 A;  4O1W A;  4WQA A;  3KHU A;  2QG4 A;  4RJT A;  2ZOO A;  1C2N A;  1KB0 A;  155C A;  3SVW A;  2B10 B;  5B5E V;  1CO6 A;  1SQQ D;  1NMI A;  1RAQ A;  2A06 D;  2JQR A;  4H0K A;  3DR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...