3L75J

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l75J00
1SQVJ 2IBZI 1SQPJ 1SQQJ 3H1LJ 3L73J 3L71J 1L0LJ 5KLVJ 1L0NJ 1NTKJ 1NTZJ 2BCCJ 1SQXJ 3CWBJ 1BCCJ 1BGYJ 3L70J 4PD4I 3BCCJ 3TGUJ 1NTMJ 1KYOI 1KB9I 4D6TJ 3H1IJ 1PP9J 3CXHI 1BE3J 3L74J 1SQBJ 1EZVI 1P84I 3L72J 4U3FJ 1NU1J 3L75J 2FYUJ 3CX5I 3H1JJ 3H1HJ 3H1KJ
chains in the Genus database with same CATH superfamily
1YIJP 2WT7A 1QVGO 4EIJA 1KTMA 3AE2C 1GL2A 1K04A 1X79B 3KHUA 2B88A 2Y0EA 3B5NA 1CZQA 4RKUJ 1OMIA 5AW8B 1S5LE 3M06A 2PP6A 4OH8B 1GU4A 2WSEJ 3V2NA 5AW5B 1T2KC 5KJ7D 3G3ZA 1RY3A 3BRVB 3MHVA 2LR2A 3II6A 3HE4A 2ITAA 4KJMA 2K88A 2R3CA 2WQYC 3BCCJ 1OZHA 3L70G 3SWKA 1PPJE 2H8PD 2OTLP 1KYOI 1L4AB 1NH4A 2CPBA 2WPVB 3RL0B 2KB7P 1JY2N 5GTIH 1HWTC 5AVQB 2OYIC 1OW7A 1MUUA 2FXOA 3GG2A 3KDPB 1KB9E 4UB8H 2WTYA 1D7MA 2P10A 3L35A 2GUSA 2NZ2A 1LTJA 1P84I 2Y0CA 3L72J 2E5YA 1NHLA 5KLIC 3RL0D 3I55P 1FZGA 1MFZA 4WY4C 4LGDE 3M9HA 3I5CA 4HYTB 2PAJA 1QL2A 4N6JA 1SQPG 4JYCA 3V2RA 1RF1C 4CPGA 2JKVA 1FBMA 2KS1A 1G1IA 2IFMA 3EWKA 1KB9H 3HUSB 4K3AA 4I7ZB 1W2EA 4UB8E 5CCHA 5KKZB 1GW3A 1J1EC 1IFJA 1NTMD 2N1TA 4WBAA 1NTKJ 1RF1A 2W8ZA 1NKNA 1J1DB 2DW3A 3H32A 3I56P 5EFWB 3O6QA 4Y99C 5AW0B 3PH0A 2M5AB 5KLIB 2K1AA 3BCCG 3L70J 2R5BA 1XTGB 3CCEP 2ZFCA 2OYHB 2E76D 2KSEA 2O01H 3CCQP 2FFDB 1ZOYC 1SQXG 1SQQG 3AEGC 3PHLA 4RESB 3RK3B 3TGUG 4ZNCA 4R4MA 1IFNA 1YITP 1MFTA 2KIKA 2QJYC 5DJUB 3AE4C 1KFMA 1DH3A 1T8ZA 1LTSC 2FYNB 4M3LA 3RL0C 2B87A 3M0DC 4R4LA 2HYNA 3IFMA 4OGQB 4GKGA 2WMMA 1L2PA 2HG5D 1NTKK 2M3BA 1ZP0C 1KB9D 2JP3A 5CJ4A 3VP9A 5AW7B 2KOGA 1URQC 1PGPA 1PPJG 5CMZA 3CWBJ 1RE3A 1SQQE 3UIAA 1JY3N 5CCHC 5AVSB 1IO4A 1EDLA 3GHGA 3KQGA 4K35A 1AQTA 3B5ND 1AVOA 1ZRTE 3H1HD 1KILC 3H1IE 2IX7C 1NKZB 1FZBA 3L73E 1QX8A 1SQBK 3H25A 2OYIB 1FOSE 1LTJC 3CCUP 2A06D 3TGUE 1AVYA 1GK4A 3H1IJ 3ITKA 3A0BE 2O1JA 1USDA 1LTAC 2QSIA 3B5NB 5APVA 1P84D 2YXRB 5TJHA 2W6BA 3KYQA 2ZYGA 2QM7A 1VQKP 2IYPA 3D6ZA 3CL3D 5AVRB 3AE8C 1JCDA 2E43A 4YTPC 4LLHA 4L73A 3O8ZA 1G2CA 2G3AA 4GT1A 5DJTB 1KYOD 3L71E 5APTA 3S1KA 4ZMDA 1IFDA 3Q1MA 4W7ZA 2QJKC 1DX7A 3RK2C 2HODA 1DEBA 2M0BA 3U1AA 5KLVK 2BASA 1NVOA 2IBZE 1M57D 3E1IA 2QA4P 1R8EA 1HVVA 1K9MQ 5AVWB 4RO0A 5APSA 3V2PA 1HBWA 2JR8A 1FZEA 2E74D 3IR9A 4JQ0D 2OYHC 2KUBA 4PD4I 1SQVG 3CMAP 2JO1A 3H6PA 5E79H 1JNMA 1X9VA 3A0HE 1SFCB 3MUDC 3RBXA 1BSHA 2RN0A 1RE3C 3GHGB 3LW5H 1KORA 2YIUB 1BDCA 3M9BA 1Z56A 1P84E 5B5EE 3HUSC 1KQFB 1IC2A 4N78E 1VQPP 1VQ6P 5KKZC 3AE6C 3FGAD 1KD1Q 1EXJA 2H43A 5AVYB 3CWBG 2YXQB 4C7NA 3CCRP 1NTKE 1VQNP 1Q82Q 1FE6A 4IFDK 3CMEP 2HPCB 1CSBA 2H89C 1ZRTD 4YXWH 1RH5B 5CCGC 1OVVA 3H1HJ 1OW6A 2XDJA 2XNXA 3TSIA 2D2CD 1VQLP 1IFIA 4PV1B 3HD7B 1JM0A 4RJTA 1R5SA 3L36A 1RF0A 4OVNF 1FZCB 4I2LC 2Q3IA 3SFEC 1N73C 1M8OB 2J58A 2Q9IA 1VQ8P 1KV4A 2W83C 2XV5A 3LIEA 3GLMA 4ASWA 2FYNC 2IFNA 3NFQA 2ZT9D 3W67A 4BRYB 3H1LD 3CC4P 3KXDA 3AE1C 2WPRA 2WSFJ 3F5HA 4N3YB 2QIWA 3TNUA 2CPSA 3FXEA 1VQ7P 3S4RA 1JTHA 1EZVE 1IZNB 2FY8A 2N1TC 4U3FG 3RBZA 2FFDC 2P67A 5APUA 1SFCC 2R3SA 3Q2YA 1L0ND 5AW6B 3WUUA 2E75D 2ZAEB 1L4AD 2C0XA 3L4FA 4JF7A 1M1KQ 4DJGA 1EDJA 4WY4A 4I1LA 1KMIZ 4W80A 1OXZA 3AE5C 1BCCE 1S5LH 1PGJA 2RKLA 3M9QA 4UB6E 3U1CA 2E76B 5APXA 1PP9E 4PD4E 1MKMA 5C39A 3L37A 3CWBE 1XTCC 1RE4A 3S9OA 5M1BA 2OYIA 4NPFX 4A7PA 5GTIE 2ZVNB 1GTWA 2WZ7A 3N4XA 1EXIA 1LT9A 3P8CE 5TISE 2ZYDA 2GM4A 1JY2P 1HGVA 1L0LG 2AEJA 2Q7CA 3RK2D 2WPQA 2G8YA 4U3FD 5BVZA 1EZVG 3H1KD 3NXSA 2NRGA 1FZFA 2QG4A 1TU3F 1H0TA 1BE3E 2POHA 4WB4A 4D6TJ 1USEA 1U7MA 2I1KA 1GL2C 3OJAB 4H44C 1GD2E 1OFCX 2Y9YA 5AVUB 5H2FH 3D71A 4L74A 4IFFA 3IN6A 3HTKB 4WVZA 4D6TE 2Z4EA 1NU1J 2JJLA 2WSCH 1T3JA 1SLQA 3EQ2A 1QVFO 1FAVA 1J1EB 4DOJA 4DT0A 1ZW0A 1JMBA 3IAOA 1G1JA 2OTJP 2SPZA 1H8AA 3T97A 3EFFK 1BGYE 1DD4A 1L0NJ 1CI6A 1SQVK 2QJPB 1PFIA 3CD6P 1QGKB 2BCCG 3R2PA 2K9JB 3QH9A 1JY3O 1FS0E 1BGYJ 3V2QA 5KLVE 1BGYG 1KYOE 1UIIA 1YQ4C 1SP4A 1JO5A 1VQ4P 3VMXA 3WUTA 1N8RQ 1N2DC 1VQOP 2A06G 3BATA 3WMM0 4YXDC 1M1JA 3AEEC 4ZKUA 1FZCC 2KXPB 1LGHB 4H44D 2K9YA 1X0TA 1YHQP 1RQUA 2B89A 1VF5B 3CX5H 1OWAA 3HD7A 3HTKA 1KC8Q 1M7LA 3RK3E 3OAKA 1NAYA 1VDFA 5L8RJ 4L76A 3MD0A 1HUCA 2FYUJ 3HRNA 3G6EP 1URQD 1NJIQ 1L4AA 1N86A 3H1KJ 3PTZA 1PIXA 2YMKA 5AW2B 1SQBD 2FBWC 1JY3P 3CLQA 1SQQK 4HKZH 1LNQA 1OIPA 2ZVOB 3EFGA 3K5BA 1VF5D 3JCUE 4DZOA 1Q90D 1KZUB 1IK9A 2KNCA 1X22A 3JSVC 3FX0A 5AVTB 2NPSB 2OYOA 4OGQC 5KAFH 3Q5RA 1LWUA 3FWNA 4HJGH 1M56D 3VP8A 4XA4A 1GL2B 1PV3A 1AV1A 1HH0A 1NTMJ 3PP5A 1KN7A 4PJ0E 2WT7B 1NTKG 2NPSD 2K9JA 2R32A 1LP1A 2UWJE 3BASA 5KJ7A 2FXMA 1Y8AA 3L71D 3RK3C 3AEAC 3E7KA 2XNDH 3SFDC 4IFMA 1LT9B 1PL5A 2YKPA 3LW5J 3TF5A 2AEMA 3H1LG 3AE9C 2KP8A 1HJ0A 5GTHE 1SQXK 4L75A 3C8VA 3VMZA 4MN4C 1R5LA 1SQPJ 5KAIH 1YTZT 1YJ9P 1KILE 1MZ9A 1LTJB 3L72D 1Q7YQ 4H0LC 1N7SC 1EDKA 3C1LA 4HB1A 1GDTA 3F89A 2KNCB 1PZQA 3E1RA 3H1ID 3NMDA 2GA1A 2NPSA 3WU2H 2AXCA 1E5WA 4B86A 5CBNA 1H89A 1Y9BA 4AUWA 3HE5A 4Z1MH 1NOHA 4AYCA 2XU6A 2PFXA 4WY4B 3B4SA 1OVUA 3KZIE 5AVZB 3A2AA 1K05A 3USSA 1ZR4A 2A45H 2M8RA 3Q5PA 3CWBD 3BVHA 2P58A 3RL0g 2ZXEB 4BWNA 1JEKA 1NU1E 2L91A 4H0LB 2C9NY 5B66E 2JWDA 1FDIA 3G4SP 1E79H 1JUNA 3KZIH 3CXHD 1SQXD 3O6QB 4TLFA 5KLVD 3V4QA 1AFOA 3CCJP 1GK6A 1LTTC 3VOPA 2KYVA 1NU1G 2WSSH 2ZXXA 4H0LD 5KAFE 1S72P 2YNYA 1M90Q 1S1CX 2W6JH 2RH0A 1M1JB 5B66H 3P8CD 2RMZA 1ZLLA 1FU1A 2J5UA 1HTLC 1KILD 1ZR2A 1DIPA 2I8DA 1GW4A 1L0NG 1S3JA 1YBKA 2QJKB 2QRXA 1SQBG 2WWWA 1VPCA 4XFJA 1S2EA 2MJZA 3AE7C 3BRTB 1FDOA 2LKMA 2P7JA 3R4YA 4I6MC 3CI9A 2IBZG 3V6IA 3CX5E 1T6AA 3H1JD 1L0NE 2IYOA 1NTZE 3B71A 4H13B 4C46A 4EYYQ 3CCLP 1LT1A 4YPCA 1K73Q 1P84H 1BGYD 2HR3A 1RHZB 1EZVD 1OVRA 2V4HA 3L73D 4KT0J 3HE5B 2FYUE 2Y9ZA 2AEFA 2BCCD 4KHXA 3SWFA 3H1HE 5APYA 2FKWB 3L75G 1KQSO 4GIFA 3L75J 1NTKD 1SQXE 4EDFA 3P7KA 1VF5C 1JMMA 5CHXA 2Y0DA 2PRRA 4WY4D 1NWQA 1A02F 1N7SB 3JCUH 3VMAA 3CXHE 2O01N 3L75E 3V5BA 1NTZK 1Q86Q 1HF9A 3BCCE 2R5DA 3BCCD 3AE3C 3D6YA 1L0LJ 1QLED 2QEXP 1VQMP 1PPJD 3NTNA 2WSCJ 1SQXJ 1BDDA 1SS1A 2WVRA 1FDMA 4IL6E 1BE3D 1EDIA 3H1KE 5AVXB 3P8MC 4GOEA 4U3FE 1N7SD 2A45G 1JY2O 3WU2E 1ZV8A 1LT9C 2IZ0A 4D6TG 1PGQA 5KJ7C 4GODA 2IPPA 5APQA 5CBOA 3CCMP 1EC5A 1RE4C 1NTZD 1SQVD 3FWLA 3AEBC 1S9KE 1URQB 3CXHI 1HJBA 2V7QJ 2V7QH 3L74J 1LWUB 3QWOC 5AW9B 3H1LE 1AJYA 1NTMK 4U3FJ 3IF4A 1N73B 2FXPA 2IZ1A 4NPDA 3L74E 1KILB 1Q2NA 3CX5I 1T3UA 1LJ2A 5TISH 2IBZI 1SQQJ 2WPSA 1N7SA 4BXLA 1U57A 1LP1B 2HFED 2WSEH 1BCCJ 3FXDA 2R44A 1S5LX 1RQVA 3CCVP 1SQPD 1N7LA 1YI2P 1J2JB 2K3RA 4OGQD 4AQRD 2FYUG 5H2FE 4QMAA 3JC22 1M1JC 5AVVB 4IL6X 3W68A 1SVFA 5BU5A 4DCKA 1OX3A 4ZKPA 3G71P 1SQVE 3OW2O 2O3JA 1LTGC 3MZWB 1JTHB 3HD7D 1UIXA 4JYBA 1FC2C 3MGNA 2LXBA 5KAIE 3L72G 2I1JA 3B8EB 3RK3D 3TNUB 3VTPC 1W2BO 4EI2A 3L70D 1LWUC 1YTZI 3AEFC 3H1JJ 4BRYA 1T2KD 1LTIC 2KI7B 2Z5IA 1SQVJ 1L0NK 2A45I 3HUSA 1L0LK 3N7NA 3H1JE 4N78D 5KLVJ 2E5TA 2KS1B 2LXCB 1NTZJ 1YQ3C 2PGDA 1FZAA 1QEXA 3MUDA 4I7ZC 1GU5A 1PP9D 4PD4D 4O9BA 3L74D 2KLVA 4XE5B 5E79E 2FYUK 1DEEG 4HH2A 1KYOH 4PV1D 2O1KA 3KPEA 4IOIH 1KQLA 3PRJA 5APWA 4IL6H 2N9BA 3PJSK 2HPCA 1ZXGA 2BCCE 3SWYA 3TYYA 3HD7C 3AEDC 2KLUA 4PJ0H 1CI6B 1CW5A 3MIWA 4LC1A 3L73G 2L5GB 1S4XA 3GF3A 4WWIA 3MP7B 3VMYA 1FZCA 4C7RA 4TT3H 4U7JA 2J59M 3H1JG 1NTZG 4ASVA 1YYCA 3HE4B 4NPEA 3OA7A 1W5CE 2IDBA 2YKQA 1AQ5A 4GDOA 2FYZA 2QJPC 2P1JA 2XKMA 2OTKE 3WUVA 2D2CC 1VL2A 1SQBE 2WSFH 4W7YA 3L71J 1QL1A 2OARA 2JDIH 3V4WA 5KLVG 1S9KD 5AW3B 1WT6A 2E42A 4OWFA 3MTUE 1PGOA 4H13D 2C0WA 2YIUC 2JWAA 1NGMB 3GHGC 1JCCA 2YO3A 1IFPA 1NU1K 2H88C 1IJDB 2XZRA 2QVAA 3GMAA 2NPSC 2P2UA 3D70A 1JB0J 1SQQD 1KB9I 1URQA 1ZN5A 2AXTE 2KZIA 2YMYA 2D2CB 3M91A 3RK2B 5B5EH 1BSNA 1H88A 2GUVA 1GMJA 2K37A 3U59A 1BCCD 1BCCG 1PP9G 3CC7P 2E74B 5GTHH 2QE7H 1VQ5P 3M0DA 1WMKA 2O01J 1GL2D 1SFCD 1RF0C 1NTMG 2OQQA 2ZT9B 3A7OA 3GF7A 2B9BA 2CK3H 3SSUA 3TDKA 2C9LY 1Y47A 1FJKA 1G2CB 2BEQD 2E75C 5CJ0A 1J1DC 3L74G 3Q5SA 3H1LJ 1FOSF 1VQ9P 1N73A 1SQPK 2OGUA 3L72E 1NAFA 3CXHH 3PLNA 5CCGA 4JPZB 2Q1KA 2W27A 5AW4B 1KQGB 1NYHA 3P32A 3Q3DA 2B87B 3A5TA 1X8YA 1RF1B 4JBZA 3ZDMA 1IK7A 3H32B 1K8AQ 2KK7A 3CCSP 3TGUJ 2N1TB 3M0AA 1Q81Q 1NU1D 2H7HA 2Z5HA 2Q3EA 2QM8A 2W90A 1KFNA 1SFCA 1GZLA 3A0BH 1NTME 3L71G 2FFDA 1HGZA 1LTBC 1PP9J 5KTBA 2A06E 3GW6A 3A3YB 2HLOA 2YO2A 3L70E 1L4AC 3RGUA 4EOTA 2JEEA 1WRGA 1YJNP 2BEZF 2OYHA 4C7NB 2M5AA 5CCGD 4H44B 1JOCA 1OW8A 2N1TD 3T97B 5BU8B 4GOFA 2MKVA 3TK1A 4H13C 1H0TB 1A02J 3H1HG 3VYIA 2ZJSE 3C9IA 3L73J 1IFMA 3G9RA 2QJYB 2BCCJ 2ZT9C 3H1IG 4PD4H 4PV1C 4UB6H 1AA0A 1SQPE 2E75B 2W6AA 2ZYAA 3A0HH 3L75D 1MV8A 2KZJA 5K5GB 1FJPA 3AECC 3VN0A 1DD3A 2YKOA 3B5NC 4Y99B 3CPWO 2E74C 1YJWP 2HODB 2FYUD 2KSJA 2M3EA 5CCHD 2WITA 5AW1B 2E76C 2IBZD 2N9YB 2Q5UA 3H1KG 1BE3J 2AXTH 1BE3G 1ZMEC 1KILA 1SQBJ 2VRSA 1U7JA 1EZVI 3CX5D 1L0LD 2Q6QA 3CC2P 4Y28J 3TGUD 1EQ7A 3LIDA 4D6TD 3ABVC 1NO4A 1L0LE
chains in the Genus database with same CATH topology
1SQVJ 2IBZI 1SQPJ 1SQQJ 3H1LJ 3L73J 3L71J 1L0LJ 5KLVJ 1L0NJ 1NTKJ 1NTZJ 2BCCJ 1SQXJ 3CWBJ 1BCCJ 1BGYJ 3L70J 4PD4I 3BCCJ 3TGUJ 1NTMJ 1KYOI 1KB9I 4D6TJ 3H1IJ 1PP9J 3CXHI 1BE3J 3L74J 1SQBJ 1EZVI 1P84I 3L72J 4U3FJ 1NU1J 3L75J 2FYUJ 3CX5I 3H1JJ 3H1HJ 3H1KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV J;  2IBZ I;  1SQP J;  1SQQ J;  3H1L J;  3L73 J;  3L71 J;  1L0L J;  5KLV J;  1L0N J;  1NTK J;  1NTZ J;  2BCC J;  1SQX J;  3CWB J;  1BCC J;  1BGY J;  3L70 J;  4PD4 I;  3BCC J;  3TGU J;  1NTM J;  1KYO I;  1KB9 I;  4D6T J;  3H1I J;  1PP9 J;  3CXH I;  1BE3 J;  3L74 J;  1SQB J;  1EZV I;  1P84 I;  3L72 J;  4U3F J;  1NU1 J;  3L75 J;  2FYU J;  3CX5 I;  3H1J J;  3H1H J;  3H1K J; 
#chains in the Genus database with same CATH topology
 1YIJ P;  2WT7 A;  1QVG O;  4EIJ A;  1KTM A;  3AE2 C;  1GL2 A;  1K04 A;  1X79 B;  3KHU A;  2B88 A;  2Y0E A;  3B5N A;  1CZQ A;  4RKU J;  1OMI A;  5AW8 B;  1S5L E;  3M06 A;  2PP6 A;  4OH8 B;  1GU4 A;  2WSE J;  3V2N A;  5AW5 B;  1T2K C;  5KJ7 D;  3G3Z A;  1RY3 A;  3BRV B;  3MHV A;  2LR2 A;  3II6 A;  3HE4 A;  2ITA A;  4KJM A;  2K88 A;  2R3C A;  2WQY C;  3BCC J;  1OZH A;  3L70 G;  3SWK A;  1PPJ E;  2H8P D;  2OTL P;  1KYO I;  1L4A B;  1NH4 A;  2CPB A;  2WPV B;  3RL0 B;  2KB7 P;  1JY2 N;  5GTI H;  1HWT C;  5AVQ B;  2OYI C;  1OW7 A;  1MUU A;  2FXO A;  3GG2 A;  3KDP B;  1KB9 E;  4UB8 H;  2WTY A;  1D7M A;  2P10 A;  3L35 A;  2GUS A;  2NZ2 A;  1LTJ A;  1P84 I;  2Y0C A;  3L72 J;  2E5Y A;  1NHL A;  5KLI C;  3RL0 D;  3I55 P;  1FZG A;  1MFZ A;  4WY4 C;  4LGD E;  3M9H A;  3I5C A;  4HYT B;  2PAJ A;  1QL2 A;  4N6J A;  1SQP G;  4JYC A;  3V2R A;  1RF1 C;  4CPG A;  2JKV A;  1FBM A;  2KS1 A;  1G1I A;  2IFM A;  3EWK A;  1KB9 H;  3HUS B;  4K3A A;  4I7Z B;  1W2E A;  4UB8 E;  5CCH A;  5KKZ B;  1GW3 A;  1J1E C;  1IFJ A;  1NTM D;  2N1T A;  4WBA A;  1NTK J;  1RF1 A;  2W8Z A;  1NKN A;  1J1D B;  2DW3 A;  3H32 A;  3I56 P;  5EFW B;  3O6Q A;  4Y99 C;  5AW0 B;  3PH0 A;  2M5A B;  5KLI B;  2K1A A;  3BCC G;  3L70 J;  2R5B A;  1XTG B;  3CCE P;  2ZFC A;  2OYH B;  2E76 D;  2KSE A;  2O01 H;  3CCQ P;  2FFD B;  1ZOY C;  1SQX G;  1SQQ G;  3AEG C;  3PHL A;  4RES B;  3RK3 B;  3TGU G;  4ZNC A;  4R4M A;  1IFN A;  1YIT P;  1MFT A;  2KIK A;  2QJY C;  5DJU B;  3AE4 C;  1KFM A;  1DH3 A;  1T8Z A;  1LTS C;  2FYN B;  4M3L A;  3RL0 C;  2B87 A;  3M0D C;  4R4L A;  2HYN A;  3IFM A;  4OGQ B;  4GKG A;  2WMM A;  1L2P A;  2HG5 D;  1NTK K;  2M3B A;  1ZP0 C;  1KB9 D;  2JP3 A;  5CJ4 A;  3VP9 A;  5AW7 B;  2KOG A;  1URQ C;  1PGP A;  1PPJ G;  5CMZ A;  3CWB J;  1RE3 A;  1SQQ E;  3UIA A;  1JY3 N;  5CCH C;  5AVS B;  1IO4 A;  1EDL A;  3GHG A;  3KQG A;  4K35 A;  1AQT A;  3B5N D;  1AVO A;  1ZRT E;  3H1H D;  1KIL C;  3H1I E;  2IX7 C;  1NKZ B;  1FZB A;  3L73 E;  1QX8 A;  1SQB K;  3H25 A;  2OYI B;  1FOS E;  1LTJ C;  3CCU P;  2A06 D;  3TGU E;  1AVY A;  1GK4 A;  3H1I J;  3ITK A;  3A0B E;  2O1J A;  1USD A;  1LTA C;  2QSI A;  3B5N B;  5APV A;  1P84 D;  2YXR B;  5TJH A;  2W6B A;  3KYQ A;  2ZYG A;  2QM7 A;  1VQK P;  2IYP A;  3D6Z A;  3CL3 D;  5AVR B;  3AE8 C;  1JCD A;  2E43 A;  4YTP C;  4LLH A;  4L73 A;  3O8Z A;  1G2C A;  2G3A A;  4GT1 A;  5DJT B;  1KYO D;  3L71 E;  5APT A;  3S1K A;  4ZMD A;  1IFD A;  3Q1M A;  4W7Z A;  2QJK C;  1DX7 A;  3RK2 C;  2HOD A;  1DEB A;  2M0B A;  3U1A A;  5KLV K;  2BAS A;  1NVO A;  2IBZ E;  1M57 D;  3E1I A;  2QA4 P;  1R8E A;  1HVV A;  1K9M Q;  5AVW B;  4RO0 A;  5APS A;  3V2P A;  1HBW A;  2JR8 A;  1FZE A;  2E74 D;  3IR9 A;  4JQ0 D;  2OYH C;  2KUB A;  4PD4 I;  1SQV G;  3CMA P;  2JO1 A;  3H6P A;  5E79 H;  1JNM A;  1X9V A;  3A0H E;  1SFC B;  3MUD C;  3RBX A;  1BSH A;  2RN0 A;  1RE3 C;  3GHG B;  3LW5 H;  1KOR A;  2YIU B;  1BDC A;  3M9B A;  1Z56 A;  1P84 E;  5B5E E;  3HUS C;  1KQF B;  1IC2 A;  4N78 E;  1VQP P;  1VQ6 P;  5KKZ C;  3AE6 C;  3FGA D;  1KD1 Q;  1EXJ A;  2H43 A;  5AVY B;  3CWB G;  2YXQ B;  4C7N A;  3CCR P;  1NTK E;  1VQN P;  1Q82 Q;  1FE6 A;  4IFD K;  3CME P;  2HPC B;  1CSB A;  2H89 C;  1ZRT D;  4YXW H;  1RH5 B;  5CCG C;  1OVV A;  3H1H J;  1OW6 A;  2XDJ A;  2XNX A;  3TSI A;  2D2C D;  1VQL P;  1IFI A;  4PV1 B;  3HD7 B;  1JM0 A;  4RJT A;  1R5S A;  3L36 A;  1RF0 A;  4OVN F;  1FZC B;  4I2L C;  2Q3I A;  3SFE C;  1N73 C;  1M8O B;  2J58 A;  2Q9I A;  1VQ8 P;  1KV4 A;  2W83 C;  2XV5 A;  3LIE A;  3GLM A;  4ASW A;  2FYN C;  2IFN A;  3NFQ A;  2ZT9 D;  3W67 A;  4BRY B;  3H1L D;  3CC4 P;  3KXD A;  3AE1 C;  2WPR A;  2WSF J;  3F5H A;  4N3Y B;  2QIW A;  3TNU A;  2CPS A;  3FXE A;  1VQ7 P;  3S4R A;  1JTH A;  1EZV E;  1IZN B;  2FY8 A;  2N1T C;  4U3F G;  3RBZ A;  2FFD C;  2P67 A;  5APU A;  1SFC C;  2R3S A;  3Q2Y A;  1L0N D;  5AW6 B;  3WUU A;  2E75 D;  2ZAE B;  1L4A D;  2C0X A;  3L4F A;  4JF7 A;  1M1K Q;  4DJG A;  1EDJ A;  4WY4 A;  4I1L A;  1KMI Z;  4W80 A;  1OXZ A;  3AE5 C;  1BCC E;  1S5L H;  1PGJ A;  2RKL A;  3M9Q A;  4UB6 E;  3U1C A;  2E76 B;  5APX A;  1PP9 E;  4PD4 E;  1MKM A;  5C39 A;  3L37 A;  3CWB E;  1XTC C;  1RE4 A;  3S9O A;  5M1B A;  2OYI A;  4NPF X;  4A7P A;  5GTI E;  2ZVN B;  1GTW A;  2WZ7 A;  3N4X A;  1EXI A;  1LT9 A;  3P8C E;  5TIS E;  2ZYD A;  2GM4 A;  1JY2 P;  1HGV A;  1L0L G;  2AEJ A;  2Q7C A;  3RK2 D;  2WPQ A;  2G8Y A;  4U3F D;  5BVZ A;  1EZV G;  3H1K D;  3NXS A;  2NRG A;  1FZF A;  2QG4 A;  1TU3 F;  1H0T A;  1BE3 E;  2POH A;  4WB4 A;  4D6T J;  1USE A;  1U7M A;  2I1K A;  1GL2 C;  3OJA B;  4H44 C;  1GD2 E;  1OFC X;  2Y9Y A;  5AVU B;  5H2F H;  3D71 A;  4L74 A;  4IFF A;  3IN6 A;  3HTK B;  4WVZ A;  4D6T E;  2Z4E A;  1NU1 J;  2JJL A;  2WSC H;  1T3J A;  1SLQ A;  3EQ2 A;  1QVF O;  1FAV A;  1J1E B;  4DOJ A;  4DT0 A;  1ZW0 A;  1JMB A;  3IAO A;  1G1J A;  2OTJ P;  2SPZ A;  1H8A A;  3T97 A;  3EFF K;  1BGY E;  1DD4 A;  1L0N J;  1CI6 A;  1SQV K;  2QJP B;  1PFI A;  3CD6 P;  1QGK B;  2BCC G;  3R2P A;  2K9J B;  3QH9 A;  1JY3 O;  1FS0 E;  1BGY J;  3V2Q A;  5KLV E;  1BGY G;  1KYO E;  1UII A;  1YQ4 C;  1SP4 A;  1JO5 A;  1VQ4 P;  3VMX A;  3WUT A;  1N8R Q;  1N2D C;  1VQO P;  2A06 G;  3BAT A;  3WMM 0;  4YXD C;  1M1J A;  3AEE C;  4ZKU A;  1FZC C;  2KXP B;  1LGH B;  4H44 D;  2K9Y A;  1X0T A;  1YHQ P;  1RQU A;  2B89 A;  1VF5 B;  3CX5 H;  1OWA A;  3HD7 A;  3HTK A;  1KC8 Q;  1M7L A;  3RK3 E;  3OAK A;  1NAY A;  1VDF A;  5L8R J;  4L76 A;  3MD0 A;  1HUC A;  2FYU J;  3HRN A;  3G6E P;  1URQ D;  1NJI Q;  1L4A A;  1N86 A;  3H1K J;  3PTZ A;  1PIX A;  2YMK A;  5AW2 B;  1SQB D;  2FBW C;  1JY3 P;  3CLQ A;  1SQQ K;  4HKZ H;  1LNQ A;  1OIP A;  2ZVO B;  3EFG A;  3K5B A;  1VF5 D;  3JCU E;  4DZO A;  1Q90 D;  1KZU B;  1IK9 A;  2KNC A;  1X22 A;  3JSV C;  3FX0 A;  5AVT B;  2NPS B;  2OYO A;  4OGQ C;  5KAF H;  3Q5R A;  1LWU A;  3FWN A;  4HJG H;  1M56 D;  3VP8 A;  4XA4 A;  1GL2 B;  1PV3 A;  1AV1 A;  1HH0 A;  1NTM J;  3PP5 A;  1KN7 A;  4PJ0 E;  2WT7 B;  1NTK G;  2NPS D;  2K9J A;  2R32 A;  1LP1 A;  2UWJ E;  3BAS A;  5KJ7 A;  2FXM A;  1Y8A A;  3L71 D;  3RK3 C;  3AEA C;  3E7K A;  2XND H;  3SFD C;  4IFM A;  1LT9 B;  1PL5 A;  2YKP A;  3LW5 J;  3TF5 A;  2AEM A;  3H1L G;  3AE9 C;  2KP8 A;  1HJ0 A;  5GTH E;  1SQX K;  4L75 A;  3C8V A;  3VMZ A;  4MN4 C;  1R5L A;  1SQP J;  5KAI H;  1YTZ T;  1YJ9 P;  1KIL E;  1MZ9 A;  1LTJ B;  3L72 D;  1Q7Y Q;  4H0L C;  1N7S C;  1EDK A;  3C1L A;  4HB1 A;  1GDT A;  3F89 A;  2KNC B;  1PZQ A;  3E1R A;  3H1I D;  3NMD A;  2GA1 A;  2NPS A;  3WU2 H;  2AXC A;  1E5W A;  4B86 A;  5CBN A;  1H89 A;  1Y9B A;  4AUW A;  3HE5 A;  4Z1M H;  1NOH A;  4AYC A;  2XU6 A;  2PFX A;  4WY4 B;  3B4S A;  1OVU A;  3KZI E;  5AVZ B;  3A2A A;  1K05 A;  3USS A;  1ZR4 A;  2A45 H;  2M8R A;  3Q5P A;  3CWB D;  3BVH A;  2P58 A;  3RL0 g;  2ZXE B;  4BWN A;  1JEK A;  1NU1 E;  2L91 A;  4H0L B;  2C9N Y;  5B66 E;  2JWD A;  1FDI A;  3G4S P;  1E79 H;  1JUN A;  3KZI H;  3CXH D;  1SQX D;  3O6Q B;  4TLF A;  5KLV D;  3V4Q A;  1AFO A;  3CCJ P;  1GK6 A;  1LTT C;  3VOP A;  2KYV A;  1NU1 G;  2WSS H;  2ZXX A;  4H0L D;  5KAF E;  1S72 P;  2YNY A;  1M90 Q;  1S1C X;  2W6J H;  2RH0 A;  1M1J B;  5B66 H;  3P8C D;  2RMZ A;  1ZLL A;  1FU1 A;  2J5U A;  1HTL C;  1KIL D;  1ZR2 A;  1DIP A;  2I8D A;  1GW4 A;  1L0N G;  1S3J A;  1YBK A;  2QJK B;  2QRX A;  1SQB G;  2WWW A;  1VPC A;  4XFJ A;  1S2E A;  2MJZ A;  3AE7 C;  3BRT B;  1FDO A;  2LKM A;  2P7J A;  3R4Y A;  4I6M C;  3CI9 A;  2IBZ G;  3V6I A;  3CX5 E;  1T6A A;  3H1J D;  1L0N E;  2IYO A;  1NTZ E;  3B71 A;  4H13 B;  4C46 A;  4EYY Q;  3CCL P;  1LT1 A;  4YPC A;  1K73 Q;  1P84 H;  1BGY D;  2HR3 A;  1RHZ B;  1EZV D;  1OVR A;  2V4H A;  3L73 D;  4KT0 J;  3HE5 B;  2FYU E;  2Y9Z A;  2AEF A;  2BCC D;  4KHX A;  3SWF A;  3H1H E;  5APY A;  2FKW B;  3L75 G;  1KQS O;  4GIF A;  3L75 J;  1NTK D;  1SQX E;  4EDF A;  3P7K A;  1VF5 C;  1JMM A;  5CHX A;  2Y0D A;  2PRR A;  4WY4 D;  1NWQ A;  1A02 F;  1N7S B;  3JCU H;  3VMA A;  3CXH E;  2O01 N;  3L75 E;  3V5B A;  1NTZ K;  1Q86 Q;  1HF9 A;  3BCC E;  2R5D A;  3BCC D;  3AE3 C;  3D6Y A;  1L0L J;  1QLE D;  2QEX P;  1VQM P;  1PPJ D;  3NTN A;  2WSC J;  1SQX J;  1BDD A;  1SS1 A;  2WVR A;  1FDM A;  4IL6 E;  1BE3 D;  1EDI A;  3H1K E;  5AVX B;  3P8M C;  4GOE A;  4U3F E;  1N7S D;  2A45 G;  1JY2 O;  3WU2 E;  1ZV8 A;  1LT9 C;  2IZ0 A;  4D6T G;  1PGQ A;  5KJ7 C;  4GOD A;  2IPP A;  5APQ A;  5CBO A;  3CCM P;  1EC5 A;  1RE4 C;  1NTZ D;  1SQV D;  3FWL A;  3AEB C;  1S9K E;  1URQ B;  3CXH I;  1HJB A;  2V7Q J;  2V7Q H;  3L74 J;  1LWU B;  3QWO C;  5AW9 B;  3H1L E;  1AJY A;  1NTM K;  4U3F J;  3IF4 A;  1N73 B;  2FXP A;  2IZ1 A;  4NPD A;  3L74 E;  1KIL B;  1Q2N A;  3CX5 I;  1T3U A;  1LJ2 A;  5TIS H;  2IBZ I;  1SQQ J;  2WPS A;  1N7S A;  4BXL A;  1U57 A;  1LP1 B;  2HFE D;  2WSE H;  1BCC J;  3FXD A;  2R44 A;  1S5L X;  1RQV A;  3CCV P;  1SQP D;  1N7L A;  1YI2 P;  1J2J B;  2K3R A;  4OGQ D;  4AQR D;  2FYU G;  5H2F E;  4QMA A;  3JC2 2;  1M1J C;  5AVV B;  4IL6 X;  3W68 A;  1SVF A;  5BU5 A;  4DCK A;  1OX3 A;  4ZKP A;  3G71 P;  1SQV E;  3OW2 O;  2O3J A;  1LTG C;  3MZW B;  1JTH B;  3HD7 D;  1UIX A;  4JYB A;  1FC2 C;  3MGN A;  2LXB A;  5KAI E;  3L72 G;  2I1J A;  3B8E B;  3RK3 D;  3TNU B;  3VTP C;  1W2B O;  4EI2 A;  3L70 D;  1LWU C;  1YTZ I;  3AEF C;  3H1J J;  4BRY A;  1T2K D;  1LTI C;  2KI7 B;  2Z5I A;  1SQV J;  1L0N K;  2A45 I;  3HUS A;  1L0L K;  3N7N A;  3H1J E;  4N78 D;  5KLV J;  2E5T A;  2KS1 B;  2LXC B;  1NTZ J;  1YQ3 C;  2PGD A;  1FZA A;  1QEX A;  3MUD A;  4I7Z C;  1GU5 A;  1PP9 D;  4PD4 D;  4O9B A;  3L74 D;  2KLV A;  4XE5 B;  5E79 E;  2FYU K;  1DEE G;  4HH2 A;  1KYO H;  4PV1 D;  2O1K A;  3KPE A;  4IOI H;  1KQL A;  3PRJ A;  5APW A;  4IL6 H;  2N9B A;  3PJS K;  2HPC A;  1ZXG A;  2BCC E;  3SWY A;  3TYY A;  3HD7 C;  3AED C;  2KLU A;  4PJ0 H;  1CI6 B;  1CW5 A;  3MIW A;  4LC1 A;  3L73 G;  2L5G B;  1S4X A;  3GF3 A;  4WWI A;  3MP7 B;  3VMY A;  1FZC A;  4C7R A;  4TT3 H;  4U7J A;  2J59 M;  3H1J G;  1NTZ G;  4ASV A;  1YYC A;  3HE4 B;  4NPE A;  3OA7 A;  1W5C E;  2IDB A;  2YKQ A;  1AQ5 A;  4GDO A;  2FYZ A;  2QJP C;  2P1J A;  2XKM A;  2OTK E;  3WUV A;  2D2C C;  1VL2 A;  1SQB E;  2WSF H;  4W7Y A;  3L71 J;  1QL1 A;  2OAR A;  2JDI H;  3V4W A;  5KLV G;  1S9K D;  5AW3 B;  1WT6 A;  2E42 A;  4OWF A;  3MTU E;  1PGO A;  4H13 D;  2C0W A;  2YIU C;  2JWA A;  1NGM B;  3GHG C;  1JCC A;  2YO3 A;  1IFP A;  1NU1 K;  2H88 C;  1IJD B;  2XZR A;  2QVA A;  3GMA A;  2NPS C;  2P2U A;  3D70 A;  1JB0 J;  1SQQ D;  1KB9 I;  1URQ A;  1ZN5 A;  2AXT E;  2KZI A;  2YMY A;  2D2C B;  3M91 A;  3RK2 B;  5B5E H;  1BSN A;  1H88 A;  2GUV A;  1GMJ A;  2K37 A;  3U59 A;  1BCC D;  1BCC G;  1PP9 G;  3CC7 P;  2E74 B;  5GTH H;  2QE7 H;  1VQ5 P;  3M0D A;  1WMK A;  2O01 J;  1GL2 D;  1SFC D;  1RF0 C;  1NTM G;  2OQQ A;  2ZT9 B;  3A7O A;  3GF7 A;  2B9B A;  2CK3 H;  3SSU A;  3TDK A;  2C9L Y;  1Y47 A;  1FJK A;  1G2C B;  2BEQ D;  2E75 C;  5CJ0 A;  1J1D C;  3L74 G;  3Q5S A;  3H1L J;  1FOS F;  1VQ9 P;  1N73 A;  1SQP K;  2OGU A;  3L72 E;  1NAF A;  3CXH H;  3PLN A;  5CCG A;  4JPZ B;  2Q1K A;  2W27 A;  5AW4 B;  1KQG B;  1NYH A;  3P32 A;  3Q3D A;  2B87 B;  3A5T A;  1X8Y A;  1RF1 B;  4JBZ A;  3ZDM A;  1IK7 A;  3H32 B;  1K8A Q;  2KK7 A;  3CCS P;  3TGU J;  2N1T B;  3M0A A;  1Q81 Q;  1NU1 D;  2H7H A;  2Z5H A;  2Q3E A;  2QM8 A;  2W90 A;  1KFN A;  1SFC A;  1GZL A;  3A0B H;  1NTM E;  3L71 G;  2FFD A;  1HGZ A;  1LTB C;  1PP9 J;  5KTB A;  2A06 E;  3GW6 A;  3A3Y B;  2HLO A;  2YO2 A;  3L70 E;  1L4A C;  3RGU A;  4EOT A;  2JEE A;  1WRG A;  1YJN P;  2BEZ F;  2OYH A;  4C7N B;  2M5A A;  5CCG D;  4H44 B;  1JOC A;  1OW8 A;  2N1T D;  3T97 B;  5BU8 B;  4GOF A;  2MKV A;  3TK1 A;  4H13 C;  1H0T B;  1A02 J;  3H1H G;  3VYI A;  2ZJS E;  3C9I A;  3L73 J;  1IFM A;  3G9R A;  2QJY B;  2BCC J;  2ZT9 C;  3H1I G;  4PD4 H;  4PV1 C;  4UB6 H;  1AA0 A;  1SQP E;  2E75 B;  2W6A A;  2ZYA A;  3A0H H;  3L75 D;  1MV8 A;  2KZJ A;  5K5G B;  1FJP A;  3AEC C;  3VN0 A;  1DD3 A;  2YKO A;  3B5N C;  4Y99 B;  3CPW O;  2E74 C;  1YJW P;  2HOD B;  2FYU D;  2KSJ A;  2M3E A;  5CCH D;  2WIT A;  5AW1 B;  2E76 C;  2IBZ D;  2N9Y B;  2Q5U A;  3H1K G;  1BE3 J;  2AXT H;  1BE3 G;  1ZME C;  1KIL A;  1SQB J;  2VRS A;  1U7J A;  1EZV I;  3CX5 D;  1L0L D;  2Q6Q A;  3CC2 P;  4Y28 J;  3TGU D;  1EQ7 A;  3LID A;  4D6T D;  3ABV C;  1NO4 A;  1L0L E; 
#chains in the Genus database with same CATH homology
 1SQV J;  2IBZ I;  1SQP J;  1SQQ J;  3H1L J;  3L73 J;  3L71 J;  1L0L J;  5KLV J;  1L0N J;  1NTK J;  1NTZ J;  2BCC J;  1SQX J;  3CWB J;  1BCC J;  1BGY J;  3L70 J;  4PD4 I;  3BCC J;  3TGU J;  1NTM J;  1KYO I;  1KB9 I;  4D6T J;  3H1I J;  1PP9 J;  3CXH I;  1BE3 J;  3L74 J;  1SQB J;  1EZV I;  1P84 I;  3L72 J;  4U3F J;  1NU1 J;  3L75 J;  2FYU J;  3CX5 I;  3H1J J;  3H1H J;  3H1K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...