3L75J

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l75J00
3H1KJ 3CX5I 3L72J 3TGUJ 1NTKJ 3CXHI 1KYOI 1SQPJ 1P84I 3H1HJ 1BCCJ 1L0NJ 1L0LJ 3H1IJ 1BGYJ 2BCCJ 3L75J 3L74J 3L71J 3L73J 3H1LJ 1SQVJ 4U3FJ 3H1JJ 4D6TJ 1SQQJ 1NTZJ 1SQXJ 1BE3J 1EZVI 2IBZI 3CWBJ 1NTMJ 4PD4I 5KLVJ 1SQBJ 3BCCJ 1PP9J 2FYUJ 1NU1J 3L70J 1KB9I
chains in the Genus database with same CATH superfamily
1NTMD 1YBKA 4NPDA 1M1JC 2E76B 3GMAA 3IN6A 3Q2YA 3E1IA 3KZIE 2XNXA 4RO0A 2GUVA 4PD4E 3V4WA 1H0TB 3CXHD 4CPGA 2WPVB 1LTIC 5AVYB 1S4XA 4NPEA 2OTLP 2NPSA 1AQ5A 2J5UA 3FGAD 3P8CE 1VQOP 2FYNC 2AEMA 4WWIA 4UB8H 4UB8E 3CWBG 5APXA 3H1JJ 1VQ9P 2IYOA 1FZAA 1PGOA 2IDBA 2Y0EA 2Y0DA 2YO3A 5AVVB 1YI2P 1FZEA 1A02J 1ZOYC 2V7QJ 4R4LA 2OYIA 1X79B 1NTME 1X22A 2QM8A 2JP3A 4WY4A 1SQPK 1GL2C 1BCCE 1BCCG 1OW7A 2AXTH 2ITAA 3TGUD 1N73B 1OVRA 4D6TE 1KYOD 2KOGA 3B5NC 4ASVA 5BU8B 1N7SD 2E75C 2HODB 3AE7C 3H1KJ 3CX5I 2OYIC 3CWBE 1KYOI 4I1LA 4JPZB 3EFGA 3CCRP 2FFDA 3P7KA 1SQQG 2QIWA 4N3YB 1GW3A 4GKGA 3A7OA 4ZKUA 1NTKG 2H7HA 2KS1B 1N2DC 3BRTB 1L2PA 3RK2B 3M0DC 1LP1B 2Q5UA 2V4HA 3C9IA 1OFCX 3W67A 1KN7A 1GZLA 1WRGA 5KKZC 4K3AA 5L8RJ 1N8RQ 3O6QB 3TGUG 3V5BA 1YHQP 1GDTA 3V4QA 3RK3E 4YXWH 1FJKA 2DW3A 3M0DA 2WQYC 1BE3D 4RJTA 1JO5A 4WY4D 2PRRA 3IF4A 2FYUJ 4N78E 1LTJB 2ZFCA 3CI9A 1SQQD 4TLFA 3L70J 3O8ZA 1NKNA 1NU1K 2B88A 4KJMA 5H2FE 5CBOA 1RHZB 1LT9C 1RF0C 2QRXA 4EDFA 1VQ7P 1NO4A 3H1KE 2QEXP 2KNCB 2QE7H 3BVHA 4DT0A 1L4AA 3GF7A 1KFNA 2L91A 2RH0A 3VMAA 4BXLA 3G71P 3SSUA 4C46A 1DH3A 2WT7B 1EXIA 1YJNP 4JYBA 3L74G 1SFCA 2QG4A 2FKWB 4GODA 2JJLA 2Y9ZA 2KUBA 2SPZA 1NTZG 3F5HA 4JQ0D 2Q3EA 4C7RA 3CCQP 2QA4P 3RK2C 1JY3O 3WUUA 3NXSA 1T2KD 1K9MQ 3A5TA 2W8ZA 1SQXE 1MUUA 1SQVE 2FBWC 2HODA 2IX7C 1NTZK 1KB9H 2HYNA 1URQC 2WPSA 2XZRA 3H1HE 3H1IE 3M06A 4L73A 4MN4C 5KAFE 2Q7CA 2FYUG 4H0LC 5CCGD 1NJIQ 1BE3J 3HE4B 1ZW0A 4PD4I 3MGNA 1SQBJ 3BCCJ 3TF5A 1LNQA 3SWYA 3VP9A 1BGYE 2D2CD 2PAJA 2QJPC 5GTIH 5GTIE 1VQ5P 1N73C 3V2PA 2WSEJ 4Y28J 3USSA 1NTMG 1J2JB 2A06G 3HD7B 2E74D 1SVFA 4I6MC 5CHXA 1KQFB 5KJ7A 4IFMA 2KK7A 1J1DC 1RH5B 3RK3C 1FZFA 1GL2D 1U7JA 2KSJA 3RK3B 3KYQA 1VQ8P 2Y0CA 2J58A 1VL2A 2ZYAA 3C1LA 1HUCA 3PHLA 1YIJP 1FE6A 1PP9G 3OAKA 3T97A 2R32A 1NWQA 1T6AA 4PV1D 1L0LD 3H1KD 1SQVJ 3GG2A 3AECC 2E42A 4U7JA 3D6YA 2CK3H 4YTPC 1S5LH 1OVVA 2OYOA 4L76A 3M9QA 1K05A 1SQBE 3BCCE 3UIAA 3V2NA 1QLED 2YKOA 3TGUE 1LT1A 5KKZB 1KILD 1GMJA 1N7SA 2FYUK 3CC4P 2KIKA 2JR8A 2QJPB 2Z5HA 1CZQA 3L75E 4IOIH 4PJ0H 5DJTB 3VOPA 2KP8A 3CMEP 4OGQC 3K5BA 1NTKE 1VPCA 4HYTB 3H1JE 2QJYB 1CI6B 3H1ID 3H1LG 4M3LA 5AW7B 4WBAA 2RMZA 1UIXA 4PD4H 2N1TB 3KZIH 4H13C 3D70A 1JY2N 3MHVA 2GUSA 3L73E 4ZMDA 2BCCJ 1KQGB 1FAVA 3B5ND 2WMMA 4BRYA 3SWFA 3A0BH 1PL5A 2XNDH 2LKMA 3JSVC 3L74J 4K35A 5K5GB 1JNMA 2IZ0A 2PP6A 4I7ZB 4NPFX 1M56D 2P58A 3TNUA 3VN0A 1LTAC 5CMZA 3VMXA 2GM4A 3F89A 1HTLC 2K3RA 3L70G 4H13D 4YPCA 2QJYC 3JC22 1SQXD 2KSEA 2J59M 3CCUP 1KILA 1X9VA 2R3CA 3RGUA 5CBNA 1A02F 5AVXB 5AW0B 3RK2D 2Q3IA 4OGQD 3I56P 1EDJA 1S2EA 5KTBA 2YMKA 3L73D 3TYYA 2AXTE 2B87B 1FOSF 2HLOA 2WSEH 4H44C 1P84D 1YTZT 1SLQA 2ZVOB 1GK6A 1ZXGA 1ZR2A 2KZIA 3HRNA 1QX8A 1XTGB 3D71A 3FXDA 1BCCJ 2KZJA 4OH8B 3H32B 1LTJA 3H1IJ 3ITKA 4WY4B 1J1EC 1LT9A 1RF0A 2A45H 3HE5B 3VTPC 5TISH 1S3JA 3L36A 5APYA 2I1KA 2IBZE 3GHGB 3U1AA 5CCHC 1OMIA 4JF7A 1WMKA 3L70D 4D6TJ 2AEJA 1SQQJ 3Q1MA 1VQKP 3SFDC 2IFMA 3Q3DA 1JB0J 2ZXXA 3L72E 4HKZH 1YQ3C 3RL0B 1IFDA 2FFDC 1NTMJ 3SFEC 3AE3C 1EZVE 1ZN5A 2K9YA 4H13B 1YJ9P 3IAOA 4W7ZA 5CCHA 3MUDC 1FOSE 1PZQA 3PRJA 5BVZA 1KILE 3R2PA 1N86A 2MJZA 4UB6H 2OQQA 3CXHI 1YTZI 2KI7B 1PGQA 1PPJE 1RE4A 1HJBA 1HVVA 1IFNA 3CCVP 1R8EA 2XKMA 3HE4A 4IL6E 1URQB 1VQ4P 1M1JB 2E76C 1RQUA 2WSFJ 3MTUE 3S4RA 3NFQA 1FZCB 3B8EB 3EWKA 2M3BA 1T2KC 1K8AQ 1N73A 1T8ZA 2LXCB 1L0LE 2JWDA 2C0XA 3N4XA 1NH4A 1ZRTE 3P8MC 3P32A 2B87A 1VDFA 2KLUA 1P84H 1FDOA 3KQGA 4U3FE 1DD3A 3HD7D 4LC1A 1DD4A 3EQ2A 1SQBD 3BCCD 1GD2E 3BASA 2H8PD 4XE5B 2O3JA 1JY3P 1X8YA 4EYYQ 2OYHB 3AEDC 4ASWA 3A0HH 3FWNA 1JCDA 1USEA 1G1IA 1PPJD 3KHUA 1NU1E 3LIDA 2NPSB 3EFFK 1LT9B 1KZUB 3M9BA 1QEXA 1RE3C 5AW8B 3H1LD 2E74C 2WWWA 5KAIH 2ZYGA 3H1JD 1PFIA 1KB9D 4PV1B 4WB4A 3L71G 4JYCA 2D2CC 1NOHA 1SQPJ 3FXEA 3I5CA 3KXDA 2ZVNB 3G3ZA 5B66H 4H44B 2YKPA 2OARA 2YKQA 3B71A 3PLNA 1GU4A 1LWUA 2KLVA 1IK9A 2E5YA 2ZT9C 3L4FA 2XDJA 5APSA 1QGKB 1NAYA 1RQVA 1KYOE 1SQVK 3L73J 2ZJSE 1IJDB 3N7NA 1E79H 1QVGO 1KILC 1OW6A 2FYUD 1PP9D 1AJYA 1VQLP 3G9RA 3VYIA 2LR2A 2PFXA 3OJAB 1H0TA 1DX7A 2IBZD 5KJ7D 5KLIB 1YJWP 4HH2A 5KLVJ 1LTGC 1H8AA 1FDIA 1LWUB 1URQA 5GTHH 4ZNCA 1M90Q 1NTZD 1GTWA 1KB9I 3L74D 4DOJA 4DCKA 3CMAP 1H88A 4U3FD 2NPSC 1HBWA 4L75A 3AEEC 1GK4A 5APTA 1AFOA 3CCJP 2M8RA 1KD1Q 2BEZF 2WSCJ 2LXBA 1SFCD 1BE3E 2Q1KA 3QH9A 1S9KE 1CW5A 2H89C 2WZ7A 1G1JA 3IR9A 1JTHA 1L4AD 1LP1A 1L0NE 1HWTC 2WSFH 1DIPA 3V2RA 2WITA 1T3UA 2H43A 1VQNP 1EDLA 3M9HA 4H0LB 5CJ0A 2E76D 2YO2A 2H88C 2Q6QA 5M1BA 3BRVB 3HTKB 2B9BA 4IFFA 1QL1A 1IZNB 1IO4A 1EZVD 1K04A 1VQ6P 1FC2C 1ZR4A 1R5LA 1RF1A 1LGHB 2BCCG 3WUTA 3S9OA 3ZDMA 1Y8AA 1FZCA 3CC7P 5KLVE 3L35A 4BRYB 1AVYA 4GT1A 2KXPB 2GA1A 3LIEA 1UIIA 2HFED 5GTHE 2E75B 2XU6A 3Q5SA 3CD6P 1NAFA 5E79H 4IL6H 2N1TA 4AYCA 4L74A 2MKVA 3AE2C 3Q5PA 3H1HJ 2RN0A 3R4YA 3WU2H 2WT7A 1EQ7A 3RL0D 3ABVC 1W2BO 1HF9A 1SQPG 1BE3G 2N1TD 1SS1A 3AEBC 4YXDC 3CC2P 2OYHC 1W5CE 3L75J 2BCCD 2E5TA 2P67A 3A3YB 5AW2B 2C0WA 5BU5A 1KYOH 1LWUC 1NKZB 4GIFA 2O1KA 2N1TC 2YNYA 2IPPA 2OTKE 3TK1A 4HB1A 3VMZA 5KLIC 2R5BA 4A7PA 3GHGA 3KDPB 3CXHE 1SQPD 5B66E 2A45G 2PGDA 2W6JH 3CWBD 2Z5IA 5APUA 1U57A 3JCUH 1RY3A 2K88A 1NTKD 2JWAA 4BWNA 1G2CB 1JMMA 1JY3N 1IFJA 1M7LA 1NU1J 2RKLA 3T97B 5B5EE 2KYVA 5KAIE 5TISE 2G3AA 4IFDK 1SQQK 3WMM0 4B86A 3A0HE 1BDDA 2R5DA 1P84I 1BCCD 1ZLLA 2XV5A 1Z56A 1EZVG 1K73Q 1RE3A 2FFDB 1E5WA 1FS0E 4W7YA 4WVZA 1EDIA 2O01J 5AW9B 2NPSD 2D2CB 2M5AA 2NZ2A 4EIJA 3L75D 3G4SP 2YXQB 1N7LA 3H1LJ 3NTNA 3L71E 2L5GB 2W6AA 2IBZG 4HJGH 3V6IA 2N9YB 3TNUB 2E74B 1PIXA 2I8DA 1SFCC 3AE1C 3HUSA 1ZMEC 3CXHH 1LJ2A 3OW2O 1IFIA 1EZVI 2HPCA 3AE8C 3L72D 4I2LC 1YITP 3MZWB 4H44D 5CCHD 1KMIZ 2BCCE 4TT3H 3CPWO 2M5AB 3RL0g 1FZGA 1FDMA 2O01N 5AW1B 1FZCC 2C9NY 1TU3F 3L72J 3BATA 4U3FG 3WU2E 2WTYA 1CI6A 1GW4A 2QJKB 5AW5B 5E79E 4XFJA 1S9KD 4C7NB 3H1HD 5AVQB 5CCGC 1L0NJ 2A45I 1NGMB 1L0LK 1RE4C 3U1CA 3L70E 4AQRD 2YXRB 3V2QA 1PPJG 2ZT9D 3II6A 3IFMA 4PJ0E 1GL2A 4N6JA 3RL0C 3B5NB 2QSIA 1USDA 1RF1C 1GL2B 3AE5C 1DEEG 4QMAA 3CCSP 2JDIH 2JEEA 1JCCA 3RK3D 2IBZI 3CCMP 1VQMP 2YIUC 2WPRA 3MUDA 1SFCB 1NTMK 4Y99B 2E43A 4D6TD 3LW5J 1S5LE 3HD7C 1KC8Q 1SQPE 3CLQA 1NU1D 2QVAA 5B5EH 3L71D 1S5LX 2CPSA 4GOFA 1ZV8A 3H1LE 1SQVD 1W2EA 1H89A 2KNCA 1MKMA 2Q9IA 1JM0A 3H1JG 3JCUE 1MZ9A 1OX3A 1Q82Q 3GLMA 1HGVA 2ZAEB 1R5SA 3PP5A 4WY4C 1KILB 5EFWB 5AVSB 2K9JB 3NMDA 1BSNA 1ZRTD 1AQTA 3B4SA 3S1KA 5AVZB 5KLVG 1Q7YQ 2Z4EA 2C9LY 2CPBA 1JY2P 2VRSA 2ZYDA 2YMYA 1SQBG 3AEAC 3AEFC 3BCCG 3M91A 3G6EP 3H25A 4EOTA 1S72P 2OTJP 1KV4A 3A0BE 3AE6C 1VF5C 5APVA 1MFTA 4IL6X 1HJ0A 1FZBA 3CL3D 2P1JA 1MV8A 5AVTB 1GU5A 1NTZJ 4GOEA 4LGDE 2IFNA 2OYIB 4C7NA 3Q5RA 3HTKA 3D6ZA 3MP7B 1OXZA 3WUVA 1L0NG 2QM7A 2BEQD 2OYHA 1PP9J 2R3SA 3OA7A 1HH0A 2BASA 3M0AA 5AVRB 1QVFO 1L4AC 5DJUB 5AW4B 1JTHB 1J1DB 1LTJC 1JY2O 3TGUJ 1BGYD 1Y47A 3E7KA 3GF3A 3I55P 2YIUB 4Y99C 1AA0A 3CCEP 2WVRA 1OW8A 1BGYG 2HG5D 3L73G 4XA4A 1RF1B 2WSCH 1L0LJ 4O9BA 1G2CA 1L0NK 4OGQB 1LTSC 4OWFA 3KPEA 3VP8A 1Y9BA 3HUSC 1VF5D 1KQSO 5AVWB 1MFZA 3L71J 1Q81Q 3C8VA 1L0ND 2IYPA 2N9BA 4R4MA 5H2FH 1SQXG 2I1JA 1X0TA 1EC5A 4W80A 1OZHA 1IC2A 1FBMA 1SQXK 2FXPA 2POHA 1BDCA 1NTZE 5AVUB 2W90A 1AVOA 4H0LD 1DEBA 4ZKPA 3CWBJ 5CJ4A 4RESB 2QJKC 3L74E 1M1KQ 3PTZA 1U7MA 5KLVK 4OVNF 1FJPA 3AEGC 2AEFA 3AE9C 4DJGA 1LTTC 1N7SC 2E75D 2NRGA 2WPQA 3L37A 3LW5H 4KHXA 3HD7A 5AW3B 5AW6B 5KLVD 3U59A 3VMYA 2P7JA 1JMBA 1FU1A 1PGJA 1YQ4C 2OGUA 3AE4C 3H6PA 4LLHA 5CCGA 1PP9E 3B5NA 1KORA 3P8CD 3GHGC 3FWLA 3H32A 4AUWA 1S1CX 3W68A 2HPCB 5KAFH 3CX5D 1KB9E 1KFMA 1T3JA 2O1JA 1NU1G 3TSIA 1NHLA 3RBZA 2FXMA 3GW6A 3O6QA 2AXCA 2P10A 5APWA 1QL2A 2B89A 2FXOA 2G8YA 2V7QH 3E1RA 4RKUJ 2A06E 3RBXA 3QWOC 1IK7A 5C39A 1Q86Q 2KS1A 1URQD 2FY8A 1VQPP 1SQBK 2UWJE 1L0LG 4DZOA 2FYZA 1M8OB 1PGPA 2JO1A 5APQA 2K37A 1XTCC 2FYUE 4N78D 1M57D 2R44A 2IZ1A 3H1IG 1SQQE 1EXJA 1BSHA 3CCLP 1JUNA 3H1HG 1SQVG 2ZT9B 1OIPA 1NTKJ 4Z1MH 3HUSB 1D7MA 1HGZA 1NTKK 2HR3A 2W27A 2W83C 3MD0A 2W6BA 3PJSK 2WSSH 4I7ZC 4JBZA 1PV3A 4KT0J 4D6TG 1NVOA 1YYCA 2A06D 3PH0A 1SP4A 2K9JA 1P84E 1NYHA 2P2UA 1BGYJ 1Q2NA 1ZP0C 4GDOA 4PV1C 3FX0A 3TDKA 2ZXEB 1OWAA 1IFPA 2O01H 2JKVA 3H1KG 1JOCA 3A2AA 1AV1A 3L72G 3MIWA 4PD4D 4U3FJ 1L4AB 4EI2A 1LTBC 2KB7P 1IFMA 5TJHA 5KJ7C 1SQXJ 1EDKA 1JEKA 3CX5H 3CX5E 2FYNB 1J1EB 1N7SB 1CSBA 3L75G 1KTMA 1M1JA 4UB6E 1KQLA 2K1AA 1VF5B 2M0BA 2Y9YA 1Q90D 1WT6A 3HE5A 2M3EA 1OVUA 3SWKA
chains in the Genus database with same CATH topology
3H1KJ 3CX5I 3L72J 3TGUJ 1NTKJ 3CXHI 1KYOI 1SQPJ 1P84I 3H1HJ 1BCCJ 1L0NJ 1L0LJ 3H1IJ 1BGYJ 2BCCJ 3L75J 3L74J 3L71J 3L73J 3H1LJ 1SQVJ 4U3FJ 3H1JJ 4D6TJ 1SQQJ 1NTZJ 1SQXJ 1BE3J 1EZVI 2IBZI 3CWBJ 1NTMJ 4PD4I 5KLVJ 1SQBJ 3BCCJ 1PP9J 2FYUJ 1NU1J 3L70J 1KB9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K J;  3CX5 I;  3L72 J;  3TGU J;  1NTK J;  3CXH I;  1KYO I;  1SQP J;  1P84 I;  3H1H J;  1BCC J;  1L0N J;  1L0L J;  3H1I J;  1BGY J;  2BCC J;  3L75 J;  3L74 J;  3L71 J;  3L73 J;  3H1L J;  1SQV J;  4U3F J;  3H1J J;  4D6T J;  1SQQ J;  1NTZ J;  1SQX J;  1BE3 J;  1EZV I;  2IBZ I;  3CWB J;  1NTM J;  4PD4 I;  5KLV J;  1SQB J;  3BCC J;  1PP9 J;  2FYU J;  1NU1 J;  3L70 J;  1KB9 I; 
#chains in the Genus database with same CATH topology
 1NTM D;  1YBK A;  4NPD A;  1M1J C;  2E76 B;  3GMA A;  3IN6 A;  3Q2Y A;  3E1I A;  3KZI E;  2XNX A;  4RO0 A;  2GUV A;  4PD4 E;  3V4W A;  1H0T B;  3CXH D;  4CPG A;  2WPV B;  1LTI C;  5AVY B;  1S4X A;  4NPE A;  2OTL P;  2NPS A;  1AQ5 A;  2J5U A;  3FGA D;  3P8C E;  1VQO P;  2FYN C;  2AEM A;  4WWI A;  4UB8 H;  4UB8 E;  3CWB G;  5APX A;  3H1J J;  1VQ9 P;  2IYO A;  1FZA A;  1PGO A;  2IDB A;  2Y0E A;  2Y0D A;  2YO3 A;  5AVV B;  1YI2 P;  1FZE A;  1A02 J;  1ZOY C;  2V7Q J;  4R4L A;  2OYI A;  1X79 B;  1NTM E;  1X22 A;  2QM8 A;  2JP3 A;  4WY4 A;  1SQP K;  1GL2 C;  1BCC E;  1BCC G;  1OW7 A;  2AXT H;  2ITA A;  3TGU D;  1N73 B;  1OVR A;  4D6T E;  1KYO D;  2KOG A;  3B5N C;  4ASV A;  5BU8 B;  1N7S D;  2E75 C;  2HOD B;  3AE7 C;  3H1K J;  3CX5 I;  2OYI C;  3CWB E;  1KYO I;  4I1L A;  4JPZ B;  3EFG A;  3CCR P;  2FFD A;  3P7K A;  1SQQ G;  2QIW A;  4N3Y B;  1GW3 A;  4GKG A;  3A7O A;  4ZKU A;  1NTK G;  2H7H A;  2KS1 B;  1N2D C;  3BRT B;  1L2P A;  3RK2 B;  3M0D C;  1LP1 B;  2Q5U A;  2V4H A;  3C9I A;  1OFC X;  3W67 A;  1KN7 A;  1GZL A;  1WRG A;  5KKZ C;  4K3A A;  5L8R J;  1N8R Q;  3O6Q B;  3TGU G;  3V5B A;  1YHQ P;  1GDT A;  3V4Q A;  3RK3 E;  4YXW H;  1FJK A;  2DW3 A;  3M0D A;  2WQY C;  1BE3 D;  4RJT A;  1JO5 A;  4WY4 D;  2PRR A;  3IF4 A;  2FYU J;  4N78 E;  1LTJ B;  2ZFC A;  3CI9 A;  1SQQ D;  4TLF A;  3L70 J;  3O8Z A;  1NKN A;  1NU1 K;  2B88 A;  4KJM A;  5H2F E;  5CBO A;  1RHZ B;  1LT9 C;  1RF0 C;  2QRX A;  4EDF A;  1VQ7 P;  1NO4 A;  3H1K E;  2QEX P;  2KNC B;  2QE7 H;  3BVH A;  4DT0 A;  1L4A A;  3GF7 A;  1KFN A;  2L91 A;  2RH0 A;  3VMA A;  4BXL A;  3G71 P;  3SSU A;  4C46 A;  1DH3 A;  2WT7 B;  1EXI A;  1YJN P;  4JYB A;  3L74 G;  1SFC A;  2QG4 A;  2FKW B;  4GOD A;  2JJL A;  2Y9Z A;  2KUB A;  2SPZ A;  1NTZ G;  3F5H A;  4JQ0 D;  2Q3E A;  4C7R A;  3CCQ P;  2QA4 P;  3RK2 C;  1JY3 O;  3WUU A;  3NXS A;  1T2K D;  1K9M Q;  3A5T A;  2W8Z A;  1SQX E;  1MUU A;  1SQV E;  2FBW C;  2HOD A;  2IX7 C;  1NTZ K;  1KB9 H;  2HYN A;  1URQ C;  2WPS A;  2XZR A;  3H1H E;  3H1I E;  3M06 A;  4L73 A;  4MN4 C;  5KAF E;  2Q7C A;  2FYU G;  4H0L C;  5CCG D;  1NJI Q;  1BE3 J;  3HE4 B;  1ZW0 A;  4PD4 I;  3MGN A;  1SQB J;  3BCC J;  3TF5 A;  1LNQ A;  3SWY A;  3VP9 A;  1BGY E;  2D2C D;  2PAJ A;  2QJP C;  5GTI H;  5GTI E;  1VQ5 P;  1N73 C;  3V2P A;  2WSE J;  4Y28 J;  3USS A;  1NTM G;  1J2J B;  2A06 G;  3HD7 B;  2E74 D;  1SVF A;  4I6M C;  5CHX A;  1KQF B;  5KJ7 A;  4IFM A;  2KK7 A;  1J1D C;  1RH5 B;  3RK3 C;  1FZF A;  1GL2 D;  1U7J A;  2KSJ A;  3RK3 B;  3KYQ A;  1VQ8 P;  2Y0C A;  2J58 A;  1VL2 A;  2ZYA A;  3C1L A;  1HUC A;  3PHL A;  1YIJ P;  1FE6 A;  1PP9 G;  3OAK A;  3T97 A;  2R32 A;  1NWQ A;  1T6A A;  4PV1 D;  1L0L D;  3H1K D;  1SQV J;  3GG2 A;  3AEC C;  2E42 A;  4U7J A;  3D6Y A;  2CK3 H;  4YTP C;  1S5L H;  1OVV A;  2OYO A;  4L76 A;  3M9Q A;  1K05 A;  1SQB E;  3BCC E;  3UIA A;  3V2N A;  1QLE D;  2YKO A;  3TGU E;  1LT1 A;  5KKZ B;  1KIL D;  1GMJ A;  1N7S A;  2FYU K;  3CC4 P;  2KIK A;  2JR8 A;  2QJP B;  2Z5H A;  1CZQ A;  3L75 E;  4IOI H;  4PJ0 H;  5DJT B;  3VOP A;  2KP8 A;  3CME P;  4OGQ C;  3K5B A;  1NTK E;  1VPC A;  4HYT B;  3H1J E;  2QJY B;  1CI6 B;  3H1I D;  3H1L G;  4M3L A;  5AW7 B;  4WBA A;  2RMZ A;  1UIX A;  4PD4 H;  2N1T B;  3KZI H;  4H13 C;  3D70 A;  1JY2 N;  3MHV A;  2GUS A;  3L73 E;  4ZMD A;  2BCC J;  1KQG B;  1FAV A;  3B5N D;  2WMM A;  4BRY A;  3SWF A;  3A0B H;  1PL5 A;  2XND H;  2LKM A;  3JSV C;  3L74 J;  4K35 A;  5K5G B;  1JNM A;  2IZ0 A;  2PP6 A;  4I7Z B;  4NPF X;  1M56 D;  2P58 A;  3TNU A;  3VN0 A;  1LTA C;  5CMZ A;  3VMX A;  2GM4 A;  3F89 A;  1HTL C;  2K3R A;  3L70 G;  4H13 D;  4YPC A;  2QJY C;  3JC2 2;  1SQX D;  2KSE A;  2J59 M;  3CCU P;  1KIL A;  1X9V A;  2R3C A;  3RGU A;  5CBN A;  1A02 F;  5AVX B;  5AW0 B;  3RK2 D;  2Q3I A;  4OGQ D;  3I56 P;  1EDJ A;  1S2E A;  5KTB A;  2YMK A;  3L73 D;  3TYY A;  2AXT E;  2B87 B;  1FOS F;  2HLO A;  2WSE H;  4H44 C;  1P84 D;  1YTZ T;  1SLQ A;  2ZVO B;  1GK6 A;  1ZXG A;  1ZR2 A;  2KZI A;  3HRN A;  1QX8 A;  1XTG B;  3D71 A;  3FXD A;  1BCC J;  2KZJ A;  4OH8 B;  3H32 B;  1LTJ A;  3H1I J;  3ITK A;  4WY4 B;  1J1E C;  1LT9 A;  1RF0 A;  2A45 H;  3HE5 B;  3VTP C;  5TIS H;  1S3J A;  3L36 A;  5APY A;  2I1K A;  2IBZ E;  3GHG B;  3U1A A;  5CCH C;  1OMI A;  4JF7 A;  1WMK A;  3L70 D;  4D6T J;  2AEJ A;  1SQQ J;  3Q1M A;  1VQK P;  3SFD C;  2IFM A;  3Q3D A;  1JB0 J;  2ZXX A;  3L72 E;  4HKZ H;  1YQ3 C;  3RL0 B;  1IFD A;  2FFD C;  1NTM J;  3SFE C;  3AE3 C;  1EZV E;  1ZN5 A;  2K9Y A;  4H13 B;  1YJ9 P;  3IAO A;  4W7Z A;  5CCH A;  3MUD C;  1FOS E;  1PZQ A;  3PRJ A;  5BVZ A;  1KIL E;  3R2P A;  1N86 A;  2MJZ A;  4UB6 H;  2OQQ A;  3CXH I;  1YTZ I;  2KI7 B;  1PGQ A;  1PPJ E;  1RE4 A;  1HJB A;  1HVV A;  1IFN A;  3CCV P;  1R8E A;  2XKM A;  3HE4 A;  4IL6 E;  1URQ B;  1VQ4 P;  1M1J B;  2E76 C;  1RQU A;  2WSF J;  3MTU E;  3S4R A;  3NFQ A;  1FZC B;  3B8E B;  3EWK A;  2M3B A;  1T2K C;  1K8A Q;  1N73 A;  1T8Z A;  2LXC B;  1L0L E;  2JWD A;  2C0X A;  3N4X A;  1NH4 A;  1ZRT E;  3P8M C;  3P32 A;  2B87 A;  1VDF A;  2KLU A;  1P84 H;  1FDO A;  3KQG A;  4U3F E;  1DD3 A;  3HD7 D;  4LC1 A;  1DD4 A;  3EQ2 A;  1SQB D;  3BCC D;  1GD2 E;  3BAS A;  2H8P D;  4XE5 B;  2O3J A;  1JY3 P;  1X8Y A;  4EYY Q;  2OYH B;  3AED C;  4ASW A;  3A0H H;  3FWN A;  1JCD A;  1USE A;  1G1I A;  1PPJ D;  3KHU A;  1NU1 E;  3LID A;  2NPS B;  3EFF K;  1LT9 B;  1KZU B;  3M9B A;  1QEX A;  1RE3 C;  5AW8 B;  3H1L D;  2E74 C;  2WWW A;  5KAI H;  2ZYG A;  3H1J D;  1PFI A;  1KB9 D;  4PV1 B;  4WB4 A;  3L71 G;  4JYC A;  2D2C C;  1NOH A;  1SQP J;  3FXE A;  3I5C A;  3KXD A;  2ZVN B;  3G3Z A;  5B66 H;  4H44 B;  2YKP A;  2OAR A;  2YKQ A;  3B71 A;  3PLN A;  1GU4 A;  1LWU A;  2KLV A;  1IK9 A;  2E5Y A;  2ZT9 C;  3L4F A;  2XDJ A;  5APS A;  1QGK B;  1NAY A;  1RQV A;  1KYO E;  1SQV K;  3L73 J;  2ZJS E;  1IJD B;  3N7N A;  1E79 H;  1QVG O;  1KIL C;  1OW6 A;  2FYU D;  1PP9 D;  1AJY A;  1VQL P;  3G9R A;  3VYI A;  2LR2 A;  2PFX A;  3OJA B;  1H0T A;  1DX7 A;  2IBZ D;  5KJ7 D;  5KLI B;  1YJW P;  4HH2 A;  5KLV J;  1LTG C;  1H8A A;  1FDI A;  1LWU B;  1URQ A;  5GTH H;  4ZNC A;  1M90 Q;  1NTZ D;  1GTW A;  1KB9 I;  3L74 D;  4DOJ A;  4DCK A;  3CMA P;  1H88 A;  4U3F D;  2NPS C;  1HBW A;  4L75 A;  3AEE C;  1GK4 A;  5APT A;  1AFO A;  3CCJ P;  2M8R A;  1KD1 Q;  2BEZ F;  2WSC J;  2LXB A;  1SFC D;  1BE3 E;  2Q1K A;  3QH9 A;  1S9K E;  1CW5 A;  2H89 C;  2WZ7 A;  1G1J A;  3IR9 A;  1JTH A;  1L4A D;  1LP1 A;  1L0N E;  1HWT C;  2WSF H;  1DIP A;  3V2R A;  2WIT A;  1T3U A;  2H43 A;  1VQN P;  1EDL A;  3M9H A;  4H0L B;  5CJ0 A;  2E76 D;  2YO2 A;  2H88 C;  2Q6Q A;  5M1B A;  3BRV B;  3HTK B;  2B9B A;  4IFF A;  1QL1 A;  1IZN B;  1IO4 A;  1EZV D;  1K04 A;  1VQ6 P;  1FC2 C;  1ZR4 A;  1R5L A;  1RF1 A;  1LGH B;  2BCC G;  3WUT A;  3S9O A;  3ZDM A;  1Y8A A;  1FZC A;  3CC7 P;  5KLV E;  3L35 A;  4BRY B;  1AVY A;  4GT1 A;  2KXP B;  2GA1 A;  3LIE A;  1UII A;  2HFE D;  5GTH E;  2E75 B;  2XU6 A;  3Q5S A;  3CD6 P;  1NAF A;  5E79 H;  4IL6 H;  2N1T A;  4AYC A;  4L74 A;  2MKV A;  3AE2 C;  3Q5P A;  3H1H J;  2RN0 A;  3R4Y A;  3WU2 H;  2WT7 A;  1EQ7 A;  3RL0 D;  3ABV C;  1W2B O;  1HF9 A;  1SQP G;  1BE3 G;  2N1T D;  1SS1 A;  3AEB C;  4YXD C;  3CC2 P;  2OYH C;  1W5C E;  3L75 J;  2BCC D;  2E5T A;  2P67 A;  3A3Y B;  5AW2 B;  2C0W A;  5BU5 A;  1KYO H;  1LWU C;  1NKZ B;  4GIF A;  2O1K A;  2N1T C;  2YNY A;  2IPP A;  2OTK E;  3TK1 A;  4HB1 A;  3VMZ A;  5KLI C;  2R5B A;  4A7P A;  3GHG A;  3KDP B;  3CXH E;  1SQP D;  5B66 E;  2A45 G;  2PGD A;  2W6J H;  3CWB D;  2Z5I A;  5APU A;  1U57 A;  3JCU H;  1RY3 A;  2K88 A;  1NTK D;  2JWA A;  4BWN A;  1G2C B;  1JMM A;  1JY3 N;  1IFJ A;  1M7L A;  1NU1 J;  2RKL A;  3T97 B;  5B5E E;  2KYV A;  5KAI E;  5TIS E;  2G3A A;  4IFD K;  1SQQ K;  3WMM 0;  4B86 A;  3A0H E;  1BDD A;  2R5D A;  1P84 I;  1BCC D;  1ZLL A;  2XV5 A;  1Z56 A;  1EZV G;  1K73 Q;  1RE3 A;  2FFD B;  1E5W A;  1FS0 E;  4W7Y A;  4WVZ A;  1EDI A;  2O01 J;  5AW9 B;  2NPS D;  2D2C B;  2M5A A;  2NZ2 A;  4EIJ A;  3L75 D;  3G4S P;  2YXQ B;  1N7L A;  3H1L J;  3NTN A;  3L71 E;  2L5G B;  2W6A A;  2IBZ G;  4HJG H;  3V6I A;  2N9Y B;  3TNU B;  2E74 B;  1PIX A;  2I8D A;  1SFC C;  3AE1 C;  3HUS A;  1ZME C;  3CXH H;  1LJ2 A;  3OW2 O;  1IFI A;  1EZV I;  2HPC A;  3AE8 C;  3L72 D;  4I2L C;  1YIT P;  3MZW B;  4H44 D;  5CCH D;  1KMI Z;  2BCC E;  4TT3 H;  3CPW O;  2M5A B;  3RL0 g;  1FZG A;  1FDM A;  2O01 N;  5AW1 B;  1FZC C;  2C9N Y;  1TU3 F;  3L72 J;  3BAT A;  4U3F G;  3WU2 E;  2WTY A;  1CI6 A;  1GW4 A;  2QJK B;  5AW5 B;  5E79 E;  4XFJ A;  1S9K D;  4C7N B;  3H1H D;  5AVQ B;  5CCG C;  1L0N J;  2A45 I;  1NGM B;  1L0L K;  1RE4 C;  3U1C A;  3L70 E;  4AQR D;  2YXR B;  3V2Q A;  1PPJ G;  2ZT9 D;  3II6 A;  3IFM A;  4PJ0 E;  1GL2 A;  4N6J A;  3RL0 C;  3B5N B;  2QSI A;  1USD A;  1RF1 C;  1GL2 B;  3AE5 C;  1DEE G;  4QMA A;  3CCS P;  2JDI H;  2JEE A;  1JCC A;  3RK3 D;  2IBZ I;  3CCM P;  1VQM P;  2YIU C;  2WPR A;  3MUD A;  1SFC B;  1NTM K;  4Y99 B;  2E43 A;  4D6T D;  3LW5 J;  1S5L E;  3HD7 C;  1KC8 Q;  1SQP E;  3CLQ A;  1NU1 D;  2QVA A;  5B5E H;  3L71 D;  1S5L X;  2CPS A;  4GOF A;  1ZV8 A;  3H1L E;  1SQV D;  1W2E A;  1H89 A;  2KNC A;  1MKM A;  2Q9I A;  1JM0 A;  3H1J G;  3JCU E;  1MZ9 A;  1OX3 A;  1Q82 Q;  3GLM A;  1HGV A;  2ZAE B;  1R5S A;  3PP5 A;  4WY4 C;  1KIL B;  5EFW B;  5AVS B;  2K9J B;  3NMD A;  1BSN A;  1ZRT D;  1AQT A;  3B4S A;  3S1K A;  5AVZ B;  5KLV G;  1Q7Y Q;  2Z4E A;  2C9L Y;  2CPB A;  1JY2 P;  2VRS A;  2ZYD A;  2YMY A;  1SQB G;  3AEA C;  3AEF C;  3BCC G;  3M91 A;  3G6E P;  3H25 A;  4EOT A;  1S72 P;  2OTJ P;  1KV4 A;  3A0B E;  3AE6 C;  1VF5 C;  5APV A;  1MFT A;  4IL6 X;  1HJ0 A;  1FZB A;  3CL3 D;  2P1J A;  1MV8 A;  5AVT B;  1GU5 A;  1NTZ J;  4GOE A;  4LGD E;  2IFN A;  2OYI B;  4C7N A;  3Q5R A;  3HTK A;  3D6Z A;  3MP7 B;  1OXZ A;  3WUV A;  1L0N G;  2QM7 A;  2BEQ D;  2OYH A;  1PP9 J;  2R3S A;  3OA7 A;  1HH0 A;  2BAS A;  3M0A A;  5AVR B;  1QVF O;  1L4A C;  5DJU B;  5AW4 B;  1JTH B;  1J1D B;  1LTJ C;  1JY2 O;  3TGU J;  1BGY D;  1Y47 A;  3E7K A;  3GF3 A;  3I55 P;  2YIU B;  4Y99 C;  1AA0 A;  3CCE P;  2WVR A;  1OW8 A;  1BGY G;  2HG5 D;  3L73 G;  4XA4 A;  1RF1 B;  2WSC H;  1L0L J;  4O9B A;  1G2C A;  1L0N K;  4OGQ B;  1LTS C;  4OWF A;  3KPE A;  3VP8 A;  1Y9B A;  3HUS C;  1VF5 D;  1KQS O;  5AVW B;  1MFZ A;  3L71 J;  1Q81 Q;  3C8V A;  1L0N D;  2IYP A;  2N9B A;  4R4M A;  5H2F H;  1SQX G;  2I1J A;  1X0T A;  1EC5 A;  4W80 A;  1OZH A;  1IC2 A;  1FBM A;  1SQX K;  2FXP A;  2POH A;  1BDC A;  1NTZ E;  5AVU B;  2W90 A;  1AVO A;  4H0L D;  1DEB A;  4ZKP A;  3CWB J;  5CJ4 A;  4RES B;  2QJK C;  3L74 E;  1M1K Q;  3PTZ A;  1U7M A;  5KLV K;  4OVN F;  1FJP A;  3AEG C;  2AEF A;  3AE9 C;  4DJG A;  1LTT C;  1N7S C;  2E75 D;  2NRG A;  2WPQ A;  3L37 A;  3LW5 H;  4KHX A;  3HD7 A;  5AW3 B;  5AW6 B;  5KLV D;  3U59 A;  3VMY A;  2P7J A;  1JMB A;  1FU1 A;  1PGJ A;  1YQ4 C;  2OGU A;  3AE4 C;  3H6P A;  4LLH A;  5CCG A;  1PP9 E;  3B5N A;  1KOR A;  3P8C D;  3GHG C;  3FWL A;  3H32 A;  4AUW A;  1S1C X;  3W68 A;  2HPC B;  5KAF H;  3CX5 D;  1KB9 E;  1KFM A;  1T3J A;  2O1J A;  1NU1 G;  3TSI A;  1NHL A;  3RBZ A;  2FXM A;  3GW6 A;  3O6Q A;  2AXC A;  2P10 A;  5APW A;  1QL2 A;  2B89 A;  2FXO A;  2G8Y A;  2V7Q H;  3E1R A;  4RKU J;  2A06 E;  3RBX A;  3QWO C;  1IK7 A;  5C39 A;  1Q86 Q;  2KS1 A;  1URQ D;  2FY8 A;  1VQP P;  1SQB K;  2UWJ E;  1L0L G;  4DZO A;  2FYZ A;  1M8O B;  1PGP A;  2JO1 A;  5APQ A;  2K37 A;  1XTC C;  2FYU E;  4N78 D;  1M57 D;  2R44 A;  2IZ1 A;  3H1I G;  1SQQ E;  1EXJ A;  1BSH A;  3CCL P;  1JUN A;  3H1H G;  1SQV G;  2ZT9 B;  1OIP A;  1NTK J;  4Z1M H;  3HUS B;  1D7M A;  1HGZ A;  1NTK K;  2HR3 A;  2W27 A;  2W83 C;  3MD0 A;  2W6B A;  3PJS K;  2WSS H;  4I7Z C;  4JBZ A;  1PV3 A;  4KT0 J;  4D6T G;  1NVO A;  1YYC A;  2A06 D;  3PH0 A;  1SP4 A;  2K9J A;  1P84 E;  1NYH A;  2P2U A;  1BGY J;  1Q2N A;  1ZP0 C;  4GDO A;  4PV1 C;  3FX0 A;  3TDK A;  2ZXE B;  1OWA A;  1IFP A;  2O01 H;  2JKV A;  3H1K G;  1JOC A;  3A2A A;  1AV1 A;  3L72 G;  3MIW A;  4PD4 D;  4U3F J;  1L4A B;  4EI2 A;  1LTB C;  2KB7 P;  1IFM A;  5TJH A;  5KJ7 C;  1SQX J;  1EDK A;  1JEK A;  3CX5 H;  3CX5 E;  2FYN B;  1J1E B;  1N7S B;  1CSB A;  3L75 G;  1KTM A;  1M1J A;  4UB6 E;  1KQL A;  2K1A A;  1VF5 B;  2M0B A;  2Y9Y A;  1Q90 D;  1WT6 A;  3HE5 A;  2M3E A;  1OVU A;  3SWK A; 
#chains in the Genus database with same CATH homology
 3H1K J;  3CX5 I;  3L72 J;  3TGU J;  1NTK J;  3CXH I;  1KYO I;  1SQP J;  1P84 I;  3H1H J;  1BCC J;  1L0N J;  1L0L J;  3H1I J;  1BGY J;  2BCC J;  3L75 J;  3L74 J;  3L71 J;  3L73 J;  3H1L J;  1SQV J;  4U3F J;  3H1J J;  4D6T J;  1SQQ J;  1NTZ J;  1SQX J;  1BE3 J;  1EZV I;  2IBZ I;  3CWB J;  1NTM J;  4PD4 I;  5KLV J;  1SQB J;  3BCC J;  1PP9 J;  2FYU J;  1NU1 J;  3L70 J;  1KB9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...