3L75D

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
b'GELELHPPAFPWSHGGPLSALDHSSVRRGFQVYKQVCSACHSMDYVAFRNLIGVTHTEAEAKALAEEVEVQDGPDENGELFMRPGKISDYFPKPYPNPEAARAANNGALPPDLSYIVNARHGGEDYVFSLLTGYCDPPAGVVVREGLHYNPYFPGQAIGMAPPIYNEILEYDDGTPATMSQIAKDVCTFLRWAAEPEHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKSRKMAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 71
structure length 241
sequence length 241
chains with identical sequence Q
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3l75D01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3l75D02
3RN1A 1SQXD 1KX7A 3L74D 3DP5A 1FCDC 3GG2A 3CX5W 4AAMA 1NMIA 1C7MA 1HJ3A 5TISV 3ITKA 3NWVA 1C75A 1LC1A 2KS1A 3PXSA 4O1WA 4XXLA 2GC7D 1L0ND 5CIEB 3KZIV 1E2RA 1AKKA 1YIQA 4AX3A 1M70A 1M6ZA 2ZOOA 1YFCA 3PHLA 5DF5A 1NIRA 5KKZB 2OZ1A 5DJQC 2PCBB 1I6EA 1HZVA 2ORLA 2Y0CA 1CTYA 1C6SA 1NMLA 1H1OA 5EXQA 1C2NA 2XTSB 4MU8A 1HZUA 3A0HV 2QG4A 3O0RC 1CYJA 2BPBB 3HQ8A 3ZOYA 1CRCA 3CP5A 3H1KD 2HV4A 5E79V 3SXTA 1DW0A 3RN0A 1JDLA 3SLEA 4FA9A 1CNOA 1IZL0 3SWSA 1C2RA 1CSXA 1I55A 5B66V 1K3HA 4PD4D 1FOCA 1M60A 2D0SA 1GQ1A 5CIHB 4PWAA 2N3YA 3VYMA 2AI5A 1WEJF 1OCDA 1S6VB 2GC4D 2ZBOA 3VMAA 2RMZA 1HCMA 3A0BV 1HH7A 3O1YA 4P4QB 2YCCA 3CX5D 4WQ8A 3L71D 1F1FA 1DT1A 3O20A 3H1ID 1QL3A 2IBZD 1CRYA 1C6OA 3ZOXA 3ZBMA 3OA8A 1H32B 351CA 1H9XA 4K3IA 1I5TA 5CICB 2K9JB 4FA4A 2BCCD 4EICA 3ZCFA 3L75D 1CCRA 1CXCA 2QJPB 2CA4B 2N9IA 2ZZS1 2FYNB 1LC2A 4UB6V 1P84D 2AIUA 3H1HD 3NBTA 4WQ9A 1LFMA 4PJ0V 3X39A 5GTIV 1EB7A 5CIBB 4WQ7A 2FYUD 1AOQA 2MHMA 1DIIC 4RSZA 3PLNA 2MTAC 3TDKA 4A7PA 1CO6A 2CA3B 2QJKB 3L73D 3WFCC 1CHIA 2GB8B 1A2SA 1R0QA 3M97X 1FI3A 1NNOA 1NTMD 2C1UA 4AANA 1YTCA 5KAIV 5TJHA 1HJ5A 5B6QA 3CXHD 1L9BC 4PW9B 4Y5RA 2PCCB 2CXBA 1CYIA 3HQ6A 2V08A 1I8PA 1BE3D 3WFEC 1C52A 2B12B 2YQBA 3H1LD 4D6TD 2O3JA 1A56A 1AOFA 2B11B 1F1CA 4NFGB 3OCDA 1SQBD 3RLMA 1CRJA 2BH4X 3SJLA 1WVEC 3HQ9A 1N90A 4IL6V 1C6RA 4DY9A 5DFSA 3CYTI 2C1DB 4EIEA 1QKSA 1CXAA 1COTA 1DVVA 3L4MA 4KMGA 2GIWA 1LS9A 2N9JA 4EDFA 1L9JC 5H2FV 3WFBC 2V07A 5CIDB 1L0LD 1U75B 1W2LA 5KLIB 3JBTB 1KV9A 4EIFA 5CIGB 3A9FA 1CORA 1GIWA 1U74B 4J20A 3OA8B 3BCCD 4XYDB 1KX2A 1FI7A 2BH5X 3H1JD 3MK7C 1PP9D 3PXWA 3WC8A 1CSWA 2L4DA 2LIRA 1BL9A 1IRVA 1QL4A 4WQEA 2JWAA 3OCDB 1CIFA 1EZVD 3PTZA 2I8FA 3ZOOA 2A06D 2ZONG 1RZ6A 2YK3A 1IO3A 2RN0A 3CWBD 3WFDC 3CXHW 1ETPA 3KHUA 4Q5PA 1PPJD 3WUIA 4UB8V 1KYOD 4H0JA 1YEBA 3FWLA 1DW1A 3C2CA 4L3GA 2B4ZA 1W5CT 1NTKD 2FWLA 4L1QA 1H31B 3ZIYA 1CC5A 1LMSA 2L91A 3PXTA 3DMIA 2N18C 1IRWA 1YCCA 3L70D 1I8OA 1GDVA 1KB0A 1I54A 3TGUD 4WQBA 3NBSA 1NU1D 3TF5A 1QYZA 1BCCD 1YNRA 3GW6A 2EXVA 3VRDA 2QJYB 2LITA 2DVHA 4O1QA 4U3FD 4FAVA 2C2CA 1CHJA 4RJTA 1YEAA 1MG3D 2CE0A 451CA 1GJQA 1K3GA 1CRIA 1IQCA 2Y0DA 4GEDB 5KLVD 1I6DA 4FA1A 2OZ1B 1DVHA 5CIFB 2C1DA 4V2KA 2B10B 2AXTV 1KB9D 4FA5A 3HQ7A 3PRJA 5GTHV 3O5CA 2C1VA 1VYDA 1CYCA 1MZ4A 4LJIA 2Y0EA 1S5LV 5C0ZA 5DJQB 1CTZA 1ZRTD 1RZ5A 4AALA 4EIDA 1HROA 2BCNB 1E8EA 4FANA 1FI9A 2N3BA 1H33A 2B0ZB 1B7VA 1SQPD 2VHDA 4GYDA 1GKSA 155CA 1QN2A 1MG2D 2PACA 3ORVA 1ZZHA 4WQAA 1SQVD 2Q3EA 1H31A 5KAFV 2DGEA 1N9CA 3L4OA 1GU2A 1H33B 3SVWA 4QAOA 1CCHA 3DR0A 1NTZD 2FRCA 4H0KA 5C9MA 1N15A 2C8SA 3L72D 1CEDA 1H32A 3MK7B 2YIUB 3TYIA 1CTJA 3PH2B 1HRCA 1YICA 4AAOA 1A8CA 1FHBA 1CHHA 1BGYD 2C9XB 4WQCA 1HJ4A 2JTIB 1N50A 2BLFB 3CU4A 3RMZA 3VNWA 5CYTR 2ZXYA 1H9YA 4N0KA 4YE1A 4L3HA 1RAPA 1KIBA 1DW3A 1DW2A 1CSUA 1CSVA 2N18B 4FB1A 3WU2V 1CIGA 1SQQD 1CIEA 1E29A 1J3SA 1RAQA 4JCGA 1CRGA 2D0WA 1DIQC 2CE1A 5IY51 1KYOW 3ZOWA 1CRHA 1AYGA 4WQDA 1FJ0A 2N9YB 2JQRA 1OAEA 5B5EV 5AURA 2BGVX 2KNCB 1CIHA
chains in the Genus database with same CATH superfamily
1LTAC 3DP5A 1SLQA 1Y47A 3CX5W 1JMBA 3B8EB 1C7MA 1IFPA 5APQA 1HJ3A 3F89A 3KQGA 3ITKA 5AVXB 3G6EP 1C75A 1LC1A 2KYVA 2KS1A 4O1WA 4XXLA 2GC7D 4GT1A 3V2NA 1YIQA 1NTZE 3HE4A 1M70A 4DT0A 1IFNA 1G1IA 2ZOOA 1ZOYC 1OMIA 1FJPA 2PCBB 3RL0C 4C7NA 1I6EA 3CCVP 1PL5A 2W6JH 4MU8A 1ZR2A 1HZUA 3A0HV 1SQXG 3CCEP 1FZBA 4RESB 3HE5B 4UB8H 3ZOYA 1CRCA 3CP5A 3H1KD 2WSSH 2OTLP 2HV4A 1DW0A 3RN0A 4NPFX 3SLEA 2P7JA 2WSCJ 4DCKA 2FBWC 3B5NC 1C2RA 1OIPA 1KILE 5AVTB 1H89A 2FYUK 5CHXA 1WEJF 1N8RQ 1S6VB 2RMZA 2AXCA 1HCMA 2I1KA 1VDFA 5APWA 4RKUJ 4P4QB 2E5TA 3H25A 1PZQA 2R3SA 3D6YA 5AW7B 2QJPC 3H1ID 1QL3A 3P8MC 3TK1A 3B5NB 3GF7A 3RL0B 5TISE 4AUWA 2M0BA 1NJIQ 1VF5D 3USSA 1KQLA 1NKZB 1H32B 2ZYAA 351CA 3U1CA 4GDOA 3L75G 1CCRA 4I7ZB 4IL6X 2FYNB 4UB6V 3H1IE 1P84D 3G71P 1SFCB 1NU1G 4H44C 3BCCG 1SQPG 3A7OA 3NBTA 1PPJE 3X39A 3HD7A 1L0LJ 3WU2E 2ZXXA 1SVFA 2HPCB 1LTJC 2FYUD 1NO4A 2MHMA 3PLNA 4PV1D 3TDKA 2H8PD 4Y28J 3Q2YA 1A2SA 3B5NA 1KTMA 3NXSA 3RL0g 2R5DA 1FI3A 1GL2B 4JYCA 1VQ7P 4B86A 3AEBC 3CCMP 1FZCC 1RQUA 5KAIV 1VL2A 1M8OB 3OW2O 1HJ5A 3M91A 2P2UA 1KQGB 1HGVA 1SQBJ 1VQKP 2V08A 5KLVK 3WFEC 2YQBA 1S2EA 2Q6QA 1AOFA 3GMAA 3VTPC 1N7SA 5GTIH 1URQC 2YO3A 3RLMA 2WPSA 1HUCA 2V7QH 4GIFA 1N90A 2V4HA 4I1LA 1LNQA 5DFSA 1QVGO 4EIEA 1NTZJ 1S4XA 3TNUA 4DOJA 4KMGA 2GIWA 3S1KA 3EQ2A 3I56P 1FE6A 3RK3C 4AQRD 3KDPB 4PJ0E 3RBZA 1Q81Q 1KFMA 1KMIZ 1AA0A 1U75B 1W2LA 3JBTB 1KV9A 1JY2O 5CCGA 4WVZA 5CCHA 1GW4A 1EDIA 1S5LE 1CORA 2JEEA 1GIWA 1U74B 1LTBC 1SQQJ 5CJ0A 3BCCD 1NYHA 2R44A 3GHGB 1U7MA 3MK7C 2K9YA 3WC8A 1IO4A 2LIRA 1BL9A 1X9VA 1CW5A 1IRVA 1QL4A 4WQEA 1K8AQ 2JWAA 3OCDB 2A45H 5DJTB 2N1TD 3CWBG 2YXRB 3KHUA 3AECC 2A06E 1PPJD 5KAFE 3W68A 4UB8V 2H7HA 1JY2N 1T2KD 2B4ZA 1P84E 3IN6A 1N73C 1NTKD 4L1QA 5GTHH 1LMSA 1YQ4C 1NHLA 1FAVA 3P32A 3AEGC 3L70D 1BCCG 2WWWA 1BCCJ 1YNRA 3HRNA 1ZR4A 2LITA 2DVHA 4WBAA 1CHJA 1SP4A 2KNCA 1HGZA 3GHGC 3KZIH 2QE7H 2A06G 1IQCA 3TGUJ 1VQOP 5TISH 4FA5A 5CCHC 1LWUC 3HD7D 1T2KC 2W90A 1HTLC 2XU6A 2KIKA 1H88A 1OWAA 4W80A 2WQYC 2E76D 3M0DA 3H1IJ 2K88A 1ZRTD 2HODA 1RZ5A 4C7RA 2D2CC 4HJGH 3AE5C 3MTUE 3E1RA 1HJ0A 3AEAC 1E8EA 2N3BA 1LTTC 1GKSA 4GYDA 2LR2A 1X0TA 1DIPA 155CA 2WSCH 2NZ2A 2QIWA 3CMEP 2ZYGA 4PV1B 3L4OA 3P7KA 2G8YA 4H44B 1CCHA 4LLHA 1NTZD 2IPPA 2FRCA 4H0KA 1NTZK 2OQQA 4HKZH 2C8SA 3L72D 1CEDA 1H32A 1RHZB 1EC5A 1PGQA 2YIUB 1CTJA 2OTKE 2K1AA 1A8CA 1D7MA 5KAIE 1L0NK 1CHHA 1H0TA 2C9XB 4Z1MH 5KAFH 4WQCA 1LTGC 1NAFA 2BEZF 1HJ4A 1NTKE 2QSIA 3VNWA 1SQBG 2P67A 2ZXYA 1H9YA 4L3HA 1SQVG 2OGUA 1RAPA 1LWUB 1CSVA 3EFFK 3M0DC 4FB1A 1IFMA 3WU2V 3O6QB 3HE4B 4JCGA 1CRHA 1G2CB 1FJ0A 1EZVE 1KILD 2KS1B 5KJ7D 1SQPE 3BCCE 3PP5A 1M1JB 3L74D 2YXQB 4GODA 1NTKK 1GD2E 1BE3G 2FFDA 4HH2A 4IOIH 5TISV 2MKVA 2OTJP 3FXEA 4EIJA 3FX0A 2ZT9D 3SWYA 3CXHI 3KZIV 1E2RA 3PH0A 1SQVK 3VP8A 4C7NB 3L73E 1YBKA 2Z4EA 1PGOA 1AVYA 3W67A 1VQNP 2HYNA 1IK9A 1YFCA 1RF0A 3PHLA 5DF5A 4CPGA 5KKZB 2QA4P 2BCCJ 1CTYA 1EDJA 4JYBA 2XV5A 1NMLA 1H1OA 5EXQA 4ZMDA 1NWQA 3O0RC 2BPBB 3HQ8A 5AW8B 2M8RA 2NPSD 3QH9A 4YPCA 2XDJA 1QL1A 3CCRP 4R4MA 1T3JA 1OW7A 1SQPJ 1S72P 1AQTA 1CSXA 2K37A 2N1TA 1M60A 2KZIA 1GQ1A 5CIHB 2N3YA 3VYMA 2QM7A 2KSJA 4H0LD 2GC4D 1S9KE 2YO2A 5KAIH 4WY4B 2L5GB 1N7SC 1M1JC 2KLVA 1LGHB 2YCCA 3CX5D 2E76C 1L4AD 4WQ8A 1RE4A 2IZ0A 2P58A 4ZNCA 1P84H 3L71D 1F1FA 1DT1A 3O20A 3S4RA 4DJGA 2IBZD 1BGYE 3ZOXA 1JCCA 2VRSA 3H1LG 1L4AA 4HYTB 2J5UA 3QWOC 5B66E 5AVWB 5AW6B 2I8DA 1EDKA 5CICB 3H1JJ 4EICA 3ZCFA 3C1LA 3WUTA 5AVRB 2QJPB 1Q86Q 3I55P 2CA4B 2ZZS1 2E42A 4WY4A 3BRTB 3OA7A 5CIBB 1PFIA 1AOQA 3BCCJ 1DIIC 1NU1J 1VQ4P 3JC22 4A7PA 1YHQP 2WSFJ 1CHIA 1R0QA 2IZ1A 1NNOA 3I5CA 1GL2C 4OH8B 1URQD 1FZCB 3M9HA 2C1UA 1GU5A 2IDBA 4W7ZA 3R2PA 1DX7A 1SS1A 2M3EA 3WU2H 1BE3D 4JPZB 2B12B 3H1LD 4D6TD 1L0NJ 5M1BA 2B11B 2WITA 1L0LE 2HODB 2WVRA 1JY3O 3MP7B 1OXZA 1UIIA 2ZYDA 1KC8Q 2BH4X 2N1TB 1WVEC 1J1DC 3AE7C 3CYTI 3L73G 1QKSA 4K35A 5H2FH 4N78E 2PFXA 4L76A 3MD0A 4EDFA 4H44D 3IF4A 3WFBC 1HVVA 1YJNP 2BCCE 1YJWP 5CIDB 1JUNA 1NU1K 1HJBA 4IFMA 4EIFA 3H1HJ 5CIGB 1XTGB 4WY4D 1L0NG 1LJ2A 1ZXGA 1MZ9A 4LGDE 3KPEA 3AEDC 2Q9IA 3A0HE 3H1JD 1PP9D 1CSWA 1Y8AA 3RK2B 2FXPA 1FZFA 1CIFA 1E79H 3G4SP 3ZOOA 5APVA 1SQQK 2FXMA 5B66H 3V6IA 1WMKA 1SQVE 1X79B 4Q5PA 2IBZI 3WUIA 2GA1A 1KYOD 5B5EH 2YMYA 2GM4A 1YEBA 3O8ZA 3HUSB 1DW1A 4L3GA 3VMYA 1AV1A 2FYNC 1OW8A 5C39A 3ZIYA 3L72J 2L91A 1EXIA 1FZEA 3AE4C 3B5ND 2POHA 4L73A 5DJUB 2A45G 2E75B 2R5BA 3CCUP 4WQBA 3NBSA 3TF5A 3AE1C 1QYZA 3GW6A 2HFED 4O1QA 4FAVA 3ZDMA 4RJTA 2E74D 1KB9E 1MG3D 3RK3E 1KB9H 2CE0A 3IAOA 1CRIA 5KLVE 2Y0DA 1BSHA 2KOGA 1LTJB 2FY8A 3MGNA 1FZGA 5CCGD 5CIFB 1VF5C 1MFTA 3NTNA 2KZJA 3MUDA 3HQ7A 3PRJA 3TYYA 1R5SA 4H13C 1YI2P 5GTHV 3O5CA 4O9BA 3CWBJ 1CYCA 1MZ4A 1Q90D 5BU5A 5E79E 5C0ZA 4PD4E 1N7LA 5BU8B 1W2EA 5DJQB 1Q2NA 1W5CE 3O6QA 4GKGA 1GDTA 3T97A 3H32A 3AEEC 1HROA 3RK2C 3A2AA 2KK7A 1URQB 1L0LK 1MG2D 5CCGC 1JY3P 2J58A 1NVOA 1H31A 3ABVC 3C8VA 1RE3C 3A3YB 2XKMA 1S1CX 1FDOA 3SVWA 4QAOA 3DR0A 4U3FE 3H1HE 4IFDK 1KILA 2A45I 2B88A 1BCCE 1N15A 4ZKPA 3MK7B 3TGUE 2W8ZA 3TYIA 1NTKG 3E7KA 5AW2B 1FHBA 4BWNA 2M5AA 2OYIA 2K9JA 3D71A 1KN7A 2XZRA 3II6A 1ZV8A 2BLFB 3RMZA 1N73A 1A02F 3LW5J 2KI7B 1RQVA 3V4QA 2KXPB 4YXWH 3B71A 1QVFO 2YKOA 3CWBE 4BXLA 1OW6A 1DW3A 1DW2A 2IYPA 2N18B 2BEQD 1SQQD 1T8ZA 2CE1A 5KTBA 2HPCA 2Q5UA 1NH4A 4OGQD 1OAEA 2ZVNB 3GHGA 1CIHA 2JDIH 3M0AA 1QLED 1SQXD 2IX7C 1KX7A 5GTHE 1FCDC 1NTMJ 3GG2A 2FYZA 4GOEA 1FS0E 1NMIA 2AXTH 2RH0A 1RF1C 3LIEA 4ASVA 2KUBA 3L75J 3PXSA 2Z5HA 5AW9B 1L0ND 4D6TJ 1X8YA 5CIEB 4M3LA 1BE3J 1AKKA 2GUVA 4ASWA 4AX3A 5E79H 1M6ZA 1DEEG 2KP8A 1NIRA 1VQ8P 3GF3A 1JY3N 3P8CE 2PRRA 2OYIC 4KT0J 3Q5PA 2XTSB 2R32A 1K05A 1SQPK 4JF7A 3NFQA 1CYJA 2FYUJ 3CPWO 1AQ5A 1H0TB 1SQVJ 1KZUB 1JM0A 3L37A 2WPRA 3CL3D 1JDLA 4FA9A 1IZNB 3CXHE 5APTA 3TGUG 1IZL0 3SWSA 1I55A 1Z56A 3CLQA 1GL2D 1OVRA 3H1HG 4BRYA 4EOTA 2D0SA 1PGPA 1SFCA 3V4WA 2SPZA 1VQ9P 1CI6B 1JTHB 2ZBOA 1NTKJ 1VPCA 4W7YA 1PPJG 1H8AA 3BVHA 2NPSC 1NOHA 1Q7YQ 2BASA 1PIXA 4RO0A 3L75E 1PP9E 3C9IA 2B87B 1CRYA 1ZLLA 1NKNA 2UWJE 3ZBMA 1VF5B 3OA8A 5L8RJ 1KD1Q 1JCDA 4WY4C 2YIUC 1H9XA 4K3IA 2K9JB 4UB8E 1OVUA 1ZW0A 1CXCA 1LT1A 2N9IA 2I1JA 1K73Q 2E74C 4NPDA 1LT9A 1VQLP 3L36A 2AIUA 3H1HD 4WQ9A 1IJDB 2KSEA 1LFMA 4PJ0V 1FZCA 1GK4A 4WQ7A 1YQ3C 5BVZA 4RSZA 5KLIC 1CO6A 1S5LX 2ZVOB 3D70A 5APSA 1KQFB 2V7QJ 2LKMA 1NTMK 3H1KJ 1NTMD 3L71G 5B5EE 5TJHA 2ZAEB 2KB7P 3CD6P 3FGAD 3VMZA 4PW9B 4Y5RA 1M7LA 1CYIA 1C52A 1IK7A 3H32B 5EFWB 1SQXE 2JJLA 2O3JA 4QMAA 1QX8A 3B4SA 1LTIC 4K3AA 2FKWB 2NPSA 3V2PA 1USDA 3GLMA 1F1CA 1S3JA 3H1LJ 3F5HA 1FZAA 3SFEC 1SQBD 3M9BA 1CRJA 3SJLA 1Y9BA 3MZWB 5KKZC 1C6RA 2ITAA 1NTZG 1MFZA 1DVVA 2XNDH 4YXDC 1LS9A 2W6AA 1OFCX 2XNXA 4U7JA 3D0WA 1NU1E 1L0NE 1L2PA 2WMMA 5KLIB 2YKQA 3L74G 1EQ7A 3MUDC 3A9FA 2BCCG 3PJSK 3OA8B 2WT7A 1M1KQ 1FI7A 4BRYB 3PXWA 5CJ4A 1R5LA 2IFMA 2H88C 1IC2A 1L4AC 3PTZA 3FXDA 2D2CD 1RF1B 1RF1A 1IFJA 2P10A 1SQQE 2H43A 2RN0A 1FOSE 2Y9ZA 3CCJP 3WFDC 3CXHW 1USEA 2W6BA 4XE5B 2E76B 1L0LG 3FWLA 3C2CA 2N9BA 3HD7C 3A0HH 4OWFA 5CCHD 1W5CT 2C0XA 1CC5A 4KJMA 3PXTA 4H0LB 2N18C 1JOCA 3SWFA 1J2JB 2YNYA 4N3YB 1GDVA 1CZQA 1KB0A 2JR8A 1YTZI 1NU1D 2AEJA 1GL2A 2C9NY 2QJYB 3TNUB 1QEXA 1YEAA 3KZIE 1YITP 451CA 1CSBA 5AVVB 1FJKA 4GEDB 3BATA 5KLVD 4FA1A 1DVHA 3G3ZA 1GZLA 2C1DA 3V2QA 1KB9D 4NPEA 2O1JA 3CC7P 2QVAA 1VQPP 1KB9I 1BDDA 4ZKUA 2Y0EA 1S5LV 2MJZA 5CBNA 5AW5B 1FC2C 1N7SD 1BDCA 3H1LE 4N6JA 1BGYG 3L70G 1RF0C 4AALA 1W2BO 4EIDA 1LTJA 5AVUB 1RE4C 1KYOH 4H0LC 2BCNB 1FBMA 3L74E 3FWNA 5KLVJ 2AXTE 1H33A 2B0ZB 2JP3A 1DD4A 1SQPD 2VHDA 2E5YA 4EI2A 1KILC 5CMZA 3ORVA 1ZZHA 4WQAA 1SQVD 2Q3EA 2ZJSE 2WSEJ 1S5LH 1CI6A 2DGEA 1EZVI 3TSIA 1J1EB 1HBWA 4WB4A 1JO5A 1H33B 3L72G 3RK3D 3VOPA 3CCQP 3V5BA 4C46A 4TLFA 5C9MA 3H1KG 3PH2B 1HRCA 1YICA 1DEBA 3LIDA 1J1DB 2B87A 4MN4C 4IL6H 4Y99B 1U57A 4IL6E 2M3BA 2WT7B 1LP1B 5AW4B 2NRGA 2JO1A 1N73B 4I6MC 3CCLP 2O01H 5CYTR 3L71E 1X22A 1KYOE 2ZT9C 2B89A 5K5GB 1JTHA 1N86A 1YYCA 3Q1MA 4TT3H 1PV3A 3H6PA 2E43A 1E29A 3JSVC 1KILB 1SFCC 2KLUA 5B5EV 5AURA 3HUSC 2BGVX 2KNCB 5KJ7C 2GUSA 3RN1A 4D6TE 1SFCD 1FOSF 1AJYA 3N7NA 1BE3E 4AAMA 3S9OA 3AE9C 2OYHA 5APXA 2B9BA 1L4AB 3NWVA 1OZHA 2ZT9B 1JB0J 2QM8A 1EZVG 1JEKA 5GTIE 3CI9A 1K04A 1FDIA 3RGUA 1PP9G 2ZXEB 4N78D 1DD3A 2O01J 2OYOA 4YTPC 3RBXA 3BASA 2OZ1A 5DJQC 2LXBA 3OJAB 2IYOA 1HZVA 3L71J 1AVOA 2ORLA 2Y0CA 1C6SA 1SQBE 1LT9C 1TU3F 1C2NA 3RK3B 1G1JA 2QG4A 1GTWA 2M5AB 2Q7CA 4Y99C 4XA4A 2PP6A 1RE3A 3SXTA 5E79V 3E1IA 4PD4I 2QEXP 3L73J 1CNOA 2CPBA 1NAYA 2CPSA 5B66V 1K3HA 4PD4D 1FOCA 1NTME 2P1JA 3A5TA 1DH3A 1IFDA 1R8EA 1M1JA 2O1KA 4PWAA 3CX5I 2AI5A 1OCDA 4U3FJ 1P84I 3VMAA 3A0BV 1ZMEC 2C9LY 1HH7A 2N1TC 3OAKA 1T6AA 5AVQB 3O1YA 2Q3IA 3H1JE 3L35A 3M06A 1FDMA 2Z5IA 2JKVA 1VQ6P 3KYQA 1WT6A 1A02J 3T97B 1C6OA 1E5WA 3U59A 2HLOA 4PJ0H 2WSFH 4HB1A 3AE6C 3EWKA 2NPSB 4XFJA 2OYHB 1I5TA 4L74A 4FA4A 2BCCD 3L75D 1KORA 4JBZA 2IBZE 1LC2A 3L70J 2WPQA 3WMM0 5GTIV 1EB7A 1PGJA 2CK3H 1GMJA 3LW5H 4OVNF 5CBOA 2FYUG 2MTAC 2CA3B 2QJKB 3L73D 4DZOA 2YMKA 1ZN5A 3IR9A 3WFCC 2GB8B 3M97X 3SSUA 1JY2P 3UIAA 4AANA 1YTCA 1NGMB 4OGQB 5B6QA 3CCSP 3CXHD 1L9BC 1N2DC 1EXJA 2G3AA 3CXHH 2PCCB 1QGKB 2CXBA 3HQ6A 1I8PA 1PP9J 1BSNA 4AYCA 1A56A 3Q5SA 2H89C 5AVYB 5APUA 4NFGB 3OCDA 2WSEH 3N4XA 2PGDA 4UB6E 2OARA 1JNMA 3HQ9A 4U3FG 4UB6H 3HTKA 3P8CD 1N7SB 4IL6V 3AE3C 4PV1C 4DY9A 2E75D 2C1DB 2FYUE 4L75A 1CXAA 2FFDC 1COTA 1VQ5P 3K5BA 3L4MA 1KQSO 2N9JA 3Q5RA 1L9JC 4WWIA 5H2FV 2QJKC 2V07A 1SQXJ 1LTSC 1L0LD 1OX3A 4H13B 2IBZG 3VYIA 2WTYA 5APYA 4J20A 3VN0A 2AEFA 3HUSA 4XYDB 2Y9YA 1VQMP 2IFNA 1KX2A 4OGQC 2BH5X 3CX5E 2OYIB 1BGYJ 2L4DA 1XTCC 3D6ZA 1EZVD 2I8FA 3H1JG 2A06D 2J59M 3L4FA 1LT9B 2ZONG 2FXOA 4R4LA 1RZ6A 2YK3A 1S9KD 1IO3A 3VP9A 3CWBD 3AEFC 2HR3A 1ETPA 5KLVG 3CC4P 3AE2C 4H0JA 4H13D 1HWTC 1AFOA 1LP1A 2E74B 1YIJP 2FWLA 2LXCB 1H31B 3WUVA 2DW3A 1NTMG 3DMIA 1YJ9P 1IRWA 1ZP0C 2HG5D 1YCCA 4JQ0D 1ZRTE 3SFDC 1I8OA 1KYOI 2Q1KA 3G9RA 1HH0A 1FU1A 1I54A 3TGUD 3H1KE 1BCCD 2W27A 4GOFA 2EXVA 3VRDA 2O01N 3HD7B 2QJYC 3L72E 4U3FD 2C2CA 2C0WA 1SQXK 1GJQA 1K3GA 2FFDB 3HTKB 3CX5H 1I6DA 3EFGA 2OZ1B 4V2KA 2B10B 1GU4A 2AXTV 3H1IG 5AW3B 1MV8A 2C1VA 2ZFCA 1VYDA 4LC1A 1WRGA 4LJIA 3RK2D 4I7ZC 4PD4H 3CMAP 3A0BE 3HE5A 2YKPA 1JMMA 3L70E 3A0BH 1K9MQ 1CTZA 5AVZB 1M90Q 2D2CB 1LWUA 2K3RA 4I2LC 1KFNA 5H2FE 5AVSB 4FANA 1FI9A 5KJ7A 1B7VA 4D6TG 2W83C 3CC2P 3V2RA 2R3CA 1QN2A 2PACA 3AE8C 2OYHC 1HF9A 5KAFV 1N9CA 1GU2A 4KHXA 1G2CA 2RKLA 3VMXA 1QL2A 3R4YA 1IFIA 1MKMA 1URQA 2E75C 4AAOA 1M57D 3KXDA 5AW1B 1RY3A 2WPVB 1J1EC 1UIXA 3RL0D 1BGYD 1YTZT 2JTIB 2JWDA 1N50A 4IFFA 5AW0B 3BRVB 3CU4A 1RH5B 3Q3DA 1MUUA 2QRXA 3IFMA 4N0KA 1EDLA 4YE1A 1M56D 3MIWA 4EYYQ 1Q82Q 3SWKA 1SQQG 1KIBA 1T3UA 3L74J 1CSUA 3JCUH 1GK6A 3M9QA 3JCUE 1CIGA 1U7JA 1CIEA 1J3SA 1RAQA 3WUUA 1KV4A 1CRGA 2D0WA 1DIQC 5IY51 1KYOW 3U1AA 3ZOWA 1SQBK 2WZ7A 1OVVA 1AYGA 4WQDA 2N9YB 2JQRA 3NMDA 1GW3A 2AEMA 3MHVA 2PAJA
chains in the Genus database with same CATH topology
3RN1A 1SQXD 1KX7A 3L74D 3DP5A 1FCDC 3GG2A 3CX5W 4AAMA 1NMIA 1C7MA 1HJ3A 5TISV 3ITKA 3NWVA 1C75A 1LC1A 2KS1A 3PXSA 4O1WA 4XXLA 2GC7D 1L0ND 5CIEB 3KZIV 1E2RA 1AKKA 1YIQA 4AX3A 1M70A 1M6ZA 2ZOOA 1YFCA 3PHLA 5DF5A 1NIRA 5KKZB 2OZ1A 5DJQC 2PCBB 1I6EA 1HZVA 2ORLA 2Y0CA 1CTYA 1C6SA 1NMLA 1H1OA 5EXQA 1C2NA 2XTSB 4MU8A 1HZUA 3A0HV 2QG4A 3O0RC 1CYJA 2BPBB 3HQ8A 3ZOYA 1CRCA 3CP5A 3H1KD 2HV4A 5E79V 3SXTA 1DW0A 3RN0A 1JDLA 3SLEA 4FA9A 1CNOA 1IZL0 3SWSA 1C2RA 1CSXA 1I55A 5B66V 1K3HA 4PD4D 1FOCA 1M60A 2D0SA 1GQ1A 5CIHB 4PWAA 2N3YA 3VYMA 2AI5A 1WEJF 1OCDA 1S6VB 2GC4D 2ZBOA 3VMAA 2RMZA 1HCMA 3A0BV 1HH7A 3O1YA 4P4QB 2YCCA 3CX5D 4WQ8A 3L71D 1F1FA 1DT1A 3O20A 3H1ID 1QL3A 2IBZD 1CRYA 1C6OA 3ZOXA 3ZBMA 3OA8A 1H32B 351CA 1H9XA 4K3IA 1I5TA 5CICB 2K9JB 4FA4A 2BCCD 4EICA 3ZCFA 3L75D 1CCRA 1CXCA 2QJPB 2CA4B 2N9IA 2ZZS1 2FYNB 1LC2A 4UB6V 1P84D 2AIUA 3H1HD 3NBTA 4WQ9A 1LFMA 4PJ0V 3X39A 5GTIV 1EB7A 5CIBB 4WQ7A 2FYUD 1AOQA 2MHMA 1DIIC 4RSZA 3PLNA 2MTAC 3TDKA 4A7PA 1CO6A 2CA3B 2QJKB 3L73D 3WFCC 1CHIA 2GB8B 1A2SA 1R0QA 3M97X 1FI3A 1NNOA 1NTMD 2C1UA 4AANA 1YTCA 5KAIV 5TJHA 1HJ5A 5B6QA 3CXHD 1L9BC 4PW9B 4Y5RA 2PCCB 2CXBA 1CYIA 3HQ6A 2V08A 1I8PA 1BE3D 3WFEC 1C52A 2B12B 2YQBA 3H1LD 4D6TD 2O3JA 1A56A 1AOFA 2B11B 1F1CA 4NFGB 3OCDA 1SQBD 3RLMA 1CRJA 2BH4X 3SJLA 1WVEC 3HQ9A 1N90A 4IL6V 1C6RA 4DY9A 5DFSA 3CYTI 2C1DB 4EIEA 1QKSA 1CXAA 1COTA 1DVVA 3L4MA 4KMGA 2GIWA 1LS9A 2N9JA 4EDFA 1L9JC 5H2FV 3WFBC 2V07A 5CIDB 1L0LD 1U75B 1W2LA 5KLIB 3JBTB 1KV9A 4EIFA 5CIGB 3A9FA 1CORA 1GIWA 1U74B 4J20A 3OA8B 3BCCD 4XYDB 1KX2A 1FI7A 2BH5X 3H1JD 3MK7C 1PP9D 3PXWA 3WC8A 1CSWA 2L4DA 2LIRA 1BL9A 1IRVA 1QL4A 4WQEA 2JWAA 3OCDB 1CIFA 1EZVD 3PTZA 2I8FA 3ZOOA 2A06D 2ZONG 1RZ6A 2YK3A 1IO3A 2RN0A 3CWBD 3WFDC 3CXHW 1ETPA 3KHUA 4Q5PA 1PPJD 3WUIA 4UB8V 1KYOD 4H0JA 1YEBA 3FWLA 1DW1A 3C2CA 4L3GA 2B4ZA 1W5CT 1NTKD 2FWLA 4L1QA 1H31B 3ZIYA 1CC5A 1LMSA 2L91A 3PXTA 3DMIA 2N18C 1IRWA 1YCCA 3L70D 1I8OA 1GDVA 1KB0A 1I54A 3TGUD 4WQBA 3NBSA 1NU1D 3TF5A 1QYZA 1BCCD 1YNRA 3GW6A 2EXVA 3VRDA 2QJYB 2LITA 2DVHA 4O1QA 4U3FD 4FAVA 2C2CA 1CHJA 4RJTA 1YEAA 1MG3D 2CE0A 451CA 1GJQA 1K3GA 1CRIA 1IQCA 2Y0DA 4GEDB 5KLVD 1I6DA 4FA1A 2OZ1B 1DVHA 5CIFB 2C1DA 4V2KA 2B10B 2AXTV 1KB9D 4FA5A 3HQ7A 3PRJA 5GTHV 3O5CA 2C1VA 1VYDA 1CYCA 1MZ4A 4LJIA 2Y0EA 1S5LV 5C0ZA 5DJQB 1CTZA 1ZRTD 1RZ5A 4AALA 4EIDA 1HROA 2BCNB 1E8EA 4FANA 1FI9A 2N3BA 1H33A 2B0ZB 1B7VA 1SQPD 2VHDA 4GYDA 1GKSA 155CA 1QN2A 1MG2D 2PACA 3ORVA 1ZZHA 4WQAA 1SQVD 2Q3EA 1H31A 5KAFV 2DGEA 1N9CA 3L4OA 1GU2A 1H33B 3SVWA 4QAOA 1CCHA 3DR0A 1NTZD 2FRCA 4H0KA 5C9MA 1N15A 2C8SA 3L72D 1CEDA 1H32A 3MK7B 2YIUB 3TYIA 1CTJA 3PH2B 1HRCA 1YICA 4AAOA 1A8CA 1FHBA 1CHHA 1BGYD 2C9XB 4WQCA 1HJ4A 2JTIB 1N50A 2BLFB 3CU4A 3RMZA 3VNWA 5CYTR 2ZXYA 1H9YA 4N0KA 4YE1A 4L3HA 1RAPA 1KIBA 1DW3A 1DW2A 1CSUA 1CSVA 2N18B 4FB1A 3WU2V 1CIGA 1SQQD 1CIEA 1E29A 1J3SA 1RAQA 4JCGA 1CRGA 2D0WA 1DIQC 2CE1A 5IY51 1KYOW 3ZOWA 1CRHA 1AYGA 4WQDA 1FJ0A 2N9YB 2JQRA 1OAEA 5B5EV 5AURA 2BGVX 2KNCB 1CIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN1 A;  1SQX D;  1KX7 A;  3L74 D;  3DP5 A;  1FCD C;  3GG2 A;  3CX5 W;  4AAM A;  1NMI A;  1C7M A;  1HJ3 A;  5TIS V;  3ITK A;  3NWV A;  1C75 A;  1LC1 A;  2KS1 A;  3PXS A;  4O1W A;  4XXL A;  2GC7 D;  1L0N D;  5CIE B;  3KZI V;  1E2R A;  1AKK A;  1YIQ A;  4AX3 A;  1M70 A;  1M6Z A;  2ZOO A;  1YFC A;  3PHL A;  5DF5 A;  1NIR A;  5KKZ B;  2OZ1 A;  5DJQ C;  2PCB B;  1I6E A;  1HZV A;  2ORL A;  2Y0C A;  1CTY A;  1C6S A;  1NML A;  1H1O A;  5EXQ A;  1C2N A;  2XTS B;  4MU8 A;  1HZU A;  3A0H V;  2QG4 A;  3O0R C;  1CYJ A;  2BPB B;  3HQ8 A;  3ZOY A;  1CRC A;  3CP5 A;  3H1K D;  2HV4 A;  5E79 V;  3SXT A;  1DW0 A;  3RN0 A;  1JDL A;  3SLE A;  4FA9 A;  1CNO A;  1IZL 0;  3SWS A;  1C2R A;  1CSX A;  1I55 A;  5B66 V;  1K3H A;  4PD4 D;  1FOC A;  1M60 A;  2D0S A;  1GQ1 A;  5CIH B;  4PWA A;  2N3Y A;  3VYM A;  2AI5 A;  1WEJ F;  1OCD A;  1S6V B;  2GC4 D;  2ZBO A;  3VMA A;  2RMZ A;  1HCM A;  3A0B V;  1HH7 A;  3O1Y A;  4P4Q B;  2YCC A;  3CX5 D;  4WQ8 A;  3L71 D;  1F1F A;  1DT1 A;  3O20 A;  3H1I D;  1QL3 A;  2IBZ D;  1CRY A;  1C6O A;  3ZOX A;  3ZBM A;  3OA8 A;  1H32 B;  351C A;  1H9X A;  4K3I A;  1I5T A;  5CIC B;  2K9J B;  4FA4 A;  2BCC D;  4EIC A;  3ZCF A;  3L75 D;  1CCR A;  1CXC A;  2QJP B;  2CA4 B;  2N9I A;  2ZZS 1;  2FYN B;  1LC2 A;  4UB6 V;  1P84 D;  2AIU A;  3H1H D;  3NBT A;  4WQ9 A;  1LFM A;  4PJ0 V;  3X39 A;  5GTI V;  1EB7 A;  5CIB B;  4WQ7 A;  2FYU D;  1AOQ A;  2MHM A;  1DII C;  4RSZ A;  3PLN A;  2MTA C;  3TDK A;  4A7P A;  1CO6 A;  2CA3 B;  2QJK B;  3L73 D;  3WFC C;  1CHI A;  2GB8 B;  1A2S A;  1R0Q A;  3M97 X;  1FI3 A;  1NNO A;  1NTM D;  2C1U A;  4AAN A;  1YTC A;  5KAI V;  5TJH A;  1HJ5 A;  5B6Q A;  3CXH D;  1L9B C;  4PW9 B;  4Y5R A;  2PCC B;  2CXB A;  1CYI A;  3HQ6 A;  2V08 A;  1I8P A;  1BE3 D;  3WFE C;  1C52 A;  2B12 B;  2YQB A;  3H1L D;  4D6T D;  2O3J A;  1A56 A;  1AOF A;  2B11 B;  1F1C A;  4NFG B;  3OCD A;  1SQB D;  3RLM A;  1CRJ A;  2BH4 X;  3SJL A;  1WVE C;  3HQ9 A;  1N90 A;  4IL6 V;  1C6R A;  4DY9 A;  5DFS A;  3CYT I;  2C1D B;  4EIE A;  1QKS A;  1CXA A;  1COT A;  1DVV A;  3L4M A;  4KMG A;  2GIW A;  1LS9 A;  2N9J A;  4EDF A;  1L9J C;  5H2F V;  3WFB C;  2V07 A;  5CID B;  1L0L D;  1U75 B;  1W2L A;  5KLI B;  3JBT B;  1KV9 A;  4EIF A;  5CIG B;  3A9F A;  1COR A;  1GIW A;  1U74 B;  4J20 A;  3OA8 B;  3BCC D;  4XYD B;  1KX2 A;  1FI7 A;  2BH5 X;  3H1J D;  3MK7 C;  1PP9 D;  3PXW A;  3WC8 A;  1CSW A;  2L4D A;  2LIR A;  1BL9 A;  1IRV A;  1QL4 A;  4WQE A;  2JWA A;  3OCD B;  1CIF A;  1EZV D;  3PTZ A;  2I8F A;  3ZOO A;  2A06 D;  2ZON G;  1RZ6 A;  2YK3 A;  1IO3 A;  2RN0 A;  3CWB D;  3WFD C;  3CXH W;  1ETP A;  3KHU A;  4Q5P A;  1PPJ D;  3WUI A;  4UB8 V;  1KYO D;  4H0J A;  1YEB A;  3FWL A;  1DW1 A;  3C2C A;  4L3G A;  2B4Z A;  1W5C T;  1NTK D;  2FWL A;  4L1Q A;  1H31 B;  3ZIY A;  1CC5 A;  1LMS A;  2L91 A;  3PXT A;  3DMI A;  2N18 C;  1IRW A;  1YCC A;  3L70 D;  1I8O A;  1GDV A;  1KB0 A;  1I54 A;  3TGU D;  4WQB A;  3NBS A;  1NU1 D;  3TF5 A;  1QYZ A;  1BCC D;  1YNR A;  3GW6 A;  2EXV A;  3VRD A;  2QJY B;  2LIT A;  2DVH A;  4O1Q A;  4U3F D;  4FAV A;  2C2C A;  1CHJ A;  4RJT A;  1YEA A;  1MG3 D;  2CE0 A;  451C A;  1GJQ A;  1K3G A;  1CRI A;  1IQC A;  2Y0D A;  4GED B;  5KLV D;  1I6D A;  4FA1 A;  2OZ1 B;  1DVH A;  5CIF B;  2C1D A;  4V2K A;  2B10 B;  2AXT V;  1KB9 D;  4FA5 A;  3HQ7 A;  3PRJ A;  5GTH V;  3O5C A;  2C1V A;  1VYD A;  1CYC A;  1MZ4 A;  4LJI A;  2Y0E A;  1S5L V;  5C0Z A;  5DJQ B;  1CTZ A;  1ZRT D;  1RZ5 A;  4AAL A;  4EID A;  1HRO A;  2BCN B;  1E8E A;  4FAN A;  1FI9 A;  2N3B A;  1H33 A;  2B0Z B;  1B7V A;  1SQP D;  2VHD A;  4GYD A;  1GKS A;  155C A;  1QN2 A;  1MG2 D;  2PAC A;  3ORV A;  1ZZH A;  4WQA A;  1SQV D;  2Q3E A;  1H31 A;  5KAF V;  2DGE A;  1N9C A;  3L4O A;  1GU2 A;  1H33 B;  3SVW A;  4QAO A;  1CCH A;  3DR0 A;  1NTZ D;  2FRC A;  4H0K A;  5C9M A;  1N15 A;  2C8S A;  3L72 D;  1CED A;  1H32 A;  3MK7 B;  2YIU B;  3TYI A;  1CTJ A;  3PH2 B;  1HRC A;  1YIC A;  4AAO A;  1A8C A;  1FHB A;  1CHH A;  1BGY D;  2C9X B;  4WQC A;  1HJ4 A;  2JTI B;  1N50 A;  2BLF B;  3CU4 A;  3RMZ A;  3VNW A;  5CYT R;  2ZXY A;  1H9Y A;  4N0K A;  4YE1 A;  4L3H A;  1RAP A;  1KIB A;  1DW3 A;  1DW2 A;  1CSU A;  1CSV A;  2N18 B;  4FB1 A;  3WU2 V;  1CIG A;  1SQQ D;  1CIE A;  1E29 A;  1J3S A;  1RAQ A;  4JCG A;  1CRG A;  2D0W A;  1DIQ C;  2CE1 A;  5IY5 1;  1KYO W;  3ZOW A;  1CRH A;  1AYG A;  4WQD A;  1FJ0 A;  2N9Y B;  2JQR A;  1OAE A;  5B5E V;  5AUR A;  2BGV X;  2KNC B;  1CIH A; 
#chains in the Genus database with same CATH topology
 1LTA C;  3DP5 A;  1SLQ A;  1Y47 A;  3CX5 W;  1JMB A;  3B8E B;  1C7M A;  1IFP A;  5APQ A;  1HJ3 A;  3F89 A;  3KQG A;  3ITK A;  5AVX B;  3G6E P;  1C75 A;  1LC1 A;  2KYV A;  2KS1 A;  4O1W A;  4XXL A;  2GC7 D;  4GT1 A;  3V2N A;  1YIQ A;  1NTZ E;  3HE4 A;  1M70 A;  4DT0 A;  1IFN A;  1G1I A;  2ZOO A;  1ZOY C;  1OMI A;  1FJP A;  2PCB B;  3RL0 C;  4C7N A;  1I6E A;  3CCV P;  1PL5 A;  2W6J H;  4MU8 A;  1ZR2 A;  1HZU A;  3A0H V;  1SQX G;  3CCE P;  1FZB A;  4RES B;  3HE5 B;  4UB8 H;  3ZOY A;  1CRC A;  3CP5 A;  3H1K D;  2WSS H;  2OTL P;  2HV4 A;  1DW0 A;  3RN0 A;  4NPF X;  3SLE A;  2P7J A;  2WSC J;  4DCK A;  2FBW C;  3B5N C;  1C2R A;  1OIP A;  1KIL E;  5AVT B;  1H89 A;  2FYU K;  5CHX A;  1WEJ F;  1N8R Q;  1S6V B;  2RMZ A;  2AXC A;  1HCM A;  2I1K A;  1VDF A;  5APW A;  4RKU J;  4P4Q B;  2E5T A;  3H25 A;  1PZQ A;  2R3S A;  3D6Y A;  5AW7 B;  2QJP C;  3H1I D;  1QL3 A;  3P8M C;  3TK1 A;  3B5N B;  3GF7 A;  3RL0 B;  5TIS E;  4AUW A;  2M0B A;  1NJI Q;  1VF5 D;  3USS A;  1KQL A;  1NKZ B;  1H32 B;  2ZYA A;  351C A;  3U1C A;  4GDO A;  3L75 G;  1CCR A;  4I7Z B;  4IL6 X;  2FYN B;  4UB6 V;  3H1I E;  1P84 D;  3G71 P;  1SFC B;  1NU1 G;  4H44 C;  3BCC G;  1SQP G;  3A7O A;  3NBT A;  1PPJ E;  3X39 A;  3HD7 A;  1L0L J;  3WU2 E;  2ZXX A;  1SVF A;  2HPC B;  1LTJ C;  2FYU D;  1NO4 A;  2MHM A;  3PLN A;  4PV1 D;  3TDK A;  2H8P D;  4Y28 J;  3Q2Y A;  1A2S A;  3B5N A;  1KTM A;  3NXS A;  3RL0 g;  2R5D A;  1FI3 A;  1GL2 B;  4JYC A;  1VQ7 P;  4B86 A;  3AEB C;  3CCM P;  1FZC C;  1RQU A;  5KAI V;  1VL2 A;  1M8O B;  3OW2 O;  1HJ5 A;  3M91 A;  2P2U A;  1KQG B;  1HGV A;  1SQB J;  1VQK P;  2V08 A;  5KLV K;  3WFE C;  2YQB A;  1S2E A;  2Q6Q A;  1AOF A;  3GMA A;  3VTP C;  1N7S A;  5GTI H;  1URQ C;  2YO3 A;  3RLM A;  2WPS A;  1HUC A;  2V7Q H;  4GIF A;  1N90 A;  2V4H A;  4I1L A;  1LNQ A;  5DFS A;  1QVG O;  4EIE A;  1NTZ J;  1S4X A;  3TNU A;  4DOJ A;  4KMG A;  2GIW A;  3S1K A;  3EQ2 A;  3I56 P;  1FE6 A;  3RK3 C;  4AQR D;  3KDP B;  4PJ0 E;  3RBZ A;  1Q81 Q;  1KFM A;  1KMI Z;  1AA0 A;  1U75 B;  1W2L A;  3JBT B;  1KV9 A;  1JY2 O;  5CCG A;  4WVZ A;  5CCH A;  1GW4 A;  1EDI A;  1S5L E;  1COR A;  2JEE A;  1GIW A;  1U74 B;  1LTB C;  1SQQ J;  5CJ0 A;  3BCC D;  1NYH A;  2R44 A;  3GHG B;  1U7M A;  3MK7 C;  2K9Y A;  3WC8 A;  1IO4 A;  2LIR A;  1BL9 A;  1X9V A;  1CW5 A;  1IRV A;  1QL4 A;  4WQE A;  1K8A Q;  2JWA A;  3OCD B;  2A45 H;  5DJT B;  2N1T D;  3CWB G;  2YXR B;  3KHU A;  3AEC C;  2A06 E;  1PPJ D;  5KAF E;  3W68 A;  4UB8 V;  2H7H A;  1JY2 N;  1T2K D;  2B4Z A;  1P84 E;  3IN6 A;  1N73 C;  1NTK D;  4L1Q A;  5GTH H;  1LMS A;  1YQ4 C;  1NHL A;  1FAV A;  3P32 A;  3AEG C;  3L70 D;  1BCC G;  2WWW A;  1BCC J;  1YNR A;  3HRN A;  1ZR4 A;  2LIT A;  2DVH A;  4WBA A;  1CHJ A;  1SP4 A;  2KNC A;  1HGZ A;  3GHG C;  3KZI H;  2QE7 H;  2A06 G;  1IQC A;  3TGU J;  1VQO P;  5TIS H;  4FA5 A;  5CCH C;  1LWU C;  3HD7 D;  1T2K C;  2W90 A;  1HTL C;  2XU6 A;  2KIK A;  1H88 A;  1OWA A;  4W80 A;  2WQY C;  2E76 D;  3M0D A;  3H1I J;  2K88 A;  1ZRT D;  2HOD A;  1RZ5 A;  4C7R A;  2D2C C;  4HJG H;  3AE5 C;  3MTU E;  3E1R A;  1HJ0 A;  3AEA C;  1E8E A;  2N3B A;  1LTT C;  1GKS A;  4GYD A;  2LR2 A;  1X0T A;  1DIP A;  155C A;  2WSC H;  2NZ2 A;  2QIW A;  3CME P;  2ZYG A;  4PV1 B;  3L4O A;  3P7K A;  2G8Y A;  4H44 B;  1CCH A;  4LLH A;  1NTZ D;  2IPP A;  2FRC A;  4H0K A;  1NTZ K;  2OQQ A;  4HKZ H;  2C8S A;  3L72 D;  1CED A;  1H32 A;  1RHZ B;  1EC5 A;  1PGQ A;  2YIU B;  1CTJ A;  2OTK E;  2K1A A;  1A8C A;  1D7M A;  5KAI E;  1L0N K;  1CHH A;  1H0T A;  2C9X B;  4Z1M H;  5KAF H;  4WQC A;  1LTG C;  1NAF A;  2BEZ F;  1HJ4 A;  1NTK E;  2QSI A;  3VNW A;  1SQB G;  2P67 A;  2ZXY A;  1H9Y A;  4L3H A;  1SQV G;  2OGU A;  1RAP A;  1LWU B;  1CSV A;  3EFF K;  3M0D C;  4FB1 A;  1IFM A;  3WU2 V;  3O6Q B;  3HE4 B;  4JCG A;  1CRH A;  1G2C B;  1FJ0 A;  1EZV E;  1KIL D;  2KS1 B;  5KJ7 D;  1SQP E;  3BCC E;  3PP5 A;  1M1J B;  3L74 D;  2YXQ B;  4GOD A;  1NTK K;  1GD2 E;  1BE3 G;  2FFD A;  4HH2 A;  4IOI H;  5TIS V;  2MKV A;  2OTJ P;  3FXE A;  4EIJ A;  3FX0 A;  2ZT9 D;  3SWY A;  3CXH I;  3KZI V;  1E2R A;  3PH0 A;  1SQV K;  3VP8 A;  4C7N B;  3L73 E;  1YBK A;  2Z4E A;  1PGO A;  1AVY A;  3W67 A;  1VQN P;  2HYN A;  1IK9 A;  1YFC A;  1RF0 A;  3PHL A;  5DF5 A;  4CPG A;  5KKZ B;  2QA4 P;  2BCC J;  1CTY A;  1EDJ A;  4JYB A;  2XV5 A;  1NML A;  1H1O A;  5EXQ A;  4ZMD A;  1NWQ A;  3O0R C;  2BPB B;  3HQ8 A;  5AW8 B;  2M8R A;  2NPS D;  3QH9 A;  4YPC A;  2XDJ A;  1QL1 A;  3CCR P;  4R4M A;  1T3J A;  1OW7 A;  1SQP J;  1S72 P;  1AQT A;  1CSX A;  2K37 A;  2N1T A;  1M60 A;  2KZI A;  1GQ1 A;  5CIH B;  2N3Y A;  3VYM A;  2QM7 A;  2KSJ A;  4H0L D;  2GC4 D;  1S9K E;  2YO2 A;  5KAI H;  4WY4 B;  2L5G B;  1N7S C;  1M1J C;  2KLV A;  1LGH B;  2YCC A;  3CX5 D;  2E76 C;  1L4A D;  4WQ8 A;  1RE4 A;  2IZ0 A;  2P58 A;  4ZNC A;  1P84 H;  3L71 D;  1F1F A;  1DT1 A;  3O20 A;  3S4R A;  4DJG A;  2IBZ D;  1BGY E;  3ZOX A;  1JCC A;  2VRS A;  3H1L G;  1L4A A;  4HYT B;  2J5U A;  3QWO C;  5B66 E;  5AVW B;  5AW6 B;  2I8D A;  1EDK A;  5CIC B;  3H1J J;  4EIC A;  3ZCF A;  3C1L A;  3WUT A;  5AVR B;  2QJP B;  1Q86 Q;  3I55 P;  2CA4 B;  2ZZS 1;  2E42 A;  4WY4 A;  3BRT B;  3OA7 A;  5CIB B;  1PFI A;  1AOQ A;  3BCC J;  1DII C;  1NU1 J;  1VQ4 P;  3JC2 2;  4A7P A;  1YHQ P;  2WSF J;  1CHI A;  1R0Q A;  2IZ1 A;  1NNO A;  3I5C A;  1GL2 C;  4OH8 B;  1URQ D;  1FZC B;  3M9H A;  2C1U A;  1GU5 A;  2IDB A;  4W7Z A;  3R2P A;  1DX7 A;  1SS1 A;  2M3E A;  3WU2 H;  1BE3 D;  4JPZ B;  2B12 B;  3H1L D;  4D6T D;  1L0N J;  5M1B A;  2B11 B;  2WIT A;  1L0L E;  2HOD B;  2WVR A;  1JY3 O;  3MP7 B;  1OXZ A;  1UII A;  2ZYD A;  1KC8 Q;  2BH4 X;  2N1T B;  1WVE C;  1J1D C;  3AE7 C;  3CYT I;  3L73 G;  1QKS A;  4K35 A;  5H2F H;  4N78 E;  2PFX A;  4L76 A;  3MD0 A;  4EDF A;  4H44 D;  3IF4 A;  3WFB C;  1HVV A;  1YJN P;  2BCC E;  1YJW P;  5CID B;  1JUN A;  1NU1 K;  1HJB A;  4IFM A;  4EIF A;  3H1H J;  5CIG B;  1XTG B;  4WY4 D;  1L0N G;  1LJ2 A;  1ZXG A;  1MZ9 A;  4LGD E;  3KPE A;  3AED C;  2Q9I A;  3A0H E;  3H1J D;  1PP9 D;  1CSW A;  1Y8A A;  3RK2 B;  2FXP A;  1FZF A;  1CIF A;  1E79 H;  3G4S P;  3ZOO A;  5APV A;  1SQQ K;  2FXM A;  5B66 H;  3V6I A;  1WMK A;  1SQV E;  1X79 B;  4Q5P A;  2IBZ I;  3WUI A;  2GA1 A;  1KYO D;  5B5E H;  2YMY A;  2GM4 A;  1YEB A;  3O8Z A;  3HUS B;  1DW1 A;  4L3G A;  3VMY A;  1AV1 A;  2FYN C;  1OW8 A;  5C39 A;  3ZIY A;  3L72 J;  2L91 A;  1EXI A;  1FZE A;  3AE4 C;  3B5N D;  2POH A;  4L73 A;  5DJU B;  2A45 G;  2E75 B;  2R5B A;  3CCU P;  4WQB A;  3NBS A;  3TF5 A;  3AE1 C;  1QYZ A;  3GW6 A;  2HFE D;  4O1Q A;  4FAV A;  3ZDM A;  4RJT A;  2E74 D;  1KB9 E;  1MG3 D;  3RK3 E;  1KB9 H;  2CE0 A;  3IAO A;  1CRI A;  5KLV E;  2Y0D A;  1BSH A;  2KOG A;  1LTJ B;  2FY8 A;  3MGN A;  1FZG A;  5CCG D;  5CIF B;  1VF5 C;  1MFT A;  3NTN A;  2KZJ A;  3MUD A;  3HQ7 A;  3PRJ A;  3TYY A;  1R5S A;  4H13 C;  1YI2 P;  5GTH V;  3O5C A;  4O9B A;  3CWB J;  1CYC A;  1MZ4 A;  1Q90 D;  5BU5 A;  5E79 E;  5C0Z A;  4PD4 E;  1N7L A;  5BU8 B;  1W2E A;  5DJQ B;  1Q2N A;  1W5C E;  3O6Q A;  4GKG A;  1GDT A;  3T97 A;  3H32 A;  3AEE C;  1HRO A;  3RK2 C;  3A2A A;  2KK7 A;  1URQ B;  1L0L K;  1MG2 D;  5CCG C;  1JY3 P;  2J58 A;  1NVO A;  1H31 A;  3ABV C;  3C8V A;  1RE3 C;  3A3Y B;  2XKM A;  1S1C X;  1FDO A;  3SVW A;  4QAO A;  3DR0 A;  4U3F E;  3H1H E;  4IFD K;  1KIL A;  2A45 I;  2B88 A;  1BCC E;  1N15 A;  4ZKP A;  3MK7 B;  3TGU E;  2W8Z A;  3TYI A;  1NTK G;  3E7K A;  5AW2 B;  1FHB A;  4BWN A;  2M5A A;  2OYI A;  2K9J A;  3D71 A;  1KN7 A;  2XZR A;  3II6 A;  1ZV8 A;  2BLF B;  3RMZ A;  1N73 A;  1A02 F;  3LW5 J;  2KI7 B;  1RQV A;  3V4Q A;  2KXP B;  4YXW H;  3B71 A;  1QVF O;  2YKO A;  3CWB E;  4BXL A;  1OW6 A;  1DW3 A;  1DW2 A;  2IYP A;  2N18 B;  2BEQ D;  1SQQ D;  1T8Z A;  2CE1 A;  5KTB A;  2HPC A;  2Q5U A;  1NH4 A;  4OGQ D;  1OAE A;  2ZVN B;  3GHG A;  1CIH A;  2JDI H;  3M0A A;  1QLE D;  1SQX D;  2IX7 C;  1KX7 A;  5GTH E;  1FCD C;  1NTM J;  3GG2 A;  2FYZ A;  4GOE A;  1FS0 E;  1NMI A;  2AXT H;  2RH0 A;  1RF1 C;  3LIE A;  4ASV A;  2KUB A;  3L75 J;  3PXS A;  2Z5H A;  5AW9 B;  1L0N D;  4D6T J;  1X8Y A;  5CIE B;  4M3L A;  1BE3 J;  1AKK A;  2GUV A;  4ASW A;  4AX3 A;  5E79 H;  1M6Z A;  1DEE G;  2KP8 A;  1NIR A;  1VQ8 P;  3GF3 A;  1JY3 N;  3P8C E;  2PRR A;  2OYI C;  4KT0 J;  3Q5P A;  2XTS B;  2R32 A;  1K05 A;  1SQP K;  4JF7 A;  3NFQ A;  1CYJ A;  2FYU J;  3CPW O;  1AQ5 A;  1H0T B;  1SQV J;  1KZU B;  1JM0 A;  3L37 A;  2WPR A;  3CL3 D;  1JDL A;  4FA9 A;  1IZN B;  3CXH E;  5APT A;  3TGU G;  1IZL 0;  3SWS A;  1I55 A;  1Z56 A;  3CLQ A;  1GL2 D;  1OVR A;  3H1H G;  4BRY A;  4EOT A;  2D0S A;  1PGP A;  1SFC A;  3V4W A;  2SPZ A;  1VQ9 P;  1CI6 B;  1JTH B;  2ZBO A;  1NTK J;  1VPC A;  4W7Y A;  1PPJ G;  1H8A A;  3BVH A;  2NPS C;  1NOH A;  1Q7Y Q;  2BAS A;  1PIX A;  4RO0 A;  3L75 E;  1PP9 E;  3C9I A;  2B87 B;  1CRY A;  1ZLL A;  1NKN A;  2UWJ E;  3ZBM A;  1VF5 B;  3OA8 A;  5L8R J;  1KD1 Q;  1JCD A;  4WY4 C;  2YIU C;  1H9X A;  4K3I A;  2K9J B;  4UB8 E;  1OVU A;  1ZW0 A;  1CXC A;  1LT1 A;  2N9I A;  2I1J A;  1K73 Q;  2E74 C;  4NPD A;  1LT9 A;  1VQL P;  3L36 A;  2AIU A;  3H1H D;  4WQ9 A;  1IJD B;  2KSE A;  1LFM A;  4PJ0 V;  1FZC A;  1GK4 A;  4WQ7 A;  1YQ3 C;  5BVZ A;  4RSZ A;  5KLI C;  1CO6 A;  1S5L X;  2ZVO B;  3D70 A;  5APS A;  1KQF B;  2V7Q J;  2LKM A;  1NTM K;  3H1K J;  1NTM D;  3L71 G;  5B5E E;  5TJH A;  2ZAE B;  2KB7 P;  3CD6 P;  3FGA D;  3VMZ A;  4PW9 B;  4Y5R A;  1M7L A;  1CYI A;  1C52 A;  1IK7 A;  3H32 B;  5EFW B;  1SQX E;  2JJL A;  2O3J A;  4QMA A;  1QX8 A;  3B4S A;  1LTI C;  4K3A A;  2FKW B;  2NPS A;  3V2P A;  1USD A;  3GLM A;  1F1C A;  1S3J A;  3H1L J;  3F5H A;  1FZA A;  3SFE C;  1SQB D;  3M9B A;  1CRJ A;  3SJL A;  1Y9B A;  3MZW B;  5KKZ C;  1C6R A;  2ITA A;  1NTZ G;  1MFZ A;  1DVV A;  2XND H;  4YXD C;  1LS9 A;  2W6A A;  1OFC X;  2XNX A;  4U7J A;  3D0W A;  1NU1 E;  1L0N E;  1L2P A;  2WMM A;  5KLI B;  2YKQ A;  3L74 G;  1EQ7 A;  3MUD C;  3A9F A;  2BCC G;  3PJS K;  3OA8 B;  2WT7 A;  1M1K Q;  1FI7 A;  4BRY B;  3PXW A;  5CJ4 A;  1R5L A;  2IFM A;  2H88 C;  1IC2 A;  1L4A C;  3PTZ A;  3FXD A;  2D2C D;  1RF1 B;  1RF1 A;  1IFJ A;  2P10 A;  1SQQ E;  2H43 A;  2RN0 A;  1FOS E;  2Y9Z A;  3CCJ P;  3WFD C;  3CXH W;  1USE A;  2W6B A;  4XE5 B;  2E76 B;  1L0L G;  3FWL A;  3C2C A;  2N9B A;  3HD7 C;  3A0H H;  4OWF A;  5CCH D;  1W5C T;  2C0X A;  1CC5 A;  4KJM A;  3PXT A;  4H0L B;  2N18 C;  1JOC A;  3SWF A;  1J2J B;  2YNY A;  4N3Y B;  1GDV A;  1CZQ A;  1KB0 A;  2JR8 A;  1YTZ I;  1NU1 D;  2AEJ A;  1GL2 A;  2C9N Y;  2QJY B;  3TNU B;  1QEX A;  1YEA A;  3KZI E;  1YIT P;  451C A;  1CSB A;  5AVV B;  1FJK A;  4GED B;  3BAT A;  5KLV D;  4FA1 A;  1DVH A;  3G3Z A;  1GZL A;  2C1D A;  3V2Q A;  1KB9 D;  4NPE A;  2O1J A;  3CC7 P;  2QVA A;  1VQP P;  1KB9 I;  1BDD A;  4ZKU A;  2Y0E A;  1S5L V;  2MJZ A;  5CBN A;  5AW5 B;  1FC2 C;  1N7S D;  1BDC A;  3H1L E;  4N6J A;  1BGY G;  3L70 G;  1RF0 C;  4AAL A;  1W2B O;  4EID A;  1LTJ A;  5AVU B;  1RE4 C;  1KYO H;  4H0L C;  2BCN B;  1FBM A;  3L74 E;  3FWN A;  5KLV J;  2AXT E;  1H33 A;  2B0Z B;  2JP3 A;  1DD4 A;  1SQP D;  2VHD A;  2E5Y A;  4EI2 A;  1KIL C;  5CMZ A;  3ORV A;  1ZZH A;  4WQA A;  1SQV D;  2Q3E A;  2ZJS E;  2WSE J;  1S5L H;  1CI6 A;  2DGE A;  1EZV I;  3TSI A;  1J1E B;  1HBW A;  4WB4 A;  1JO5 A;  1H33 B;  3L72 G;  3RK3 D;  3VOP A;  3CCQ P;  3V5B A;  4C46 A;  4TLF A;  5C9M A;  3H1K G;  3PH2 B;  1HRC A;  1YIC A;  1DEB A;  3LID A;  1J1D B;  2B87 A;  4MN4 C;  4IL6 H;  4Y99 B;  1U57 A;  4IL6 E;  2M3B A;  2WT7 B;  1LP1 B;  5AW4 B;  2NRG A;  2JO1 A;  1N73 B;  4I6M C;  3CCL P;  2O01 H;  5CYT R;  3L71 E;  1X22 A;  1KYO E;  2ZT9 C;  2B89 A;  5K5G B;  1JTH A;  1N86 A;  1YYC A;  3Q1M A;  4TT3 H;  1PV3 A;  3H6P A;  2E43 A;  1E29 A;  3JSV C;  1KIL B;  1SFC C;  2KLU A;  5B5E V;  5AUR A;  3HUS C;  2BGV X;  2KNC B;  5KJ7 C;  2GUS A;  3RN1 A;  4D6T E;  1SFC D;  1FOS F;  1AJY A;  3N7N A;  1BE3 E;  4AAM A;  3S9O A;  3AE9 C;  2OYH A;  5APX A;  2B9B A;  1L4A B;  3NWV A;  1OZH A;  2ZT9 B;  1JB0 J;  2QM8 A;  1EZV G;  1JEK A;  5GTI E;  3CI9 A;  1K04 A;  1FDI A;  3RGU A;  1PP9 G;  2ZXE B;  4N78 D;  1DD3 A;  2O01 J;  2OYO A;  4YTP C;  3RBX A;  3BAS A;  2OZ1 A;  5DJQ C;  2LXB A;  3OJA B;  2IYO A;  1HZV A;  3L71 J;  1AVO A;  2ORL A;  2Y0C A;  1C6S A;  1SQB E;  1LT9 C;  1TU3 F;  1C2N A;  3RK3 B;  1G1J A;  2QG4 A;  1GTW A;  2M5A B;  2Q7C A;  4Y99 C;  4XA4 A;  2PP6 A;  1RE3 A;  3SXT A;  5E79 V;  3E1I A;  4PD4 I;  2QEX P;  3L73 J;  1CNO A;  2CPB A;  1NAY A;  2CPS A;  5B66 V;  1K3H A;  4PD4 D;  1FOC A;  1NTM E;  2P1J A;  3A5T A;  1DH3 A;  1IFD A;  1R8E A;  1M1J A;  2O1K A;  4PWA A;  3CX5 I;  2AI5 A;  1OCD A;  4U3F J;  1P84 I;  3VMA A;  3A0B V;  1ZME C;  2C9L Y;  1HH7 A;  2N1T C;  3OAK A;  1T6A A;  5AVQ B;  3O1Y A;  2Q3I A;  3H1J E;  3L35 A;  3M06 A;  1FDM A;  2Z5I A;  2JKV A;  1VQ6 P;  3KYQ A;  1WT6 A;  1A02 J;  3T97 B;  1C6O A;  1E5W A;  3U59 A;  2HLO A;  4PJ0 H;  2WSF H;  4HB1 A;  3AE6 C;  3EWK A;  2NPS B;  4XFJ A;  2OYH B;  1I5T A;  4L74 A;  4FA4 A;  2BCC D;  3L75 D;  1KOR A;  4JBZ A;  2IBZ E;  1LC2 A;  3L70 J;  2WPQ A;  3WMM 0;  5GTI V;  1EB7 A;  1PGJ A;  2CK3 H;  1GMJ A;  3LW5 H;  4OVN F;  5CBO A;  2FYU G;  2MTA C;  2CA3 B;  2QJK B;  3L73 D;  4DZO A;  2YMK A;  1ZN5 A;  3IR9 A;  3WFC C;  2GB8 B;  3M97 X;  3SSU A;  1JY2 P;  3UIA A;  4AAN A;  1YTC A;  1NGM B;  4OGQ B;  5B6Q A;  3CCS P;  3CXH D;  1L9B C;  1N2D C;  1EXJ A;  2G3A A;  3CXH H;  2PCC B;  1QGK B;  2CXB A;  3HQ6 A;  1I8P A;  1PP9 J;  1BSN A;  4AYC A;  1A56 A;  3Q5S A;  2H89 C;  5AVY B;  5APU A;  4NFG B;  3OCD A;  2WSE H;  3N4X A;  2PGD A;  4UB6 E;  2OAR A;  1JNM A;  3HQ9 A;  4U3F G;  4UB6 H;  3HTK A;  3P8C D;  1N7S B;  4IL6 V;  3AE3 C;  4PV1 C;  4DY9 A;  2E75 D;  2C1D B;  2FYU E;  4L75 A;  1CXA A;  2FFD C;  1COT A;  1VQ5 P;  3K5B A;  3L4M A;  1KQS O;  2N9J A;  3Q5R A;  1L9J C;  4WWI A;  5H2F V;  2QJK C;  2V07 A;  1SQX J;  1LTS C;  1L0L D;  1OX3 A;  4H13 B;  2IBZ G;  3VYI A;  2WTY A;  5APY A;  4J20 A;  3VN0 A;  2AEF A;  3HUS A;  4XYD B;  2Y9Y A;  1VQM P;  2IFN A;  1KX2 A;  4OGQ C;  2BH5 X;  3CX5 E;  2OYI B;  1BGY J;  2L4D A;  1XTC C;  3D6Z A;  1EZV D;  2I8F A;  3H1J G;  2A06 D;  2J59 M;  3L4F A;  1LT9 B;  2ZON G;  2FXO A;  4R4L A;  1RZ6 A;  2YK3 A;  1S9K D;  1IO3 A;  3VP9 A;  3CWB D;  3AEF C;  2HR3 A;  1ETP A;  5KLV G;  3CC4 P;  3AE2 C;  4H0J A;  4H13 D;  1HWT C;  1AFO A;  1LP1 A;  2E74 B;  1YIJ P;  2FWL A;  2LXC B;  1H31 B;  3WUV A;  2DW3 A;  1NTM G;  3DMI A;  1YJ9 P;  1IRW A;  1ZP0 C;  2HG5 D;  1YCC A;  4JQ0 D;  1ZRT E;  3SFD C;  1I8O A;  1KYO I;  2Q1K A;  3G9R A;  1HH0 A;  1FU1 A;  1I54 A;  3TGU D;  3H1K E;  1BCC D;  2W27 A;  4GOF A;  2EXV A;  3VRD A;  2O01 N;  3HD7 B;  2QJY C;  3L72 E;  4U3F D;  2C2C A;  2C0W A;  1SQX K;  1GJQ A;  1K3G A;  2FFD B;  3HTK B;  3CX5 H;  1I6D A;  3EFG A;  2OZ1 B;  4V2K A;  2B10 B;  1GU4 A;  2AXT V;  3H1I G;  5AW3 B;  1MV8 A;  2C1V A;  2ZFC A;  1VYD A;  4LC1 A;  1WRG A;  4LJI A;  3RK2 D;  4I7Z C;  4PD4 H;  3CMA P;  3A0B E;  3HE5 A;  2YKP A;  1JMM A;  3L70 E;  3A0B H;  1K9M Q;  1CTZ A;  5AVZ B;  1M90 Q;  2D2C B;  1LWU A;  2K3R A;  4I2L C;  1KFN A;  5H2F E;  5AVS B;  4FAN A;  1FI9 A;  5KJ7 A;  1B7V A;  4D6T G;  2W83 C;  3CC2 P;  3V2R A;  2R3C A;  1QN2 A;  2PAC A;  3AE8 C;  2OYH C;  1HF9 A;  5KAF V;  1N9C A;  1GU2 A;  4KHX A;  1G2C A;  2RKL A;  3VMX A;  1QL2 A;  3R4Y A;  1IFI A;  1MKM A;  1URQ A;  2E75 C;  4AAO A;  1M57 D;  3KXD A;  5AW1 B;  1RY3 A;  2WPV B;  1J1E C;  1UIX A;  3RL0 D;  1BGY D;  1YTZ T;  2JTI B;  2JWD A;  1N50 A;  4IFF A;  5AW0 B;  3BRV B;  3CU4 A;  1RH5 B;  3Q3D A;  1MUU A;  2QRX A;  3IFM A;  4N0K A;  1EDL A;  4YE1 A;  1M56 D;  3MIW A;  4EYY Q;  1Q82 Q;  3SWK A;  1SQQ G;  1KIB A;  1T3U A;  3L74 J;  1CSU A;  3JCU H;  1GK6 A;  3M9Q A;  3JCU E;  1CIG A;  1U7J A;  1CIE A;  1J3S A;  1RAQ A;  3WUU A;  1KV4 A;  1CRG A;  2D0W A;  1DIQ C;  5IY5 1;  1KYO W;  3U1A A;  3ZOW A;  1SQB K;  2WZ7 A;  1OVV A;  1AYG A;  4WQD A;  2N9Y B;  2JQR A;  3NMD A;  1GW3 A;  2AEM A;  3MHV A;  2PAJ A; 
#chains in the Genus database with same CATH homology
 3RN1 A;  1SQX D;  1KX7 A;  3L74 D;  3DP5 A;  1FCD C;  3GG2 A;  3CX5 W;  4AAM A;  1NMI A;  1C7M A;  1HJ3 A;  5TIS V;  3ITK A;  3NWV A;  1C75 A;  1LC1 A;  2KS1 A;  3PXS A;  4O1W A;  4XXL A;  2GC7 D;  1L0N D;  5CIE B;  3KZI V;  1E2R A;  1AKK A;  1YIQ A;  4AX3 A;  1M70 A;  1M6Z A;  2ZOO A;  1YFC A;  3PHL A;  5DF5 A;  1NIR A;  5KKZ B;  2OZ1 A;  5DJQ C;  2PCB B;  1I6E A;  1HZV A;  2ORL A;  2Y0C A;  1CTY A;  1C6S A;  1NML A;  1H1O A;  5EXQ A;  1C2N A;  2XTS B;  4MU8 A;  1HZU A;  3A0H V;  2QG4 A;  3O0R C;  1CYJ A;  2BPB B;  3HQ8 A;  3ZOY A;  1CRC A;  3CP5 A;  3H1K D;  2HV4 A;  5E79 V;  3SXT A;  1DW0 A;  3RN0 A;  1JDL A;  3SLE A;  4FA9 A;  1CNO A;  1IZL 0;  3SWS A;  1C2R A;  1CSX A;  1I55 A;  5B66 V;  1K3H A;  4PD4 D;  1FOC A;  1M60 A;  2D0S A;  1GQ1 A;  5CIH B;  4PWA A;  2N3Y A;  3VYM A;  2AI5 A;  1WEJ F;  1OCD A;  1S6V B;  2GC4 D;  2ZBO A;  3VMA A;  2RMZ A;  1HCM A;  3A0B V;  1HH7 A;  3O1Y A;  4P4Q B;  2YCC A;  3CX5 D;  4WQ8 A;  3L71 D;  1F1F A;  1DT1 A;  3O20 A;  3H1I D;  1QL3 A;  2IBZ D;  1CRY A;  1C6O A;  3ZOX A;  3ZBM A;  3OA8 A;  1H32 B;  351C A;  1H9X A;  4K3I A;  1I5T A;  5CIC B;  2K9J B;  4FA4 A;  2BCC D;  4EIC A;  3ZCF A;  3L75 D;  1CCR A;  1CXC A;  2QJP B;  2CA4 B;  2N9I A;  2ZZS 1;  2FYN B;  1LC2 A;  4UB6 V;  1P84 D;  2AIU A;  3H1H D;  3NBT A;  4WQ9 A;  1LFM A;  4PJ0 V;  3X39 A;  5GTI V;  1EB7 A;  5CIB B;  4WQ7 A;  2FYU D;  1AOQ A;  2MHM A;  1DII C;  4RSZ A;  3PLN A;  2MTA C;  3TDK A;  4A7P A;  1CO6 A;  2CA3 B;  2QJK B;  3L73 D;  3WFC C;  1CHI A;  2GB8 B;  1A2S A;  1R0Q A;  3M97 X;  1FI3 A;  1NNO A;  1NTM D;  2C1U A;  4AAN A;  1YTC A;  5KAI V;  5TJH A;  1HJ5 A;  5B6Q A;  3CXH D;  1L9B C;  4PW9 B;  4Y5R A;  2PCC B;  2CXB A;  1CYI A;  3HQ6 A;  2V08 A;  1I8P A;  1BE3 D;  3WFE C;  1C52 A;  2B12 B;  2YQB A;  3H1L D;  4D6T D;  2O3J A;  1A56 A;  1AOF A;  2B11 B;  1F1C A;  4NFG B;  3OCD A;  1SQB D;  3RLM A;  1CRJ A;  2BH4 X;  3SJL A;  1WVE C;  3HQ9 A;  1N90 A;  4IL6 V;  1C6R A;  4DY9 A;  5DFS A;  3CYT I;  2C1D B;  4EIE A;  1QKS A;  1CXA A;  1COT A;  1DVV A;  3L4M A;  4KMG A;  2GIW A;  1LS9 A;  2N9J A;  4EDF A;  1L9J C;  5H2F V;  3WFB C;  2V07 A;  5CID B;  1L0L D;  1U75 B;  1W2L A;  5KLI B;  3JBT B;  1KV9 A;  4EIF A;  5CIG B;  3A9F A;  1COR A;  1GIW A;  1U74 B;  4J20 A;  3OA8 B;  3BCC D;  4XYD B;  1KX2 A;  1FI7 A;  2BH5 X;  3H1J D;  3MK7 C;  1PP9 D;  3PXW A;  3WC8 A;  1CSW A;  2L4D A;  2LIR A;  1BL9 A;  1IRV A;  1QL4 A;  4WQE A;  2JWA A;  3OCD B;  1CIF A;  1EZV D;  3PTZ A;  2I8F A;  3ZOO A;  2A06 D;  2ZON G;  1RZ6 A;  2YK3 A;  1IO3 A;  2RN0 A;  3CWB D;  3WFD C;  3CXH W;  1ETP A;  3KHU A;  4Q5P A;  1PPJ D;  3WUI A;  4UB8 V;  1KYO D;  4H0J A;  1YEB A;  3FWL A;  1DW1 A;  3C2C A;  4L3G A;  2B4Z A;  1W5C T;  1NTK D;  2FWL A;  4L1Q A;  1H31 B;  3ZIY A;  1CC5 A;  1LMS A;  2L91 A;  3PXT A;  3DMI A;  2N18 C;  1IRW A;  1YCC A;  3L70 D;  1I8O A;  1GDV A;  1KB0 A;  1I54 A;  3TGU D;  4WQB A;  3NBS A;  1NU1 D;  3TF5 A;  1QYZ A;  1BCC D;  1YNR A;  3GW6 A;  2EXV A;  3VRD A;  2QJY B;  2LIT A;  2DVH A;  4O1Q A;  4U3F D;  4FAV A;  2C2C A;  1CHJ A;  4RJT A;  1YEA A;  1MG3 D;  2CE0 A;  451C A;  1GJQ A;  1K3G A;  1CRI A;  1IQC A;  2Y0D A;  4GED B;  5KLV D;  1I6D A;  4FA1 A;  2OZ1 B;  1DVH A;  5CIF B;  2C1D A;  4V2K A;  2B10 B;  2AXT V;  1KB9 D;  4FA5 A;  3HQ7 A;  3PRJ A;  5GTH V;  3O5C A;  2C1V A;  1VYD A;  1CYC A;  1MZ4 A;  4LJI A;  2Y0E A;  1S5L V;  5C0Z A;  5DJQ B;  1CTZ A;  1ZRT D;  1RZ5 A;  4AAL A;  4EID A;  1HRO A;  2BCN B;  1E8E A;  4FAN A;  1FI9 A;  2N3B A;  1H33 A;  2B0Z B;  1B7V A;  1SQP D;  2VHD A;  4GYD A;  1GKS A;  155C A;  1QN2 A;  1MG2 D;  2PAC A;  3ORV A;  1ZZH A;  4WQA A;  1SQV D;  2Q3E A;  1H31 A;  5KAF V;  2DGE A;  1N9C A;  3L4O A;  1GU2 A;  1H33 B;  3SVW A;  4QAO A;  1CCH A;  3DR0 A;  1NTZ D;  2FRC A;  4H0K A;  5C9M A;  1N15 A;  2C8S A;  3L72 D;  1CED A;  1H32 A;  3MK7 B;  2YIU B;  3TYI A;  1CTJ A;  3PH2 B;  1HRC A;  1YIC A;  4AAO A;  1A8C A;  1FHB A;  1CHH A;  1BGY D;  2C9X B;  4WQC A;  1HJ4 A;  2JTI B;  1N50 A;  2BLF B;  3CU4 A;  3RMZ A;  3VNW A;  5CYT R;  2ZXY A;  1H9Y A;  4N0K A;  4YE1 A;  4L3H A;  1RAP A;  1KIB A;  1DW3 A;  1DW2 A;  1CSU A;  1CSV A;  2N18 B;  4FB1 A;  3WU2 V;  1CIG A;  1SQQ D;  1CIE A;  1E29 A;  1J3S A;  1RAQ A;  4JCG A;  1CRG A;  2D0W A;  1DIQ C;  2CE1 A;  5IY5 1;  1KYO W;  3ZOW A;  1CRH A;  1AYG A;  4WQD A;  1FJ0 A;  2N9Y B;  2JQR A;  1OAE A;  5B5E V;  5AUR A;  2BGV X;  2KNC B;  1CIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...