3L75D

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 71
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l75D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l75D02
1CORA 1PPJD 4PD4D 1CRCA 2O3JA 4AAOA 1GDVA 4WQAA 1C7MA 1COTA 1L0ND 5CYTR 2JWAA 1EZVD 1M60A 1M70A 1FCDC 2JQRA 1S6VB 451CA 1LS9A 5KLVD 4U3FD 2LITA 4L3HA 2L4DA 2AI5A 2BCNB 1NU1D 1H32A 4AALA 2N9YB 4O1WA 5CIEB 1DW2A 3L71D 1LFMA 1M6ZA 5CIBB 1CRYA 1YNRA 1DT1A 3WFEC 1I8PA 2HV4A 1YICA 1CYCA 3PHLA 1ZRTD 1CHJA 2YCCA 1C2RA 1BE3D 1CXAA 1GQ1A 3L70D 1N15A 3H1LD 4RSZA 1AOQA 4NFGB 3RMZA 4DY9A 1FI9A 5CIDB 4AX3A 1LC1A 2XTSB 5TISV 1W2LA 1FI3A 2YQBA 2FRCA 1LMSA 5CIFB 2N9JA 1RAPA 1DVHA 2PCCB 2DVHA 1QL3A 4WQ8A 4MU8A 4EICA 4WQEA 3O5CA 3PXWA 2A06D 4PWAA 2L91A 5TJHA 3PH2B 1DIIC 1DIQC 4AAMA 4N0KA 1K3HA 3H1JD 3L4OA 3H1ID 3ZOWA 3DR0A 1NTMD 3CYTI 3WFCC 1U75B 2CE1A 2RMZA 5DJQB 3HQ8A 3NWVA 3GG2A 1FI7A 2GC4D 2V07A 3JBTB 1YTCA 1ETPA 1I54A 2I8FA 1HRCA 1H1OA 1CIFA 1GU2A 1NMIA 2ZXYA 2C1UA 3NBSA 3OA8A 1GJQA 3HQ7A 1AYGA 1A8CA 1CCHA 1CYJA 1CSVA 4EIFA 3VYMA 1OCDA 5CIHB 3WC8A 2GC7D 3OCDA 1HROA 5AURA 1B7VA 1H31B 4L1QA 4XYDB 4K3IA 1N9CA 1RAQA 1CIGA 2FYNB 5H2FV 1CTJA 1N50A 351CA 3OA8B 1E29A 5KLIB 1KV9A 1HJ5A 3C2CA 3BCCD 3OCDB 1WVEC 4A7PA 1CIHA 2Y0CA 2QJYB 1KX2A 2V08A 1C6RA 2AIUA 5GTHV 3RN0A 3ZOYA 4Y5RA 1C6SA 1C52A 2QJPB 2B12B 1YIQA 2N9IA 1CNOA 1K3GA 1I55A 4D6TD 4GEDB 1GIWA 3WFDC 2YIUB 2JTIB 5B5EV 1BL9A 2OZ1A 1CTYA 1N90A 3TF5A 3CU4A 1MG2D 1KB0A 4PJ0V 3ZOOA 2KNCB 2QJKB 3DP5A 1QKSA 3ZIYA 4RJTA 2C1DA 1H32B 2D0WA 5CIGB 1QN2A 1WEJF 1NTZD 3X39A 1YEAA 3MK7C 3SXTA 3NBTA 1A2SA 2OZ1B 2FYUD 2C2CA 4O1QA 4QAOA 1F1CA 2RN0A 1FOCA 5C0ZA 1DW1A 1I5TA 1RZ5A 2BCCD 2YK3A 1NIRA 3PXSA 3CX5W 1OAEA 2N18B 5DFSA 1I6DA 3ZOXA 2N3YA 3GW6A 2Y0DA 1CC5A 1IO3A 1SQPD 2C1VA 3TDKA 2B0ZB 2MTAC 3VRDA 4FANA 1H9XA 1HH7A 1I8OA 1RZ6A 1H33A 2BH4X 2ZOOA 5GTIV 1CRHA 2MHMA 3SJLA 1YFCA 3DMIA 3RLMA 155CA 2CA4B 1CRGA 1J3SA 1IQCA 1DW0A 1SQBD 3SVWA 1H33B 1CRJA 3VMAA 3ITKA 4FAVA 1IZL0 1HZUA 1SQVD 2CA3B 4UB6V 2D0SA 1U74B 1KYOW 3ORVA 5CICB 3A0HV 1P84D 3KZIV 2BLFB 5DF5A 2GB8B 1I6EA 4WQCA 2LIRA 1PP9D 3FWLA 3L73D 5KKZB 1CSXA 1E2RA 2QG4A 1CXCA 2BPBB 1E8EA 4H0JA 2ORLA 4GYDA 5KAIV 3WU2V 1CIEA 4Q5PA 3CWBD 1SQXD 1CRIA 1C2NA 1CSWA 2CXBA 2CE0A 1L9JC 1H9YA 4KMGA 1ZZHA 3L74D 3L75D 1C75A 1NMLA 3A9FA 1KIBA 5E79V 2Q3EA 1FJ0A 4EIEA 1KB9D 3PLNA 3ZCFA 3WUIA 2ZONG 4V2KA 4YE1A 1QYZA 4P4QB 2B10B 1CEDA 2Y0EA 3M97X 3CP5A 3MK7B 3L72D 4FB1A 1CO6A 2IBZD 1VYDA 4AANA 1S5LV 3L4MA 3ZBMA 4LJIA 4WQBA 1C6OA 2BGVX 4EDFA 4XXLA 3PRJA 1NNOA 3CX5D 3HQ9A 1IRVA 4WQ9A 1HJ3A 2AXTV 2C1DB 3SLEA 3TYIA 3SWSA 1DW3A 2BH5X 3KHUA 2GIWA 1NTKD 1A56A 1DVVA 3H1KD 1KX7A 1R0QA 1AOFA 2C9XB 4L3GA 2PACA 3O1YA 5IY51 5B6QA 1HZVA 5EXQA 1AKKA 3TGUD 2DGEA 3CXHD 4JCGA 2K9JB 1CTZA 3PTZA 2KS1A 2PCBB 2B4ZA 4FA4A 1MG3D 3H1HD 1FHBA 1F1FA 3O0RC 1CSUA 2EXVA 1HJ4A 1MZ4A 2N18C 1QL4A 1W5CT 2ZBOA 4UB8V 1CHIA 3CXHW 4FA5A 4FA9A 1L9BC 5B66V 4IL6V 2B11B 4H0KA 1HCMA 5DJQC 4J20A 3WFBC 1KYOD 1H31A 4WQDA 4EIDA 1LC2A 1L0LD 3O20A 1GKSA 2ZZS1 1JDLA 4WQ7A 2FWLA 3PXTA 3VNWA 3RN1A 1CCRA 5KAFV 1SQQD 1YCCA 1EB7A 2N3BA 3HQ6A 1BCCD 1CHHA 2VHDA 1CYIA 1IRWA 4PW9B 3A0BV 2C8SA 4FA1A 1YEBA 5C9MA 1BGYD
chains in the Genus database with same CATH superfamily
1CORA 3H1LJ 1NTKK 4PD4D 1YJWP 1AQTA 1U7JA 3V2QA 3OW2O 5CYTR 1Q86Q 2JWAA 1M60A 1M70A 1GL2D 2NRGA 3RK2C 2YNYA 5KKZC 1NAYA 3II6A 3E1RA 4KHXA 3AE6C 1GU5A 2AI5A 1QGKB 4BRYA 4AALA 2YKPA 1M6ZA 2IYOA 1I8PA 2P67A 2HV4A 2HPCB 2ZT9D 4N6JA 3H1IJ 1CHJA 3AEFC 2E42A 1KILE 1C2RA 1ZR4A 3GF7A 2FFDA 2OYIA 2QE7H 1VQ6P 1BE3D 3AE1C 4RSZA 1T3JA 2M3EA 1AOQA 3RMZA 1FI9A 3HUSC 5CIDB 1SQBG 5TISV 2HODB 1W2LA 1EXJA 2YQBA 2FRCA 5CIFB 3KPEA 2N9JA 2B87B 3GHGB 1FJPA 1BDCA 2GUVA 4RO0A 4QMAA 1KILA 4JF7A 1AQ5A 3MUDA 2NPSA 4PWAA 1L0NK 1EZVE 1XTCC 1VL2A 1DIIC 1L4AD 1SP4A 2KLUA 4EI2A 4CPGA 3H1JD 1HUCA 2E76B 2ZYDA 3ZOWA 1E5WA 3PJSK 3RL0C 3CYTI 2K1AA 3CWBG 2CE1A 5DJQB 3HQ8A 1JOCA 1CI6B 1NU1K 3GG2A 1SFCA 2AEJA 2GC4D 1KB9H 3L71E 4D6TE 1HRCA 2IFNA 3WUVA 3W67A 1GU2A 4PJ0H 4O9BA 2WPSA 3OA8A 2V4HA 4C7NB 3HQ7A 4D6TJ 1S72P 5AVRB 5EFWB 3Q3DA 5CIHB 1YIJP 2E75C 3WC8A 1FOSF 3U1AA 4LLHA 1MFZA 4K3IA 1OZHA 1S1CX 5H2FV 2MJZA 4OVNF 2GM4A 2OARA 2D2CC 1VQLP 1N2DC 2WSSH 2LR2A 1GL2B 2OYHC 3U1CA 3OCDB 4A7PA 5AVWB 1N8RQ 1CIHA 2V08A 1KQSO 2AIUA 1KZUB 3RN0A 2WQYC 2IZ1A 3CL3D 1HJBA 1C52A 1NKNA 4Y99C 1JMMA 2QJPB 2IDBA 2KP8A 2N9IA 3CCSP 2AEMA 1X22A 1NKZB 1D7MA 3W68A 2ZXEB 4GEDB 2K37A 2JTIB 1NTME 1YQ3C 1CTYA 1N90A 2W83C 1HGZA 2YO3A 3K5BA 3HRNA 3CC2P 3RK3B 1H0TB 3ZOOA 1BSNA 2P10A 1QKSA 4RJTA 1H32B 4UB6E 2D0WA 2Y9ZA 2OTLP 1T6AA 3O6QB 1YEAA 1RF1A 2UWJE 3A0HE 1L0LG 3KYQA 4O1QA 2DW3A 2O01J 1Y47A 4B86A 5KAIE 3TNUA 1BCCG 1F1CA 3MZWB 2RN0A 1LTAC 5C0ZA 3GLMA 4OWFA 2KXPB 2YK3A 5CCGD 1G2CA 1M1JA 3A5TA 3CX5W 5DFSA 4ZKPA 3ZOXA 2N3YA 3GW6A 1MKMA 2Y0DA 1T2KC 1IO3A 1IO4A 4FANA 1EC5A 1EZVG 5KJ7C 1LTJC 2BH4X 2ZOOA 1FDMA 2N1TA 3CCEP 3AE8C 1YFCA 1FZBA 1CRGA 1S5LE 3G6EP 3L71G 1J3SA 3I5CA 4Z1MH 1H33B 4FAVA 1RQUA 4JYCA 2WVRA 3RL0g 1GK4A 2Q7CA 5CMZA 2FYUE 2Y9YA 3KZIV 2GB8B 5CCHC 2G3AA 1PP9D 1CSXA 1LWUB 2QG4A 1ZW0A 3NMDA 2XU6A 1FZCC 3HD7A 2WT7A 1KD1Q 5KLIC 1LJ2A 2Q9IA 3H1KE 1SQXD 1CRIA 1C2NA 3H6PA 2CE0A 4JQ0D 1GW3A 1P84I 3H1KJ 1ZZHA 3L74D 2HPCA 2QJYC 3G3ZA 4C7RA 3MIWA 3L35A 1NMLA 2IFMA 5AW5B 4I1LA 2Q3EA 1FJ0A 4EIEA 1FE6A 1OVUA 3P7KA 4EYYQ 3PLNA 3ZCFA 3WUIA 2ZONG 2HFED 2E5TA 4ZKUA 1NTMG 1RE4C 2B10B 4YPCA 3AECC 1VF5D 4UB6H 4HYTB 2HODA 1N73B 1CO6A 2PP6A 1KYOE 3A0HH 1HVVA 3FWNA 1OIPA 1M8OB 1VQ9P 3H32A 4XXLA 3G71P 3HQ9A 3GMAA 3JSVC 2O01N 1LP1A 1FZAA 5KAIH 1TU3F 1DW3A 1SQQJ 1P84H 3MD0A 1KX7A 3WUUA 2ZYGA 4JYBA 2C9XB 2IBZI 3D71A 2PACA 2W90A 4I7ZC 3RGUA 1JMBA 2FFDC 1FBMA 3CXHD 4JCGA 1CI6A 2N9BA 4PD4E 1LT9B 5AW6B 3BCCG 1FS0E 2PCBB 2B4ZA 1SVFA 2JO1A 1MG3D 3H1HD 3O0RC 2A45H 3KDPB 1HJ4A 1JTHB 2ZBOA 3D0WA 1GTWA 3CXHW 1XTGB 4FA9A 5B66V 4IL6V 5AVVB 3HE4A 1HCMA 2OYHA 3WFBC 1J1EB 3MUDC 1S5LH 3O20A 1J1DB 1M56D 1CSBA 2FWLA 3L72E 1CCRA 3HQ6A 3UIAA 1VQMP 1CHHA 2Z4EA 1BE3E 1SFCC 3A0BV 2OQQA 1YEBA 1BE3J 2FYUG 2FYNC 2E74C 3E7KA 1PPJD 4N3YB 2O3JA 1U7MA 1GDVA 4WQAA 1Q82Q 3M0DC 1IJDB 2JQRA 3HTKB 2M0BA 2POHA 1DIPA 2C9NY 5KLVD 2BCCG 4U3FD 2LITA 4KJMA 1YBKA 4LGDE 4BWNA 3LIEA 2BCNB 1URQC 1K04A 2M8RA 1H32A 3FX0A 1SQPG 4PD4I 4HB1A 4EIJA 3G4SP 5CIBB 1VF5B 1CRYA 1DT1A 1LGHB 1YICA 3EQ2A 1CYCA 3OJAB 3H1JJ 3PHLA 2XNXA 2YCCA 1S4XA 4GOEA 2R5BA 1KYOH 1JY3O 5AW0B 1CXAA 4L73A 1N15A 4WY4C 4RKUJ 1LTJA 5AW7B 1SQQK 4GT1A 1A02F 1L4AA 3CC7P 1DD4A 2BEQD 3LIDA 2J5UA 1LTTC 1FI3A 1DX7A 1GZLA 1LMSA 5BVZA 1SQVG 3S9OA 1DVHA 2WZ7A 1BGYE 2DVHA 4MU8A 2XZRA 2A06D 1YYCA 4PD4H 1RF1C 1EDLA 3L73G 5TJHA 2ZFCA 3EWKA 3PH2B 1JM0A 1DIQC 1RY3A 2V7QJ 3VMXA 1JCCA 3M9BA 4H44D 3C1LA 3WFCC 2RMZA 1LTBC 1NU1E 3M0AA 5CCHA 4PJ0E 3JBTB 1GDTA 2WSCJ 1ETPA 1I54A 3L75G 2I8FA 1H1OA 3R2PA 2C1UA 5APVA 1M1JC 4RESB 1GJQA 2Q3IA 1DEEG 1CSVA 4EIFA 3BRVB 3AEBC 1L2PA 2GC7D 2KOGA 1KFMA 4ASVA 5AURA 3L70E 4L1QA 2M5AA 3H1LE 3L72G 1OFCX 2N1TC 1GD2E 1N9CA 3USSA 1NAFA 1CIGA 1FZFA 351CA 3TSIA 2YMKA 1VQ8P 1RE4A 1KV9A 2FXMA 3E1IA 3C2CA 1WVEC 3Q2YA 3RK2B 5GTHV 1C6RA 2WSFJ 1NTKG 2CK3H 1S9KE 3KQGA 4PV1C 3Q1MA 1LTIC 5GTIE 2B12B 1KV4A 1YIQA 5DJTB 2L5GB 1QVFO 1CNOA 3VYIA 3FGAD 3Q5SA 1GIWA 1YTZI 3H1IE 2YIUB 3H25A 5B5EV 5APXA 2QA4P 1S3JA 1GW4A 3TF5A 1G1JA 1W2BO 4YTPC 3CU4A 1KB0A 3HD7C 1BDDA 3RK3D 2KNCB 1RQVA 2QJKB 1N7SD 3V6IA 5AW8B 2YKQA 1X0TA 5CCGA 1LTGC 1NTZD 3X39A 3HUSB 3MK7C 3SXTA 4NPEA 3V4QA 3NBTA 1A2SA 4BXLA 2OZ1B 4L76A 2C2CA 2WPVB 1M90Q 4H13C 3VOPA 2OTJP 5AVZB 1EDJA 2QVAA 3WU2E 1USEA 4N78E 1DW1A 4W7YA 1H89A 3PXSA 3V2PA 1CW5A 2V7QH 3GHGC 1BGYG 4H44B 2Q6QA 3CCMP 1PP9J 1IFNA 5E79E 1PZQA 1L0NG 2QM7A 1H9XA 3CX5I 2WSCH 1SQXE 2KLVA 4WBAA 1OMIA 2SPZA 3RBXA 2MHMA 1T8ZA 5APSA 1JCDA 1SQXJ 3Q5PA 3DMIA 2E76C 1FU1A 3WMM0 1NU1G 3L74J 3M0DA 1KQFB 2KUBA 4WB4A 1FJKA 1HH0A 2XDJA 1DW0A 1SQBD 2OYOA 4H0LD 1AA0A 5BU5A 1URQA 4OH8B 3T97A 2D2CB 2BLFB 3L70G 1AV1A 2H89C 3H1LG 3AEDC 4WQCA 1IZNB 3MTUE 1PGOA 1QL2A 4Y99B 3CWBD 4WY4A 1GL2C 5GTIH 4UB8E 1H9YA 2FY8A 1C75A 3A9FA 3M9HA 1VPCA 1HGVA 3HE5B 1KB9D 2QJPC 2PRRA 3CPWO 1N7SB 5BU8B 1H8AA 3H1IG 2ITAA 2YMYA 1QYZA 4P4QB 1VQ5P 4C46A 1VQKP 5KAFE 2ZT9C 3CP5A 3F89A 3B71A 4FB1A 4I2LC 1VYDA 1OW8A 1ZOYC 4AYCA 4EDFA 3PRJA 3CX5D 2AXTV 2PAJA 5L8RJ 1P84E 3SWSA 3WU2H 1DVVA 2JJLA 3KXDA 5AVYB 2ZAEB 3QH9A 4OGQD 1HZVA 5EXQA 1AKKA 2WITA 2K9JB 2W6BA 1NVOA 4AQRD 3PTZA 2KS1A 5E79H 1SQXK 4FA4A 1L4AC 1FHBA 2KYVA 1QL4A 3L37A 3MGNA 3A7OA 1NGMB 4FA5A 4H0KA 3AE9C 4J20A 4U3FJ 4D6TG 2ZVNB 4WQDA 1KILD 1L0LD 3CXHI 4ZNCA 1GKSA 2G8YA 4H0LB 1QEXA 2NPSD 2WSEJ 2IBZE 1RHZB 2FBWC 3AE2C 1BCCD 5TISE 2H88C 2B88A 3CCQP 3P8CE 2W8ZA 1GMJA 2JKVA 3AE4C 1AVOA 2ZXXA 3AE3C 4FA1A 2Q1KA 4NPDA 2PGDA 1QLED 1FZCB 4K35A 1C7MA 1COTA 1H88A 1EZVD 4WVZA 1FCDC 1YQ4C 1S6VB 1LWUC 451CA 3TGUE 4UB8H 2ZJSE 3Q5RA 4L3HA 4W80A 2O1KA 1MV8A 3TGUJ 2L4DA 2R5DA 1R5SA 4HKZH 4U7JA 3M9QA 2N9YB 2JP3A 5CIEB 1DW2A 3L71D 1LFMA 5CHXA 3IR9A 1YNRA 2QIWA 3WFEC 3NTNA 1MFTA 5KAFH 2O01H 2B87A 3GHGA 3CC4P 1GQ1A 4BRYB 1VDFA 5H2FE 1SQQE 4DY9A 2MKVA 3V2RA 4AX3A 1LC1A 2I1JA 2K9YA 2WPRA 3VMZA 4OGQB 5AW1B 2FFDB 3SSUA 1N7LA 5CBNA 2OYIB 2PCCB 5CBOA 3B5ND 1YTZT 4WQ8A 4WQEA 3WUTA 5CCGC 4AAMA 4C7NA 4N0KA 1M7LA 1YI2P 3L4OA 1ZLLA 2P7JA 1NTMD 2A45G 1NH4A 1IC2A 5CJ4A 1LT9C 1KILB 2W6JH 3NWVA 1FI7A 2V07A 2C0WA 4HJGH 1KQLA 2NPSB 1NMIA 1K8AQ 2BEZF 3NBSA 1PGQA 5KTBA 3A2AA 1EDKA 2LXCB 3CMEP 3VYMA 1OCDA 1GL2A 1IFIA 3SFDC 3OCDA 2Q5UA 1J1EC 2KIKA 4R4MA 5TISH 1HROA 1J1DC 1B7VA 1HWTC 3B8EB 1SFCB 4XYDB 2IBZG 1Y8AA 1WRGA 1NTZE 3D70A 5APUA 2FYNB 1CTJA 3OA8B 2KSEA 1NTZJ 3MP7B 1JY3P 1KORA 3BCCD 1KFNA 3AE7C 2Y0CA 1KX2A 3RK2D 2GUSA 3ZOYA 4Y5RA 3PH0A 3H1KG 1H0TA 2P2UA 2H43A 3IAOA 4XE5B 1ZV8A 1I55A 3O6QA 3H1JE 3TGUG 3WFDC 5AVQB 3LW5J 1X8YA 1BL9A 2J58A 4W7ZA 1WT6A 2KK7A 1IK7A 1UIXA 2FXPA 3VN0A 3ZIYA 4DOJA 5CIGB 1VF5C 3BRTB 1QL1A 1JY3N 5APWA 5H2FH 3KZIE 2O1JA 3S1KA 2FYUD 3ABVC 2OGUA 2GA1A 2KB7P 3B5NB 1SQQG 1SQBJ 2NZ2A 2QRXA 1FOCA 1RZ5A 2BCCD 1RF1B 1JNMA 1W2EA 1NIRA 4DJGA 1OAEA 2N18B 1I6DA 3OAKA 3CCVP 1CZQA 1SQPD 2C1VA 3TDKA 2B0ZB 2MTAC 3RL0D 1U57A 3NXSA 3TNUB 1HH7A 2WTYA 1H33A 3CWBE 1CRHA 1GU4A 3CWBJ 3V2NA 3SJLA 1G2CB 1M1JB 2H7HA 3BASA 2HYNA 2CA4B 2B89A 2IX7C 2E75D 1PFIA 1IQCA 3CMAP 1LWUA 3ITKA 2YXQB 4GIFA 1KQGB 1ZMEC 1SQVD 2CA3B 4UB6V 1NTZK 2D0SA 1Q7YQ 2K88A 1KYOW 2JEEA 3ORVA 5CICB 3A0HV 1MUUA 3VP8A 1BE3G 2D2CD 3P32A 2WWWA 3CX5E 3L73D 5KKZB 3IF4A 2ORLA 4GYDA 5KAIV 3VTPC 4EOTA 3JCUE 4Q5PA 4PV1B 2JR8A 5DJUB 2QSIA 1NOHA 3LW5H 3U59A 1KC8Q 3L75D 1N73A 4IOIH 5B66E 4IL6E 4LC1A 1IFDA 2ZVOB 5APTA 5K5GB 2R3SA 2W6AA 1M1KQ 1PL5A 3HD7B 3H1JG 2WT7B 1JB0J 1OX3A 3C8VA 3AEGC 1CEDA 2Y0EA 3M97X 2YIUC 3L4FA 1ZXGA 5AW2B 3MK7B 2B9BA 3L72D 2R3CA 3I56P 2QM8A 1FOSE 1S5LV 1L0LE 1SQBK 3L4MA 3KZIH 4H13B 3TYYA 1VQ4P 4LJIA 4IFDK 3A0BE 1C6OA 2KI7B 2QJKC 1NNOA 1L0LJ 1KB9I 1IRVA 4WQ9A 1LT9A 1HJ3A 2C1DB 3SLEA 1BCCE 2BH5X 3KHUA 2GIWA 2AXCA 1NTKD 1A56A 1KN7A 2OTKE 1JTHA 2ZYAA 1BCCJ 1R0QA 4GDOA 1PP9E 2VRSA 3D6YA 2J59M 5IY51 4MN4C 4TT3H 3F5HA 3RL0B 3H32B 5AVUB 1T2KD 2DGEA 3C9IA 2C0XA 1LP1B 2BASA 5KJ7D 1CSUA 2EXVA 1MZ4A 3L74E 1W5CT 4H44C 1Q2NA 1CHIA 1L9BC 4GODA 5DJQC 2E75B 3IN6A 4EIDA 1HBWA 1FC2C 4YXDC 1JDLA 1T3UA 2IYPA 1UIIA 3L71J 3VNWA 4GKGA 4DZOA 3V4WA 1GK6A 2YO2A 1RF0A 3HE4B 3HTKA 1LTSC 2VHDA 2OYHB 1CYIA 2PFXA 2WSFH 5CCHD 2C8SA 1KTMA 1AVYA 1AFOA 3CX5H 1BGYD 1VQOP 1CRCA 4AAOA 1PGJA 1L0ND 3JCUH 4ZMDA 3D6ZA 1QVGO 2QEXP 3EFFK 3I55P 2XV5A 3CXHE 2AEFA 1LS9A 2XNDH 5B66H 4IL6H 2Z5IA 1NU1D 3H1HE 4O1WA 3S4RA 3H1HJ 3QWOC 3M06A 2ZT9B 1EZVI 2IZ0A 3P8MC 1ZRTD 4IFFA 1NTMJ 1L0LK 3RK3C 3B5NA 1N7SC 1LT1A 3CCLP 3L70D 1NWQA 3H1LD 3A0BH 1FDOA 4NFGB 1LNQA 2LXBA 2XTSB 1ZP0C 1NO4A 3CI9A 2Z5HA 3G9RA 1RAPA 3M91A 1DD3A 5GTHE 1QL3A 4EICA 1PPJE 3O5CA 3PXWA 2YKOA 1LTJB 1Q81Q 1EQ7A 1S9KD 2L91A 1K9MQ 3BATA 1PP9G 1L4AB 3BCCE 1IFJA 2C9LY 5B5EE 1SS1A 1NJIQ 3V5BA 1K3HA 5KLVE 3BCCJ 4IL6X 4U3FE 3H1ID 3CCUP 1VQNP 3DR0A 2KZIA 2JWDA 1NYHA 1W5CE 4L75A 1U75B 1SQXG 2M3BA 5KLVJ 1YJ9P 1YTCA 3L74G 1MZ9A 1CIFA 2K3RA 2ZXYA 2P1JA 1YJNP 1EDIA 1AYGA 1A8CA 1CCHA 4XA4A 1E79H 1CYJA 5AVXB 3SFEC 1ZN5A 1EXIA 2R44A 1X79B 2XKMA 1H31B 4H0LC 1SFCD 1S2EA 5AW9B 1RAQA 1AJYA 1N50A 2E74D 1E29A 5KLIB 4N78D 1FDIA 1RH5B 1HJ5A 2RKLA 3L36A 2FYUJ 1IK9A 5APQA 2QJYB 1OVVA 2M5AB 2A06E 2CPSA 1C6SA 1OVRA 3CXHH 2BCCE 4L74A 2WMMA 2KNCA 3CCRP 4ASWA 3RBZA 1URQD 1K3GA 2BCCJ 4D6TD 1RE3C 3HUSA 1SQPE 2IPPA 2OZ1A 1NTMK 1SQPJ 3H1HG 3BVHA 1IFMA 3SWYA 3IFMA 1MG2D 1R8EA 4PJ0V 1JO5A 3DP5A 2FYZA 2W27A 2C1DA 1PIXA 1QN2A 1HTLC 2A45I 4WY4D 1WEJF 1VQ7P 4DT0A 1Y9BA 5AVSB 1G1IA 1N73C 3NFQA 1WMKA 4IFMA 5M1BA 2RH0A 1KMIZ 4QAOA 1YHQP 4I7ZB 1SLQA 3EFGA 1SQVE 1IFPA 4DCKA 5GTHH 2WPQA 1PGPA 1SQVJ 1I5TA 5AVTB 4XFJA 4OGQC 3L73E 2OYIC 5KLVK 1PPJG 1N86A 1CC5A 5B5EH 3PP5A 3L73J 1ZR2A 4Y28J 3VRDA 3AEEC 1BSHA 1OW6A 3VMYA 1I8OA 1RZ6A 2R32A 5GTIV 2WSEH 1HF9A 5C39A 5KLVG 3L75E 4U3FG 3AE5C 3RLMA 155CA 1OXZA 2HG5D 1FZEA 3L75J 4KT0J 1FAVA 1KILC 4YXWH 2FKWB 3RK3E 3ZDMA 2NPSC 3SVWA 3A3YB 1CRJA 3VMAA 1IZL0 1USDA 1HZUA 2AXTE 3N4XA 2E43A 2LKMA 2E74B 1U74B 2P58A 2N1TD 2YXRB 4R4LA 2FYUK 1P84D 5DF5A 3L72J 4I6MC 3OA7A 3FXEA 5AW3B 1A02J 1I6EA 1Q90D 2LIRA 3FWLA 2HLOA 1KYOI 1E2RA 1CXCA 2BPBB 1E8EA 3O8ZA 4H0JA 3WU2V 3HE5A 1FZGA 1Z56A 1NTKE 1CIEA 1N7SA 3N7NA 3VP9A 1X9VA 1URQB 4TLFA 3T97B 4PV1D 3SWKA 1CSWA 1NTKJ 2CXBA 4K3AA 1L9JC 1RF0C 3JC22 4KMGA 4WWIA 1SQPK 2A06G 1VQPP 2HR3A 1DH3A 1PV3A 1KIBA 3GF3A 5E79V 1R5LA 3SWFA 2I1KA 3FXDA 4V2KA 3HD7D 4YE1A 1OWAA 4WY4B 5APYA 4HH2A 3CCJP 2CPBA 3MHVA 2IBZD 1S5LX 1JUNA 3B4SA 4AANA 1SQBE 1QX8A 3AEAC 3ZBMA 4JBZA 2FXOA 3P8CD 4WQBA 4H13D 2BGVX 3CD6P 1SQVK 2K9JA 5KJ7A 1M57D 1JY2P 3TYIA 5CJ0A 1HJ0A 1K05A 2H8PD 3H1KD 1J2JB 1AOFA 2JDIH 4L3GA 3O1YA 3CLQA 5B6QA 3B5NC 4JPZB 3TGUD 1CTZA 1OW7A 2E5YA 4GOFA 4M3LA 1BGYJ 1L0NE 5AW4B 1DEBA 1F1FA 4AUWA 1L0NJ 2N18C 4UB8V 1JEKA 1YITP 2E76D 2B11B 1KB9E 2KSJA 1KYOD 1JY2O 1H31A 1LC2A 1NHLA 2KS1B 2ZZS1 1NU1J 1JY2N 4WQ7A 2N1TB 3PXTA 1FZCA 3RN1A 5KAFV 1SQQD 1YCCA 1EB7A 2N3BA 1ZRTE 2AXTH 4NPFX 3TK1A 1K73Q 2I8DA 1RE3A 2KZJA 3R4YA 1IRWA 4PW9B 1NTZG 5C9MA 3L70J
chains in the Genus database with same CATH topology
1CORA 1PPJD 4PD4D 1CRCA 2O3JA 4AAOA 1GDVA 4WQAA 1C7MA 1COTA 1L0ND 5CYTR 2JWAA 1EZVD 1M60A 1M70A 1FCDC 2JQRA 1S6VB 451CA 1LS9A 5KLVD 4U3FD 2LITA 4L3HA 2L4DA 2AI5A 2BCNB 1NU1D 1H32A 4AALA 2N9YB 4O1WA 5CIEB 1DW2A 3L71D 1LFMA 1M6ZA 5CIBB 1CRYA 1YNRA 1DT1A 3WFEC 1I8PA 2HV4A 1YICA 1CYCA 3PHLA 1ZRTD 1CHJA 2YCCA 1C2RA 1BE3D 1CXAA 1GQ1A 3L70D 1N15A 3H1LD 4RSZA 1AOQA 4NFGB 3RMZA 4DY9A 1FI9A 5CIDB 4AX3A 1LC1A 2XTSB 5TISV 1W2LA 1FI3A 2YQBA 2FRCA 1LMSA 5CIFB 2N9JA 1RAPA 1DVHA 2PCCB 2DVHA 1QL3A 4WQ8A 4MU8A 4EICA 4WQEA 3O5CA 3PXWA 2A06D 4PWAA 2L91A 5TJHA 3PH2B 1DIIC 1DIQC 4AAMA 4N0KA 1K3HA 3H1JD 3L4OA 3H1ID 3ZOWA 3DR0A 1NTMD 3CYTI 3WFCC 1U75B 2CE1A 2RMZA 5DJQB 3HQ8A 3NWVA 3GG2A 1FI7A 2GC4D 2V07A 3JBTB 1YTCA 1ETPA 1I54A 2I8FA 1HRCA 1H1OA 1CIFA 1GU2A 1NMIA 2ZXYA 2C1UA 3NBSA 3OA8A 1GJQA 3HQ7A 1AYGA 1A8CA 1CCHA 1CYJA 1CSVA 4EIFA 3VYMA 1OCDA 5CIHB 3WC8A 2GC7D 3OCDA 1HROA 5AURA 1B7VA 1H31B 4L1QA 4XYDB 4K3IA 1N9CA 1RAQA 1CIGA 2FYNB 5H2FV 1CTJA 1N50A 351CA 3OA8B 1E29A 5KLIB 1KV9A 1HJ5A 3C2CA 3BCCD 3OCDB 1WVEC 4A7PA 1CIHA 2Y0CA 2QJYB 1KX2A 2V08A 1C6RA 2AIUA 5GTHV 3RN0A 3ZOYA 4Y5RA 1C6SA 1C52A 2QJPB 2B12B 1YIQA 2N9IA 1CNOA 1K3GA 1I55A 4D6TD 4GEDB 1GIWA 3WFDC 2YIUB 2JTIB 5B5EV 1BL9A 2OZ1A 1CTYA 1N90A 3TF5A 3CU4A 1MG2D 1KB0A 4PJ0V 3ZOOA 2KNCB 2QJKB 3DP5A 1QKSA 3ZIYA 4RJTA 2C1DA 1H32B 2D0WA 5CIGB 1QN2A 1WEJF 1NTZD 3X39A 1YEAA 3MK7C 3SXTA 3NBTA 1A2SA 2OZ1B 2FYUD 2C2CA 4O1QA 4QAOA 1F1CA 2RN0A 1FOCA 5C0ZA 1DW1A 1I5TA 1RZ5A 2BCCD 2YK3A 1NIRA 3PXSA 3CX5W 1OAEA 2N18B 5DFSA 1I6DA 3ZOXA 2N3YA 3GW6A 2Y0DA 1CC5A 1IO3A 1SQPD 2C1VA 3TDKA 2B0ZB 2MTAC 3VRDA 4FANA 1H9XA 1HH7A 1I8OA 1RZ6A 1H33A 2BH4X 2ZOOA 5GTIV 1CRHA 2MHMA 3SJLA 1YFCA 3DMIA 3RLMA 155CA 2CA4B 1CRGA 1J3SA 1IQCA 1DW0A 1SQBD 3SVWA 1H33B 1CRJA 3VMAA 3ITKA 4FAVA 1IZL0 1HZUA 1SQVD 2CA3B 4UB6V 2D0SA 1U74B 1KYOW 3ORVA 5CICB 3A0HV 1P84D 3KZIV 2BLFB 5DF5A 2GB8B 1I6EA 4WQCA 2LIRA 1PP9D 3FWLA 3L73D 5KKZB 1CSXA 1E2RA 2QG4A 1CXCA 2BPBB 1E8EA 4H0JA 2ORLA 4GYDA 5KAIV 3WU2V 1CIEA 4Q5PA 3CWBD 1SQXD 1CRIA 1C2NA 1CSWA 2CXBA 2CE0A 1L9JC 1H9YA 4KMGA 1ZZHA 3L74D 3L75D 1C75A 1NMLA 3A9FA 1KIBA 5E79V 2Q3EA 1FJ0A 4EIEA 1KB9D 3PLNA 3ZCFA 3WUIA 2ZONG 4V2KA 4YE1A 1QYZA 4P4QB 2B10B 1CEDA 2Y0EA 3M97X 3CP5A 3MK7B 3L72D 4FB1A 1CO6A 2IBZD 1VYDA 4AANA 1S5LV 3L4MA 3ZBMA 4LJIA 4WQBA 1C6OA 2BGVX 4EDFA 4XXLA 3PRJA 1NNOA 3CX5D 3HQ9A 1IRVA 4WQ9A 1HJ3A 2AXTV 2C1DB 3SLEA 3TYIA 3SWSA 1DW3A 2BH5X 3KHUA 2GIWA 1NTKD 1A56A 1DVVA 3H1KD 1KX7A 1R0QA 1AOFA 2C9XB 4L3GA 2PACA 3O1YA 5IY51 5B6QA 1HZVA 5EXQA 1AKKA 3TGUD 2DGEA 3CXHD 4JCGA 2K9JB 1CTZA 3PTZA 2KS1A 2PCBB 2B4ZA 4FA4A 1MG3D 3H1HD 1FHBA 1F1FA 3O0RC 1CSUA 2EXVA 1HJ4A 1MZ4A 2N18C 1QL4A 1W5CT 2ZBOA 4UB8V 1CHIA 3CXHW 4FA5A 4FA9A 1L9BC 5B66V 4IL6V 2B11B 4H0KA 1HCMA 5DJQC 4J20A 3WFBC 1KYOD 1H31A 4WQDA 4EIDA 1LC2A 1L0LD 3O20A 1GKSA 2ZZS1 1JDLA 4WQ7A 2FWLA 3PXTA 3VNWA 3RN1A 1CCRA 5KAFV 1SQQD 1YCCA 1EB7A 2N3BA 3HQ6A 1BCCD 1CHHA 2VHDA 1CYIA 1IRWA 4PW9B 3A0BV 2C8SA 4FA1A 1YEBA 5C9MA 1BGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COR A;  1PPJ D;  4PD4 D;  1CRC A;  2O3J A;  4AAO A;  1GDV A;  4WQA A;  1C7M A;  1COT A;  1L0N D;  5CYT R;  2JWA A;  1EZV D;  1M60 A;  1M70 A;  1FCD C;  2JQR A;  1S6V B;  451C A;  1LS9 A;  5KLV D;  4U3F D;  2LIT A;  4L3H A;  2L4D A;  2AI5 A;  2BCN B;  1NU1 D;  1H32 A;  4AAL A;  2N9Y B;  4O1W A;  5CIE B;  1DW2 A;  3L71 D;  1LFM A;  1M6Z A;  5CIB B;  1CRY A;  1YNR A;  1DT1 A;  3WFE C;  1I8P A;  2HV4 A;  1YIC A;  1CYC A;  3PHL A;  1ZRT D;  1CHJ A;  2YCC A;  1C2R A;  1BE3 D;  1CXA A;  1GQ1 A;  3L70 D;  1N15 A;  3H1L D;  4RSZ A;  1AOQ A;  4NFG B;  3RMZ A;  4DY9 A;  1FI9 A;  5CID B;  4AX3 A;  1LC1 A;  2XTS B;  5TIS V;  1W2L A;  1FI3 A;  2YQB A;  2FRC A;  1LMS A;  5CIF B;  2N9J A;  1RAP A;  1DVH A;  2PCC B;  2DVH A;  1QL3 A;  4WQ8 A;  4MU8 A;  4EIC A;  4WQE A;  3O5C A;  3PXW A;  2A06 D;  4PWA A;  2L91 A;  5TJH A;  3PH2 B;  1DII C;  1DIQ C;  4AAM A;  4N0K A;  1K3H A;  3H1J D;  3L4O A;  3H1I D;  3ZOW A;  3DR0 A;  1NTM D;  3CYT I;  3WFC C;  1U75 B;  2CE1 A;  2RMZ A;  5DJQ B;  3HQ8 A;  3NWV A;  3GG2 A;  1FI7 A;  2GC4 D;  2V07 A;  3JBT B;  1YTC A;  1ETP A;  1I54 A;  2I8F A;  1HRC A;  1H1O A;  1CIF A;  1GU2 A;  1NMI A;  2ZXY A;  2C1U A;  3NBS A;  3OA8 A;  1GJQ A;  3HQ7 A;  1AYG A;  1A8C A;  1CCH A;  1CYJ A;  1CSV A;  4EIF A;  3VYM A;  1OCD A;  5CIH B;  3WC8 A;  2GC7 D;  3OCD A;  1HRO A;  5AUR A;  1B7V A;  1H31 B;  4L1Q A;  4XYD B;  4K3I A;  1N9C A;  1RAQ A;  1CIG A;  2FYN B;  5H2F V;  1CTJ A;  1N50 A;  351C A;  3OA8 B;  1E29 A;  5KLI B;  1KV9 A;  1HJ5 A;  3C2C A;  3BCC D;  3OCD B;  1WVE C;  4A7P A;  1CIH A;  2Y0C A;  2QJY B;  1KX2 A;  2V08 A;  1C6R A;  2AIU A;  5GTH V;  3RN0 A;  3ZOY A;  4Y5R A;  1C6S A;  1C52 A;  2QJP B;  2B12 B;  1YIQ A;  2N9I A;  1CNO A;  1K3G A;  1I55 A;  4D6T D;  4GED B;  1GIW A;  3WFD C;  2YIU B;  2JTI B;  5B5E V;  1BL9 A;  2OZ1 A;  1CTY A;  1N90 A;  3TF5 A;  3CU4 A;  1MG2 D;  1KB0 A;  4PJ0 V;  3ZOO A;  2KNC B;  2QJK B;  3DP5 A;  1QKS A;  3ZIY A;  4RJT A;  2C1D A;  1H32 B;  2D0W A;  5CIG B;  1QN2 A;  1WEJ F;  1NTZ D;  3X39 A;  1YEA A;  3MK7 C;  3SXT A;  3NBT A;  1A2S A;  2OZ1 B;  2FYU D;  2C2C A;  4O1Q A;  4QAO A;  1F1C A;  2RN0 A;  1FOC A;  5C0Z A;  1DW1 A;  1I5T A;  1RZ5 A;  2BCC D;  2YK3 A;  1NIR A;  3PXS A;  3CX5 W;  1OAE A;  2N18 B;  5DFS A;  1I6D A;  3ZOX A;  2N3Y A;  3GW6 A;  2Y0D A;  1CC5 A;  1IO3 A;  1SQP D;  2C1V A;  3TDK A;  2B0Z B;  2MTA C;  3VRD A;  4FAN A;  1H9X A;  1HH7 A;  1I8O A;  1RZ6 A;  1H33 A;  2BH4 X;  2ZOO A;  5GTI V;  1CRH A;  2MHM A;  3SJL A;  1YFC A;  3DMI A;  3RLM A;  155C A;  2CA4 B;  1CRG A;  1J3S A;  1IQC A;  1DW0 A;  1SQB D;  3SVW A;  1H33 B;  1CRJ A;  3VMA A;  3ITK A;  4FAV A;  1IZL 0;  1HZU A;  1SQV D;  2CA3 B;  4UB6 V;  2D0S A;  1U74 B;  1KYO W;  3ORV A;  5CIC B;  3A0H V;  1P84 D;  3KZI V;  2BLF B;  5DF5 A;  2GB8 B;  1I6E A;  4WQC A;  2LIR A;  1PP9 D;  3FWL A;  3L73 D;  5KKZ B;  1CSX A;  1E2R A;  2QG4 A;  1CXC A;  2BPB B;  1E8E A;  4H0J A;  2ORL A;  4GYD A;  5KAI V;  3WU2 V;  1CIE A;  4Q5P A;  3CWB D;  1SQX D;  1CRI A;  1C2N A;  1CSW A;  2CXB A;  2CE0 A;  1L9J C;  1H9Y A;  4KMG A;  1ZZH A;  3L74 D;  3L75 D;  1C75 A;  1NML A;  3A9F A;  1KIB A;  5E79 V;  2Q3E A;  1FJ0 A;  4EIE A;  1KB9 D;  3PLN A;  3ZCF A;  3WUI A;  2ZON G;  4V2K A;  4YE1 A;  1QYZ A;  4P4Q B;  2B10 B;  1CED A;  2Y0E A;  3M97 X;  3CP5 A;  3MK7 B;  3L72 D;  4FB1 A;  1CO6 A;  2IBZ D;  1VYD A;  4AAN A;  1S5L V;  3L4M A;  3ZBM A;  4LJI A;  4WQB A;  1C6O A;  2BGV X;  4EDF A;  4XXL A;  3PRJ A;  1NNO A;  3CX5 D;  3HQ9 A;  1IRV A;  4WQ9 A;  1HJ3 A;  2AXT V;  2C1D B;  3SLE A;  3TYI A;  3SWS A;  1DW3 A;  2BH5 X;  3KHU A;  2GIW A;  1NTK D;  1A56 A;  1DVV A;  3H1K D;  1KX7 A;  1R0Q A;  1AOF A;  2C9X B;  4L3G A;  2PAC A;  3O1Y A;  5IY5 1;  5B6Q A;  1HZV A;  5EXQ A;  1AKK A;  3TGU D;  2DGE A;  3CXH D;  4JCG A;  2K9J B;  1CTZ A;  3PTZ A;  2KS1 A;  2PCB B;  2B4Z A;  4FA4 A;  1MG3 D;  3H1H D;  1FHB A;  1F1F A;  3O0R C;  1CSU A;  2EXV A;  1HJ4 A;  1MZ4 A;  2N18 C;  1QL4 A;  1W5C T;  2ZBO A;  4UB8 V;  1CHI A;  3CXH W;  4FA5 A;  4FA9 A;  1L9B C;  5B66 V;  4IL6 V;  2B11 B;  4H0K A;  1HCM A;  5DJQ C;  4J20 A;  3WFB C;  1KYO D;  1H31 A;  4WQD A;  4EID A;  1LC2 A;  1L0L D;  3O20 A;  1GKS A;  2ZZS 1;  1JDL A;  4WQ7 A;  2FWL A;  3PXT A;  3VNW A;  3RN1 A;  1CCR A;  5KAF V;  1SQQ D;  1YCC A;  1EB7 A;  2N3B A;  3HQ6 A;  1BCC D;  1CHH A;  2VHD A;  1CYI A;  1IRW A;  4PW9 B;  3A0B V;  2C8S A;  4FA1 A;  1YEB A;  5C9M A;  1BGY D; 
#chains in the Genus database with same CATH topology
 1COR A;  3H1L J;  1NTK K;  4PD4 D;  1YJW P;  1AQT A;  1U7J A;  3V2Q A;  3OW2 O;  5CYT R;  1Q86 Q;  2JWA A;  1M60 A;  1M70 A;  1GL2 D;  2NRG A;  3RK2 C;  2YNY A;  5KKZ C;  1NAY A;  3II6 A;  3E1R A;  4KHX A;  3AE6 C;  1GU5 A;  2AI5 A;  1QGK B;  4BRY A;  4AAL A;  2YKP A;  1M6Z A;  2IYO A;  1I8P A;  2P67 A;  2HV4 A;  2HPC B;  2ZT9 D;  4N6J A;  3H1I J;  1CHJ A;  3AEF C;  2E42 A;  1KIL E;  1C2R A;  1ZR4 A;  3GF7 A;  2FFD A;  2OYI A;  2QE7 H;  1VQ6 P;  1BE3 D;  3AE1 C;  4RSZ A;  1T3J A;  2M3E A;  1AOQ A;  3RMZ A;  1FI9 A;  3HUS C;  5CID B;  1SQB G;  5TIS V;  2HOD B;  1W2L A;  1EXJ A;  2YQB A;  2FRC A;  5CIF B;  3KPE A;  2N9J A;  2B87 B;  3GHG B;  1FJP A;  1BDC A;  2GUV A;  4RO0 A;  4QMA A;  1KIL A;  4JF7 A;  1AQ5 A;  3MUD A;  2NPS A;  4PWA A;  1L0N K;  1EZV E;  1XTC C;  1VL2 A;  1DII C;  1L4A D;  1SP4 A;  2KLU A;  4EI2 A;  4CPG A;  3H1J D;  1HUC A;  2E76 B;  2ZYD A;  3ZOW A;  1E5W A;  3PJS K;  3RL0 C;  3CYT I;  2K1A A;  3CWB G;  2CE1 A;  5DJQ B;  3HQ8 A;  1JOC A;  1CI6 B;  1NU1 K;  3GG2 A;  1SFC A;  2AEJ A;  2GC4 D;  1KB9 H;  3L71 E;  4D6T E;  1HRC A;  2IFN A;  3WUV A;  3W67 A;  1GU2 A;  4PJ0 H;  4O9B A;  2WPS A;  3OA8 A;  2V4H A;  4C7N B;  3HQ7 A;  4D6T J;  1S72 P;  5AVR B;  5EFW B;  3Q3D A;  5CIH B;  1YIJ P;  2E75 C;  3WC8 A;  1FOS F;  3U1A A;  4LLH A;  1MFZ A;  4K3I A;  1OZH A;  1S1C X;  5H2F V;  2MJZ A;  4OVN F;  2GM4 A;  2OAR A;  2D2C C;  1VQL P;  1N2D C;  2WSS H;  2LR2 A;  1GL2 B;  2OYH C;  3U1C A;  3OCD B;  4A7P A;  5AVW B;  1N8R Q;  1CIH A;  2V08 A;  1KQS O;  2AIU A;  1KZU B;  3RN0 A;  2WQY C;  2IZ1 A;  3CL3 D;  1HJB A;  1C52 A;  1NKN A;  4Y99 C;  1JMM A;  2QJP B;  2IDB A;  2KP8 A;  2N9I A;  3CCS P;  2AEM A;  1X22 A;  1NKZ B;  1D7M A;  3W68 A;  2ZXE B;  4GED B;  2K37 A;  2JTI B;  1NTM E;  1YQ3 C;  1CTY A;  1N90 A;  2W83 C;  1HGZ A;  2YO3 A;  3K5B A;  3HRN A;  3CC2 P;  3RK3 B;  1H0T B;  3ZOO A;  1BSN A;  2P10 A;  1QKS A;  4RJT A;  1H32 B;  4UB6 E;  2D0W A;  2Y9Z A;  2OTL P;  1T6A A;  3O6Q B;  1YEA A;  1RF1 A;  2UWJ E;  3A0H E;  1L0L G;  3KYQ A;  4O1Q A;  2DW3 A;  2O01 J;  1Y47 A;  4B86 A;  5KAI E;  3TNU A;  1BCC G;  1F1C A;  3MZW B;  2RN0 A;  1LTA C;  5C0Z A;  3GLM A;  4OWF A;  2KXP B;  2YK3 A;  5CCG D;  1G2C A;  1M1J A;  3A5T A;  3CX5 W;  5DFS A;  4ZKP A;  3ZOX A;  2N3Y A;  3GW6 A;  1MKM A;  2Y0D A;  1T2K C;  1IO3 A;  1IO4 A;  4FAN A;  1EC5 A;  1EZV G;  5KJ7 C;  1LTJ C;  2BH4 X;  2ZOO A;  1FDM A;  2N1T A;  3CCE P;  3AE8 C;  1YFC A;  1FZB A;  1CRG A;  1S5L E;  3G6E P;  3L71 G;  1J3S A;  3I5C A;  4Z1M H;  1H33 B;  4FAV A;  1RQU A;  4JYC A;  2WVR A;  3RL0 g;  1GK4 A;  2Q7C A;  5CMZ A;  2FYU E;  2Y9Y A;  3KZI V;  2GB8 B;  5CCH C;  2G3A A;  1PP9 D;  1CSX A;  1LWU B;  2QG4 A;  1ZW0 A;  3NMD A;  2XU6 A;  1FZC C;  3HD7 A;  2WT7 A;  1KD1 Q;  5KLI C;  1LJ2 A;  2Q9I A;  3H1K E;  1SQX D;  1CRI A;  1C2N A;  3H6P A;  2CE0 A;  4JQ0 D;  1GW3 A;  1P84 I;  3H1K J;  1ZZH A;  3L74 D;  2HPC A;  2QJY C;  3G3Z A;  4C7R A;  3MIW A;  3L35 A;  1NML A;  2IFM A;  5AW5 B;  4I1L A;  2Q3E A;  1FJ0 A;  4EIE A;  1FE6 A;  1OVU A;  3P7K A;  4EYY Q;  3PLN A;  3ZCF A;  3WUI A;  2ZON G;  2HFE D;  2E5T A;  4ZKU A;  1NTM G;  1RE4 C;  2B10 B;  4YPC A;  3AEC C;  1VF5 D;  4UB6 H;  4HYT B;  2HOD A;  1N73 B;  1CO6 A;  2PP6 A;  1KYO E;  3A0H H;  1HVV A;  3FWN A;  1OIP A;  1M8O B;  1VQ9 P;  3H32 A;  4XXL A;  3G71 P;  3HQ9 A;  3GMA A;  3JSV C;  2O01 N;  1LP1 A;  1FZA A;  5KAI H;  1TU3 F;  1DW3 A;  1SQQ J;  1P84 H;  3MD0 A;  1KX7 A;  3WUU A;  2ZYG A;  4JYB A;  2C9X B;  2IBZ I;  3D71 A;  2PAC A;  2W90 A;  4I7Z C;  3RGU A;  1JMB A;  2FFD C;  1FBM A;  3CXH D;  4JCG A;  1CI6 A;  2N9B A;  4PD4 E;  1LT9 B;  5AW6 B;  3BCC G;  1FS0 E;  2PCB B;  2B4Z A;  1SVF A;  2JO1 A;  1MG3 D;  3H1H D;  3O0R C;  2A45 H;  3KDP B;  1HJ4 A;  1JTH B;  2ZBO A;  3D0W A;  1GTW A;  3CXH W;  1XTG B;  4FA9 A;  5B66 V;  4IL6 V;  5AVV B;  3HE4 A;  1HCM A;  2OYH A;  3WFB C;  1J1E B;  3MUD C;  1S5L H;  3O20 A;  1J1D B;  1M56 D;  1CSB A;  2FWL A;  3L72 E;  1CCR A;  3HQ6 A;  3UIA A;  1VQM P;  1CHH A;  2Z4E A;  1BE3 E;  1SFC C;  3A0B V;  2OQQ A;  1YEB A;  1BE3 J;  2FYU G;  2FYN C;  2E74 C;  3E7K A;  1PPJ D;  4N3Y B;  2O3J A;  1U7M A;  1GDV A;  4WQA A;  1Q82 Q;  3M0D C;  1IJD B;  2JQR A;  3HTK B;  2M0B A;  2POH A;  1DIP A;  2C9N Y;  5KLV D;  2BCC G;  4U3F D;  2LIT A;  4KJM A;  1YBK A;  4LGD E;  4BWN A;  3LIE A;  2BCN B;  1URQ C;  1K04 A;  2M8R A;  1H32 A;  3FX0 A;  1SQP G;  4PD4 I;  4HB1 A;  4EIJ A;  3G4S P;  5CIB B;  1VF5 B;  1CRY A;  1DT1 A;  1LGH B;  1YIC A;  3EQ2 A;  1CYC A;  3OJA B;  3H1J J;  3PHL A;  2XNX A;  2YCC A;  1S4X A;  4GOE A;  2R5B A;  1KYO H;  1JY3 O;  5AW0 B;  1CXA A;  4L73 A;  1N15 A;  4WY4 C;  4RKU J;  1LTJ A;  5AW7 B;  1SQQ K;  4GT1 A;  1A02 F;  1L4A A;  3CC7 P;  1DD4 A;  2BEQ D;  3LID A;  2J5U A;  1LTT C;  1FI3 A;  1DX7 A;  1GZL A;  1LMS A;  5BVZ A;  1SQV G;  3S9O A;  1DVH A;  2WZ7 A;  1BGY E;  2DVH A;  4MU8 A;  2XZR A;  2A06 D;  1YYC A;  4PD4 H;  1RF1 C;  1EDL A;  3L73 G;  5TJH A;  2ZFC A;  3EWK A;  3PH2 B;  1JM0 A;  1DIQ C;  1RY3 A;  2V7Q J;  3VMX A;  1JCC A;  3M9B A;  4H44 D;  3C1L A;  3WFC C;  2RMZ A;  1LTB C;  1NU1 E;  3M0A A;  5CCH A;  4PJ0 E;  3JBT B;  1GDT A;  2WSC J;  1ETP A;  1I54 A;  3L75 G;  2I8F A;  1H1O A;  3R2P A;  2C1U A;  5APV A;  1M1J C;  4RES B;  1GJQ A;  2Q3I A;  1DEE G;  1CSV A;  4EIF A;  3BRV B;  3AEB C;  1L2P A;  2GC7 D;  2KOG A;  1KFM A;  4ASV A;  5AUR A;  3L70 E;  4L1Q A;  2M5A A;  3H1L E;  3L72 G;  1OFC X;  2N1T C;  1GD2 E;  1N9C A;  3USS A;  1NAF A;  1CIG A;  1FZF A;  351C A;  3TSI A;  2YMK A;  1VQ8 P;  1RE4 A;  1KV9 A;  2FXM A;  3E1I A;  3C2C A;  1WVE C;  3Q2Y A;  3RK2 B;  5GTH V;  1C6R A;  2WSF J;  1NTK G;  2CK3 H;  1S9K E;  3KQG A;  4PV1 C;  3Q1M A;  1LTI C;  5GTI E;  2B12 B;  1KV4 A;  1YIQ A;  5DJT B;  2L5G B;  1QVF O;  1CNO A;  3VYI A;  3FGA D;  3Q5S A;  1GIW A;  1YTZ I;  3H1I E;  2YIU B;  3H25 A;  5B5E V;  5APX A;  2QA4 P;  1S3J A;  1GW4 A;  3TF5 A;  1G1J A;  1W2B O;  4YTP C;  3CU4 A;  1KB0 A;  3HD7 C;  1BDD A;  3RK3 D;  2KNC B;  1RQV A;  2QJK B;  1N7S D;  3V6I A;  5AW8 B;  2YKQ A;  1X0T A;  5CCG A;  1LTG C;  1NTZ D;  3X39 A;  3HUS B;  3MK7 C;  3SXT A;  4NPE A;  3V4Q A;  3NBT A;  1A2S A;  4BXL A;  2OZ1 B;  4L76 A;  2C2C A;  2WPV B;  1M90 Q;  4H13 C;  3VOP A;  2OTJ P;  5AVZ B;  1EDJ A;  2QVA A;  3WU2 E;  1USE A;  4N78 E;  1DW1 A;  4W7Y A;  1H89 A;  3PXS A;  3V2P A;  1CW5 A;  2V7Q H;  3GHG C;  1BGY G;  4H44 B;  2Q6Q A;  3CCM P;  1PP9 J;  1IFN A;  5E79 E;  1PZQ A;  1L0N G;  2QM7 A;  1H9X A;  3CX5 I;  2WSC H;  1SQX E;  2KLV A;  4WBA A;  1OMI A;  2SPZ A;  3RBX A;  2MHM A;  1T8Z A;  5APS A;  1JCD A;  1SQX J;  3Q5P A;  3DMI A;  2E76 C;  1FU1 A;  3WMM 0;  1NU1 G;  3L74 J;  3M0D A;  1KQF B;  2KUB A;  4WB4 A;  1FJK A;  1HH0 A;  2XDJ A;  1DW0 A;  1SQB D;  2OYO A;  4H0L D;  1AA0 A;  5BU5 A;  1URQ A;  4OH8 B;  3T97 A;  2D2C B;  2BLF B;  3L70 G;  1AV1 A;  2H89 C;  3H1L G;  3AED C;  4WQC A;  1IZN B;  3MTU E;  1PGO A;  1QL2 A;  4Y99 B;  3CWB D;  4WY4 A;  1GL2 C;  5GTI H;  4UB8 E;  1H9Y A;  2FY8 A;  1C75 A;  3A9F A;  3M9H A;  1VPC A;  1HGV A;  3HE5 B;  1KB9 D;  2QJP C;  2PRR A;  3CPW O;  1N7S B;  5BU8 B;  1H8A A;  3H1I G;  2ITA A;  2YMY A;  1QYZ A;  4P4Q B;  1VQ5 P;  4C46 A;  1VQK P;  5KAF E;  2ZT9 C;  3CP5 A;  3F89 A;  3B71 A;  4FB1 A;  4I2L C;  1VYD A;  1OW8 A;  1ZOY C;  4AYC A;  4EDF A;  3PRJ A;  3CX5 D;  2AXT V;  2PAJ A;  5L8R J;  1P84 E;  3SWS A;  3WU2 H;  1DVV A;  2JJL A;  3KXD A;  5AVY B;  2ZAE B;  3QH9 A;  4OGQ D;  1HZV A;  5EXQ A;  1AKK A;  2WIT A;  2K9J B;  2W6B A;  1NVO A;  4AQR D;  3PTZ A;  2KS1 A;  5E79 H;  1SQX K;  4FA4 A;  1L4A C;  1FHB A;  2KYV A;  1QL4 A;  3L37 A;  3MGN A;  3A7O A;  1NGM B;  4FA5 A;  4H0K A;  3AE9 C;  4J20 A;  4U3F J;  4D6T G;  2ZVN B;  4WQD A;  1KIL D;  1L0L D;  3CXH I;  4ZNC A;  1GKS A;  2G8Y A;  4H0L B;  1QEX A;  2NPS D;  2WSE J;  2IBZ E;  1RHZ B;  2FBW C;  3AE2 C;  1BCC D;  5TIS E;  2H88 C;  2B88 A;  3CCQ P;  3P8C E;  2W8Z A;  1GMJ A;  2JKV A;  3AE4 C;  1AVO A;  2ZXX A;  3AE3 C;  4FA1 A;  2Q1K A;  4NPD A;  2PGD A;  1QLE D;  1FZC B;  4K35 A;  1C7M A;  1COT A;  1H88 A;  1EZV D;  4WVZ A;  1FCD C;  1YQ4 C;  1S6V B;  1LWU C;  451C A;  3TGU E;  4UB8 H;  2ZJS E;  3Q5R A;  4L3H A;  4W80 A;  2O1K A;  1MV8 A;  3TGU J;  2L4D A;  2R5D A;  1R5S A;  4HKZ H;  4U7J A;  3M9Q A;  2N9Y B;  2JP3 A;  5CIE B;  1DW2 A;  3L71 D;  1LFM A;  5CHX A;  3IR9 A;  1YNR A;  2QIW A;  3WFE C;  3NTN A;  1MFT A;  5KAF H;  2O01 H;  2B87 A;  3GHG A;  3CC4 P;  1GQ1 A;  4BRY B;  1VDF A;  5H2F E;  1SQQ E;  4DY9 A;  2MKV A;  3V2R A;  4AX3 A;  1LC1 A;  2I1J A;  2K9Y A;  2WPR A;  3VMZ A;  4OGQ B;  5AW1 B;  2FFD B;  3SSU A;  1N7L A;  5CBN A;  2OYI B;  2PCC B;  5CBO A;  3B5N D;  1YTZ T;  4WQ8 A;  4WQE A;  3WUT A;  5CCG C;  4AAM A;  4C7N A;  4N0K A;  1M7L A;  1YI2 P;  3L4O A;  1ZLL A;  2P7J A;  1NTM D;  2A45 G;  1NH4 A;  1IC2 A;  5CJ4 A;  1LT9 C;  1KIL B;  2W6J H;  3NWV A;  1FI7 A;  2V07 A;  2C0W A;  4HJG H;  1KQL A;  2NPS B;  1NMI A;  1K8A Q;  2BEZ F;  3NBS A;  1PGQ A;  5KTB A;  3A2A A;  1EDK A;  2LXC B;  3CME P;  3VYM A;  1OCD A;  1GL2 A;  1IFI A;  3SFD C;  3OCD A;  2Q5U A;  1J1E C;  2KIK A;  4R4M A;  5TIS H;  1HRO A;  1J1D C;  1B7V A;  1HWT C;  3B8E B;  1SFC B;  4XYD B;  2IBZ G;  1Y8A A;  1WRG A;  1NTZ E;  3D70 A;  5APU A;  2FYN B;  1CTJ A;  3OA8 B;  2KSE A;  1NTZ J;  3MP7 B;  1JY3 P;  1KOR A;  3BCC D;  1KFN A;  3AE7 C;  2Y0C A;  1KX2 A;  3RK2 D;  2GUS A;  3ZOY A;  4Y5R A;  3PH0 A;  3H1K G;  1H0T A;  2P2U A;  2H43 A;  3IAO A;  4XE5 B;  1ZV8 A;  1I55 A;  3O6Q A;  3H1J E;  3TGU G;  3WFD C;  5AVQ B;  3LW5 J;  1X8Y A;  1BL9 A;  2J58 A;  4W7Z A;  1WT6 A;  2KK7 A;  1IK7 A;  1UIX A;  2FXP A;  3VN0 A;  3ZIY A;  4DOJ A;  5CIG B;  1VF5 C;  3BRT B;  1QL1 A;  1JY3 N;  5APW A;  5H2F H;  3KZI E;  2O1J A;  3S1K A;  2FYU D;  3ABV C;  2OGU A;  2GA1 A;  2KB7 P;  3B5N B;  1SQQ G;  1SQB J;  2NZ2 A;  2QRX A;  1FOC A;  1RZ5 A;  2BCC D;  1RF1 B;  1JNM A;  1W2E A;  1NIR A;  4DJG A;  1OAE A;  2N18 B;  1I6D A;  3OAK A;  3CCV P;  1CZQ A;  1SQP D;  2C1V A;  3TDK A;  2B0Z B;  2MTA C;  3RL0 D;  1U57 A;  3NXS A;  3TNU B;  1HH7 A;  2WTY A;  1H33 A;  3CWB E;  1CRH A;  1GU4 A;  3CWB J;  3V2N A;  3SJL A;  1G2C B;  1M1J B;  2H7H A;  3BAS A;  2HYN A;  2CA4 B;  2B89 A;  2IX7 C;  2E75 D;  1PFI A;  1IQC A;  3CMA P;  1LWU A;  3ITK A;  2YXQ B;  4GIF A;  1KQG B;  1ZME C;  1SQV D;  2CA3 B;  4UB6 V;  1NTZ K;  2D0S A;  1Q7Y Q;  2K88 A;  1KYO W;  2JEE A;  3ORV A;  5CIC B;  3A0H V;  1MUU A;  3VP8 A;  1BE3 G;  2D2C D;  3P32 A;  2WWW A;  3CX5 E;  3L73 D;  5KKZ B;  3IF4 A;  2ORL A;  4GYD A;  5KAI V;  3VTP C;  4EOT A;  3JCU E;  4Q5P A;  4PV1 B;  2JR8 A;  5DJU B;  2QSI A;  1NOH A;  3LW5 H;  3U59 A;  1KC8 Q;  3L75 D;  1N73 A;  4IOI H;  5B66 E;  4IL6 E;  4LC1 A;  1IFD A;  2ZVO B;  5APT A;  5K5G B;  2R3S A;  2W6A A;  1M1K Q;  1PL5 A;  3HD7 B;  3H1J G;  2WT7 B;  1JB0 J;  1OX3 A;  3C8V A;  3AEG C;  1CED A;  2Y0E A;  3M97 X;  2YIU C;  3L4F A;  1ZXG A;  5AW2 B;  3MK7 B;  2B9B A;  3L72 D;  2R3C A;  3I56 P;  2QM8 A;  1FOS E;  1S5L V;  1L0L E;  1SQB K;  3L4M A;  3KZI H;  4H13 B;  3TYY A;  1VQ4 P;  4LJI A;  4IFD K;  3A0B E;  1C6O A;  2KI7 B;  2QJK C;  1NNO A;  1L0L J;  1KB9 I;  1IRV A;  4WQ9 A;  1LT9 A;  1HJ3 A;  2C1D B;  3SLE A;  1BCC E;  2BH5 X;  3KHU A;  2GIW A;  2AXC A;  1NTK D;  1A56 A;  1KN7 A;  2OTK E;  1JTH A;  2ZYA A;  1BCC J;  1R0Q A;  4GDO A;  1PP9 E;  2VRS A;  3D6Y A;  2J59 M;  5IY5 1;  4MN4 C;  4TT3 H;  3F5H A;  3RL0 B;  3H32 B;  5AVU B;  1T2K D;  2DGE A;  3C9I A;  2C0X A;  1LP1 B;  2BAS A;  5KJ7 D;  1CSU A;  2EXV A;  1MZ4 A;  3L74 E;  1W5C T;  4H44 C;  1Q2N A;  1CHI A;  1L9B C;  4GOD A;  5DJQ C;  2E75 B;  3IN6 A;  4EID A;  1HBW A;  1FC2 C;  4YXD C;  1JDL A;  1T3U A;  2IYP A;  1UII A;  3L71 J;  3VNW A;  4GKG A;  4DZO A;  3V4W A;  1GK6 A;  2YO2 A;  1RF0 A;  3HE4 B;  3HTK A;  1LTS C;  2VHD A;  2OYH B;  1CYI A;  2PFX A;  2WSF H;  5CCH D;  2C8S A;  1KTM A;  1AVY A;  1AFO A;  3CX5 H;  1BGY D;  1VQO P;  1CRC A;  4AAO A;  1PGJ A;  1L0N D;  3JCU H;  4ZMD A;  3D6Z A;  1QVG O;  2QEX P;  3EFF K;  3I55 P;  2XV5 A;  3CXH E;  2AEF A;  1LS9 A;  2XND H;  5B66 H;  4IL6 H;  2Z5I A;  1NU1 D;  3H1H E;  4O1W A;  3S4R A;  3H1H J;  3QWO C;  3M06 A;  2ZT9 B;  1EZV I;  2IZ0 A;  3P8M C;  1ZRT D;  4IFF A;  1NTM J;  1L0L K;  3RK3 C;  3B5N A;  1N7S C;  1LT1 A;  3CCL P;  3L70 D;  1NWQ A;  3H1L D;  3A0B H;  1FDO A;  4NFG B;  1LNQ A;  2LXB A;  2XTS B;  1ZP0 C;  1NO4 A;  3CI9 A;  2Z5H A;  3G9R A;  1RAP A;  3M91 A;  1DD3 A;  5GTH E;  1QL3 A;  4EIC A;  1PPJ E;  3O5C A;  3PXW A;  2YKO A;  1LTJ B;  1Q81 Q;  1EQ7 A;  1S9K D;  2L91 A;  1K9M Q;  3BAT A;  1PP9 G;  1L4A B;  3BCC E;  1IFJ A;  2C9L Y;  5B5E E;  1SS1 A;  1NJI Q;  3V5B A;  1K3H A;  5KLV E;  3BCC J;  4IL6 X;  4U3F E;  3H1I D;  3CCU P;  1VQN P;  3DR0 A;  2KZI A;  2JWD A;  1NYH A;  1W5C E;  4L75 A;  1U75 B;  1SQX G;  2M3B A;  5KLV J;  1YJ9 P;  1YTC A;  3L74 G;  1MZ9 A;  1CIF A;  2K3R A;  2ZXY A;  2P1J A;  1YJN P;  1EDI A;  1AYG A;  1A8C A;  1CCH A;  4XA4 A;  1E79 H;  1CYJ A;  5AVX B;  3SFE C;  1ZN5 A;  1EXI A;  2R44 A;  1X79 B;  2XKM A;  1H31 B;  4H0L C;  1SFC D;  1S2E A;  5AW9 B;  1RAQ A;  1AJY A;  1N50 A;  2E74 D;  1E29 A;  5KLI B;  4N78 D;  1FDI A;  1RH5 B;  1HJ5 A;  2RKL A;  3L36 A;  2FYU J;  1IK9 A;  5APQ A;  2QJY B;  1OVV A;  2M5A B;  2A06 E;  2CPS A;  1C6S A;  1OVR A;  3CXH H;  2BCC E;  4L74 A;  2WMM A;  2KNC A;  3CCR P;  4ASW A;  3RBZ A;  1URQ D;  1K3G A;  2BCC J;  4D6T D;  1RE3 C;  3HUS A;  1SQP E;  2IPP A;  2OZ1 A;  1NTM K;  1SQP J;  3H1H G;  3BVH A;  1IFM A;  3SWY A;  3IFM A;  1MG2 D;  1R8E A;  4PJ0 V;  1JO5 A;  3DP5 A;  2FYZ A;  2W27 A;  2C1D A;  1PIX A;  1QN2 A;  1HTL C;  2A45 I;  4WY4 D;  1WEJ F;  1VQ7 P;  4DT0 A;  1Y9B A;  5AVS B;  1G1I A;  1N73 C;  3NFQ A;  1WMK A;  4IFM A;  5M1B A;  2RH0 A;  1KMI Z;  4QAO A;  1YHQ P;  4I7Z B;  1SLQ A;  3EFG A;  1SQV E;  1IFP A;  4DCK A;  5GTH H;  2WPQ A;  1PGP A;  1SQV J;  1I5T A;  5AVT B;  4XFJ A;  4OGQ C;  3L73 E;  2OYI C;  5KLV K;  1PPJ G;  1N86 A;  1CC5 A;  5B5E H;  3PP5 A;  3L73 J;  1ZR2 A;  4Y28 J;  3VRD A;  3AEE C;  1BSH A;  1OW6 A;  3VMY A;  1I8O A;  1RZ6 A;  2R32 A;  5GTI V;  2WSE H;  1HF9 A;  5C39 A;  5KLV G;  3L75 E;  4U3F G;  3AE5 C;  3RLM A;  155C A;  1OXZ A;  2HG5 D;  1FZE A;  3L75 J;  4KT0 J;  1FAV A;  1KIL C;  4YXW H;  2FKW B;  3RK3 E;  3ZDM A;  2NPS C;  3SVW A;  3A3Y B;  1CRJ A;  3VMA A;  1IZL 0;  1USD A;  1HZU A;  2AXT E;  3N4X A;  2E43 A;  2LKM A;  2E74 B;  1U74 B;  2P58 A;  2N1T D;  2YXR B;  4R4L A;  2FYU K;  1P84 D;  5DF5 A;  3L72 J;  4I6M C;  3OA7 A;  3FXE A;  5AW3 B;  1A02 J;  1I6E A;  1Q90 D;  2LIR A;  3FWL A;  2HLO A;  1KYO I;  1E2R A;  1CXC A;  2BPB B;  1E8E A;  3O8Z A;  4H0J A;  3WU2 V;  3HE5 A;  1FZG A;  1Z56 A;  1NTK E;  1CIE A;  1N7S A;  3N7N A;  3VP9 A;  1X9V A;  1URQ B;  4TLF A;  3T97 B;  4PV1 D;  3SWK A;  1CSW A;  1NTK J;  2CXB A;  4K3A A;  1L9J C;  1RF0 C;  3JC2 2;  4KMG A;  4WWI A;  1SQP K;  2A06 G;  1VQP P;  2HR3 A;  1DH3 A;  1PV3 A;  1KIB A;  3GF3 A;  5E79 V;  1R5L A;  3SWF A;  2I1K A;  3FXD A;  4V2K A;  3HD7 D;  4YE1 A;  1OWA A;  4WY4 B;  5APY A;  4HH2 A;  3CCJ P;  2CPB A;  3MHV A;  2IBZ D;  1S5L X;  1JUN A;  3B4S A;  4AAN A;  1SQB E;  1QX8 A;  3AEA C;  3ZBM A;  4JBZ A;  2FXO A;  3P8C D;  4WQB A;  4H13 D;  2BGV X;  3CD6 P;  1SQV K;  2K9J A;  5KJ7 A;  1M57 D;  1JY2 P;  3TYI A;  5CJ0 A;  1HJ0 A;  1K05 A;  2H8P D;  3H1K D;  1J2J B;  1AOF A;  2JDI H;  4L3G A;  3O1Y A;  3CLQ A;  5B6Q A;  3B5N C;  4JPZ B;  3TGU D;  1CTZ A;  1OW7 A;  2E5Y A;  4GOF A;  4M3L A;  1BGY J;  1L0N E;  5AW4 B;  1DEB A;  1F1F A;  4AUW A;  1L0N J;  2N18 C;  4UB8 V;  1JEK A;  1YIT P;  2E76 D;  2B11 B;  1KB9 E;  2KSJ A;  1KYO D;  1JY2 O;  1H31 A;  1LC2 A;  1NHL A;  2KS1 B;  2ZZS 1;  1NU1 J;  1JY2 N;  4WQ7 A;  2N1T B;  3PXT A;  1FZC A;  3RN1 A;  5KAF V;  1SQQ D;  1YCC A;  1EB7 A;  2N3B A;  1ZRT E;  2AXT H;  4NPF X;  3TK1 A;  1K73 Q;  2I8D A;  1RE3 A;  2KZJ A;  3R4Y A;  1IRW A;  4PW9 B;  1NTZ G;  5C9M A;  3L70 J; 
#chains in the Genus database with same CATH homology
 1COR A;  1PPJ D;  4PD4 D;  1CRC A;  2O3J A;  4AAO A;  1GDV A;  4WQA A;  1C7M A;  1COT A;  1L0N D;  5CYT R;  2JWA A;  1EZV D;  1M60 A;  1M70 A;  1FCD C;  2JQR A;  1S6V B;  451C A;  1LS9 A;  5KLV D;  4U3F D;  2LIT A;  4L3H A;  2L4D A;  2AI5 A;  2BCN B;  1NU1 D;  1H32 A;  4AAL A;  2N9Y B;  4O1W A;  5CIE B;  1DW2 A;  3L71 D;  1LFM A;  1M6Z A;  5CIB B;  1CRY A;  1YNR A;  1DT1 A;  3WFE C;  1I8P A;  2HV4 A;  1YIC A;  1CYC A;  3PHL A;  1ZRT D;  1CHJ A;  2YCC A;  1C2R A;  1BE3 D;  1CXA A;  1GQ1 A;  3L70 D;  1N15 A;  3H1L D;  4RSZ A;  1AOQ A;  4NFG B;  3RMZ A;  4DY9 A;  1FI9 A;  5CID B;  4AX3 A;  1LC1 A;  2XTS B;  5TIS V;  1W2L A;  1FI3 A;  2YQB A;  2FRC A;  1LMS A;  5CIF B;  2N9J A;  1RAP A;  1DVH A;  2PCC B;  2DVH A;  1QL3 A;  4WQ8 A;  4MU8 A;  4EIC A;  4WQE A;  3O5C A;  3PXW A;  2A06 D;  4PWA A;  2L91 A;  5TJH A;  3PH2 B;  1DII C;  1DIQ C;  4AAM A;  4N0K A;  1K3H A;  3H1J D;  3L4O A;  3H1I D;  3ZOW A;  3DR0 A;  1NTM D;  3CYT I;  3WFC C;  1U75 B;  2CE1 A;  2RMZ A;  5DJQ B;  3HQ8 A;  3NWV A;  3GG2 A;  1FI7 A;  2GC4 D;  2V07 A;  3JBT B;  1YTC A;  1ETP A;  1I54 A;  2I8F A;  1HRC A;  1H1O A;  1CIF A;  1GU2 A;  1NMI A;  2ZXY A;  2C1U A;  3NBS A;  3OA8 A;  1GJQ A;  3HQ7 A;  1AYG A;  1A8C A;  1CCH A;  1CYJ A;  1CSV A;  4EIF A;  3VYM A;  1OCD A;  5CIH B;  3WC8 A;  2GC7 D;  3OCD A;  1HRO A;  5AUR A;  1B7V A;  1H31 B;  4L1Q A;  4XYD B;  4K3I A;  1N9C A;  1RAQ A;  1CIG A;  2FYN B;  5H2F V;  1CTJ A;  1N50 A;  351C A;  3OA8 B;  1E29 A;  5KLI B;  1KV9 A;  1HJ5 A;  3C2C A;  3BCC D;  3OCD B;  1WVE C;  4A7P A;  1CIH A;  2Y0C A;  2QJY B;  1KX2 A;  2V08 A;  1C6R A;  2AIU A;  5GTH V;  3RN0 A;  3ZOY A;  4Y5R A;  1C6S A;  1C52 A;  2QJP B;  2B12 B;  1YIQ A;  2N9I A;  1CNO A;  1K3G A;  1I55 A;  4D6T D;  4GED B;  1GIW A;  3WFD C;  2YIU B;  2JTI B;  5B5E V;  1BL9 A;  2OZ1 A;  1CTY A;  1N90 A;  3TF5 A;  3CU4 A;  1MG2 D;  1KB0 A;  4PJ0 V;  3ZOO A;  2KNC B;  2QJK B;  3DP5 A;  1QKS A;  3ZIY A;  4RJT A;  2C1D A;  1H32 B;  2D0W A;  5CIG B;  1QN2 A;  1WEJ F;  1NTZ D;  3X39 A;  1YEA A;  3MK7 C;  3SXT A;  3NBT A;  1A2S A;  2OZ1 B;  2FYU D;  2C2C A;  4O1Q A;  4QAO A;  1F1C A;  2RN0 A;  1FOC A;  5C0Z A;  1DW1 A;  1I5T A;  1RZ5 A;  2BCC D;  2YK3 A;  1NIR A;  3PXS A;  3CX5 W;  1OAE A;  2N18 B;  5DFS A;  1I6D A;  3ZOX A;  2N3Y A;  3GW6 A;  2Y0D A;  1CC5 A;  1IO3 A;  1SQP D;  2C1V A;  3TDK A;  2B0Z B;  2MTA C;  3VRD A;  4FAN A;  1H9X A;  1HH7 A;  1I8O A;  1RZ6 A;  1H33 A;  2BH4 X;  2ZOO A;  5GTI V;  1CRH A;  2MHM A;  3SJL A;  1YFC A;  3DMI A;  3RLM A;  155C A;  2CA4 B;  1CRG A;  1J3S A;  1IQC A;  1DW0 A;  1SQB D;  3SVW A;  1H33 B;  1CRJ A;  3VMA A;  3ITK A;  4FAV A;  1IZL 0;  1HZU A;  1SQV D;  2CA3 B;  4UB6 V;  2D0S A;  1U74 B;  1KYO W;  3ORV A;  5CIC B;  3A0H V;  1P84 D;  3KZI V;  2BLF B;  5DF5 A;  2GB8 B;  1I6E A;  4WQC A;  2LIR A;  1PP9 D;  3FWL A;  3L73 D;  5KKZ B;  1CSX A;  1E2R A;  2QG4 A;  1CXC A;  2BPB B;  1E8E A;  4H0J A;  2ORL A;  4GYD A;  5KAI V;  3WU2 V;  1CIE A;  4Q5P A;  3CWB D;  1SQX D;  1CRI A;  1C2N A;  1CSW A;  2CXB A;  2CE0 A;  1L9J C;  1H9Y A;  4KMG A;  1ZZH A;  3L74 D;  3L75 D;  1C75 A;  1NML A;  3A9F A;  1KIB A;  5E79 V;  2Q3E A;  1FJ0 A;  4EIE A;  1KB9 D;  3PLN A;  3ZCF A;  3WUI A;  2ZON G;  4V2K A;  4YE1 A;  1QYZ A;  4P4Q B;  2B10 B;  1CED A;  2Y0E A;  3M97 X;  3CP5 A;  3MK7 B;  3L72 D;  4FB1 A;  1CO6 A;  2IBZ D;  1VYD A;  4AAN A;  1S5L V;  3L4M A;  3ZBM A;  4LJI A;  4WQB A;  1C6O A;  2BGV X;  4EDF A;  4XXL A;  3PRJ A;  1NNO A;  3CX5 D;  3HQ9 A;  1IRV A;  4WQ9 A;  1HJ3 A;  2AXT V;  2C1D B;  3SLE A;  3TYI A;  3SWS A;  1DW3 A;  2BH5 X;  3KHU A;  2GIW A;  1NTK D;  1A56 A;  1DVV A;  3H1K D;  1KX7 A;  1R0Q A;  1AOF A;  2C9X B;  4L3G A;  2PAC A;  3O1Y A;  5IY5 1;  5B6Q A;  1HZV A;  5EXQ A;  1AKK A;  3TGU D;  2DGE A;  3CXH D;  4JCG A;  2K9J B;  1CTZ A;  3PTZ A;  2KS1 A;  2PCB B;  2B4Z A;  4FA4 A;  1MG3 D;  3H1H D;  1FHB A;  1F1F A;  3O0R C;  1CSU A;  2EXV A;  1HJ4 A;  1MZ4 A;  2N18 C;  1QL4 A;  1W5C T;  2ZBO A;  4UB8 V;  1CHI A;  3CXH W;  4FA5 A;  4FA9 A;  1L9B C;  5B66 V;  4IL6 V;  2B11 B;  4H0K A;  1HCM A;  5DJQ C;  4J20 A;  3WFB C;  1KYO D;  1H31 A;  4WQD A;  4EID A;  1LC2 A;  1L0L D;  3O20 A;  1GKS A;  2ZZS 1;  1JDL A;  4WQ7 A;  2FWL A;  3PXT A;  3VNW A;  3RN1 A;  1CCR A;  5KAF V;  1SQQ D;  1YCC A;  1EB7 A;  2N3B A;  3HQ6 A;  1BCC D;  1CHH A;  2VHD A;  1CYI A;  1IRW A;  4PW9 B;  3A0B V;  2C8S A;  4FA1 A;  1YEB A;  5C9M A;  1BGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...