3L75D

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 71
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l75D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l75D02
3A0HV 1LFMA 2C1DB 4WQEA 3SLEA 1L9JC 1S6VB 2FYUD 3L4MA 1H32A 2B12B 3TYIA 1HH7A 2BH5X 3CXHD 5IY51 2CE0A 2Y0DA 1COTA 1AOQA 2OZ1A 4KMGA 3CWBD 2DVHA 3ZCFA 1RZ6A 4K3IA 4EIEA 5DF5A 1L0ND 2GC7D 3OA8A 1C6SA 1ZRTD 1LC1A 1U74B 1SQPD 1H9XA 3DMIA 4AANA 5AURA 3A0BV 4MU8A 2CXBA 3PH2B 2AIUA 3ZIYA 4A7PA 2KS1A 5H2FV 5DJQB 3HQ7A 2PCCB 1I55A 1EB7A 5CYTR 4LJIA 1CRIA 1N9CA 1DVHA 1GQ1A 2A06D 1YICA 2GB8B 5TISV 5CIDB 1DIQC 3OCDA 1QN2A 3PXWA 3CP5A 1KYOD 3MK7C 3O0RC 2V08A 5KLIB 1GIWA 4WQ9A 1CIEA 3H1ID 1ETPA 1CRCA 1DW1A 3VNWA 1H33B 5CIFB 5EXQA 1NU1D 5CIGB 3NBSA 1KB0A 2KNCB 4FA9A 4WQCA 5GTIV 4XYDB 3WFEC 3L75D 5GTHV 1CTYA 351CA 3CXHW 1DT1A 1C6OA 4H0JA 3HQ6A 3SWSA 2JTIB 5DJQC 1FHBA 2BLFB 4JCGA 4WQ8A 1W2LA 5CIHB 2Q3EA 2D0WA 3PLNA 1WEJF 1RAPA 1GJQA 2PACA 1CSXA 2FYNB 3M97X 3PXTA 1GKSA 2LIRA 4H0KA 2YCCA 1E2RA 1IQCA 1FOCA 4EDFA 2YIUB 3WC8A 2VHDA 2GIWA 1I5TA 1U75B 4NFGB 1KYOW 2N3YA 3PHLA 4PWAA 4AAOA 2B0ZB 3ZOOA 1BE3D 1BGYD 3HQ8A 3PXSA 3GW6A 2ZXYA 3RLMA 1HCMA 3OA8B 3H1LD 2AXTV 2O3JA 5CICB 4RSZA 4XXLA 3WUIA 2AI5A 2N9IA 4GEDB 3ZOWA 3TDKA 2YK3A 2FWLA 2RMZA 2ZOOA 3O1YA 1P84D 2B10B 1LMSA 2C1VA 1C7MA 1NMLA 1FCDC 2N18C 4AAMA 3KHUA 2QJPB 3JBTB 1HZUA 5C9MA 3KZIV 3A9FA 4FA1A 2Y0CA 4Q5PA 3OCDB 4RJTA 4WQ7A 4WQAA 2CE1A 1CORA 3H1JD 1CCHA 3ZOXA 3HQ9A 4YE1A 1LC2A 1F1FA 1N90A 1MG3D 5CIEB 3SJLA 1CRHA 2DGEA 2HV4A 2QG4A 4IL6V 4D6TD 3FWLA 1CRJA 1OAEA 3CU4A 1DVVA 1EZVD 4L1QA 1CSVA 1YEBA 5TJHA 1HJ5A 4GYDA 1KIBA 3L4OA 1KV9A 1CTJA 4AX3A 1CIHA 3VMAA 1BCCD 2B4ZA 4FAVA 2K9JB 1HJ4A 4PJ0V 1FI7A 1NTMD 2CA4B 1SQBD 3H1KD 4P4QB 1CYJA 5CIBB 4QAOA 3CX5D 3RMZA 1CRGA 1NMIA 3L72D 2ZZS1 3VYMA 4PD4D 5KKZB 1K3HA 1WVEC 3WFBC 3PTZA 3SXTA 1YCCA 4U3FD 2N18B 4L3GA 4EIDA 3ORVA 3ITKA 4EIFA 1RZ5A 2C8SA 451CA 1E8EA 2ZBOA 3L71D 2C1DA 4O1QA 1CIFA 1SQXD 1N15A 3X39A 2L4DA 4UB8V 1CRYA 4WQDA 2B11B 2XTSB 1QL3A 1SQVD 1H31A 1KB9D 3CYTI 2OZ1B 1M6ZA 1BL9A 1AKKA 1H33A 1CTZA 3L73D 1ZZHA 1LS9A 5KLVD 1MG2D 3WFDC 2D0SA 2JWAA 1OCDA 1FI9A 1H9YA 1L0LD 1H32B 2BCNB 2L91A 2C1UA 1MZ4A 1QL4A 4FANA 2MHMA 1CXCA 1H1OA 2Y0EA 1GU2A 3WFCC 3RN1A 1YEAA 1YFCA 1HZVA 4EICA 1AOFA 3DR0A 1S5LV 3TF5A 4N0KA 2N9YB 1NNOA 1I6EA 4L3HA 1W5CT 1C2RA 3DP5A 2MTAC 1YNRA 1CIGA 1DIIC 1RAQA 2RN0A 3H1HD 3L70D 1CHJA 1HRCA 1PP9D 2BPBB 2ZONG 2CA3B 4AALA 2QJYB 5B6QA 1J3SA 1C2NA 1CYIA 2N3BA 1JDLA 2BGVX 1CSWA 3TGUD 5E79V 1CXAA 2QJKB 1VYDA 4WQBA 3NWVA 1IRWA 1NTKD 1YIQA 1SQQD 2C9XB 3SVWA 1H31B 5B5EV 2EXVA 1NTZD 1DW3A 3RN0A 2GC4D 3GG2A 1DW2A 4UB6V 3ZOYA 1F1CA 1M60A 5KAIV 3WU2V 2C2CA 1KX2A 1QYZA 1A2SA 2JQRA 1CCRA 1N50A 4DY9A 3O20A 2BCCD 2LITA 4Y5RA 3O5CA 1KX7A 1B7VA 4O1WA 3ZBMA 2BH4X 1A56A 3BCCD 5DFSA 5C0ZA 1I8PA 1AYGA 4FA4A 4J20A 4PW9B 1YTCA 1HROA 1CHHA 5KAFV 1I54A 1L9BC 3L74D 2I8FA 4FA5A 1GDVA 3CX5W 1CHIA 1CYCA 1C75A 1FJ0A 1IRVA 1CC5A 1A8CA 1IZL0 3VRDA 1I8OA 1IO3A 155CA 2V07A 1NIRA 1FI3A 1E29A 5B66V 1PPJD 2PCBB 1K3GA 3PRJA 1CSUA 1QKSA 1C52A 4V2KA 1HJ3A 1DW0A 3C2CA 3NBTA 1M70A 1CNOA 1CEDA 2FRCA 1I6DA 2YQBA 4FB1A 1C6RA 3MK7B 2IBZD 1CO6A 2N9JA 2ORLA 1R0QA
chains in the Genus database with same CATH superfamily
4DCKA 1JUNA 1LFMA 2C1DB 4WQEA 2E42A 1HF9A 3VP9A 3CXHI 1HGVA 1IK7A 1NH4A 2FY8A 2B12B 3H1LG 1LTJA 1HH7A 2N9BA 2BH5X 1AQ5A 2Y0DA 2Z5HA 3CWBD 4K3IA 3N7NA 1NU1E 3H1HG 3L70G 1ZRTE 1EXIA 2PAJA 3SFDC 5KLVJ 4XE5B 1H9XA 1HJBA 3AE5C 3BCCE 5AURA 4EOTA 1AVYA 2CXBA 3RL0D 2AIUA 1S9KE 5APTA 1URQD 1G2CB 2UWJE 4D6TE 2Q7CA 2ZT9C 2ITAA 1NTKG 1NKNA 2XNXA 1VQMP 1EB7A 4PD4I 1FDMA 1PGJA 1N9CA 1DVHA 2A06D 2GB8B 1SQXE 4CPGA 1L0LJ 5DJTB 3B71A 2WPVB 2N1TB 2GUVA 3OCDA 2B89A 2L5GB 3EQ2A 1BE3G 5KLVE 3MP7B 1M7LA 1OW7A 1KZUB 1NTKE 2YMKA 1EXJA 3I5CA 1SQBJ 2V08A 3D6ZA 3H1ID 1ETPA 1CRCA 1SVFA 2HODB 4MN4C 3BCCG 1BE3J 2FFDB 5AVSB 1FOSE 1OX3A 2GM4A 1L0NE 5GTHV 2C0XA 351CA 3CXHW 2YO2A 1KQSO 2HR3A 2Q3EA 2D0WA 1ZP0C 3EFGA 3HD7C 3ABVC 1IC2A 3H1JJ 1LJ2A 3M97X 1JMMA 4R4MA 3PXTA 1GKSA 3C1LA 3RL0C 1AJYA 3D6YA 2Y9YA 3CCQP 2G8YA 1QX8A 1YTZT 1GU4A 3WC8A 2VHDA 3WMM0 1SQVJ 2IPPA 3AECC 5CCGA 2GUSA 1FC2C 3L72E 1S72P 1EZVG 1Q7YQ 2JKVA 2B0ZB 3B5ND 2WMMA 1RH5B 1PL5A 1J1EC 1YQ3C 2V7QH 2M3EA 4Y99B 1LTJC 4L74A 3OA8B 3H1LD 2O3JA 2OYHA 4RSZA 5AW5B 1P84H 2WSCJ 3TDKA 1H8AA 2FWLA 2RMZA 2V7QJ 1NHLA 5KAFE 3O1YA 3Q5PA 2B10B 3L75E 1J1DC 1C7MA 2C1VA 2M3BA 3HE5A 4M3LA 4Y99C 2C0WA 1FCDC 2ZYGA 2QA4P 4PD4E 3KHUA 3MGNA 1S4XA 3A9FA 1N2DC 1T6AA 3OCDB 3CWBE 1M57D 2CE1A 3H1JD 1CCHA 1WRGA 2YKOA 2BEQD 1QEXA 3IR9A 4U3FE 4D6TD 3Q1MA 3RGUA 3CU4A 1PPJE 1CSVA 3JCUH 1T3JA 1YEBA 3PJSK 5TJHA 3B5NB 1HJ5A 1KFNA 3L4OA 4IL6E 4AX3A 5KJ7D 4FAVA 1HJ4A 1BCCE 1J2JB 1FI7A 3U1AA 1SFCB 5CJ0A 4QAOA 3HTKB 3L72D 5KKZB 1W2BO 3FWNA 1CW5A 3WFBC 1N86A 1VQLP 4U3FD 1PP9G 2N18B 3AEBC 1N73A 4Y28J 3A3YB 4GOFA 4EIFA 1NVOA 1RZ5A 4JQ0D 1LT9B 2OTJP 2C1DA 1H88A 1X0TA 2KOGA 3B8EB 3AE1C 2PRRA 1EDIA 2K37A 1QL3A 1MKMA 4I7ZC 2ZT9B 2D2CB 1H33A 3ZDMA 1Y47A 3L73D 1LS9A 2IBZG 2D0SA 2WSCH 2O1JA 2ZVNB 1OCDA 3FXEA 1PGPA 1H9YA 1KORA 4PD4H 1L0LD 1EZVE 1H32B 2L91A 2C1UA 1MZ4A 3H1LJ 1QVGO 3E1IA 4C7NB 2MHMA 1CXCA 4RO0A 2C9NY 1H1OA 3V5BA 4ASVA 4ZKUA 4C7RA 1YEAA 1YFCA 4EI2A 4K35A 3L73J 3TYYA 4N0KA 1JTHA 1SQBG 4H44B 1RE3A 3RK3E 4L3HA 1JTHB 4KT0J 2P67A 3DP5A 2HG5D 2B87A 1MFTA 3CWBJ 3VMYA 1K73Q 1VQ5P 1RF0C 1NO4A 1R5SA 1L0NG 1PGQA 2KB7P 2XZRA 4AALA 4L76A 1DX7A 4C7NA 1J3SA 2FBWC 1CYIA 1VQNP 1JY3P 1JDLA 3L71G 3TGUD 2WVRA 1XTGB 3L35A 4OGQD 3AE9C 2QJKB 4L75A 4WQBA 1M1JB 1SQPJ 3NWVA 1JMBA 3L75J 5KLIC 1YIQA 3BATA 1SQQD 2ZT9D 3D70A 1NJIQ 1A02J 2A06G 5TISE 1NTZD 1BE3E 5KLVG 1KILC 1Q2NA 4UB6V 4PV1D 1NTMK 5KAIV 2B88A 3U1CA 2KSEA 1VPCA 2LITA 3O5CA 1IFNA 3MIWA 1B7VA 4O1WA 1ZOYC 4UB6E 1A56A 3HD7B 2WT7A 2IZ0A 1AA0A 5AW1B 5H2FH 1YTCA 1FZEA 1HROA 4ZNCA 1I54A 1L9BC 2I8FA 4FA5A 1FJ0A 3P8CE 3H1HE 1JCCA 1I8OA 4YXDC 3AEGC 1IO3A 2K9YA 4DZOA 2V07A 4GT1A 3IF4A 1K3GA 3OJAB 3OA7A 3TK1A 5C39A 1CSBA 1QKSA 5APVA 1QLED 2QJPC 3JSVC 2NRGA 2ZYDA 3NBTA 2KUBA 2YQBA 2HLOA 2OYIB 5TISH 1VQ9P 1JB0J 1TU3F 3HUSC 2N9JA 1NOHA 2NPSB 1URQC 4YTPC 1VQ6P 1P84E 3M9BA 2QJYC 2ZJSE 5L8RJ 1M90Q 1LTBC 4I6MC 2C9LY 4PV1B 3TGUE 1KILD 1XTCC 1OVVA 3H1IG 4WY4D 3VMZA 3LIDA 2WQYC 3L71J 2E74D 2CE0A 1RF0A 1OIPA 1AQTA 1LWUA 1AOQA 1GK6A 3IAOA 1NTZJ 1RZ6A 4R4LA 1KV4A 2WSFH 1FU1A 3MD0A 1L0ND 3OA8A 1C6SA 2LR2A 2R32A 3DMIA 3R2PA 4A7PA 2KS1A 3TGUG 5H2FV 1L4AD 2AXCA 4BRYB 2OQQA 2YKPA 1S5LE 3CCUP 1SQXK 2PCCB 1I55A 4PJ0E 1AFOA 2R5DA 1YICA 3A2AA 1SQVK 3F5HA 4U3FJ 1HTLC 5APWA 3AEEC 3CP5A 1QVFO 1GU5A 1VL2A 1KYOD 2KZJA 1OMIA 3GHGB 4WQ9A 1CIEA 1WT6A 2I1JA 2R44A 2QEXP 1RE3C 1DW1A 1BCCG 3VNWA 1H33B 1RQVA 5EXQA 2Q1KA 1NU1D 4JBZA 3NBSA 1KFMA 2YIUC 2R3SA 2XU6A 5GTIV 3L75D 1C6OA 4H0JA 3HQ6A 4U3FG 2JTIB 4HJGH 3CMAP 2BLFB 4WQ8A 3GLMA 1KYOE 4ASWA 4IFFA 1WEJF 1GJQA 2PACA 2IYOA 4GOEA 1L4AB 1BGYJ 2JDIH 1SQQK 3L70E 1NAFA 1IQCA 3HTKA 1SFCA 1OFCX 1NTZK 1SQVG 2OGUA 2FYUK 2IBZI 2Z5IA 2GIWA 4IFMA 1I5TA 1U75B 4RKUJ 4AAOA 4LLHA 2OYIC 1S5LH 2BASA 1BE3D 3HQ8A 5KLVK 3G9RA 2FXMA 2M0BA 1DH3A 1BSHA 2XDJA 3C9IA 3RBXA 1FZCB 5AW6B 5B5EH 1VQPP 2YK3A 1QL2A 3T97A 2A45G 3LW5J 3CX5H 1KB9H 3EFFK 1IFDA 2QJPB 4N6JA 4W80A 1HZUA 1J1EB 1K05A 3MUDC 5C9MA 4FA1A 3NFQA 2OYHC 2J59M 2QM7A 4RJTA 1DEEG 1CORA 3HE5B 2E5TA 3G71P 2WSEH 2A45H 1KC8Q 1S3JA 1SFCD 2LKMA 3L72J 2OYHB 1Y8AA 4IL6V 3FWLA 2QE7H 3HE4A 4K3AA 1FZAA 1CI6B 1PP9J 3CCEP 2AXTH 4GYDA 5KAIH 1ZMEC 5BU8B 1VDFA 5KJ7C 4H0LD 3BASA 3VMAA 1BCCD 1LWUC 2B4ZA 2RKLA 3PP5A 1PP9E 4PJ0V 3AE6C 3AEAC 2CA4B 3V6IA 3RMZA 2D2CD 1RE4C 1M8OB 1S9KD 4IFDK 2WPSA 1WVEC 2WITA 2WTYA 3PTZA 1GMJA 4NPEA 3VOPA 2E76B 3TNUB 5H2FE 3A0HE 4EIDA 3ITKA 451CA 1MZ9A 2XV5A 2ZBOA 4O1QA 3BVHA 1SQXD 3R4YA 4UB8V 1CRYA 1IJDB 1PPJG 4WQDA 1SLQA 2B11B 2XTSB 2OYIA 1VF5D 2FFDA 2IYPA 2PFXA 3GMAA 1CTZA 2FYUJ 3WFDC 3KQGA 1L0LE 1PV3A 1PFIA 1OVUA 2BCNB 2W8ZA 3EWKA 3MHVA 1E5WA 2JEEA 2ZYAA 2WPQA 1HZVA 4EICA 1N7SB 3P8MC 1W5CE 3L4FA 2J58A 5GTIE 3TF5A 2MKVA 3RK3D 1JCDA 3V2PA 1VQ4P 4W7YA 1ZR2A 1HBWA 2FXOA 1W5CT 1C2RA 2E75C 3H1HJ 3A7OA 2MTAC 2D2CC 2RN0A 4WY4A 1HRCA 2I8DA 4WBAA 2BPBB 3FXDA 1FDOA 1KILA 1SQQJ 5KAIE 3V2RA 3KZIE 5B6QA 4N78D 1YI2P 1H0TB 1SP4A 1R5LA 2P10A 4NPDA 1VYDA 4TLFA 2W27A 1IRWA 2JWDA 4JYCA 2QSIA 2C9XB 2WT7B 3AE2C 2EXVA 1GL2D 2O01J 3RN0A 1JY2P 5AVZB 2AXTE 3CLQA 3GG2A 3P7KA 4XA4A 5AW3B 4OH8B 2FYUG 2Q9IA 4AUWA 2C2CA 1KX2A 1QYZA 1A2SA 1YHQP 1UIXA 1GL2A 1MUUA 1NTKJ 4OGQB 4DY9A 1SS1A 4N3YB 4HH2A 3VYIA 3V4QA 1KX7A 1KB9I 5EFWB 1SQVE 3ZBMA 3BCCD 5DFSA 1I8PA 2OTKE 3FX0A 1QL1A 4FA4A 3O6QB 1N7SC 2P2UA 3L74D 3CX5W 1CYCA 5CCHA 2W6AA 3VRDA 3USSA 3VMXA 1JM0A 1URQB 2KIKA 2QVAA 1BDDA 2PCBB 1U7MA 1CSUA 4TT3H 2B87B 1HWTC 5AVYB 2K88A 1G1IA 1PIXA 1C52A 1DW0A 4ZKPA 2QM8A 1CEDA 3KPEA 2ZFCA 1C6RA 3MK7B 1YTZI 5AW9B 2IBZD 1CO6A 1YBKA 1DEBA 2LXBA 2ORLA 1R0QA 3B4SA 5AVTB 3A0HV 1ZXGA 1GL2B 1K04A 4D6TJ 2H7HA 2M5AA 1FZBA 5KJ7A 3F89A 3SLEA 1FZFA 4WWIA 5AVQB 2WWWA 1GTWA 5AVXB 4OWFA 3H1KE 1BGYG 1USDA 3L4MA 1H32A 2HPCB 2IX7C 1NU1G 1YJ9P 3CXHD 3TSIA 1COTA 2CK3H 1GD2E 1SQBK 3ZCFA 5CJ4A 2YNYA 1IZNB 2GA1A 1KILB 1SQPD 1NTKK 4AANA 3A0BV 1LT9A 3ZIYA 4DT0A 2YMYA 1ZV8A 1BCCJ 2SPZA 4WY4B 2ZVOB 5DJQB 1USEA 2E74B 3BRTB 3NMDA 3L37A 4PJ0H 1NGMB 1GQ1A 3RK2D 1NTZG 2AEMA 2YO3A 5TISV 1HUCA 1EQ7A 1DIQC 4KJMA 1QN2A 1FZCC 4U7JA 2PGDA 1JY3N 1DD3A 2HFED 1IFJA 3O0RC 4GIFA 1LNQA 5KLIB 1GIWA 3W68A 1D7MA 1QGKB 2R3CA 3M9QA 3WUTA 5CCHC 3PH0A 1OXZA 3CL3D 2G3AA 2PP6A 1KB0A 2KNCB 4WQCA 3LIEA 3II6A 3AE8C 4RESB 3C8VA 3K5BA 3MZWB 2E75D 3KDPB 3A0BH 1DT1A 4W7ZA 3SWSA 2JO1A 4JCGA 2WSFJ 3TNUA 1LTAC 1OVRA 3LW5H 3PLNA 1JEKA 4H44C 1RAPA 3CXHE 1CSXA 2FYNB 3L74E 3V2QA 1FOCA 1X22A 4EDFA 1YQ4C 2YIUB 1K9MQ 3PHLA 2Z4EA 2N1TD 4HYTB 3Q3DA 3RK2C 3GHGC 3IFMA 5APYA 1H89A 1X79B 3PXSA 5KTBA 2V4HA 4LGDE 3RLMA 2A06E 2AXTV 5CICB 1L0LK 3O8ZA 3UIAA 4GEDB 3H1JE 3ZOWA 3OAKA 2ZOOA 4B86A 3L73E 3V4WA 1LMSA 1NMLA 1U57A 3WU2H 2HYNA 2N18C 2E75B 4AAMA 3JBTB 1SQPG 3I55P 3W67A 2YXQB 3KZIV 2FKWB 2W6BA 4Q5PA 4WQ7A 1VF5C 2O01N 1FS0E 2IFMA 1ZN5A 2O01H 1SQBE 1YYCA 2FYUE 3HQ9A 4BXLA 1RE4A 1F1FA 1N90A 2KNCA 3E7KA 1MG3D 4I1LA 5CIEB 2FYNC 5CMZA 5CCGC 1CRHA 2DGEA 1FZCA 2HV4A 1ZR4A 1LP1A 1G2CA 3GF7A 3SFEC 3CXHH 1DVVA 4L1QA 1YJWP 4UB8E 1KV9A 1CTJA 4PV1C 1NWQA 2IBZE 1S2EA 2K9JB 3SWFA 1NTMD 3CCRP 1Q81Q 1SQBD 3H1KD 4P4QB 1CYJA 5CIBB 5E79E 3HUSB 2DW3A 1CRGA 1NMIA 1E79H 1LTJB 2E76C 1HGZA 3HD7A 1JO5A 2HPCA 1L4AA 4GODA 1SQPK 2H8PD 2H88C 2YXRB 1IFPA 3A0HH 4L3GA 2XKMA 1LGHB 3ORVA 2C8SA 1J1DB 1E8EA 3S1KA 3L71D 3JC22 1CIFA 2R5BA 1DIPA 2L4DA 3Q5RA 1KILE 3H1JG 3WU2E 2Q6QA 4AQRD 2VRSA 1KB9D 5AVRB 2Q5UA 1SQQG 1BL9A 1AKKA 1ZZHA 1AVOA 1MG2D 5CBOA 4WY4C 3GHGA 1FI9A 2J5UA 2WZ7A 1BSNA 1URQA 1KYOH 1MFZA 1QL4A 2AEJA 2IZ1A 5GTHH 3P8CD 1T3UA 2Y0EA 3RN1A 3CCMP 2BCCE 2I1KA 3AEDC 1VF5B 1S5LV 4QMAA 3CI9A 2ZXEB 3M06A 4DOJA 3BRVB 1KQGB 5AW4B 5B66E 1SQQE 3CWBG 1YNRA 4BRYA 1M1JC 1DIIC 3L70D 2ZONG 1WMKA 3KZIH 5E79H 1C2NA 1CSWA 1N7SD 1KQFB 1CXAA 2KLVA 1L0NK 1LTIC 2FXPA 2RH0A 2WPRA 1N8RQ 3SVWA 3L70J 5CBNA 5AW8B 3H32B 1DW3A 3A5TA 4UB8H 2NZ2A 2N1TC 5APUA 1DW2A 1RF1B 1F1CA 3WU2V 1N73B 3GF3A 3O20A 2JR8A 2BH4X 2H89C 1JY2N 4H44D 1IK9A 4J20A 5APQA 5KAFV 3L74J 3NXSA 3CC7P 4ZMDA 1N73C 1GDVA 3D71A 1GZLA 1Z56A 1IRVA 1CC5A 1IFIA 3IN6A 1A8CA 1IZL0 1EDLA 1H0TA 4YXWH 155CA 3G3ZA 3WUUA 3CMEP 1NIRA 3D0WA 1FI3A 2BCCJ 3PRJA 3Q2YA 3CCJP 1IFMA 4V2KA 2K3RA 1HJ3A 3MTUE 1BGYE 4FB1A 3L73G 2E5YA 2JJLA 2XNDH 3SSUA 5AVWB 3RBZA 4LC1A 1A02F 2JP3A 3H6PA 3WUVA 1JNMA 3BCCJ 1L9JC 1G1JA 5CHXA 2P58A 1S6VB 2FYUD 1T2KC 3B5NC 3H32A 4H0LC 3RK3C 2E74C 2KP8A 3TYIA 4HKZH 2BCCG 4YPCA 5IY51 2KZIA 2Q3IA 1M1JA 2OZ1A 1GW3A 4C46A 4KMGA 2DVHA 1FBMA 4EIEA 5DF5A 2KSJA 3L74G 1JY3O 2GC7D 1ZRTD 1FJKA 1IO4A 1LC1A 1U74B 1KN7A 4MU8A 3PH2B 3MUDA 1SQXJ 4EIJA 3HQ7A 2E43A 3CX5I 1T8ZA 4DJGA 1LTSC 5CYTR 2K1AA 4LJIA 1CRIA 1YIJP 2QJKC 3CPWO 1FZGA 2IFNA 5B5EE 2NPSD 3L71E 5CIDB 1BDCA 3PXWA 1NYHA 3H1KJ 3CX5E 3L36A 1EZVI 3MK7C 1Q90D 5AW7B 3HE4B 3AE4C 5BVZA 1EDKA 4JF7A 1T2KD 5CIFB 3Q5SA 3N4XA 3S9OA 5CIGB 2QIWA 1RQUA 4FA9A 3L72G 2OYOA 1PZQA 3AE7C 4XYDB 3WFEC 1CTYA 2WSEJ 2HODA 2KLUA 5DJQC 1FHBA 1OWAA 3G4SP 5CIHB 1W2LA 3E1RA 3M0DA 5AW0B 1L2PA 1K8AQ 2N1TA 4L73A 3V2NA 2LIRA 4H0KA 2YCCA 3I56P 1E2RA 3HUSA 4WB4A 2KK7A 3T97B 1KMIZ 1EC5A 2K9JA 1HVVA 2P7JA 4NFGB 3OW2O 1KYOW 2N3YA 4PWAA 1KYOI 1LT9C 1HJ0A 1L0LG 3ZOOA 3B5NA 3CD6P 1BGYD 4BWNA 4H0LB 3CCSP 3CCVP 3GW6A 5CCGD 2ZXYA 1HCMA 1LP1B 4XXLA 3WUIA 2AI5A 2N9IA 1U7JA 1VQ7P 5DJUB 1N7LA 2H43A 2OTLP 1P84D 1RHZB 3VN0A 3CCLP 1Q82Q 1ZLLA 1LT1A 3P32A 1M1KQ 1OW8A 1LTGC 3KXDA 1Y9BA 2Y0CA 2IDBA 4WQAA 2M8RA 2M5AB 1MV8A 3ZOXA 2CPSA 1JOCA 4YE1A 3VP8A 1LC2A 1CZQA 4JYBA 3SJLA 3TGUJ 2QG4A 2KS1B 1CRJA 1OAEA 1PGOA 1EZVD 4OVNF 3JCUE 4UB6H 2W6JH 1FJPA 3M91A 1KIBA 4I7ZB 3H1LE 4N78E 1CIHA 3HRNA 1KQLA 1FDIA 1RF1C 4JPZB 2Y9ZA 1LWUB 4AYCA 2AEFA 3CX5D 4EYYQ 2A45I 1DD4A 2ZZS1 3VYMA 1UIIA 4PD4D 1K3HA 3AEFC 2W83C 3SXTA 1NU1J 1YCCA 5KKZC 5GTHE 3U59A 1OW6A 1SFCC 2YKQA 1M56D 2KYVA 3FGAD 4KHXA 2QRXA 1N15A 3X39A 3KYQA 2POHA 5AW2B 1RY3A 1FE6A 2NPSA 1KB9E 5APSA 1SQVD 1H31A 3CYTI 2OZ1B 1KTMA 4NPFX 1M6ZA 5KLVD 1X9VA 2JWAA 4IOIH 3QWOC 4O9BA 4XFJA 1ZW0A 4IL6X 3M9HA 4GDOA 2BEZF 4I2LC 2ZAEB 3M0AA 4FANA 1NTME 3H1IJ 5KAFH 3A0BE 1GU2A 3WFCC 1GDTA 5K5GB 1NU1K 1SQPE 1GL2C 5AVVB 1AOFA 3DR0A 5CCHD 1P84I 2N9YB 3VTPC 1GK4A 3NTNA 3H1KG 1NNOA 1I6EA 5B66H 3S4RA 4HB1A 1CIGA 1S1CX 1RAQA 2OARA 1N7SA 2O1KA 1NAYA 3H1HD 1CHJA 3M0DC 2E76D 1PP9D 4H13C 2CA3B 4WVZA 4Z1MH 1LTTC 2QJYB 2LXCB 2B9BA 1OZHA 2N3BA 4H13B 2BGVX 1S5LX 2NPSC 5E79V 1SQXG 3CC4P 1GW4A 1NKZB 1L4AC 1NTKD 2W90A 1NTMJ 3RL0g 1KD1Q 1H31B 5B5EV 4D6TG 1FOSF 1Q86Q 5BU5A 2KI7B 2GC4D 3ZOYA 3SWYA 1W2EA 1M60A 3G6EP 3SWKA 1EDJA 2JQRA 1CCRA 1N50A 1RF1A 5GTIH 1YJNP 1VQ8P 2MJZA 2BCCD 4Y5RA 1NTMG 1AV1A 5C0ZA 5APXA 1AYGA 3H25A 3RK3B 1JY2O 5AVUB 3AE3C 2WSSH 4PW9B 4IL6H 2P1JA 1VQOP 1CHHA 4OGQC 1CHIA 1R8EA 1C75A 3L75G 2FYZA 5M1BA 2FFDC 2CPBA 2ZXXA 1FAVA 3QH9A 3RL0B 1E29A 4H13D 5B66V 1PPJD 1CI6A 1YITP 3O6QA 1L0NJ 3HD7D 3C2CA 3H1IE 1I6DA 1M70A 1CNOA 2FRCA 3RK2B 1NTZE 4GKGA 1HH0A 2KXPB 1X8YA 1VQKP 3CC2P
chains in the Genus database with same CATH topology
3A0HV 1LFMA 2C1DB 4WQEA 3SLEA 1L9JC 1S6VB 2FYUD 3L4MA 1H32A 2B12B 3TYIA 1HH7A 2BH5X 3CXHD 5IY51 2CE0A 2Y0DA 1COTA 1AOQA 2OZ1A 4KMGA 3CWBD 2DVHA 3ZCFA 1RZ6A 4K3IA 4EIEA 5DF5A 1L0ND 2GC7D 3OA8A 1C6SA 1ZRTD 1LC1A 1U74B 1SQPD 1H9XA 3DMIA 4AANA 5AURA 3A0BV 4MU8A 2CXBA 3PH2B 2AIUA 3ZIYA 4A7PA 2KS1A 5H2FV 5DJQB 3HQ7A 2PCCB 1I55A 1EB7A 5CYTR 4LJIA 1CRIA 1N9CA 1DVHA 1GQ1A 2A06D 1YICA 2GB8B 5TISV 5CIDB 1DIQC 3OCDA 1QN2A 3PXWA 3CP5A 1KYOD 3MK7C 3O0RC 2V08A 5KLIB 1GIWA 4WQ9A 1CIEA 3H1ID 1ETPA 1CRCA 1DW1A 3VNWA 1H33B 5CIFB 5EXQA 1NU1D 5CIGB 3NBSA 1KB0A 2KNCB 4FA9A 4WQCA 5GTIV 4XYDB 3WFEC 3L75D 5GTHV 1CTYA 351CA 3CXHW 1DT1A 1C6OA 4H0JA 3HQ6A 3SWSA 2JTIB 5DJQC 1FHBA 2BLFB 4JCGA 4WQ8A 1W2LA 5CIHB 2Q3EA 2D0WA 3PLNA 1WEJF 1RAPA 1GJQA 2PACA 1CSXA 2FYNB 3M97X 3PXTA 1GKSA 2LIRA 4H0KA 2YCCA 1E2RA 1IQCA 1FOCA 4EDFA 2YIUB 3WC8A 2VHDA 2GIWA 1I5TA 1U75B 4NFGB 1KYOW 2N3YA 3PHLA 4PWAA 4AAOA 2B0ZB 3ZOOA 1BE3D 1BGYD 3HQ8A 3PXSA 3GW6A 2ZXYA 3RLMA 1HCMA 3OA8B 3H1LD 2AXTV 2O3JA 5CICB 4RSZA 4XXLA 3WUIA 2AI5A 2N9IA 4GEDB 3ZOWA 3TDKA 2YK3A 2FWLA 2RMZA 2ZOOA 3O1YA 1P84D 2B10B 1LMSA 2C1VA 1C7MA 1NMLA 1FCDC 2N18C 4AAMA 3KHUA 2QJPB 3JBTB 1HZUA 5C9MA 3KZIV 3A9FA 4FA1A 2Y0CA 4Q5PA 3OCDB 4RJTA 4WQ7A 4WQAA 2CE1A 1CORA 3H1JD 1CCHA 3ZOXA 3HQ9A 4YE1A 1LC2A 1F1FA 1N90A 1MG3D 5CIEB 3SJLA 1CRHA 2DGEA 2HV4A 2QG4A 4IL6V 4D6TD 3FWLA 1CRJA 1OAEA 3CU4A 1DVVA 1EZVD 4L1QA 1CSVA 1YEBA 5TJHA 1HJ5A 4GYDA 1KIBA 3L4OA 1KV9A 1CTJA 4AX3A 1CIHA 3VMAA 1BCCD 2B4ZA 4FAVA 2K9JB 1HJ4A 4PJ0V 1FI7A 1NTMD 2CA4B 1SQBD 3H1KD 4P4QB 1CYJA 5CIBB 4QAOA 3CX5D 3RMZA 1CRGA 1NMIA 3L72D 2ZZS1 3VYMA 4PD4D 5KKZB 1K3HA 1WVEC 3WFBC 3PTZA 3SXTA 1YCCA 4U3FD 2N18B 4L3GA 4EIDA 3ORVA 3ITKA 4EIFA 1RZ5A 2C8SA 451CA 1E8EA 2ZBOA 3L71D 2C1DA 4O1QA 1CIFA 1SQXD 1N15A 3X39A 2L4DA 4UB8V 1CRYA 4WQDA 2B11B 2XTSB 1QL3A 1SQVD 1H31A 1KB9D 3CYTI 2OZ1B 1M6ZA 1BL9A 1AKKA 1H33A 1CTZA 3L73D 1ZZHA 1LS9A 5KLVD 1MG2D 3WFDC 2D0SA 2JWAA 1OCDA 1FI9A 1H9YA 1L0LD 1H32B 2BCNB 2L91A 2C1UA 1MZ4A 1QL4A 4FANA 2MHMA 1CXCA 1H1OA 2Y0EA 1GU2A 3WFCC 3RN1A 1YEAA 1YFCA 1HZVA 4EICA 1AOFA 3DR0A 1S5LV 3TF5A 4N0KA 2N9YB 1NNOA 1I6EA 4L3HA 1W5CT 1C2RA 3DP5A 2MTAC 1YNRA 1CIGA 1DIIC 1RAQA 2RN0A 3H1HD 3L70D 1CHJA 1HRCA 1PP9D 2BPBB 2ZONG 2CA3B 4AALA 2QJYB 5B6QA 1J3SA 1C2NA 1CYIA 2N3BA 1JDLA 2BGVX 1CSWA 3TGUD 5E79V 1CXAA 2QJKB 1VYDA 4WQBA 3NWVA 1IRWA 1NTKD 1YIQA 1SQQD 2C9XB 3SVWA 1H31B 5B5EV 2EXVA 1NTZD 1DW3A 3RN0A 2GC4D 3GG2A 1DW2A 4UB6V 3ZOYA 1F1CA 1M60A 5KAIV 3WU2V 2C2CA 1KX2A 1QYZA 1A2SA 2JQRA 1CCRA 1N50A 4DY9A 3O20A 2BCCD 2LITA 4Y5RA 3O5CA 1KX7A 1B7VA 4O1WA 3ZBMA 2BH4X 1A56A 3BCCD 5DFSA 5C0ZA 1I8PA 1AYGA 4FA4A 4J20A 4PW9B 1YTCA 1HROA 1CHHA 5KAFV 1I54A 1L9BC 3L74D 2I8FA 4FA5A 1GDVA 3CX5W 1CHIA 1CYCA 1C75A 1FJ0A 1IRVA 1CC5A 1A8CA 1IZL0 3VRDA 1I8OA 1IO3A 155CA 2V07A 1NIRA 1FI3A 1E29A 5B66V 1PPJD 2PCBB 1K3GA 3PRJA 1CSUA 1QKSA 1C52A 4V2KA 1HJ3A 1DW0A 3C2CA 3NBTA 1M70A 1CNOA 1CEDA 2FRCA 1I6DA 2YQBA 4FB1A 1C6RA 3MK7B 2IBZD 1CO6A 2N9JA 2ORLA 1R0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H V;  1LFM A;  2C1D B;  4WQE A;  3SLE A;  1L9J C;  1S6V B;  2FYU D;  3L4M A;  1H32 A;  2B12 B;  3TYI A;  1HH7 A;  2BH5 X;  3CXH D;  5IY5 1;  2CE0 A;  2Y0D A;  1COT A;  1AOQ A;  2OZ1 A;  4KMG A;  3CWB D;  2DVH A;  3ZCF A;  1RZ6 A;  4K3I A;  4EIE A;  5DF5 A;  1L0N D;  2GC7 D;  3OA8 A;  1C6S A;  1ZRT D;  1LC1 A;  1U74 B;  1SQP D;  1H9X A;  3DMI A;  4AAN A;  5AUR A;  3A0B V;  4MU8 A;  2CXB A;  3PH2 B;  2AIU A;  3ZIY A;  4A7P A;  2KS1 A;  5H2F V;  5DJQ B;  3HQ7 A;  2PCC B;  1I55 A;  1EB7 A;  5CYT R;  4LJI A;  1CRI A;  1N9C A;  1DVH A;  1GQ1 A;  2A06 D;  1YIC A;  2GB8 B;  5TIS V;  5CID B;  1DIQ C;  3OCD A;  1QN2 A;  3PXW A;  3CP5 A;  1KYO D;  3MK7 C;  3O0R C;  2V08 A;  5KLI B;  1GIW A;  4WQ9 A;  1CIE A;  3H1I D;  1ETP A;  1CRC A;  1DW1 A;  3VNW A;  1H33 B;  5CIF B;  5EXQ A;  1NU1 D;  5CIG B;  3NBS A;  1KB0 A;  2KNC B;  4FA9 A;  4WQC A;  5GTI V;  4XYD B;  3WFE C;  3L75 D;  5GTH V;  1CTY A;  351C A;  3CXH W;  1DT1 A;  1C6O A;  4H0J A;  3HQ6 A;  3SWS A;  2JTI B;  5DJQ C;  1FHB A;  2BLF B;  4JCG A;  4WQ8 A;  1W2L A;  5CIH B;  2Q3E A;  2D0W A;  3PLN A;  1WEJ F;  1RAP A;  1GJQ A;  2PAC A;  1CSX A;  2FYN B;  3M97 X;  3PXT A;  1GKS A;  2LIR A;  4H0K A;  2YCC A;  1E2R A;  1IQC A;  1FOC A;  4EDF A;  2YIU B;  3WC8 A;  2VHD A;  2GIW A;  1I5T A;  1U75 B;  4NFG B;  1KYO W;  2N3Y A;  3PHL A;  4PWA A;  4AAO A;  2B0Z B;  3ZOO A;  1BE3 D;  1BGY D;  3HQ8 A;  3PXS A;  3GW6 A;  2ZXY A;  3RLM A;  1HCM A;  3OA8 B;  3H1L D;  2AXT V;  2O3J A;  5CIC B;  4RSZ A;  4XXL A;  3WUI A;  2AI5 A;  2N9I A;  4GED B;  3ZOW A;  3TDK A;  2YK3 A;  2FWL A;  2RMZ A;  2ZOO A;  3O1Y A;  1P84 D;  2B10 B;  1LMS A;  2C1V A;  1C7M A;  1NML A;  1FCD C;  2N18 C;  4AAM A;  3KHU A;  2QJP B;  3JBT B;  1HZU A;  5C9M A;  3KZI V;  3A9F A;  4FA1 A;  2Y0C A;  4Q5P A;  3OCD B;  4RJT A;  4WQ7 A;  4WQA A;  2CE1 A;  1COR A;  3H1J D;  1CCH A;  3ZOX A;  3HQ9 A;  4YE1 A;  1LC2 A;  1F1F A;  1N90 A;  1MG3 D;  5CIE B;  3SJL A;  1CRH A;  2DGE A;  2HV4 A;  2QG4 A;  4IL6 V;  4D6T D;  3FWL A;  1CRJ A;  1OAE A;  3CU4 A;  1DVV A;  1EZV D;  4L1Q A;  1CSV A;  1YEB A;  5TJH A;  1HJ5 A;  4GYD A;  1KIB A;  3L4O A;  1KV9 A;  1CTJ A;  4AX3 A;  1CIH A;  3VMA A;  1BCC D;  2B4Z A;  4FAV A;  2K9J B;  1HJ4 A;  4PJ0 V;  1FI7 A;  1NTM D;  2CA4 B;  1SQB D;  3H1K D;  4P4Q B;  1CYJ A;  5CIB B;  4QAO A;  3CX5 D;  3RMZ A;  1CRG A;  1NMI A;  3L72 D;  2ZZS 1;  3VYM A;  4PD4 D;  5KKZ B;  1K3H A;  1WVE C;  3WFB C;  3PTZ A;  3SXT A;  1YCC A;  4U3F D;  2N18 B;  4L3G A;  4EID A;  3ORV A;  3ITK A;  4EIF A;  1RZ5 A;  2C8S A;  451C A;  1E8E A;  2ZBO A;  3L71 D;  2C1D A;  4O1Q A;  1CIF A;  1SQX D;  1N15 A;  3X39 A;  2L4D A;  4UB8 V;  1CRY A;  4WQD A;  2B11 B;  2XTS B;  1QL3 A;  1SQV D;  1H31 A;  1KB9 D;  3CYT I;  2OZ1 B;  1M6Z A;  1BL9 A;  1AKK A;  1H33 A;  1CTZ A;  3L73 D;  1ZZH A;  1LS9 A;  5KLV D;  1MG2 D;  3WFD C;  2D0S A;  2JWA A;  1OCD A;  1FI9 A;  1H9Y A;  1L0L D;  1H32 B;  2BCN B;  2L91 A;  2C1U A;  1MZ4 A;  1QL4 A;  4FAN A;  2MHM A;  1CXC A;  1H1O A;  2Y0E A;  1GU2 A;  3WFC C;  3RN1 A;  1YEA A;  1YFC A;  1HZV A;  4EIC A;  1AOF A;  3DR0 A;  1S5L V;  3TF5 A;  4N0K A;  2N9Y B;  1NNO A;  1I6E A;  4L3H A;  1W5C T;  1C2R A;  3DP5 A;  2MTA C;  1YNR A;  1CIG A;  1DII C;  1RAQ A;  2RN0 A;  3H1H D;  3L70 D;  1CHJ A;  1HRC A;  1PP9 D;  2BPB B;  2ZON G;  2CA3 B;  4AAL A;  2QJY B;  5B6Q A;  1J3S A;  1C2N A;  1CYI A;  2N3B A;  1JDL A;  2BGV X;  1CSW A;  3TGU D;  5E79 V;  1CXA A;  2QJK B;  1VYD A;  4WQB A;  3NWV A;  1IRW A;  1NTK D;  1YIQ A;  1SQQ D;  2C9X B;  3SVW A;  1H31 B;  5B5E V;  2EXV A;  1NTZ D;  1DW3 A;  3RN0 A;  2GC4 D;  3GG2 A;  1DW2 A;  4UB6 V;  3ZOY A;  1F1C A;  1M60 A;  5KAI V;  3WU2 V;  2C2C A;  1KX2 A;  1QYZ A;  1A2S A;  2JQR A;  1CCR A;  1N50 A;  4DY9 A;  3O20 A;  2BCC D;  2LIT A;  4Y5R A;  3O5C A;  1KX7 A;  1B7V A;  4O1W A;  3ZBM A;  2BH4 X;  1A56 A;  3BCC D;  5DFS A;  5C0Z A;  1I8P A;  1AYG A;  4FA4 A;  4J20 A;  4PW9 B;  1YTC A;  1HRO A;  1CHH A;  5KAF V;  1I54 A;  1L9B C;  3L74 D;  2I8F A;  4FA5 A;  1GDV A;  3CX5 W;  1CHI A;  1CYC A;  1C75 A;  1FJ0 A;  1IRV A;  1CC5 A;  1A8C A;  1IZL 0;  3VRD A;  1I8O A;  1IO3 A;  155C A;  2V07 A;  1NIR A;  1FI3 A;  1E29 A;  5B66 V;  1PPJ D;  2PCB B;  1K3G A;  3PRJ A;  1CSU A;  1QKS A;  1C52 A;  4V2K A;  1HJ3 A;  1DW0 A;  3C2C A;  3NBT A;  1M70 A;  1CNO A;  1CED A;  2FRC A;  1I6D A;  2YQB A;  4FB1 A;  1C6R A;  3MK7 B;  2IBZ D;  1CO6 A;  2N9J A;  2ORL A;  1R0Q A; 
#chains in the Genus database with same CATH topology
 4DCK A;  1JUN A;  1LFM A;  2C1D B;  4WQE A;  2E42 A;  1HF9 A;  3VP9 A;  3CXH I;  1HGV A;  1IK7 A;  1NH4 A;  2FY8 A;  2B12 B;  3H1L G;  1LTJ A;  1HH7 A;  2N9B A;  2BH5 X;  1AQ5 A;  2Y0D A;  2Z5H A;  3CWB D;  4K3I A;  3N7N A;  1NU1 E;  3H1H G;  3L70 G;  1ZRT E;  1EXI A;  2PAJ A;  3SFD C;  5KLV J;  4XE5 B;  1H9X A;  1HJB A;  3AE5 C;  3BCC E;  5AUR A;  4EOT A;  1AVY A;  2CXB A;  3RL0 D;  2AIU A;  1S9K E;  5APT A;  1URQ D;  1G2C B;  2UWJ E;  4D6T E;  2Q7C A;  2ZT9 C;  2ITA A;  1NTK G;  1NKN A;  2XNX A;  1VQM P;  1EB7 A;  4PD4 I;  1FDM A;  1PGJ A;  1N9C A;  1DVH A;  2A06 D;  2GB8 B;  1SQX E;  4CPG A;  1L0L J;  5DJT B;  3B71 A;  2WPV B;  2N1T B;  2GUV A;  3OCD A;  2B89 A;  2L5G B;  3EQ2 A;  1BE3 G;  5KLV E;  3MP7 B;  1M7L A;  1OW7 A;  1KZU B;  1NTK E;  2YMK A;  1EXJ A;  3I5C A;  1SQB J;  2V08 A;  3D6Z A;  3H1I D;  1ETP A;  1CRC A;  1SVF A;  2HOD B;  4MN4 C;  3BCC G;  1BE3 J;  2FFD B;  5AVS B;  1FOS E;  1OX3 A;  2GM4 A;  1L0N E;  5GTH V;  2C0X A;  351C A;  3CXH W;  2YO2 A;  1KQS O;  2HR3 A;  2Q3E A;  2D0W A;  1ZP0 C;  3EFG A;  3HD7 C;  3ABV C;  1IC2 A;  3H1J J;  1LJ2 A;  3M97 X;  1JMM A;  4R4M A;  3PXT A;  1GKS A;  3C1L A;  3RL0 C;  1AJY A;  3D6Y A;  2Y9Y A;  3CCQ P;  2G8Y A;  1QX8 A;  1YTZ T;  1GU4 A;  3WC8 A;  2VHD A;  3WMM 0;  1SQV J;  2IPP A;  3AEC C;  5CCG A;  2GUS A;  1FC2 C;  3L72 E;  1S72 P;  1EZV G;  1Q7Y Q;  2JKV A;  2B0Z B;  3B5N D;  2WMM A;  1RH5 B;  1PL5 A;  1J1E C;  1YQ3 C;  2V7Q H;  2M3E A;  4Y99 B;  1LTJ C;  4L74 A;  3OA8 B;  3H1L D;  2O3J A;  2OYH A;  4RSZ A;  5AW5 B;  1P84 H;  2WSC J;  3TDK A;  1H8A A;  2FWL A;  2RMZ A;  2V7Q J;  1NHL A;  5KAF E;  3O1Y A;  3Q5P A;  2B10 B;  3L75 E;  1J1D C;  1C7M A;  2C1V A;  2M3B A;  3HE5 A;  4M3L A;  4Y99 C;  2C0W A;  1FCD C;  2ZYG A;  2QA4 P;  4PD4 E;  3KHU A;  3MGN A;  1S4X A;  3A9F A;  1N2D C;  1T6A A;  3OCD B;  3CWB E;  1M57 D;  2CE1 A;  3H1J D;  1CCH A;  1WRG A;  2YKO A;  2BEQ D;  1QEX A;  3IR9 A;  4U3F E;  4D6T D;  3Q1M A;  3RGU A;  3CU4 A;  1PPJ E;  1CSV A;  3JCU H;  1T3J A;  1YEB A;  3PJS K;  5TJH A;  3B5N B;  1HJ5 A;  1KFN A;  3L4O A;  4IL6 E;  4AX3 A;  5KJ7 D;  4FAV A;  1HJ4 A;  1BCC E;  1J2J B;  1FI7 A;  3U1A A;  1SFC B;  5CJ0 A;  4QAO A;  3HTK B;  3L72 D;  5KKZ B;  1W2B O;  3FWN A;  1CW5 A;  3WFB C;  1N86 A;  1VQL P;  4U3F D;  1PP9 G;  2N18 B;  3AEB C;  1N73 A;  4Y28 J;  3A3Y B;  4GOF A;  4EIF A;  1NVO A;  1RZ5 A;  4JQ0 D;  1LT9 B;  2OTJ P;  2C1D A;  1H88 A;  1X0T A;  2KOG A;  3B8E B;  3AE1 C;  2PRR A;  1EDI A;  2K37 A;  1QL3 A;  1MKM A;  4I7Z C;  2ZT9 B;  2D2C B;  1H33 A;  3ZDM A;  1Y47 A;  3L73 D;  1LS9 A;  2IBZ G;  2D0S A;  2WSC H;  2O1J A;  2ZVN B;  1OCD A;  3FXE A;  1PGP A;  1H9Y A;  1KOR A;  4PD4 H;  1L0L D;  1EZV E;  1H32 B;  2L91 A;  2C1U A;  1MZ4 A;  3H1L J;  1QVG O;  3E1I A;  4C7N B;  2MHM A;  1CXC A;  4RO0 A;  2C9N Y;  1H1O A;  3V5B A;  4ASV A;  4ZKU A;  4C7R A;  1YEA A;  1YFC A;  4EI2 A;  4K35 A;  3L73 J;  3TYY A;  4N0K A;  1JTH A;  1SQB G;  4H44 B;  1RE3 A;  3RK3 E;  4L3H A;  1JTH B;  4KT0 J;  2P67 A;  3DP5 A;  2HG5 D;  2B87 A;  1MFT A;  3CWB J;  3VMY A;  1K73 Q;  1VQ5 P;  1RF0 C;  1NO4 A;  1R5S A;  1L0N G;  1PGQ A;  2KB7 P;  2XZR A;  4AAL A;  4L76 A;  1DX7 A;  4C7N A;  1J3S A;  2FBW C;  1CYI A;  1VQN P;  1JY3 P;  1JDL A;  3L71 G;  3TGU D;  2WVR A;  1XTG B;  3L35 A;  4OGQ D;  3AE9 C;  2QJK B;  4L75 A;  4WQB A;  1M1J B;  1SQP J;  3NWV A;  1JMB A;  3L75 J;  5KLI C;  1YIQ A;  3BAT A;  1SQQ D;  2ZT9 D;  3D70 A;  1NJI Q;  1A02 J;  2A06 G;  5TIS E;  1NTZ D;  1BE3 E;  5KLV G;  1KIL C;  1Q2N A;  4UB6 V;  4PV1 D;  1NTM K;  5KAI V;  2B88 A;  3U1C A;  2KSE A;  1VPC A;  2LIT A;  3O5C A;  1IFN A;  3MIW A;  1B7V A;  4O1W A;  1ZOY C;  4UB6 E;  1A56 A;  3HD7 B;  2WT7 A;  2IZ0 A;  1AA0 A;  5AW1 B;  5H2F H;  1YTC A;  1FZE A;  1HRO A;  4ZNC A;  1I54 A;  1L9B C;  2I8F A;  4FA5 A;  1FJ0 A;  3P8C E;  3H1H E;  1JCC A;  1I8O A;  4YXD C;  3AEG C;  1IO3 A;  2K9Y A;  4DZO A;  2V07 A;  4GT1 A;  3IF4 A;  1K3G A;  3OJA B;  3OA7 A;  3TK1 A;  5C39 A;  1CSB A;  1QKS A;  5APV A;  1QLE D;  2QJP C;  3JSV C;  2NRG A;  2ZYD A;  3NBT A;  2KUB A;  2YQB A;  2HLO A;  2OYI B;  5TIS H;  1VQ9 P;  1JB0 J;  1TU3 F;  3HUS C;  2N9J A;  1NOH A;  2NPS B;  1URQ C;  4YTP C;  1VQ6 P;  1P84 E;  3M9B A;  2QJY C;  2ZJS E;  5L8R J;  1M90 Q;  1LTB C;  4I6M C;  2C9L Y;  4PV1 B;  3TGU E;  1KIL D;  1XTC C;  1OVV A;  3H1I G;  4WY4 D;  3VMZ A;  3LID A;  2WQY C;  3L71 J;  2E74 D;  2CE0 A;  1RF0 A;  1OIP A;  1AQT A;  1LWU A;  1AOQ A;  1GK6 A;  3IAO A;  1NTZ J;  1RZ6 A;  4R4L A;  1KV4 A;  2WSF H;  1FU1 A;  3MD0 A;  1L0N D;  3OA8 A;  1C6S A;  2LR2 A;  2R32 A;  3DMI A;  3R2P A;  4A7P A;  2KS1 A;  3TGU G;  5H2F V;  1L4A D;  2AXC A;  4BRY B;  2OQQ A;  2YKP A;  1S5L E;  3CCU P;  1SQX K;  2PCC B;  1I55 A;  4PJ0 E;  1AFO A;  2R5D A;  1YIC A;  3A2A A;  1SQV K;  3F5H A;  4U3F J;  1HTL C;  5APW A;  3AEE C;  3CP5 A;  1QVF O;  1GU5 A;  1VL2 A;  1KYO D;  2KZJ A;  1OMI A;  3GHG B;  4WQ9 A;  1CIE A;  1WT6 A;  2I1J A;  2R44 A;  2QEX P;  1RE3 C;  1DW1 A;  1BCC G;  3VNW A;  1H33 B;  1RQV A;  5EXQ A;  2Q1K A;  1NU1 D;  4JBZ A;  3NBS A;  1KFM A;  2YIU C;  2R3S A;  2XU6 A;  5GTI V;  3L75 D;  1C6O A;  4H0J A;  3HQ6 A;  4U3F G;  2JTI B;  4HJG H;  3CMA P;  2BLF B;  4WQ8 A;  3GLM A;  1KYO E;  4ASW A;  4IFF A;  1WEJ F;  1GJQ A;  2PAC A;  2IYO A;  4GOE A;  1L4A B;  1BGY J;  2JDI H;  1SQQ K;  3L70 E;  1NAF A;  1IQC A;  3HTK A;  1SFC A;  1OFC X;  1NTZ K;  1SQV G;  2OGU A;  2FYU K;  2IBZ I;  2Z5I A;  2GIW A;  4IFM A;  1I5T A;  1U75 B;  4RKU J;  4AAO A;  4LLH A;  2OYI C;  1S5L H;  2BAS A;  1BE3 D;  3HQ8 A;  5KLV K;  3G9R A;  2FXM A;  2M0B A;  1DH3 A;  1BSH A;  2XDJ A;  3C9I A;  3RBX A;  1FZC B;  5AW6 B;  5B5E H;  1VQP P;  2YK3 A;  1QL2 A;  3T97 A;  2A45 G;  3LW5 J;  3CX5 H;  1KB9 H;  3EFF K;  1IFD A;  2QJP B;  4N6J A;  4W80 A;  1HZU A;  1J1E B;  1K05 A;  3MUD C;  5C9M A;  4FA1 A;  3NFQ A;  2OYH C;  2J59 M;  2QM7 A;  4RJT A;  1DEE G;  1COR A;  3HE5 B;  2E5T A;  3G71 P;  2WSE H;  2A45 H;  1KC8 Q;  1S3J A;  1SFC D;  2LKM A;  3L72 J;  2OYH B;  1Y8A A;  4IL6 V;  3FWL A;  2QE7 H;  3HE4 A;  4K3A A;  1FZA A;  1CI6 B;  1PP9 J;  3CCE P;  2AXT H;  4GYD A;  5KAI H;  1ZME C;  5BU8 B;  1VDF A;  5KJ7 C;  4H0L D;  3BAS A;  3VMA A;  1BCC D;  1LWU C;  2B4Z A;  2RKL A;  3PP5 A;  1PP9 E;  4PJ0 V;  3AE6 C;  3AEA C;  2CA4 B;  3V6I A;  3RMZ A;  2D2C D;  1RE4 C;  1M8O B;  1S9K D;  4IFD K;  2WPS A;  1WVE C;  2WIT A;  2WTY A;  3PTZ A;  1GMJ A;  4NPE A;  3VOP A;  2E76 B;  3TNU B;  5H2F E;  3A0H E;  4EID A;  3ITK A;  451C A;  1MZ9 A;  2XV5 A;  2ZBO A;  4O1Q A;  3BVH A;  1SQX D;  3R4Y A;  4UB8 V;  1CRY A;  1IJD B;  1PPJ G;  4WQD A;  1SLQ A;  2B11 B;  2XTS B;  2OYI A;  1VF5 D;  2FFD A;  2IYP A;  2PFX A;  3GMA A;  1CTZ A;  2FYU J;  3WFD C;  3KQG A;  1L0L E;  1PV3 A;  1PFI A;  1OVU A;  2BCN B;  2W8Z A;  3EWK A;  3MHV A;  1E5W A;  2JEE A;  2ZYA A;  2WPQ A;  1HZV A;  4EIC A;  1N7S B;  3P8M C;  1W5C E;  3L4F A;  2J58 A;  5GTI E;  3TF5 A;  2MKV A;  3RK3 D;  1JCD A;  3V2P A;  1VQ4 P;  4W7Y A;  1ZR2 A;  1HBW A;  2FXO A;  1W5C T;  1C2R A;  2E75 C;  3H1H J;  3A7O A;  2MTA C;  2D2C C;  2RN0 A;  4WY4 A;  1HRC A;  2I8D A;  4WBA A;  2BPB B;  3FXD A;  1FDO A;  1KIL A;  1SQQ J;  5KAI E;  3V2R A;  3KZI E;  5B6Q A;  4N78 D;  1YI2 P;  1H0T B;  1SP4 A;  1R5L A;  2P10 A;  4NPD A;  1VYD A;  4TLF A;  2W27 A;  1IRW A;  2JWD A;  4JYC A;  2QSI A;  2C9X B;  2WT7 B;  3AE2 C;  2EXV A;  1GL2 D;  2O01 J;  3RN0 A;  1JY2 P;  5AVZ B;  2AXT E;  3CLQ A;  3GG2 A;  3P7K A;  4XA4 A;  5AW3 B;  4OH8 B;  2FYU G;  2Q9I A;  4AUW A;  2C2C A;  1KX2 A;  1QYZ A;  1A2S A;  1YHQ P;  1UIX A;  1GL2 A;  1MUU A;  1NTK J;  4OGQ B;  4DY9 A;  1SS1 A;  4N3Y B;  4HH2 A;  3VYI A;  3V4Q A;  1KX7 A;  1KB9 I;  5EFW B;  1SQV E;  3ZBM A;  3BCC D;  5DFS A;  1I8P A;  2OTK E;  3FX0 A;  1QL1 A;  4FA4 A;  3O6Q B;  1N7S C;  2P2U A;  3L74 D;  3CX5 W;  1CYC A;  5CCH A;  2W6A A;  3VRD A;  3USS A;  3VMX A;  1JM0 A;  1URQ B;  2KIK A;  2QVA A;  1BDD A;  2PCB B;  1U7M A;  1CSU A;  4TT3 H;  2B87 B;  1HWT C;  5AVY B;  2K88 A;  1G1I A;  1PIX A;  1C52 A;  1DW0 A;  4ZKP A;  2QM8 A;  1CED A;  3KPE A;  2ZFC A;  1C6R A;  3MK7 B;  1YTZ I;  5AW9 B;  2IBZ D;  1CO6 A;  1YBK A;  1DEB A;  2LXB A;  2ORL A;  1R0Q A;  3B4S A;  5AVT B;  3A0H V;  1ZXG A;  1GL2 B;  1K04 A;  4D6T J;  2H7H A;  2M5A A;  1FZB A;  5KJ7 A;  3F89 A;  3SLE A;  1FZF A;  4WWI A;  5AVQ B;  2WWW A;  1GTW A;  5AVX B;  4OWF A;  3H1K E;  1BGY G;  1USD A;  3L4M A;  1H32 A;  2HPC B;  2IX7 C;  1NU1 G;  1YJ9 P;  3CXH D;  3TSI A;  1COT A;  2CK3 H;  1GD2 E;  1SQB K;  3ZCF A;  5CJ4 A;  2YNY A;  1IZN B;  2GA1 A;  1KIL B;  1SQP D;  1NTK K;  4AAN A;  3A0B V;  1LT9 A;  3ZIY A;  4DT0 A;  2YMY A;  1ZV8 A;  1BCC J;  2SPZ A;  4WY4 B;  2ZVO B;  5DJQ B;  1USE A;  2E74 B;  3BRT B;  3NMD A;  3L37 A;  4PJ0 H;  1NGM B;  1GQ1 A;  3RK2 D;  1NTZ G;  2AEM A;  2YO3 A;  5TIS V;  1HUC A;  1EQ7 A;  1DIQ C;  4KJM A;  1QN2 A;  1FZC C;  4U7J A;  2PGD A;  1JY3 N;  1DD3 A;  2HFE D;  1IFJ A;  3O0R C;  4GIF A;  1LNQ A;  5KLI B;  1GIW A;  3W68 A;  1D7M A;  1QGK B;  2R3C A;  3M9Q A;  3WUT A;  5CCH C;  3PH0 A;  1OXZ A;  3CL3 D;  2G3A A;  2PP6 A;  1KB0 A;  2KNC B;  4WQC A;  3LIE A;  3II6 A;  3AE8 C;  4RES B;  3C8V A;  3K5B A;  3MZW B;  2E75 D;  3KDP B;  3A0B H;  1DT1 A;  4W7Z A;  3SWS A;  2JO1 A;  4JCG A;  2WSF J;  3TNU A;  1LTA C;  1OVR A;  3LW5 H;  3PLN A;  1JEK A;  4H44 C;  1RAP A;  3CXH E;  1CSX A;  2FYN B;  3L74 E;  3V2Q A;  1FOC A;  1X22 A;  4EDF A;  1YQ4 C;  2YIU B;  1K9M Q;  3PHL A;  2Z4E A;  2N1T D;  4HYT B;  3Q3D A;  3RK2 C;  3GHG C;  3IFM A;  5APY A;  1H89 A;  1X79 B;  3PXS A;  5KTB A;  2V4H A;  4LGD E;  3RLM A;  2A06 E;  2AXT V;  5CIC B;  1L0L K;  3O8Z A;  3UIA A;  4GED B;  3H1J E;  3ZOW A;  3OAK A;  2ZOO A;  4B86 A;  3L73 E;  3V4W A;  1LMS A;  1NML A;  1U57 A;  3WU2 H;  2HYN A;  2N18 C;  2E75 B;  4AAM A;  3JBT B;  1SQP G;  3I55 P;  3W67 A;  2YXQ B;  3KZI V;  2FKW B;  2W6B A;  4Q5P A;  4WQ7 A;  1VF5 C;  2O01 N;  1FS0 E;  2IFM A;  1ZN5 A;  2O01 H;  1SQB E;  1YYC A;  2FYU E;  3HQ9 A;  4BXL A;  1RE4 A;  1F1F A;  1N90 A;  2KNC A;  3E7K A;  1MG3 D;  4I1L A;  5CIE B;  2FYN C;  5CMZ A;  5CCG C;  1CRH A;  2DGE A;  1FZC A;  2HV4 A;  1ZR4 A;  1LP1 A;  1G2C A;  3GF7 A;  3SFE C;  3CXH H;  1DVV A;  4L1Q A;  1YJW P;  4UB8 E;  1KV9 A;  1CTJ A;  4PV1 C;  1NWQ A;  2IBZ E;  1S2E A;  2K9J B;  3SWF A;  1NTM D;  3CCR P;  1Q81 Q;  1SQB D;  3H1K D;  4P4Q B;  1CYJ A;  5CIB B;  5E79 E;  3HUS B;  2DW3 A;  1CRG A;  1NMI A;  1E79 H;  1LTJ B;  2E76 C;  1HGZ A;  3HD7 A;  1JO5 A;  2HPC A;  1L4A A;  4GOD A;  1SQP K;  2H8P D;  2H88 C;  2YXR B;  1IFP A;  3A0H H;  4L3G A;  2XKM A;  1LGH B;  3ORV A;  2C8S A;  1J1D B;  1E8E A;  3S1K A;  3L71 D;  3JC2 2;  1CIF A;  2R5B A;  1DIP A;  2L4D A;  3Q5R A;  1KIL E;  3H1J G;  3WU2 E;  2Q6Q A;  4AQR D;  2VRS A;  1KB9 D;  5AVR B;  2Q5U A;  1SQQ G;  1BL9 A;  1AKK A;  1ZZH A;  1AVO A;  1MG2 D;  5CBO A;  4WY4 C;  3GHG A;  1FI9 A;  2J5U A;  2WZ7 A;  1BSN A;  1URQ A;  1KYO H;  1MFZ A;  1QL4 A;  2AEJ A;  2IZ1 A;  5GTH H;  3P8C D;  1T3U A;  2Y0E A;  3RN1 A;  3CCM P;  2BCC E;  2I1K A;  3AED C;  1VF5 B;  1S5L V;  4QMA A;  3CI9 A;  2ZXE B;  3M06 A;  4DOJ A;  3BRV B;  1KQG B;  5AW4 B;  5B66 E;  1SQQ E;  3CWB G;  1YNR A;  4BRY A;  1M1J C;  1DII C;  3L70 D;  2ZON G;  1WMK A;  3KZI H;  5E79 H;  1C2N A;  1CSW A;  1N7S D;  1KQF B;  1CXA A;  2KLV A;  1L0N K;  1LTI C;  2FXP A;  2RH0 A;  2WPR A;  1N8R Q;  3SVW A;  3L70 J;  5CBN A;  5AW8 B;  3H32 B;  1DW3 A;  3A5T A;  4UB8 H;  2NZ2 A;  2N1T C;  5APU A;  1DW2 A;  1RF1 B;  1F1C A;  3WU2 V;  1N73 B;  3GF3 A;  3O20 A;  2JR8 A;  2BH4 X;  2H89 C;  1JY2 N;  4H44 D;  1IK9 A;  4J20 A;  5APQ A;  5KAF V;  3L74 J;  3NXS A;  3CC7 P;  4ZMD A;  1N73 C;  1GDV A;  3D71 A;  1GZL A;  1Z56 A;  1IRV A;  1CC5 A;  1IFI A;  3IN6 A;  1A8C A;  1IZL 0;  1EDL A;  1H0T A;  4YXW H;  155C A;  3G3Z A;  3WUU A;  3CME P;  1NIR A;  3D0W A;  1FI3 A;  2BCC J;  3PRJ A;  3Q2Y A;  3CCJ P;  1IFM A;  4V2K A;  2K3R A;  1HJ3 A;  3MTU E;  1BGY E;  4FB1 A;  3L73 G;  2E5Y A;  2JJL A;  2XND H;  3SSU A;  5AVW B;  3RBZ A;  4LC1 A;  1A02 F;  2JP3 A;  3H6P A;  3WUV A;  1JNM A;  3BCC J;  1L9J C;  1G1J A;  5CHX A;  2P58 A;  1S6V B;  2FYU D;  1T2K C;  3B5N C;  3H32 A;  4H0L C;  3RK3 C;  2E74 C;  2KP8 A;  3TYI A;  4HKZ H;  2BCC G;  4YPC A;  5IY5 1;  2KZI A;  2Q3I A;  1M1J A;  2OZ1 A;  1GW3 A;  4C46 A;  4KMG A;  2DVH A;  1FBM A;  4EIE A;  5DF5 A;  2KSJ A;  3L74 G;  1JY3 O;  2GC7 D;  1ZRT D;  1FJK A;  1IO4 A;  1LC1 A;  1U74 B;  1KN7 A;  4MU8 A;  3PH2 B;  3MUD A;  1SQX J;  4EIJ A;  3HQ7 A;  2E43 A;  3CX5 I;  1T8Z A;  4DJG A;  1LTS C;  5CYT R;  2K1A A;  4LJI A;  1CRI A;  1YIJ P;  2QJK C;  3CPW O;  1FZG A;  2IFN A;  5B5E E;  2NPS D;  3L71 E;  5CID B;  1BDC A;  3PXW A;  1NYH A;  3H1K J;  3CX5 E;  3L36 A;  1EZV I;  3MK7 C;  1Q90 D;  5AW7 B;  3HE4 B;  3AE4 C;  5BVZ A;  1EDK A;  4JF7 A;  1T2K D;  5CIF B;  3Q5S A;  3N4X A;  3S9O A;  5CIG B;  2QIW A;  1RQU A;  4FA9 A;  3L72 G;  2OYO A;  1PZQ A;  3AE7 C;  4XYD B;  3WFE C;  1CTY A;  2WSE J;  2HOD A;  2KLU A;  5DJQ C;  1FHB A;  1OWA A;  3G4S P;  5CIH B;  1W2L A;  3E1R A;  3M0D A;  5AW0 B;  1L2P A;  1K8A Q;  2N1T A;  4L73 A;  3V2N A;  2LIR A;  4H0K A;  2YCC A;  3I56 P;  1E2R A;  3HUS A;  4WB4 A;  2KK7 A;  3T97 B;  1KMI Z;  1EC5 A;  2K9J A;  1HVV A;  2P7J A;  4NFG B;  3OW2 O;  1KYO W;  2N3Y A;  4PWA A;  1KYO I;  1LT9 C;  1HJ0 A;  1L0L G;  3ZOO A;  3B5N A;  3CD6 P;  1BGY D;  4BWN A;  4H0L B;  3CCS P;  3CCV P;  3GW6 A;  5CCG D;  2ZXY A;  1HCM A;  1LP1 B;  4XXL A;  3WUI A;  2AI5 A;  2N9I A;  1U7J A;  1VQ7 P;  5DJU B;  1N7L A;  2H43 A;  2OTL P;  1P84 D;  1RHZ B;  3VN0 A;  3CCL P;  1Q82 Q;  1ZLL A;  1LT1 A;  3P32 A;  1M1K Q;  1OW8 A;  1LTG C;  3KXD A;  1Y9B A;  2Y0C A;  2IDB A;  4WQA A;  2M8R A;  2M5A B;  1MV8 A;  3ZOX A;  2CPS A;  1JOC A;  4YE1 A;  3VP8 A;  1LC2 A;  1CZQ A;  4JYB A;  3SJL A;  3TGU J;  2QG4 A;  2KS1 B;  1CRJ A;  1OAE A;  1PGO A;  1EZV D;  4OVN F;  3JCU E;  4UB6 H;  2W6J H;  1FJP A;  3M91 A;  1KIB A;  4I7Z B;  3H1L E;  4N78 E;  1CIH A;  3HRN A;  1KQL A;  1FDI A;  1RF1 C;  4JPZ B;  2Y9Z A;  1LWU B;  4AYC A;  2AEF A;  3CX5 D;  4EYY Q;  2A45 I;  1DD4 A;  2ZZS 1;  3VYM A;  1UII A;  4PD4 D;  1K3H A;  3AEF C;  2W83 C;  3SXT A;  1NU1 J;  1YCC A;  5KKZ C;  5GTH E;  3U59 A;  1OW6 A;  1SFC C;  2YKQ A;  1M56 D;  2KYV A;  3FGA D;  4KHX A;  2QRX A;  1N15 A;  3X39 A;  3KYQ A;  2POH A;  5AW2 B;  1RY3 A;  1FE6 A;  2NPS A;  1KB9 E;  5APS A;  1SQV D;  1H31 A;  3CYT I;  2OZ1 B;  1KTM A;  4NPF X;  1M6Z A;  5KLV D;  1X9V A;  2JWA A;  4IOI H;  3QWO C;  4O9B A;  4XFJ A;  1ZW0 A;  4IL6 X;  3M9H A;  4GDO A;  2BEZ F;  4I2L C;  2ZAE B;  3M0A A;  4FAN A;  1NTM E;  3H1I J;  5KAF H;  3A0B E;  1GU2 A;  3WFC C;  1GDT A;  5K5G B;  1NU1 K;  1SQP E;  1GL2 C;  5AVV B;  1AOF A;  3DR0 A;  5CCH D;  1P84 I;  2N9Y B;  3VTP C;  1GK4 A;  3NTN A;  3H1K G;  1NNO A;  1I6E A;  5B66 H;  3S4R A;  4HB1 A;  1CIG A;  1S1C X;  1RAQ A;  2OAR A;  1N7S A;  2O1K A;  1NAY A;  3H1H D;  1CHJ A;  3M0D C;  2E76 D;  1PP9 D;  4H13 C;  2CA3 B;  4WVZ A;  4Z1M H;  1LTT C;  2QJY B;  2LXC B;  2B9B A;  1OZH A;  2N3B A;  4H13 B;  2BGV X;  1S5L X;  2NPS C;  5E79 V;  1SQX G;  3CC4 P;  1GW4 A;  1NKZ B;  1L4A C;  1NTK D;  2W90 A;  1NTM J;  3RL0 g;  1KD1 Q;  1H31 B;  5B5E V;  4D6T G;  1FOS F;  1Q86 Q;  5BU5 A;  2KI7 B;  2GC4 D;  3ZOY A;  3SWY A;  1W2E A;  1M60 A;  3G6E P;  3SWK A;  1EDJ A;  2JQR A;  1CCR A;  1N50 A;  1RF1 A;  5GTI H;  1YJN P;  1VQ8 P;  2MJZ A;  2BCC D;  4Y5R A;  1NTM G;  1AV1 A;  5C0Z A;  5APX A;  1AYG A;  3H25 A;  3RK3 B;  1JY2 O;  5AVU B;  3AE3 C;  2WSS H;  4PW9 B;  4IL6 H;  2P1J A;  1VQO P;  1CHH A;  4OGQ C;  1CHI A;  1R8E A;  1C75 A;  3L75 G;  2FYZ A;  5M1B A;  2FFD C;  2CPB A;  2ZXX A;  1FAV A;  3QH9 A;  3RL0 B;  1E29 A;  4H13 D;  5B66 V;  1PPJ D;  1CI6 A;  1YIT P;  3O6Q A;  1L0N J;  3HD7 D;  3C2C A;  3H1I E;  1I6D A;  1M70 A;  1CNO A;  2FRC A;  3RK2 B;  1NTZ E;  4GKG A;  1HH0 A;  2KXP B;  1X8Y A;  1VQK P;  3CC2 P; 
#chains in the Genus database with same CATH homology
 3A0H V;  1LFM A;  2C1D B;  4WQE A;  3SLE A;  1L9J C;  1S6V B;  2FYU D;  3L4M A;  1H32 A;  2B12 B;  3TYI A;  1HH7 A;  2BH5 X;  3CXH D;  5IY5 1;  2CE0 A;  2Y0D A;  1COT A;  1AOQ A;  2OZ1 A;  4KMG A;  3CWB D;  2DVH A;  3ZCF A;  1RZ6 A;  4K3I A;  4EIE A;  5DF5 A;  1L0N D;  2GC7 D;  3OA8 A;  1C6S A;  1ZRT D;  1LC1 A;  1U74 B;  1SQP D;  1H9X A;  3DMI A;  4AAN A;  5AUR A;  3A0B V;  4MU8 A;  2CXB A;  3PH2 B;  2AIU A;  3ZIY A;  4A7P A;  2KS1 A;  5H2F V;  5DJQ B;  3HQ7 A;  2PCC B;  1I55 A;  1EB7 A;  5CYT R;  4LJI A;  1CRI A;  1N9C A;  1DVH A;  1GQ1 A;  2A06 D;  1YIC A;  2GB8 B;  5TIS V;  5CID B;  1DIQ C;  3OCD A;  1QN2 A;  3PXW A;  3CP5 A;  1KYO D;  3MK7 C;  3O0R C;  2V08 A;  5KLI B;  1GIW A;  4WQ9 A;  1CIE A;  3H1I D;  1ETP A;  1CRC A;  1DW1 A;  3VNW A;  1H33 B;  5CIF B;  5EXQ A;  1NU1 D;  5CIG B;  3NBS A;  1KB0 A;  2KNC B;  4FA9 A;  4WQC A;  5GTI V;  4XYD B;  3WFE C;  3L75 D;  5GTH V;  1CTY A;  351C A;  3CXH W;  1DT1 A;  1C6O A;  4H0J A;  3HQ6 A;  3SWS A;  2JTI B;  5DJQ C;  1FHB A;  2BLF B;  4JCG A;  4WQ8 A;  1W2L A;  5CIH B;  2Q3E A;  2D0W A;  3PLN A;  1WEJ F;  1RAP A;  1GJQ A;  2PAC A;  1CSX A;  2FYN B;  3M97 X;  3PXT A;  1GKS A;  2LIR A;  4H0K A;  2YCC A;  1E2R A;  1IQC A;  1FOC A;  4EDF A;  2YIU B;  3WC8 A;  2VHD A;  2GIW A;  1I5T A;  1U75 B;  4NFG B;  1KYO W;  2N3Y A;  3PHL A;  4PWA A;  4AAO A;  2B0Z B;  3ZOO A;  1BE3 D;  1BGY D;  3HQ8 A;  3PXS A;  3GW6 A;  2ZXY A;  3RLM A;  1HCM A;  3OA8 B;  3H1L D;  2AXT V;  2O3J A;  5CIC B;  4RSZ A;  4XXL A;  3WUI A;  2AI5 A;  2N9I A;  4GED B;  3ZOW A;  3TDK A;  2YK3 A;  2FWL A;  2RMZ A;  2ZOO A;  3O1Y A;  1P84 D;  2B10 B;  1LMS A;  2C1V A;  1C7M A;  1NML A;  1FCD C;  2N18 C;  4AAM A;  3KHU A;  2QJP B;  3JBT B;  1HZU A;  5C9M A;  3KZI V;  3A9F A;  4FA1 A;  2Y0C A;  4Q5P A;  3OCD B;  4RJT A;  4WQ7 A;  4WQA A;  2CE1 A;  1COR A;  3H1J D;  1CCH A;  3ZOX A;  3HQ9 A;  4YE1 A;  1LC2 A;  1F1F A;  1N90 A;  1MG3 D;  5CIE B;  3SJL A;  1CRH A;  2DGE A;  2HV4 A;  2QG4 A;  4IL6 V;  4D6T D;  3FWL A;  1CRJ A;  1OAE A;  3CU4 A;  1DVV A;  1EZV D;  4L1Q A;  1CSV A;  1YEB A;  5TJH A;  1HJ5 A;  4GYD A;  1KIB A;  3L4O A;  1KV9 A;  1CTJ A;  4AX3 A;  1CIH A;  3VMA A;  1BCC D;  2B4Z A;  4FAV A;  2K9J B;  1HJ4 A;  4PJ0 V;  1FI7 A;  1NTM D;  2CA4 B;  1SQB D;  3H1K D;  4P4Q B;  1CYJ A;  5CIB B;  4QAO A;  3CX5 D;  3RMZ A;  1CRG A;  1NMI A;  3L72 D;  2ZZS 1;  3VYM A;  4PD4 D;  5KKZ B;  1K3H A;  1WVE C;  3WFB C;  3PTZ A;  3SXT A;  1YCC A;  4U3F D;  2N18 B;  4L3G A;  4EID A;  3ORV A;  3ITK A;  4EIF A;  1RZ5 A;  2C8S A;  451C A;  1E8E A;  2ZBO A;  3L71 D;  2C1D A;  4O1Q A;  1CIF A;  1SQX D;  1N15 A;  3X39 A;  2L4D A;  4UB8 V;  1CRY A;  4WQD A;  2B11 B;  2XTS B;  1QL3 A;  1SQV D;  1H31 A;  1KB9 D;  3CYT I;  2OZ1 B;  1M6Z A;  1BL9 A;  1AKK A;  1H33 A;  1CTZ A;  3L73 D;  1ZZH A;  1LS9 A;  5KLV D;  1MG2 D;  3WFD C;  2D0S A;  2JWA A;  1OCD A;  1FI9 A;  1H9Y A;  1L0L D;  1H32 B;  2BCN B;  2L91 A;  2C1U A;  1MZ4 A;  1QL4 A;  4FAN A;  2MHM A;  1CXC A;  1H1O A;  2Y0E A;  1GU2 A;  3WFC C;  3RN1 A;  1YEA A;  1YFC A;  1HZV A;  4EIC A;  1AOF A;  3DR0 A;  1S5L V;  3TF5 A;  4N0K A;  2N9Y B;  1NNO A;  1I6E A;  4L3H A;  1W5C T;  1C2R A;  3DP5 A;  2MTA C;  1YNR A;  1CIG A;  1DII C;  1RAQ A;  2RN0 A;  3H1H D;  3L70 D;  1CHJ A;  1HRC A;  1PP9 D;  2BPB B;  2ZON G;  2CA3 B;  4AAL A;  2QJY B;  5B6Q A;  1J3S A;  1C2N A;  1CYI A;  2N3B A;  1JDL A;  2BGV X;  1CSW A;  3TGU D;  5E79 V;  1CXA A;  2QJK B;  1VYD A;  4WQB A;  3NWV A;  1IRW A;  1NTK D;  1YIQ A;  1SQQ D;  2C9X B;  3SVW A;  1H31 B;  5B5E V;  2EXV A;  1NTZ D;  1DW3 A;  3RN0 A;  2GC4 D;  3GG2 A;  1DW2 A;  4UB6 V;  3ZOY A;  1F1C A;  1M60 A;  5KAI V;  3WU2 V;  2C2C A;  1KX2 A;  1QYZ A;  1A2S A;  2JQR A;  1CCR A;  1N50 A;  4DY9 A;  3O20 A;  2BCC D;  2LIT A;  4Y5R A;  3O5C A;  1KX7 A;  1B7V A;  4O1W A;  3ZBM A;  2BH4 X;  1A56 A;  3BCC D;  5DFS A;  5C0Z A;  1I8P A;  1AYG A;  4FA4 A;  4J20 A;  4PW9 B;  1YTC A;  1HRO A;  1CHH A;  5KAF V;  1I54 A;  1L9B C;  3L74 D;  2I8F A;  4FA5 A;  1GDV A;  3CX5 W;  1CHI A;  1CYC A;  1C75 A;  1FJ0 A;  1IRV A;  1CC5 A;  1A8C A;  1IZL 0;  3VRD A;  1I8O A;  1IO3 A;  155C A;  2V07 A;  1NIR A;  1FI3 A;  1E29 A;  5B66 V;  1PPJ D;  2PCB B;  1K3G A;  3PRJ A;  1CSU A;  1QKS A;  1C52 A;  4V2K A;  1HJ3 A;  1DW0 A;  3C2C A;  3NBT A;  1M70 A;  1CNO A;  1CED A;  2FRC A;  1I6D A;  2YQB A;  4FB1 A;  1C6R A;  3MK7 B;  2IBZ D;  1CO6 A;  2N9J A;  2ORL A;  1R0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...