3L75D

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 71
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l75D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l75D02
2V08A 1CSWA 1A56A 1HJ3A 2GC7D 1BCCD 1DW3A 3TYIA 2C1DB 1GKSA 1CHHA 1LFMA 2RN0A 3WU2V 3PHLA 5AURA 1NTKD 1YIQA 1DIIC 2GC4D 3DMIA 1NMIA 1H9YA 1EZVD 3PLNA 3ITKA 4FA1A 3VNWA 2LIRA 3GG2A 2CE0A 2O3JA 2GB8B 1N50A 1I6DA 2FRCA 4IL6V 3O5CA 1BGYD 4XYDB 1BE3D 3HQ6A 4YE1A 1DW0A 1DIQC 1H33B 1RZ5A 1FHBA 4N0KA 1GIWA 1SQPD 3MK7C 1I8PA 1NMLA 3L72D 1RZ6A 3OA8A 1M6ZA 1HCMA 1L9JC 2DVHA 3WFCC 4AALA 1KX7A 1FI7A 4U3FD 1PPJD 1IZL0 3VRDA 4D6TD 3PH2B 2QJPB 3ORVA 4MU8A 1YEAA 4GEDB 5EXQA 4H0JA 3L74D 1C2NA 1NTZD 3L70D 1CO6A 1I5TA 1C6OA 5CIDB 1C6SA 1GDVA 3VYMA 3NBTA 2ZXYA 3OCDB 5KLVD 2PACA 3CYTI 1QL3A 1CIGA 4FANA 1N90A 3H1LD 2B4ZA 4Y5RA 1CEDA 1CIFA 1IRVA 1CRJA 1C7MA 1CSUA 4QAOA 4JCGA 1CIHA 3HQ7A 4L3GA 4RJTA 1EB7A 2ZONG 1SQBD 4EIFA 4O1QA 1LC1A 1CCHA 5KAFV 3PTZA 3CXHD 2MTAC 2N9YB 2Y0EA 2C1UA 1FI9A 4WQ9A 1CYJA 2EXVA 3L71D 4J20A 4FB1A 1CHIA 3X39A 3NBSA 4EIDA 1IQCA 2C9XB 1COTA 4FAVA 1FOCA 2B12B 1AYGA 1JDLA 2K9JB 3GW6A 2B0ZB 4FA5A 2FYNB 1LMSA 1HZVA 3O1YA 2N18B 1U75B 1YICA 1DT1A 1HRCA 1QL4A 1CRGA 1RAPA 1CNOA 1FI3A 5B5EV 1NU1D 1FCDC 3A0BV 3M97X 1AKKA 1QYZA 2D0WA 1HJ4A 2N9JA 2HV4A 3O0RC 5DJQC 3ZOYA 4DY9A 5H2FV 1QN2A 2LITA 1C6RA 1YCCA 3WFDC 1CC5A 5B66V 1C52A 2I8FA 2MHMA 4WQBA 2QG4A 2FWLA 3KHUA 5GTHV 3CX5D 3O20A 3ZCFA 3ZOWA 4UB6V 1CSXA 1W5CT 3OCDA 4XXLA 1CHJA 2Y0CA 3A0HV 3DR0A 1MG2D 2BGVX 1SQVD 4PJ0V 2Q3EA 5C9MA 1WEJF 1MG3D 3L4MA 4Q5PA 2CE1A 1M70A 2BH5X 1N15A 1DVVA 5CYTR 4L3HA 2D0SA 1CRYA 2JWAA 2KS1A 1J3SA 3DP5A 2C2CA 3A9FA 3JBTB 4AAMA 5GTIV 1CYIA 4V2KA 4EICA 2PCCB 1QKSA 3HQ9A 3OA8B 2AI5A 2XTSB 1CSVA 3CWBD 5CIFB 1CTJA 4LJIA 1ETPA 2AXTV 451CA 4FA4A 4L1QA 4PW9B 5DJQB 2BLFB 1A8CA 4EDFA 3SJLA 3RMZA 1KB9D 3WFBC 2IBZD 1A2SA 5E79V 1IO3A 1HJ5A 3VMAA 3MK7B 4KMGA 1GQ1A 3L4OA 4WQAA 1HZUA 1H9XA 2QJYB 4H0KA 3SXTA 1CORA 2YIUB 1CXCA 1DW2A 2ORLA 1LC2A 1AOQA 1CTZA 5DF5A 1F1CA 1WVEC 1CRCA 1S5LV 3WFEC 3TGUD 5KAIV 3ZBMA 1N9CA 1M60A 1S6VB 1P84D 2B11B 2C1DA 2QJKB 1GU2A 3BCCD 1F1FA 2JTIB 1L0LD 2N18C 5KLIB 1R0QA 4K3IA 2ZOOA 3SWSA 4FA9A 1MZ4A 2B10B 1OCDA 1OAEA 1U74B 4WQDA 1H33A 3CU4A 1E29A 3L75D 3PRJA 3RLMA 1H31A 3SVWA 1CXAA 1HH7A 1KV9A 1SQXD 3TDKA 1NNOA 5CICB 2C1VA 1YFCA 1LS9A 5B6QA 2N3BA 2CA4B 4AANA 2DGEA 1H32B 4P4QB 5TISV 3L73D 1RAQA 2N9IA 1KIBA 1L0ND 4A7PA 4UB8V 1SQQD 4RSZA 4PWAA 1C75A 1CRIA 1FJ0A 1PP9D 4GYDA 5CIHB 1W2LA 1K3GA 1VYDA 3PXTA 2V07A 1B7VA 5KKZB 1KYOD 1C2RA 2JQRA 2BH4X 3ZIYA 5IY51 2AIUA 1IRWA 1CTYA 2BPBB 1I6EA 1K3HA 4PD4D 1H1OA 2OZ1B 1YEBA 3H1KD 5CIGB 4AX3A 3CX5W 1BL9A 2YCCA 3HQ8A 2RMZA 1YTCA 1E2RA 1NTMD 3NWVA 2Y0DA 3SLEA 3CP5A 1KB0A 1CRHA 2N3YA 3CXHW 3ZOXA 2VHDA 2GIWA 3H1HD 1YNRA 1DVHA 5CIBB 2OZ1A 3H1JD 3RN0A 3ZOOA 3C2CA 1AOFA 3H1ID 1HROA 1L9BC 351CA 3WUIA 2L91A 4WQEA 1CCRA 4EIEA 1ZRTD 2CA3B 1KX2A 5C0ZA 1E8EA 1NIRA 3RN1A 3WC8A 1CYCA 155CA 3KZIV 4WQCA 4AAOA 2A06D 1ZZHA 4WQ7A 1H32A 2ZZS1 2BCNB 4O1WA 1GJQA 3TF5A 2CXBA 1KYOW 1CIEA 2L4DA 1H31B 2BCCD 3FWLA 2YQBA 3PXWA 2FYUD 1I54A 1DW1A 1I8OA 4NFGB 2C8SA 2YK3A 5CIEB 5DFSA 4WQ8A 5TJHA 1I55A 2KNCB 2ZBOA 2PCBB 3PXSA
chains in the Genus database with same CATH superfamily
5GTIH 1FZEA 1CSWA 3B71A 3L73E 3TSIA 4C7RA 3QH9A 3VMZA 3FXEA 3BATA 3KQGA 2P1JA 2RN0A 3WU2V 1EC5A 3WU2E 1YIQA 2W90A 2GC4D 1HWTC 2B89A 3PLNA 1NTMK 3ITKA 2HG5D 4HJGH 2BEQD 3CD6P 2QEXP 1VF5B 1SQBJ 1N50A 5APUA 4IL6V 1BGYD 4YE1A 1NTME 2KSEA 4UB6H 1JY3O 1Q7YQ 2ZYDA 4MN4C 4WY4C 3L75J 1KORA 1FI7A 1N73B 4U3FD 1KB9I 3VRDA 1BGYJ 1S9KD 1NO4A 4H0JA 2ZXXA 1GL2D 1C6SA 1GDVA 1L0NJ 3NBTA 3OCDB 5KLVD 1EDJA 4W7YA 1LGHB 2WSEJ 1N90A 5CCHD 1CEDA 2FXMA 2Q5UA 4DCKA 2IYOA 1KILC 1CRJA 1EZVG 1CIHA 3HQ7A 4L3GA 1X0TA 3CCEP 5KKZC 1CSBA 4N3YB 1LC1A 1EXJA 4PJ0H 1CCHA 2MTAC 2Y0EA 5AVWB 3D6YA 1BE3J 3MZWB 3L71D 3RL0B 3Q1MA 1NOHA 3AE4C 5AW8B 1NWQA 2NPSB 4JYBA 2HLOA 1IZNB 5AW4B 1JTHB 1GU4A 2B12B 1M7LA 3L72E 1OFCX 4D6TJ 2B0ZB 1AFOA 4H13C 1LMSA 3CCLP 4UB8E 3S4RA 5CHXA 1HZVA 1M90Q 1PGOA 2HODA 1U75B 4OVNF 1AVYA 1QL4A 1SQPJ 1S3JA 1CNOA 1LJ2A 3CC7P 1NU1D 3KZIE 3A0BV 1LWUA 1SQVG 2WTYA 3M97X 2E76D 1QYZA 2KB7P 1HJ4A 3E1IA 1Y9BA 2HV4A 3O0RC 4AYCA 5H2FV 2KSJA 1OVUA 1WRGA 1IK7A 2LITA 5AVRB 1CI6B 2MHMA 2QG4A 1ZR2A 2WITA 5AW1B 3ZOWA 4LGDE 3I56P 1CHJA 3DR0A 1H88A 2BGVX 2Q3EA 1WEJF 3L4MA 1RQVA 2KS1A 3IFMA 1J3SA 2IBZG 3A9FA 1RE3C 2OARA 3N7NA 1BE3E 3JBTB 3OA8B 2PCCB 1E5WA 2AI5A 1CSVA 1PGPA 5CIFB 4EI2A 1ETPA 3AE2C 4FA4A 3AE9C 3SJLA 4D6TE 1KB9D 4N6JA 5BU8B 1VQ6P 2AEFA 2JWDA 2K1AA 3HTKB 2CPSA 1IO3A 5KAIH 1NU1K 2SPZA 4H44B 1GQ1A 1X9VA 1NTZK 5B5EE 2R32A 2E76C 1S2EA 2KZJA 1AOQA 2LR2A 1U7MA 1OW6A 2N1TA 5DF5A 1GZLA 3VMYA 1F1CA 1WVEC 1OVRA 1JB0J 3G9RA 3WMM0 3MP7B 1EDKA 1LT1A 2JTIB 5AVQB 2N18C 1VQ9P 2IFMA 2WZ7A 1BDCA 2A06G 1T2KC 1VQKP 2ZOOA 2WSFH 3SWSA 3CPWO 1OCDA 2WSEH 1FZCC 1N7SD 1U74B 4WQDA 1UIIA 3CU4A 1E29A 3PRJA 1AA0A 1KQGB 1FC2C 2KK7A 1ZOYC 1FZAA 5GTHH 3G71P 3TDKA 4M3LA 5KLVK 1YFCA 2CA4B 1PL5A 1H32B 3O6QB 2WSFJ 1KYOI 1KIBA 4OGQB 2M3EA 4UB8V 1SQQD 4PWAA 1C75A 3L36A 2K9YA 1YTZI 1K73Q 4GYDA 1H0TA 1N7SA 1B7VA 5KKZB 2IBZE 2ZXEB 3TGUE 1LT9A 3M91A 1DIPA 1VF5D 1KILB 3V5BA 2ZFCA 2BPBB 3CWBE 1L0NG 2I8DA 3BRVB 1I6EA 3VP8A 1Z56A 3H1KD 4UB6E 3CX5W 2N1TD 4RO0A 3WUVA 4W7ZA 1DEBA 1YJWP 1NTMD 2BCCG 1AV1A 1CRHA 1GMJA 3HE4A 1KFNA 1DX7A 4BXLA 1RF0C 3F89A 2BASA 4JYCA 5CCGA 5BU5A 2WPVB 3FGAD 1S9KE 5AW5B 2E43A 5TISH 3RN0A 2MKVA 4C7NA 3H1ID 3L35A 1NTZE 1VQ5P 1KILD 3U59A 1HJBA 3Q5SA 1VDFA 4OWFA 1FZGA 351CA 1N8RQ 5KLVE 2IZ0A 1SQXE 1SQXG 1PPJE 1VF5C 1ZRTD 2CA3B 1N7SB 2QRXA 1H0TB 3NMDA 1URQD 1UIXA 1HUCA 3P7KA 3Q2YA 3A0BE 1KV4A 2Z5IA 4WY4B 2HPCA 3CXHI 1ZZHA 1Y8AA 1VQ8P 1WMKA 3CCMP 1GJQA 1MFTA 2FFDA 1KYOW 3SWFA 3MIWA 2WSCH 2E74B 3E1RA 4GKGA 5GTHE 2BCCD 3RBXA 3PXWA 4I7ZC 1DW1A 3S9OA 1Q86Q 1L4AB 1SQPG 2E75D 2OYIB 2C8SA 1Q2NA 1ZR4A 4L73A 1ZXGA 3CCUP 1URQC 2ZBOA 1GL2A 4KHXA 4YXWH 2IBZI 1PP9G 5GTIE 4PD4H 1CHHA 2KP8A 2M5AA 4R4LA 5KJ7C 3M0DA 2FYNC 4L75A 3H1LG 1IC2A 5AURA 4N78E 1RF1B 3DMIA 1NMIA 1SQVK 1SQBE 3VNWA 2D2CB 1KZUB 1K04A 1LTAC 3H1KJ 2LIRA 1L4AC 2Q1KA 3HTKA 3GG2A 3A5TA 1X8YA 5DJTB 4BRYB 1RE4A 3FX0A 4I6MC 1K9MQ 3VN0A 1EZVI 5CCGD 1BE3D 3HQ6A 1DIQC 1H33B 3RL0g 4N0KA 1GIWA 3H32B 3MK7C 1NMLA 2XNXA 3OA8A 3AE5C 2R5BA 1M6ZA 1HCMA 2FKWB 1L9JC 2DVHA 2QVAA 3RL0D 3V2QA 3HD7A 5APQA 3RL0C 1PPJD 4D6TD 2QJYC 2QJPB 3ORVA 2UWJE 1R8EA 4YXDC 3A2AA 5EXQA 2HR3A 3L74D 1C2NA 3B5NC 1NTZD 3L70D 5CIDB 1LP1B 3E7KA 2ZXYA 1NTKJ 2HYNA 1Q81Q 2PACA 3CYTI 2V4HA 3CCQP 2B4ZA 4PV1B 1P84I 1IRVA 1C7MA 4JPZB 1CSUA 1ZW0A 3RK2B 2C9LY 4RJTA 1KQFB 1KYOH 4EIFA 1LWUB 3JCUH 3CXHD 2C1UA 1CYJA 2EXVA 4FB1A 1CHIA 3X39A 1ZP0C 1E79H 1L0LK 2PP6A 1IQCA 1S4XA 2JR8A 1JDLA 4ASWA 1SQBG 2R3SA 3GW6A 4FA5A 5DJUB 1MKMA 3BASA 1OWAA 3CCRP 3O1YA 1YICA 3CCJP 1DT1A 1HRCA 2GUVA 3L74G 5CCHC 3LW5J 1JY3N 1SQPK 1CW5A 1GW4A 5CJ0A 4NPDA 3V4WA 2P58A 1SQVJ 1W2BO 1YCCA 2C0XA 2CPBA 1USEA 2FWLA 1AVOA 1JMMA 3KHUA 5GTHV 3EWKA 3CX5D 1GK4A 4IFMA 3ZCFA 1HF9A 1GW3A 1SQBK 1EZVE 3AE7C 1FOSE 2K88A 3CX5H 2H88C 4WY4D 1SQVD 3ZDMA 1QL1A 2YKPA 3NFQA 3K5BA 5C9MA 2QM8A 1M70A 2BH5X 4UB8H 4PD4E 5CYTR 3L4FA 1CRYA 3DP5A 1LTTC 2C2CA 4U3FE 3HD7B 1SFCC 3TGUJ 4QMAA 1CYIA 2ZVNB 4V2KA 3VMXA 2MJZA 2QJKC 1CTJA 2IDBA 3M9HA 3L70E 1J1EB 4PV1D 4L1QA 2A45I 1W2EA 3L71E 1KMIZ 5L8RJ 5TISE 3GF7A 2WPRA 1A8CA 4EDFA 4CPGA 3SWYA 2Y9YA 1EQ7A 3WFBC 3H1HJ 5E79V 5E79E 4DOJA 1HJ5A 1RE4C 3MK7B 1AJYA 2PAJA 3SXTA 1H9XA 4H0KA 1IFJA 1U57A 1CORA 1DW2A 2G8YA 3H1HE 3H1JJ 3L73J 1CTZA 2BCCJ 2FXOA 1QL2A 3CLQA 1ZRTE 3TYYA 3WFEC 2DW3A 3HUSC 5KAIV 3ZBMA 5B66E 4NPFX 3Q3DA 3A7OA 2I1KA 3M0DC 1SVFA 4H44D 2E74D 1XTCC 4H13D 1GU2A 1F1FA 1L0LD 1QVFO 2V7QH 1USDA 3AE6C 3H6PA 3TK1A 4RESB 1R0QA 3HE5B 2YXRB 4AQRD 4FA9A 1MZ4A 3H32A 1SP4A 1L4AA 1OAEA 5KAIE 3CWBG 1RQUA 1KQSO 1YTZT 1NU1E 3L75D 2J58A 1H31A 1M56D 2NPSC 3SVWA 1W5CE 4YTPC 4BRYA 1KV9A 2C1VA 2OYHB 1IK9A 4IL6E 4P4QB 1SFCD 1QVGO 1RAQA 4WY4A 1L0ND 4RSZA 1QX8A 2H43A 4H13B 1PP9D 2M0BA 3II6A 3PXTA 2V07A 4XE5B 3A3YB 1C2RA 2JQRA 2JEEA 2R3CA 3PP5A 4ZMDA 1GK6A 1NH4A 2GM4A 1J1EC 3P8CD 1G2CA 1IRWA 3IF4A 4WBAA 1K3HA 4PD4D 1KFMA 2C9NY 3L71J 2KLUA 5CIGB 4AX3A 1ZN5A 1BL9A 1NYHA 2OYIA 2YCCA 1YYCA 3HQ8A 3M9QA 4ZKPA 1YTCA 3HE4B 1SQQK 2O1KA 5B5EH 1VQOP 2Y0DA 1R5SA 3SLEA 3BCCE 3BCCG 4HB1A 3V6IA 2AXTH 4R4MA 2B87B 1OVVA 3H1HD 1NKZB 3EQ2A 1NAFA 1SQXK 1G1JA 3H1JD 2FFDC 3T97B 3RK2C 1LTIC 5AW6B 1KQLA 3C2CA 3ABVC 3USSA 1L9BC 1OXZA 1KILA 2L5GB 4WQEA 1LT9B 3RK3C 1CCRA 4I1LA 2XKMA 3MTUE 2YMKA 2AEMA 3A0HE 1CYCA 1HGZA 1FDMA 2A06D 3EFGA 3O6QA 5B66H 1H32A 3H1LE 3A0BH 2ZZS1 5AVVB 1KD1Q 4NPEA 2BCNB 1IFMA 2B87A 1FDIA 1PGJA 1OIPA 3CI9A 5APYA 5KJ7A 5M1BA 1CIEA 2PRRA 5AW9B 1M1JA 3FWLA 2FY8A 2ZJSE 1I54A 1OX3A 3O8ZA 3RGUA 2WSCJ 3AE3C 5KLVG 1MUUA 3BCCJ 5CBNA 5TJHA 2KNCB 1HTLC 4U3FG 4AUWA 1G2CB 3RK3D 1HJ3A 4L76A 2E5TA 4JF7A 3TYIA 1KILE 1RY3A 1LFMA 3P8CE 1L4AD 2E75B 5APTA 1L2PA 1QGKB 4C46A 1N2DC 2QM7A 3PHLA 1NTKD 1DIIC 2JO1A 3HD7C 1JCDA 1JY2P 1H9YA 1T6AA 1EZVD 1JCCA 1KB9H 3L72G 1HH0A 1CZQA 2OYHA 4DZOA 4PD4I 2YXQB 2ZYAA 4GDOA 2O3JA 1VQ7P 5APSA 1FZFA 1Q90D 3O5CA 4XYDB 2KUBA 4ASVA 1NTZG 1HJ0A 1YQ3C 1RZ5A 5CBOA 4H44C 4O9BA 5KTBA 3GLMA 1EXIA 1BSNA 3G3ZA 1FJKA 4LLHA 3B4SA 1IZL0 2FBWC 4MU8A 1YEAA 2BCCE 3LW5H 2FXPA 1SLQA 2E42A 1K05A 1I5TA 1C6OA 3M06A 1HVVA 3C8VA 1CIGA 2N1TB 1R5LA 2ZYGA 4Y5RA 3AEBC 2E74C 5AW7B 1CI6A 2W6BA 4DT0A 4QAOA 2E5YA 2NPSD 5KLIC 4B86A 2ZONG 1SQBD 2WPQA 3TGUG 2A06E 4H0LD 5KAFV 3L70G 1AQ5A 2N9YB 5AW0B 1FI9A 4BWNA 1M1JC 4EIDA 3C9IA 2IPPA 2GA1A 3RK3E 2C9XB 1DD3A 4FAVA 2AXCA 2K9JA 3I5CA 2E76B 2FYNB 3N4XA 2NPSA 1BCCG 3L75G 1J1DC 2B9BA 1VPCA 1CRGA 1FI3A 1BCCE 4Y28J 1N7LA 1T8ZA 5B5EV 1S72P 3KZIH 2OYIC 1LWUC 5DJQC 3L73G 2LXBA 1YBKA 1QN2A 1A02J 3CCVP 1C52A 1S5LE 2P67A 2PFXA 2WPSA 3O20A 3M0AA 1W5CT 1P84H 3OCDA 2Y0CA 4W80A 2FYZA 4PJ0V 2JDIH 1MG3D 4Q5PA 2CE1A 1YIJP 2HODB 1N73C 1DVVA 4L3HA 3RK2D 1FS0E 2NRGA 1PV3A 4AAMA 2R5DA 4EICA 3HQ9A 1PZQA 1SQPE 4LJIA 2AXTV 3VTPC 4PW9B 4KT0J 2ITAA 3PH0A 4EIJA 1KYOE 3RK3B 1A2SA 4H0LB 1NVOA 1YQ4C 4KMGA 4HH2A 3L4OA 2FYUK 2XV5A 2YMYA 3QWOC 1RH5B 2YIUB 2O1JA 3MUDC 4IOIH 1VQPP 1RE3A 1M57D 1NGMB 2HFED 1XTGB 3H1KE 5E79H 5CCGC 1S5LV 1ZMEC 1LP1A 2XNDH 1S6VB 1M60A 2WSSH 1P84D 2C1DA 1JOCA 5AVUB 4I2LC 1NKNA 3WUTA 1LT9C 1QLED 2M8RA 1LNQA 5KLIB 4K3IA 1IO4A 1M1KQ 3V2PA 2W8ZA 2B10B 3H25A 5CMZA 1KC8Q 1ZV8A 2QSIA 1H33A 2KYVA 3RLMA 4H0LC 3AEAC 3B8EB 4K35A 1CXAA 1YITP 1L0LG 1NTMJ 1SQXD 1JNMA 3AE8C 3V2RA 5B6QA 2N3BA 1OW7A 3RBZA 4AANA 1SFCA 5TISV 2N1TC 5KAFE 1RF1A 3B5ND 3H1IG 1CRIA 3BRTB 1FJ0A 2RKLA 1W2LA 2WWWA 2AXTE 2M5AB 3S1KA 1LTSC 4JBZA 1VQMP 2POHA 5APWA 5IY51 4WB4A 5EFWB 2AIUA 1GL2B 1AQTA 1L0LE 1MFZA 1YEBA 2KXPB 1Y47A 3B5NA 3WU2H 1E2RA 1OMIA 3V2NA 3NWVA 3G6EP 1BDDA 3OW2O 1BGYG 1KB0A 2N3YA 1FAVA 1T3UA 3CXHW 1NTKK 3B5NB 2FFDB 2GIWA 1YJ9P 1DVHA 3FXDA 5K5GB 1GTWA 1SQQJ 1DH3A 2OZ1A 2HPCB 5AVTB 3JSVC 1AOFA 1NU1J 3CCSP 3D70A 4XA4A 5AVSB 3UIAA 1PGQA 2L91A 1SQQE 1GL2C 3CC2P 3HD7D 3CWBJ 4EIEA 4OGQD 1LTGC 2ZAEB 2KIKA 5CCHA 1KX2A 1FU1A 2D2CD 5C0ZA 4C7NB 2WMMA 1E8EA 2GUSA 3H1JG 1NIRA 1RHZB 2Z4EA 3KZIV 5H2FH 4AAOA 2OTKE 2ZT9D 1PP9E 4WQ7A 1A02F 3AE1C 1S5LX 1SFCB 3L37A 4O1WA 3G4SP 2C0WA 3TF5A 1KN7A 3AEDC 1BGYE 4D6TG 3MUDA 3TNUB 3CL3D 3LIEA 1VQNP 2YQBA 1N86A 2H89C 3U1AA 4IL6H 1IFNA 1I8OA 2PGDA 2KI7B 2YO2A 1L0NE 2QA4P 2ZVOB 2YK3A 5CIEB 4K3AA 5KAFH 2OTLP 4PV1C 5DFSA 1I55A 2WQYC 5KLVJ 2IYPA 2Q6QA 1SS1A 2VRSA 2PCBB 3PXSA 1GDTA 2V08A 2FYUJ 1A56A 3H1JE 2GC7D 1X22A 3LIDA 2YIUC 1BCCD 1DD4A 1DW3A 2C1DB 1TU3F 1GKSA 2P7JA 3P8MC 4Y99C 1NU1G 4XFJA 5AW2B 3AEEC 1EDIA 1JO5A 3OA7A 1YJNP 2IZ1A 1FZBA 3D6ZA 4FA1A 1BSHA 2WVRA 3L72J 4TLFA 4L74A 3W68A 1J1DB 2CE0A 2GB8B 1I6DA 2FRCA 1N7SC 4EOTA 1DW0A 1JUNA 1URQA 1FHBA 3H1HG 2RH0A 1VL2A 1SQPD 1I8PA 3L72D 1RZ6A 3WFCC 4AALA 1KX7A 2Z5HA 2H7HA 1LTBC 4JQ0D 2K37A 3MD0A 1MV8A 3PH2B 3SSUA 4Y99B 2LXCB 4GEDB 1L0NK 2I1JA 2IX7C 3IAOA 2AEJA 1HBWA 1CO6A 2WT7B 3VYMA 2IFNA 3EFFK 1PP9J 3L71G 1QL3A 4FANA 3H1LD 3D0WA 2OGUA 1CIFA 1IFIA 4GT1A 2YKOA 2R44A 2KZIA 1NAYA 4JCGA 4N78D 3R2PA 1EB7A 3GHGC 4O1QA 1SQXJ 2G3AA 4GODA 3PTZA 1FZCB 4WQ9A 3GHGB 4J20A 2XDJA 3VP9A 3NBSA 1BE3G 2XZRA 1S5LH 2Q9IA 1COTA 1FOCA 3F5HA 1AYGA 2QJPC 2Q7CA 2K9JB 1JY2N 1EDLA 1BCCJ 1JM0A 1PPJG 2KS1B 1NTZJ 3AECC 1KB9E 2N18B 3HUSB 1RF1C 2JJLA 3GHGA 1U7JA 1RAPA 1FZCA 3KXDA 3L74E 1FCDC 2P10A 1AKKA 1DEEG 2D0WA 2N9JA 2A45H 3ZOYA 4DY9A 4GOEA 1C6RA 5B66V 3WFDC 1CC5A 2QE7H 2I8FA 4GOFA 4WQBA 5CJ4A 4UB6V 1CSXA 1T3JA 4XXLA 2JP3A 1K8AQ 3MGNA 3A0HV 1MG2D 1PFIA 1QEXA 3KYQA 5H2FE 2Q3IA 1FJPA 3L75E 3MHVA 2W83C 3HUSA 1JEKA 1G1IA 1N15A 3SWKA 5AVYB 3M9BA 2D0SA 2JWAA 1OZHA 3IN6A 3VOPA 5GTIV 3OAKA 2W6AA 1QKSA 5APVA 2XTSB 1JTHA 3PJSK 3CWBD 3NXSA 1IJDB 1URQB 3CXHE 4ZNCA 1JY3P 451CA 4KJMA 4HKZH 5DJQB 1L0LJ 1NTMG 1VQ4P 2BLFB 3SFEC 1GD2E 1FBMA 3RMZA 4YPCA 3AEFC 4LC1A 2IBZD 4HYTB 2E75C 3VMAA 1JY2O 4WQAA 1HZUA 2QJYB 1CXCA 1D7MA 1LC2A 2ORLA 2YNYA 1KTMA 3NTNA 2KOGA 3D71A 3W67A 1NHLA 2ZT9B 1CRCA 5C39A 3TGUD 2YKQA 1HGVA 2WT7A 1VQLP 1OW8A 1N9CA 3R4YA 3VYIA 1Q82Q 2B11B 3KPEA 2JKVA 4Z1MH 1H8AA 2QJKB 1SQVE 2QIWA 3BCCD 4IFFA 1FOSF 2O01J 4GIFA 1N73A 2A45G 3V4QA 2KNCA 4U7JA 2W6JH 3CX5E 3C1LA 3AEGC 1GU5A 1ZLLA 5AVXB 1IFDA 3GMAA 2N9BA 2J5UA 1SQQG 4EYYQ 2FYUE 3FWNA 1M1JB 2CK3H 3CMEP 1HH7A 2Y9ZA 1NNOA 3WUUA 5CICB 3SFDC 1LS9A 5BVZA 4ZKUA 2DGEA 3L73D 3Q5RA 3H1IE 3JC22 2N9IA 1J2JB 2YO3A 3L70J 1NJIQ 4A7PA 4I7ZB 5CIHB 1K3GA 1VYDA 1T2KD 3IR9A 3Q5PA 4IFDK 1KYOD 3HRNA 2BH4X 3ZIYA 3CC4P 2OYOA 1M8OB 3P32A 1YI2P 3CXHH 1FE6A 3GF3A 3I55P 1P84E 2O01N 1CTYA 3T97A 4IL6X 1H1OA 3KDPB 2OZ1B 4WWIA 1LTJB 3OJAB 5AVZB 2RMZA 2NZ2A 1S1CX 2ZT9C 1MZ9A 4OH8B 3H1LJ 3BVHA 3CP5A 3TNUA 2OYHC 2FYUG 2D2CC 2J59M 4WVZA 3ZOXA 2VHDA 2W27A 4U3FJ 1YNRA 4OGQC 2H8PD 3H1KG 5CIBB 2V7QJ 1NTKG 1PIXA 3ZOOA 1WT6A 3JCUE 1HROA 5KJ7D 1JMBA 3WUIA 2XU6A 3H1IJ 2OTJP 2OQQA 4TT3H 1NTKE 1LTJC 1IFPA 3CX5I 2KLVA 3U1CA 3RN1A 3WC8A 155CA 3CMAP 4WQCA 1X79B 1RF0A 4DJGA 5AW3B 2O01H 2CXBA 2BEZF 2L4DA 1H31B 3A0HH 2FYUD 1FDOA 2B88A 4NFGB 3L74J 2K3RA 2M3BA 1H89A 2LKMA 1LTJA 3HE5A 4WQ8A 4PJ0E 2P2UA 5APXA 1YHQP 4RKUJ
chains in the Genus database with same CATH topology
2V08A 1CSWA 1A56A 1HJ3A 2GC7D 1BCCD 1DW3A 3TYIA 2C1DB 1GKSA 1CHHA 1LFMA 2RN0A 3WU2V 3PHLA 5AURA 1NTKD 1YIQA 1DIIC 2GC4D 3DMIA 1NMIA 1H9YA 1EZVD 3PLNA 3ITKA 4FA1A 3VNWA 2LIRA 3GG2A 2CE0A 2O3JA 2GB8B 1N50A 1I6DA 2FRCA 4IL6V 3O5CA 1BGYD 4XYDB 1BE3D 3HQ6A 4YE1A 1DW0A 1DIQC 1H33B 1RZ5A 1FHBA 4N0KA 1GIWA 1SQPD 3MK7C 1I8PA 1NMLA 3L72D 1RZ6A 3OA8A 1M6ZA 1HCMA 1L9JC 2DVHA 3WFCC 4AALA 1KX7A 1FI7A 4U3FD 1PPJD 1IZL0 3VRDA 4D6TD 3PH2B 2QJPB 3ORVA 4MU8A 1YEAA 4GEDB 5EXQA 4H0JA 3L74D 1C2NA 1NTZD 3L70D 1CO6A 1I5TA 1C6OA 5CIDB 1C6SA 1GDVA 3VYMA 3NBTA 2ZXYA 3OCDB 5KLVD 2PACA 3CYTI 1QL3A 1CIGA 4FANA 1N90A 3H1LD 2B4ZA 4Y5RA 1CEDA 1CIFA 1IRVA 1CRJA 1C7MA 1CSUA 4QAOA 4JCGA 1CIHA 3HQ7A 4L3GA 4RJTA 1EB7A 2ZONG 1SQBD 4EIFA 4O1QA 1LC1A 1CCHA 5KAFV 3PTZA 3CXHD 2MTAC 2N9YB 2Y0EA 2C1UA 1FI9A 4WQ9A 1CYJA 2EXVA 3L71D 4J20A 4FB1A 1CHIA 3X39A 3NBSA 4EIDA 1IQCA 2C9XB 1COTA 4FAVA 1FOCA 2B12B 1AYGA 1JDLA 2K9JB 3GW6A 2B0ZB 4FA5A 2FYNB 1LMSA 1HZVA 3O1YA 2N18B 1U75B 1YICA 1DT1A 1HRCA 1QL4A 1CRGA 1RAPA 1CNOA 1FI3A 5B5EV 1NU1D 1FCDC 3A0BV 3M97X 1AKKA 1QYZA 2D0WA 1HJ4A 2N9JA 2HV4A 3O0RC 5DJQC 3ZOYA 4DY9A 5H2FV 1QN2A 2LITA 1C6RA 1YCCA 3WFDC 1CC5A 5B66V 1C52A 2I8FA 2MHMA 4WQBA 2QG4A 2FWLA 3KHUA 5GTHV 3CX5D 3O20A 3ZCFA 3ZOWA 4UB6V 1CSXA 1W5CT 3OCDA 4XXLA 1CHJA 2Y0CA 3A0HV 3DR0A 1MG2D 2BGVX 1SQVD 4PJ0V 2Q3EA 5C9MA 1WEJF 1MG3D 3L4MA 4Q5PA 2CE1A 1M70A 2BH5X 1N15A 1DVVA 5CYTR 4L3HA 2D0SA 1CRYA 2JWAA 2KS1A 1J3SA 3DP5A 2C2CA 3A9FA 3JBTB 4AAMA 5GTIV 1CYIA 4V2KA 4EICA 2PCCB 1QKSA 3HQ9A 3OA8B 2AI5A 2XTSB 1CSVA 3CWBD 5CIFB 1CTJA 4LJIA 1ETPA 2AXTV 451CA 4FA4A 4L1QA 4PW9B 5DJQB 2BLFB 1A8CA 4EDFA 3SJLA 3RMZA 1KB9D 3WFBC 2IBZD 1A2SA 5E79V 1IO3A 1HJ5A 3VMAA 3MK7B 4KMGA 1GQ1A 3L4OA 4WQAA 1HZUA 1H9XA 2QJYB 4H0KA 3SXTA 1CORA 2YIUB 1CXCA 1DW2A 2ORLA 1LC2A 1AOQA 1CTZA 5DF5A 1F1CA 1WVEC 1CRCA 1S5LV 3WFEC 3TGUD 5KAIV 3ZBMA 1N9CA 1M60A 1S6VB 1P84D 2B11B 2C1DA 2QJKB 1GU2A 3BCCD 1F1FA 2JTIB 1L0LD 2N18C 5KLIB 1R0QA 4K3IA 2ZOOA 3SWSA 4FA9A 1MZ4A 2B10B 1OCDA 1OAEA 1U74B 4WQDA 1H33A 3CU4A 1E29A 3L75D 3PRJA 3RLMA 1H31A 3SVWA 1CXAA 1HH7A 1KV9A 1SQXD 3TDKA 1NNOA 5CICB 2C1VA 1YFCA 1LS9A 5B6QA 2N3BA 2CA4B 4AANA 2DGEA 1H32B 4P4QB 5TISV 3L73D 1RAQA 2N9IA 1KIBA 1L0ND 4A7PA 4UB8V 1SQQD 4RSZA 4PWAA 1C75A 1CRIA 1FJ0A 1PP9D 4GYDA 5CIHB 1W2LA 1K3GA 1VYDA 3PXTA 2V07A 1B7VA 5KKZB 1KYOD 1C2RA 2JQRA 2BH4X 3ZIYA 5IY51 2AIUA 1IRWA 1CTYA 2BPBB 1I6EA 1K3HA 4PD4D 1H1OA 2OZ1B 1YEBA 3H1KD 5CIGB 4AX3A 3CX5W 1BL9A 2YCCA 3HQ8A 2RMZA 1YTCA 1E2RA 1NTMD 3NWVA 2Y0DA 3SLEA 3CP5A 1KB0A 1CRHA 2N3YA 3CXHW 3ZOXA 2VHDA 2GIWA 3H1HD 1YNRA 1DVHA 5CIBB 2OZ1A 3H1JD 3RN0A 3ZOOA 3C2CA 1AOFA 3H1ID 1HROA 1L9BC 351CA 3WUIA 2L91A 4WQEA 1CCRA 4EIEA 1ZRTD 2CA3B 1KX2A 5C0ZA 1E8EA 1NIRA 3RN1A 3WC8A 1CYCA 155CA 3KZIV 4WQCA 4AAOA 2A06D 1ZZHA 4WQ7A 1H32A 2ZZS1 2BCNB 4O1WA 1GJQA 3TF5A 2CXBA 1KYOW 1CIEA 2L4DA 1H31B 2BCCD 3FWLA 2YQBA 3PXWA 2FYUD 1I54A 1DW1A 1I8OA 4NFGB 2C8SA 2YK3A 5CIEB 5DFSA 4WQ8A 5TJHA 1I55A 2KNCB 2ZBOA 2PCBB 3PXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V08 A;  1CSW A;  1A56 A;  1HJ3 A;  2GC7 D;  1BCC D;  1DW3 A;  3TYI A;  2C1D B;  1GKS A;  1CHH A;  1LFM A;  2RN0 A;  3WU2 V;  3PHL A;  5AUR A;  1NTK D;  1YIQ A;  1DII C;  2GC4 D;  3DMI A;  1NMI A;  1H9Y A;  1EZV D;  3PLN A;  3ITK A;  4FA1 A;  3VNW A;  2LIR A;  3GG2 A;  2CE0 A;  2O3J A;  2GB8 B;  1N50 A;  1I6D A;  2FRC A;  4IL6 V;  3O5C A;  1BGY D;  4XYD B;  1BE3 D;  3HQ6 A;  4YE1 A;  1DW0 A;  1DIQ C;  1H33 B;  1RZ5 A;  1FHB A;  4N0K A;  1GIW A;  1SQP D;  3MK7 C;  1I8P A;  1NML A;  3L72 D;  1RZ6 A;  3OA8 A;  1M6Z A;  1HCM A;  1L9J C;  2DVH A;  3WFC C;  4AAL A;  1KX7 A;  1FI7 A;  4U3F D;  1PPJ D;  1IZL 0;  3VRD A;  4D6T D;  3PH2 B;  2QJP B;  3ORV A;  4MU8 A;  1YEA A;  4GED B;  5EXQ A;  4H0J A;  3L74 D;  1C2N A;  1NTZ D;  3L70 D;  1CO6 A;  1I5T A;  1C6O A;  5CID B;  1C6S A;  1GDV A;  3VYM A;  3NBT A;  2ZXY A;  3OCD B;  5KLV D;  2PAC A;  3CYT I;  1QL3 A;  1CIG A;  4FAN A;  1N90 A;  3H1L D;  2B4Z A;  4Y5R A;  1CED A;  1CIF A;  1IRV A;  1CRJ A;  1C7M A;  1CSU A;  4QAO A;  4JCG A;  1CIH A;  3HQ7 A;  4L3G A;  4RJT A;  1EB7 A;  2ZON G;  1SQB D;  4EIF A;  4O1Q A;  1LC1 A;  1CCH A;  5KAF V;  3PTZ A;  3CXH D;  2MTA C;  2N9Y B;  2Y0E A;  2C1U A;  1FI9 A;  4WQ9 A;  1CYJ A;  2EXV A;  3L71 D;  4J20 A;  4FB1 A;  1CHI A;  3X39 A;  3NBS A;  4EID A;  1IQC A;  2C9X B;  1COT A;  4FAV A;  1FOC A;  2B12 B;  1AYG A;  1JDL A;  2K9J B;  3GW6 A;  2B0Z B;  4FA5 A;  2FYN B;  1LMS A;  1HZV A;  3O1Y A;  2N18 B;  1U75 B;  1YIC A;  1DT1 A;  1HRC A;  1QL4 A;  1CRG A;  1RAP A;  1CNO A;  1FI3 A;  5B5E V;  1NU1 D;  1FCD C;  3A0B V;  3M97 X;  1AKK A;  1QYZ A;  2D0W A;  1HJ4 A;  2N9J A;  2HV4 A;  3O0R C;  5DJQ C;  3ZOY A;  4DY9 A;  5H2F V;  1QN2 A;  2LIT A;  1C6R A;  1YCC A;  3WFD C;  1CC5 A;  5B66 V;  1C52 A;  2I8F A;  2MHM A;  4WQB A;  2QG4 A;  2FWL A;  3KHU A;  5GTH V;  3CX5 D;  3O20 A;  3ZCF A;  3ZOW A;  4UB6 V;  1CSX A;  1W5C T;  3OCD A;  4XXL A;  1CHJ A;  2Y0C A;  3A0H V;  3DR0 A;  1MG2 D;  2BGV X;  1SQV D;  4PJ0 V;  2Q3E A;  5C9M A;  1WEJ F;  1MG3 D;  3L4M A;  4Q5P A;  2CE1 A;  1M70 A;  2BH5 X;  1N15 A;  1DVV A;  5CYT R;  4L3H A;  2D0S A;  1CRY A;  2JWA A;  2KS1 A;  1J3S A;  3DP5 A;  2C2C A;  3A9F A;  3JBT B;  4AAM A;  5GTI V;  1CYI A;  4V2K A;  4EIC A;  2PCC B;  1QKS A;  3HQ9 A;  3OA8 B;  2AI5 A;  2XTS B;  1CSV A;  3CWB D;  5CIF B;  1CTJ A;  4LJI A;  1ETP A;  2AXT V;  451C A;  4FA4 A;  4L1Q A;  4PW9 B;  5DJQ B;  2BLF B;  1A8C A;  4EDF A;  3SJL A;  3RMZ A;  1KB9 D;  3WFB C;  2IBZ D;  1A2S A;  5E79 V;  1IO3 A;  1HJ5 A;  3VMA A;  3MK7 B;  4KMG A;  1GQ1 A;  3L4O A;  4WQA A;  1HZU A;  1H9X A;  2QJY B;  4H0K A;  3SXT A;  1COR A;  2YIU B;  1CXC A;  1DW2 A;  2ORL A;  1LC2 A;  1AOQ A;  1CTZ A;  5DF5 A;  1F1C A;  1WVE C;  1CRC A;  1S5L V;  3WFE C;  3TGU D;  5KAI V;  3ZBM A;  1N9C A;  1M60 A;  1S6V B;  1P84 D;  2B11 B;  2C1D A;  2QJK B;  1GU2 A;  3BCC D;  1F1F A;  2JTI B;  1L0L D;  2N18 C;  5KLI B;  1R0Q A;  4K3I A;  2ZOO A;  3SWS A;  4FA9 A;  1MZ4 A;  2B10 B;  1OCD A;  1OAE A;  1U74 B;  4WQD A;  1H33 A;  3CU4 A;  1E29 A;  3L75 D;  3PRJ A;  3RLM A;  1H31 A;  3SVW A;  1CXA A;  1HH7 A;  1KV9 A;  1SQX D;  3TDK A;  1NNO A;  5CIC B;  2C1V A;  1YFC A;  1LS9 A;  5B6Q A;  2N3B A;  2CA4 B;  4AAN A;  2DGE A;  1H32 B;  4P4Q B;  5TIS V;  3L73 D;  1RAQ A;  2N9I A;  1KIB A;  1L0N D;  4A7P A;  4UB8 V;  1SQQ D;  4RSZ A;  4PWA A;  1C75 A;  1CRI A;  1FJ0 A;  1PP9 D;  4GYD A;  5CIH B;  1W2L A;  1K3G A;  1VYD A;  3PXT A;  2V07 A;  1B7V A;  5KKZ B;  1KYO D;  1C2R A;  2JQR A;  2BH4 X;  3ZIY A;  5IY5 1;  2AIU A;  1IRW A;  1CTY A;  2BPB B;  1I6E A;  1K3H A;  4PD4 D;  1H1O A;  2OZ1 B;  1YEB A;  3H1K D;  5CIG B;  4AX3 A;  3CX5 W;  1BL9 A;  2YCC A;  3HQ8 A;  2RMZ A;  1YTC A;  1E2R A;  1NTM D;  3NWV A;  2Y0D A;  3SLE A;  3CP5 A;  1KB0 A;  1CRH A;  2N3Y A;  3CXH W;  3ZOX A;  2VHD A;  2GIW A;  3H1H D;  1YNR A;  1DVH A;  5CIB B;  2OZ1 A;  3H1J D;  3RN0 A;  3ZOO A;  3C2C A;  1AOF A;  3H1I D;  1HRO A;  1L9B C;  351C A;  3WUI A;  2L91 A;  4WQE A;  1CCR A;  4EIE A;  1ZRT D;  2CA3 B;  1KX2 A;  5C0Z A;  1E8E A;  1NIR A;  3RN1 A;  3WC8 A;  1CYC A;  155C A;  3KZI V;  4WQC A;  4AAO A;  2A06 D;  1ZZH A;  4WQ7 A;  1H32 A;  2ZZS 1;  2BCN B;  4O1W A;  1GJQ A;  3TF5 A;  2CXB A;  1KYO W;  1CIE A;  2L4D A;  1H31 B;  2BCC D;  3FWL A;  2YQB A;  3PXW A;  2FYU D;  1I54 A;  1DW1 A;  1I8O A;  4NFG B;  2C8S A;  2YK3 A;  5CIE B;  5DFS A;  4WQ8 A;  5TJH A;  1I55 A;  2KNC B;  2ZBO A;  2PCB B;  3PXS A; 
#chains in the Genus database with same CATH topology
 5GTI H;  1FZE A;  1CSW A;  3B71 A;  3L73 E;  3TSI A;  4C7R A;  3QH9 A;  3VMZ A;  3FXE A;  3BAT A;  3KQG A;  2P1J A;  2RN0 A;  3WU2 V;  1EC5 A;  3WU2 E;  1YIQ A;  2W90 A;  2GC4 D;  1HWT C;  2B89 A;  3PLN A;  1NTM K;  3ITK A;  2HG5 D;  4HJG H;  2BEQ D;  3CD6 P;  2QEX P;  1VF5 B;  1SQB J;  1N50 A;  5APU A;  4IL6 V;  1BGY D;  4YE1 A;  1NTM E;  2KSE A;  4UB6 H;  1JY3 O;  1Q7Y Q;  2ZYD A;  4MN4 C;  4WY4 C;  3L75 J;  1KOR A;  1FI7 A;  1N73 B;  4U3F D;  1KB9 I;  3VRD A;  1BGY J;  1S9K D;  1NO4 A;  4H0J A;  2ZXX A;  1GL2 D;  1C6S A;  1GDV A;  1L0N J;  3NBT A;  3OCD B;  5KLV D;  1EDJ A;  4W7Y A;  1LGH B;  2WSE J;  1N90 A;  5CCH D;  1CED A;  2FXM A;  2Q5U A;  4DCK A;  2IYO A;  1KIL C;  1CRJ A;  1EZV G;  1CIH A;  3HQ7 A;  4L3G A;  1X0T A;  3CCE P;  5KKZ C;  1CSB A;  4N3Y B;  1LC1 A;  1EXJ A;  4PJ0 H;  1CCH A;  2MTA C;  2Y0E A;  5AVW B;  3D6Y A;  1BE3 J;  3MZW B;  3L71 D;  3RL0 B;  3Q1M A;  1NOH A;  3AE4 C;  5AW8 B;  1NWQ A;  2NPS B;  4JYB A;  2HLO A;  1IZN B;  5AW4 B;  1JTH B;  1GU4 A;  2B12 B;  1M7L A;  3L72 E;  1OFC X;  4D6T J;  2B0Z B;  1AFO A;  4H13 C;  1LMS A;  3CCL P;  4UB8 E;  3S4R A;  5CHX A;  1HZV A;  1M90 Q;  1PGO A;  2HOD A;  1U75 B;  4OVN F;  1AVY A;  1QL4 A;  1SQP J;  1S3J A;  1CNO A;  1LJ2 A;  3CC7 P;  1NU1 D;  3KZI E;  3A0B V;  1LWU A;  1SQV G;  2WTY A;  3M97 X;  2E76 D;  1QYZ A;  2KB7 P;  1HJ4 A;  3E1I A;  1Y9B A;  2HV4 A;  3O0R C;  4AYC A;  5H2F V;  2KSJ A;  1OVU A;  1WRG A;  1IK7 A;  2LIT A;  5AVR B;  1CI6 B;  2MHM A;  2QG4 A;  1ZR2 A;  2WIT A;  5AW1 B;  3ZOW A;  4LGD E;  3I56 P;  1CHJ A;  3DR0 A;  1H88 A;  2BGV X;  2Q3E A;  1WEJ F;  3L4M A;  1RQV A;  2KS1 A;  3IFM A;  1J3S A;  2IBZ G;  3A9F A;  1RE3 C;  2OAR A;  3N7N A;  1BE3 E;  3JBT B;  3OA8 B;  2PCC B;  1E5W A;  2AI5 A;  1CSV A;  1PGP A;  5CIF B;  4EI2 A;  1ETP A;  3AE2 C;  4FA4 A;  3AE9 C;  3SJL A;  4D6T E;  1KB9 D;  4N6J A;  5BU8 B;  1VQ6 P;  2AEF A;  2JWD A;  2K1A A;  3HTK B;  2CPS A;  1IO3 A;  5KAI H;  1NU1 K;  2SPZ A;  4H44 B;  1GQ1 A;  1X9V A;  1NTZ K;  5B5E E;  2R32 A;  2E76 C;  1S2E A;  2KZJ A;  1AOQ A;  2LR2 A;  1U7M A;  1OW6 A;  2N1T A;  5DF5 A;  1GZL A;  3VMY A;  1F1C A;  1WVE C;  1OVR A;  1JB0 J;  3G9R A;  3WMM 0;  3MP7 B;  1EDK A;  1LT1 A;  2JTI B;  5AVQ B;  2N18 C;  1VQ9 P;  2IFM A;  2WZ7 A;  1BDC A;  2A06 G;  1T2K C;  1VQK P;  2ZOO A;  2WSF H;  3SWS A;  3CPW O;  1OCD A;  2WSE H;  1FZC C;  1N7S D;  1U74 B;  4WQD A;  1UII A;  3CU4 A;  1E29 A;  3PRJ A;  1AA0 A;  1KQG B;  1FC2 C;  2KK7 A;  1ZOY C;  1FZA A;  5GTH H;  3G71 P;  3TDK A;  4M3L A;  5KLV K;  1YFC A;  2CA4 B;  1PL5 A;  1H32 B;  3O6Q B;  2WSF J;  1KYO I;  1KIB A;  4OGQ B;  2M3E A;  4UB8 V;  1SQQ D;  4PWA A;  1C75 A;  3L36 A;  2K9Y A;  1YTZ I;  1K73 Q;  4GYD A;  1H0T A;  1N7S A;  1B7V A;  5KKZ B;  2IBZ E;  2ZXE B;  3TGU E;  1LT9 A;  3M91 A;  1DIP A;  1VF5 D;  1KIL B;  3V5B A;  2ZFC A;  2BPB B;  3CWB E;  1L0N G;  2I8D A;  3BRV B;  1I6E A;  3VP8 A;  1Z56 A;  3H1K D;  4UB6 E;  3CX5 W;  2N1T D;  4RO0 A;  3WUV A;  4W7Z A;  1DEB A;  1YJW P;  1NTM D;  2BCC G;  1AV1 A;  1CRH A;  1GMJ A;  3HE4 A;  1KFN A;  1DX7 A;  4BXL A;  1RF0 C;  3F89 A;  2BAS A;  4JYC A;  5CCG A;  5BU5 A;  2WPV B;  3FGA D;  1S9K E;  5AW5 B;  2E43 A;  5TIS H;  3RN0 A;  2MKV A;  4C7N A;  3H1I D;  3L35 A;  1NTZ E;  1VQ5 P;  1KIL D;  3U59 A;  1HJB A;  3Q5S A;  1VDF A;  4OWF A;  1FZG A;  351C A;  1N8R Q;  5KLV E;  2IZ0 A;  1SQX E;  1SQX G;  1PPJ E;  1VF5 C;  1ZRT D;  2CA3 B;  1N7S B;  2QRX A;  1H0T B;  3NMD A;  1URQ D;  1UIX A;  1HUC A;  3P7K A;  3Q2Y A;  3A0B E;  1KV4 A;  2Z5I A;  4WY4 B;  2HPC A;  3CXH I;  1ZZH A;  1Y8A A;  1VQ8 P;  1WMK A;  3CCM P;  1GJQ A;  1MFT A;  2FFD A;  1KYO W;  3SWF A;  3MIW A;  2WSC H;  2E74 B;  3E1R A;  4GKG A;  5GTH E;  2BCC D;  3RBX A;  3PXW A;  4I7Z C;  1DW1 A;  3S9O A;  1Q86 Q;  1L4A B;  1SQP G;  2E75 D;  2OYI B;  2C8S A;  1Q2N A;  1ZR4 A;  4L73 A;  1ZXG A;  3CCU P;  1URQ C;  2ZBO A;  1GL2 A;  4KHX A;  4YXW H;  2IBZ I;  1PP9 G;  5GTI E;  4PD4 H;  1CHH A;  2KP8 A;  2M5A A;  4R4L A;  5KJ7 C;  3M0D A;  2FYN C;  4L75 A;  3H1L G;  1IC2 A;  5AUR A;  4N78 E;  1RF1 B;  3DMI A;  1NMI A;  1SQV K;  1SQB E;  3VNW A;  2D2C B;  1KZU B;  1K04 A;  1LTA C;  3H1K J;  2LIR A;  1L4A C;  2Q1K A;  3HTK A;  3GG2 A;  3A5T A;  1X8Y A;  5DJT B;  4BRY B;  1RE4 A;  3FX0 A;  4I6M C;  1K9M Q;  3VN0 A;  1EZV I;  5CCG D;  1BE3 D;  3HQ6 A;  1DIQ C;  1H33 B;  3RL0 g;  4N0K A;  1GIW A;  3H32 B;  3MK7 C;  1NML A;  2XNX A;  3OA8 A;  3AE5 C;  2R5B A;  1M6Z A;  1HCM A;  2FKW B;  1L9J C;  2DVH A;  2QVA A;  3RL0 D;  3V2Q A;  3HD7 A;  5APQ A;  3RL0 C;  1PPJ D;  4D6T D;  2QJY C;  2QJP B;  3ORV A;  2UWJ E;  1R8E A;  4YXD C;  3A2A A;  5EXQ A;  2HR3 A;  3L74 D;  1C2N A;  3B5N C;  1NTZ D;  3L70 D;  5CID B;  1LP1 B;  3E7K A;  2ZXY A;  1NTK J;  2HYN A;  1Q81 Q;  2PAC A;  3CYT I;  2V4H A;  3CCQ P;  2B4Z A;  4PV1 B;  1P84 I;  1IRV A;  1C7M A;  4JPZ B;  1CSU A;  1ZW0 A;  3RK2 B;  2C9L Y;  4RJT A;  1KQF B;  1KYO H;  4EIF A;  1LWU B;  3JCU H;  3CXH D;  2C1U A;  1CYJ A;  2EXV A;  4FB1 A;  1CHI A;  3X39 A;  1ZP0 C;  1E79 H;  1L0L K;  2PP6 A;  1IQC A;  1S4X A;  2JR8 A;  1JDL A;  4ASW A;  1SQB G;  2R3S A;  3GW6 A;  4FA5 A;  5DJU B;  1MKM A;  3BAS A;  1OWA A;  3CCR P;  3O1Y A;  1YIC A;  3CCJ P;  1DT1 A;  1HRC A;  2GUV A;  3L74 G;  5CCH C;  3LW5 J;  1JY3 N;  1SQP K;  1CW5 A;  1GW4 A;  5CJ0 A;  4NPD A;  3V4W A;  2P58 A;  1SQV J;  1W2B O;  1YCC A;  2C0X A;  2CPB A;  1USE A;  2FWL A;  1AVO A;  1JMM A;  3KHU A;  5GTH V;  3EWK A;  3CX5 D;  1GK4 A;  4IFM A;  3ZCF A;  1HF9 A;  1GW3 A;  1SQB K;  1EZV E;  3AE7 C;  1FOS E;  2K88 A;  3CX5 H;  2H88 C;  4WY4 D;  1SQV D;  3ZDM A;  1QL1 A;  2YKP A;  3NFQ A;  3K5B A;  5C9M A;  2QM8 A;  1M70 A;  2BH5 X;  4UB8 H;  4PD4 E;  5CYT R;  3L4F A;  1CRY A;  3DP5 A;  1LTT C;  2C2C A;  4U3F E;  3HD7 B;  1SFC C;  3TGU J;  4QMA A;  1CYI A;  2ZVN B;  4V2K A;  3VMX A;  2MJZ A;  2QJK C;  1CTJ A;  2IDB A;  3M9H A;  3L70 E;  1J1E B;  4PV1 D;  4L1Q A;  2A45 I;  1W2E A;  3L71 E;  1KMI Z;  5L8R J;  5TIS E;  3GF7 A;  2WPR A;  1A8C A;  4EDF A;  4CPG A;  3SWY A;  2Y9Y A;  1EQ7 A;  3WFB C;  3H1H J;  5E79 V;  5E79 E;  4DOJ A;  1HJ5 A;  1RE4 C;  3MK7 B;  1AJY A;  2PAJ A;  3SXT A;  1H9X A;  4H0K A;  1IFJ A;  1U57 A;  1COR A;  1DW2 A;  2G8Y A;  3H1H E;  3H1J J;  3L73 J;  1CTZ A;  2BCC J;  2FXO A;  1QL2 A;  3CLQ A;  1ZRT E;  3TYY A;  3WFE C;  2DW3 A;  3HUS C;  5KAI V;  3ZBM A;  5B66 E;  4NPF X;  3Q3D A;  3A7O A;  2I1K A;  3M0D C;  1SVF A;  4H44 D;  2E74 D;  1XTC C;  4H13 D;  1GU2 A;  1F1F A;  1L0L D;  1QVF O;  2V7Q H;  1USD A;  3AE6 C;  3H6P A;  3TK1 A;  4RES B;  1R0Q A;  3HE5 B;  2YXR B;  4AQR D;  4FA9 A;  1MZ4 A;  3H32 A;  1SP4 A;  1L4A A;  1OAE A;  5KAI E;  3CWB G;  1RQU A;  1KQS O;  1YTZ T;  1NU1 E;  3L75 D;  2J58 A;  1H31 A;  1M56 D;  2NPS C;  3SVW A;  1W5C E;  4YTP C;  4BRY A;  1KV9 A;  2C1V A;  2OYH B;  1IK9 A;  4IL6 E;  4P4Q B;  1SFC D;  1QVG O;  1RAQ A;  4WY4 A;  1L0N D;  4RSZ A;  1QX8 A;  2H43 A;  4H13 B;  1PP9 D;  2M0B A;  3II6 A;  3PXT A;  2V07 A;  4XE5 B;  3A3Y B;  1C2R A;  2JQR A;  2JEE A;  2R3C A;  3PP5 A;  4ZMD A;  1GK6 A;  1NH4 A;  2GM4 A;  1J1E C;  3P8C D;  1G2C A;  1IRW A;  3IF4 A;  4WBA A;  1K3H A;  4PD4 D;  1KFM A;  2C9N Y;  3L71 J;  2KLU A;  5CIG B;  4AX3 A;  1ZN5 A;  1BL9 A;  1NYH A;  2OYI A;  2YCC A;  1YYC A;  3HQ8 A;  3M9Q A;  4ZKP A;  1YTC A;  3HE4 B;  1SQQ K;  2O1K A;  5B5E H;  1VQO P;  2Y0D A;  1R5S A;  3SLE A;  3BCC E;  3BCC G;  4HB1 A;  3V6I A;  2AXT H;  4R4M A;  2B87 B;  1OVV A;  3H1H D;  1NKZ B;  3EQ2 A;  1NAF A;  1SQX K;  1G1J A;  3H1J D;  2FFD C;  3T97 B;  3RK2 C;  1LTI C;  5AW6 B;  1KQL A;  3C2C A;  3ABV C;  3USS A;  1L9B C;  1OXZ A;  1KIL A;  2L5G B;  4WQE A;  1LT9 B;  3RK3 C;  1CCR A;  4I1L A;  2XKM A;  3MTU E;  2YMK A;  2AEM A;  3A0H E;  1CYC A;  1HGZ A;  1FDM A;  2A06 D;  3EFG A;  3O6Q A;  5B66 H;  1H32 A;  3H1L E;  3A0B H;  2ZZS 1;  5AVV B;  1KD1 Q;  4NPE A;  2BCN B;  1IFM A;  2B87 A;  1FDI A;  1PGJ A;  1OIP A;  3CI9 A;  5APY A;  5KJ7 A;  5M1B A;  1CIE A;  2PRR A;  5AW9 B;  1M1J A;  3FWL A;  2FY8 A;  2ZJS E;  1I54 A;  1OX3 A;  3O8Z A;  3RGU A;  2WSC J;  3AE3 C;  5KLV G;  1MUU A;  3BCC J;  5CBN A;  5TJH A;  2KNC B;  1HTL C;  4U3F G;  4AUW A;  1G2C B;  3RK3 D;  1HJ3 A;  4L76 A;  2E5T A;  4JF7 A;  3TYI A;  1KIL E;  1RY3 A;  1LFM A;  3P8C E;  1L4A D;  2E75 B;  5APT A;  1L2P A;  1QGK B;  4C46 A;  1N2D C;  2QM7 A;  3PHL A;  1NTK D;  1DII C;  2JO1 A;  3HD7 C;  1JCD A;  1JY2 P;  1H9Y A;  1T6A A;  1EZV D;  1JCC A;  1KB9 H;  3L72 G;  1HH0 A;  1CZQ A;  2OYH A;  4DZO A;  4PD4 I;  2YXQ B;  2ZYA A;  4GDO A;  2O3J A;  1VQ7 P;  5APS A;  1FZF A;  1Q90 D;  3O5C A;  4XYD B;  2KUB A;  4ASV A;  1NTZ G;  1HJ0 A;  1YQ3 C;  1RZ5 A;  5CBO A;  4H44 C;  4O9B A;  5KTB A;  3GLM A;  1EXI A;  1BSN A;  3G3Z A;  1FJK A;  4LLH A;  3B4S A;  1IZL 0;  2FBW C;  4MU8 A;  1YEA A;  2BCC E;  3LW5 H;  2FXP A;  1SLQ A;  2E42 A;  1K05 A;  1I5T A;  1C6O A;  3M06 A;  1HVV A;  3C8V A;  1CIG A;  2N1T B;  1R5L A;  2ZYG A;  4Y5R A;  3AEB C;  2E74 C;  5AW7 B;  1CI6 A;  2W6B A;  4DT0 A;  4QAO A;  2E5Y A;  2NPS D;  5KLI C;  4B86 A;  2ZON G;  1SQB D;  2WPQ A;  3TGU G;  2A06 E;  4H0L D;  5KAF V;  3L70 G;  1AQ5 A;  2N9Y B;  5AW0 B;  1FI9 A;  4BWN A;  1M1J C;  4EID A;  3C9I A;  2IPP A;  2GA1 A;  3RK3 E;  2C9X B;  1DD3 A;  4FAV A;  2AXC A;  2K9J A;  3I5C A;  2E76 B;  2FYN B;  3N4X A;  2NPS A;  1BCC G;  3L75 G;  1J1D C;  2B9B A;  1VPC A;  1CRG A;  1FI3 A;  1BCC E;  4Y28 J;  1N7L A;  1T8Z A;  5B5E V;  1S72 P;  3KZI H;  2OYI C;  1LWU C;  5DJQ C;  3L73 G;  2LXB A;  1YBK A;  1QN2 A;  1A02 J;  3CCV P;  1C52 A;  1S5L E;  2P67 A;  2PFX A;  2WPS A;  3O20 A;  3M0A A;  1W5C T;  1P84 H;  3OCD A;  2Y0C A;  4W80 A;  2FYZ A;  4PJ0 V;  2JDI H;  1MG3 D;  4Q5P A;  2CE1 A;  1YIJ P;  2HOD B;  1N73 C;  1DVV A;  4L3H A;  3RK2 D;  1FS0 E;  2NRG A;  1PV3 A;  4AAM A;  2R5D A;  4EIC A;  3HQ9 A;  1PZQ A;  1SQP E;  4LJI A;  2AXT V;  3VTP C;  4PW9 B;  4KT0 J;  2ITA A;  3PH0 A;  4EIJ A;  1KYO E;  3RK3 B;  1A2S A;  4H0L B;  1NVO A;  1YQ4 C;  4KMG A;  4HH2 A;  3L4O A;  2FYU K;  2XV5 A;  2YMY A;  3QWO C;  1RH5 B;  2YIU B;  2O1J A;  3MUD C;  4IOI H;  1VQP P;  1RE3 A;  1M57 D;  1NGM B;  2HFE D;  1XTG B;  3H1K E;  5E79 H;  5CCG C;  1S5L V;  1ZME C;  1LP1 A;  2XND H;  1S6V B;  1M60 A;  2WSS H;  1P84 D;  2C1D A;  1JOC A;  5AVU B;  4I2L C;  1NKN A;  3WUT A;  1LT9 C;  1QLE D;  2M8R A;  1LNQ A;  5KLI B;  4K3I A;  1IO4 A;  1M1K Q;  3V2P A;  2W8Z A;  2B10 B;  3H25 A;  5CMZ A;  1KC8 Q;  1ZV8 A;  2QSI A;  1H33 A;  2KYV A;  3RLM A;  4H0L C;  3AEA C;  3B8E B;  4K35 A;  1CXA A;  1YIT P;  1L0L G;  1NTM J;  1SQX D;  1JNM A;  3AE8 C;  3V2R A;  5B6Q A;  2N3B A;  1OW7 A;  3RBZ A;  4AAN A;  1SFC A;  5TIS V;  2N1T C;  5KAF E;  1RF1 A;  3B5N D;  3H1I G;  1CRI A;  3BRT B;  1FJ0 A;  2RKL A;  1W2L A;  2WWW A;  2AXT E;  2M5A B;  3S1K A;  1LTS C;  4JBZ A;  1VQM P;  2POH A;  5APW A;  5IY5 1;  4WB4 A;  5EFW B;  2AIU A;  1GL2 B;  1AQT A;  1L0L E;  1MFZ A;  1YEB A;  2KXP B;  1Y47 A;  3B5N A;  3WU2 H;  1E2R A;  1OMI A;  3V2N A;  3NWV A;  3G6E P;  1BDD A;  3OW2 O;  1BGY G;  1KB0 A;  2N3Y A;  1FAV A;  1T3U A;  3CXH W;  1NTK K;  3B5N B;  2FFD B;  2GIW A;  1YJ9 P;  1DVH A;  3FXD A;  5K5G B;  1GTW A;  1SQQ J;  1DH3 A;  2OZ1 A;  2HPC B;  5AVT B;  3JSV C;  1AOF A;  1NU1 J;  3CCS P;  3D70 A;  4XA4 A;  5AVS B;  3UIA A;  1PGQ A;  2L91 A;  1SQQ E;  1GL2 C;  3CC2 P;  3HD7 D;  3CWB J;  4EIE A;  4OGQ D;  1LTG C;  2ZAE B;  2KIK A;  5CCH A;  1KX2 A;  1FU1 A;  2D2C D;  5C0Z A;  4C7N B;  2WMM A;  1E8E A;  2GUS A;  3H1J G;  1NIR A;  1RHZ B;  2Z4E A;  3KZI V;  5H2F H;  4AAO A;  2OTK E;  2ZT9 D;  1PP9 E;  4WQ7 A;  1A02 F;  3AE1 C;  1S5L X;  1SFC B;  3L37 A;  4O1W A;  3G4S P;  2C0W A;  3TF5 A;  1KN7 A;  3AED C;  1BGY E;  4D6T G;  3MUD A;  3TNU B;  3CL3 D;  3LIE A;  1VQN P;  2YQB A;  1N86 A;  2H89 C;  3U1A A;  4IL6 H;  1IFN A;  1I8O A;  2PGD A;  2KI7 B;  2YO2 A;  1L0N E;  2QA4 P;  2ZVO B;  2YK3 A;  5CIE B;  4K3A A;  5KAF H;  2OTL P;  4PV1 C;  5DFS A;  1I55 A;  2WQY C;  5KLV J;  2IYP A;  2Q6Q A;  1SS1 A;  2VRS A;  2PCB B;  3PXS A;  1GDT A;  2V08 A;  2FYU J;  1A56 A;  3H1J E;  2GC7 D;  1X22 A;  3LID A;  2YIU C;  1BCC D;  1DD4 A;  1DW3 A;  2C1D B;  1TU3 F;  1GKS A;  2P7J A;  3P8M C;  4Y99 C;  1NU1 G;  4XFJ A;  5AW2 B;  3AEE C;  1EDI A;  1JO5 A;  3OA7 A;  1YJN P;  2IZ1 A;  1FZB A;  3D6Z A;  4FA1 A;  1BSH A;  2WVR A;  3L72 J;  4TLF A;  4L74 A;  3W68 A;  1J1D B;  2CE0 A;  2GB8 B;  1I6D A;  2FRC A;  1N7S C;  4EOT A;  1DW0 A;  1JUN A;  1URQ A;  1FHB A;  3H1H G;  2RH0 A;  1VL2 A;  1SQP D;  1I8P A;  3L72 D;  1RZ6 A;  3WFC C;  4AAL A;  1KX7 A;  2Z5H A;  2H7H A;  1LTB C;  4JQ0 D;  2K37 A;  3MD0 A;  1MV8 A;  3PH2 B;  3SSU A;  4Y99 B;  2LXC B;  4GED B;  1L0N K;  2I1J A;  2IX7 C;  3IAO A;  2AEJ A;  1HBW A;  1CO6 A;  2WT7 B;  3VYM A;  2IFN A;  3EFF K;  1PP9 J;  3L71 G;  1QL3 A;  4FAN A;  3H1L D;  3D0W A;  2OGU A;  1CIF A;  1IFI A;  4GT1 A;  2YKO A;  2R44 A;  2KZI A;  1NAY A;  4JCG A;  4N78 D;  3R2P A;  1EB7 A;  3GHG C;  4O1Q A;  1SQX J;  2G3A A;  4GOD A;  3PTZ A;  1FZC B;  4WQ9 A;  3GHG B;  4J20 A;  2XDJ A;  3VP9 A;  3NBS A;  1BE3 G;  2XZR A;  1S5L H;  2Q9I A;  1COT A;  1FOC A;  3F5H A;  1AYG A;  2QJP C;  2Q7C A;  2K9J B;  1JY2 N;  1EDL A;  1BCC J;  1JM0 A;  1PPJ G;  2KS1 B;  1NTZ J;  3AEC C;  1KB9 E;  2N18 B;  3HUS B;  1RF1 C;  2JJL A;  3GHG A;  1U7J A;  1RAP A;  1FZC A;  3KXD A;  3L74 E;  1FCD C;  2P10 A;  1AKK A;  1DEE G;  2D0W A;  2N9J A;  2A45 H;  3ZOY A;  4DY9 A;  4GOE A;  1C6R A;  5B66 V;  3WFD C;  1CC5 A;  2QE7 H;  2I8F A;  4GOF A;  4WQB A;  5CJ4 A;  4UB6 V;  1CSX A;  1T3J A;  4XXL A;  2JP3 A;  1K8A Q;  3MGN A;  3A0H V;  1MG2 D;  1PFI A;  1QEX A;  3KYQ A;  5H2F E;  2Q3I A;  1FJP A;  3L75 E;  3MHV A;  2W83 C;  3HUS A;  1JEK A;  1G1I A;  1N15 A;  3SWK A;  5AVY B;  3M9B A;  2D0S A;  2JWA A;  1OZH A;  3IN6 A;  3VOP A;  5GTI V;  3OAK A;  2W6A A;  1QKS A;  5APV A;  2XTS B;  1JTH A;  3PJS K;  3CWB D;  3NXS A;  1IJD B;  1URQ B;  3CXH E;  4ZNC A;  1JY3 P;  451C A;  4KJM A;  4HKZ H;  5DJQ B;  1L0L J;  1NTM G;  1VQ4 P;  2BLF B;  3SFE C;  1GD2 E;  1FBM A;  3RMZ A;  4YPC A;  3AEF C;  4LC1 A;  2IBZ D;  4HYT B;  2E75 C;  3VMA A;  1JY2 O;  4WQA A;  1HZU A;  2QJY B;  1CXC A;  1D7M A;  1LC2 A;  2ORL A;  2YNY A;  1KTM A;  3NTN A;  2KOG A;  3D71 A;  3W67 A;  1NHL A;  2ZT9 B;  1CRC A;  5C39 A;  3TGU D;  2YKQ A;  1HGV A;  2WT7 A;  1VQL P;  1OW8 A;  1N9C A;  3R4Y A;  3VYI A;  1Q82 Q;  2B11 B;  3KPE A;  2JKV A;  4Z1M H;  1H8A A;  2QJK B;  1SQV E;  2QIW A;  3BCC D;  4IFF A;  1FOS F;  2O01 J;  4GIF A;  1N73 A;  2A45 G;  3V4Q A;  2KNC A;  4U7J A;  2W6J H;  3CX5 E;  3C1L A;  3AEG C;  1GU5 A;  1ZLL A;  5AVX B;  1IFD A;  3GMA A;  2N9B A;  2J5U A;  1SQQ G;  4EYY Q;  2FYU E;  3FWN A;  1M1J B;  2CK3 H;  3CME P;  1HH7 A;  2Y9Z A;  1NNO A;  3WUU A;  5CIC B;  3SFD C;  1LS9 A;  5BVZ A;  4ZKU A;  2DGE A;  3L73 D;  3Q5R A;  3H1I E;  3JC2 2;  2N9I A;  1J2J B;  2YO3 A;  3L70 J;  1NJI Q;  4A7P A;  4I7Z B;  5CIH B;  1K3G A;  1VYD A;  1T2K D;  3IR9 A;  3Q5P A;  4IFD K;  1KYO D;  3HRN A;  2BH4 X;  3ZIY A;  3CC4 P;  2OYO A;  1M8O B;  3P32 A;  1YI2 P;  3CXH H;  1FE6 A;  3GF3 A;  3I55 P;  1P84 E;  2O01 N;  1CTY A;  3T97 A;  4IL6 X;  1H1O A;  3KDP B;  2OZ1 B;  4WWI A;  1LTJ B;  3OJA B;  5AVZ B;  2RMZ A;  2NZ2 A;  1S1C X;  2ZT9 C;  1MZ9 A;  4OH8 B;  3H1L J;  3BVH A;  3CP5 A;  3TNU A;  2OYH C;  2FYU G;  2D2C C;  2J59 M;  4WVZ A;  3ZOX A;  2VHD A;  2W27 A;  4U3F J;  1YNR A;  4OGQ C;  2H8P D;  3H1K G;  5CIB B;  2V7Q J;  1NTK G;  1PIX A;  3ZOO A;  1WT6 A;  3JCU E;  1HRO A;  5KJ7 D;  1JMB A;  3WUI A;  2XU6 A;  3H1I J;  2OTJ P;  2OQQ A;  4TT3 H;  1NTK E;  1LTJ C;  1IFP A;  3CX5 I;  2KLV A;  3U1C A;  3RN1 A;  3WC8 A;  155C A;  3CMA P;  4WQC A;  1X79 B;  1RF0 A;  4DJG A;  5AW3 B;  2O01 H;  2CXB A;  2BEZ F;  2L4D A;  1H31 B;  3A0H H;  2FYU D;  1FDO A;  2B88 A;  4NFG B;  3L74 J;  2K3R A;  2M3B A;  1H89 A;  2LKM A;  1LTJ A;  3HE5 A;  4WQ8 A;  4PJ0 E;  2P2U A;  5APX A;  1YHQ P;  4RKU J; 
#chains in the Genus database with same CATH homology
 2V08 A;  1CSW A;  1A56 A;  1HJ3 A;  2GC7 D;  1BCC D;  1DW3 A;  3TYI A;  2C1D B;  1GKS A;  1CHH A;  1LFM A;  2RN0 A;  3WU2 V;  3PHL A;  5AUR A;  1NTK D;  1YIQ A;  1DII C;  2GC4 D;  3DMI A;  1NMI A;  1H9Y A;  1EZV D;  3PLN A;  3ITK A;  4FA1 A;  3VNW A;  2LIR A;  3GG2 A;  2CE0 A;  2O3J A;  2GB8 B;  1N50 A;  1I6D A;  2FRC A;  4IL6 V;  3O5C A;  1BGY D;  4XYD B;  1BE3 D;  3HQ6 A;  4YE1 A;  1DW0 A;  1DIQ C;  1H33 B;  1RZ5 A;  1FHB A;  4N0K A;  1GIW A;  1SQP D;  3MK7 C;  1I8P A;  1NML A;  3L72 D;  1RZ6 A;  3OA8 A;  1M6Z A;  1HCM A;  1L9J C;  2DVH A;  3WFC C;  4AAL A;  1KX7 A;  1FI7 A;  4U3F D;  1PPJ D;  1IZL 0;  3VRD A;  4D6T D;  3PH2 B;  2QJP B;  3ORV A;  4MU8 A;  1YEA A;  4GED B;  5EXQ A;  4H0J A;  3L74 D;  1C2N A;  1NTZ D;  3L70 D;  1CO6 A;  1I5T A;  1C6O A;  5CID B;  1C6S A;  1GDV A;  3VYM A;  3NBT A;  2ZXY A;  3OCD B;  5KLV D;  2PAC A;  3CYT I;  1QL3 A;  1CIG A;  4FAN A;  1N90 A;  3H1L D;  2B4Z A;  4Y5R A;  1CED A;  1CIF A;  1IRV A;  1CRJ A;  1C7M A;  1CSU A;  4QAO A;  4JCG A;  1CIH A;  3HQ7 A;  4L3G A;  4RJT A;  1EB7 A;  2ZON G;  1SQB D;  4EIF A;  4O1Q A;  1LC1 A;  1CCH A;  5KAF V;  3PTZ A;  3CXH D;  2MTA C;  2N9Y B;  2Y0E A;  2C1U A;  1FI9 A;  4WQ9 A;  1CYJ A;  2EXV A;  3L71 D;  4J20 A;  4FB1 A;  1CHI A;  3X39 A;  3NBS A;  4EID A;  1IQC A;  2C9X B;  1COT A;  4FAV A;  1FOC A;  2B12 B;  1AYG A;  1JDL A;  2K9J B;  3GW6 A;  2B0Z B;  4FA5 A;  2FYN B;  1LMS A;  1HZV A;  3O1Y A;  2N18 B;  1U75 B;  1YIC A;  1DT1 A;  1HRC A;  1QL4 A;  1CRG A;  1RAP A;  1CNO A;  1FI3 A;  5B5E V;  1NU1 D;  1FCD C;  3A0B V;  3M97 X;  1AKK A;  1QYZ A;  2D0W A;  1HJ4 A;  2N9J A;  2HV4 A;  3O0R C;  5DJQ C;  3ZOY A;  4DY9 A;  5H2F V;  1QN2 A;  2LIT A;  1C6R A;  1YCC A;  3WFD C;  1CC5 A;  5B66 V;  1C52 A;  2I8F A;  2MHM A;  4WQB A;  2QG4 A;  2FWL A;  3KHU A;  5GTH V;  3CX5 D;  3O20 A;  3ZCF A;  3ZOW A;  4UB6 V;  1CSX A;  1W5C T;  3OCD A;  4XXL A;  1CHJ A;  2Y0C A;  3A0H V;  3DR0 A;  1MG2 D;  2BGV X;  1SQV D;  4PJ0 V;  2Q3E A;  5C9M A;  1WEJ F;  1MG3 D;  3L4M A;  4Q5P A;  2CE1 A;  1M70 A;  2BH5 X;  1N15 A;  1DVV A;  5CYT R;  4L3H A;  2D0S A;  1CRY A;  2JWA A;  2KS1 A;  1J3S A;  3DP5 A;  2C2C A;  3A9F A;  3JBT B;  4AAM A;  5GTI V;  1CYI A;  4V2K A;  4EIC A;  2PCC B;  1QKS A;  3HQ9 A;  3OA8 B;  2AI5 A;  2XTS B;  1CSV A;  3CWB D;  5CIF B;  1CTJ A;  4LJI A;  1ETP A;  2AXT V;  451C A;  4FA4 A;  4L1Q A;  4PW9 B;  5DJQ B;  2BLF B;  1A8C A;  4EDF A;  3SJL A;  3RMZ A;  1KB9 D;  3WFB C;  2IBZ D;  1A2S A;  5E79 V;  1IO3 A;  1HJ5 A;  3VMA A;  3MK7 B;  4KMG A;  1GQ1 A;  3L4O A;  4WQA A;  1HZU A;  1H9X A;  2QJY B;  4H0K A;  3SXT A;  1COR A;  2YIU B;  1CXC A;  1DW2 A;  2ORL A;  1LC2 A;  1AOQ A;  1CTZ A;  5DF5 A;  1F1C A;  1WVE C;  1CRC A;  1S5L V;  3WFE C;  3TGU D;  5KAI V;  3ZBM A;  1N9C A;  1M60 A;  1S6V B;  1P84 D;  2B11 B;  2C1D A;  2QJK B;  1GU2 A;  3BCC D;  1F1F A;  2JTI B;  1L0L D;  2N18 C;  5KLI B;  1R0Q A;  4K3I A;  2ZOO A;  3SWS A;  4FA9 A;  1MZ4 A;  2B10 B;  1OCD A;  1OAE A;  1U74 B;  4WQD A;  1H33 A;  3CU4 A;  1E29 A;  3L75 D;  3PRJ A;  3RLM A;  1H31 A;  3SVW A;  1CXA A;  1HH7 A;  1KV9 A;  1SQX D;  3TDK A;  1NNO A;  5CIC B;  2C1V A;  1YFC A;  1LS9 A;  5B6Q A;  2N3B A;  2CA4 B;  4AAN A;  2DGE A;  1H32 B;  4P4Q B;  5TIS V;  3L73 D;  1RAQ A;  2N9I A;  1KIB A;  1L0N D;  4A7P A;  4UB8 V;  1SQQ D;  4RSZ A;  4PWA A;  1C75 A;  1CRI A;  1FJ0 A;  1PP9 D;  4GYD A;  5CIH B;  1W2L A;  1K3G A;  1VYD A;  3PXT A;  2V07 A;  1B7V A;  5KKZ B;  1KYO D;  1C2R A;  2JQR A;  2BH4 X;  3ZIY A;  5IY5 1;  2AIU A;  1IRW A;  1CTY A;  2BPB B;  1I6E A;  1K3H A;  4PD4 D;  1H1O A;  2OZ1 B;  1YEB A;  3H1K D;  5CIG B;  4AX3 A;  3CX5 W;  1BL9 A;  2YCC A;  3HQ8 A;  2RMZ A;  1YTC A;  1E2R A;  1NTM D;  3NWV A;  2Y0D A;  3SLE A;  3CP5 A;  1KB0 A;  1CRH A;  2N3Y A;  3CXH W;  3ZOX A;  2VHD A;  2GIW A;  3H1H D;  1YNR A;  1DVH A;  5CIB B;  2OZ1 A;  3H1J D;  3RN0 A;  3ZOO A;  3C2C A;  1AOF A;  3H1I D;  1HRO A;  1L9B C;  351C A;  3WUI A;  2L91 A;  4WQE A;  1CCR A;  4EIE A;  1ZRT D;  2CA3 B;  1KX2 A;  5C0Z A;  1E8E A;  1NIR A;  3RN1 A;  3WC8 A;  1CYC A;  155C A;  3KZI V;  4WQC A;  4AAO A;  2A06 D;  1ZZH A;  4WQ7 A;  1H32 A;  2ZZS 1;  2BCN B;  4O1W A;  1GJQ A;  3TF5 A;  2CXB A;  1KYO W;  1CIE A;  2L4D A;  1H31 B;  2BCC D;  3FWL A;  2YQB A;  3PXW A;  2FYU D;  1I54 A;  1DW1 A;  1I8O A;  4NFG B;  2C8S A;  2YK3 A;  5CIE B;  5DFS A;  4WQ8 A;  5TJH A;  1I55 A;  2KNC B;  2ZBO A;  2PCB B;  3PXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...