3L75J

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l75J00
3BCCJ 1KYOI 1KB9I 1L0LJ 1SQPJ 3CXHI 5KLVJ 1L0NJ 3H1JJ 1BE3J 1SQQJ 3H1HJ 1BGYJ 3CX5I 4D6TJ 3H1LJ 3L71J 3TGUJ 1NTZJ 3L74J 1NU1J 1PP9J 1SQVJ 4U3FJ 2FYUJ 3L75J 1P84I 1SQBJ 3H1IJ 3CWBJ 4PD4I 2BCCJ 3H1KJ 3L73J 1NTKJ 1BCCJ 1EZVI 3L72J 2IBZI 3L70J 1SQXJ 1NTMJ
chains in the Genus database with same CATH superfamily
4EOTA 3BCCJ 3A0HH 2V4HA 3RL0g 2YIUC 2OYOA 5AVRB 3CCLP 2WSFJ 3H1HG 4MN4C 3MTUE 2KP8A 1BGYE 1AVYA 1KB9E 3GMAA 1LWUB 2WTYA 4ZKPA 4AYCA 1MFZA 3CX5D 2C9NY 2E75C 3CCVP 2WSEH 4IL6H 1LJ2A 1JEKA 2Y0EA 4U3FG 4PV1D 1SQPD 3LW5H 3P32A 3S9OA 2K3RA 1IFPA 4D6TE 2ZYGA 1OW6A 3L37A 2HLOA 1XTCC 1S9KD 1BE3G 1SQQG 3CMEP 3SWFA 1KMIZ 2WSCH 3CL3D 4ZKUA 2WZ7A 3U1AA 1N7SC 3H1HE 3RK3B 1PZQA 1OIPA 2Q3EA 3TK1A 1T2KC 2AXTE 3I56P 3Q3DA 4O9BA 2HYNA 5KLVK 2BCCJ 5KLVE 1KC8Q 1LWUA 3CCQP 4TT3H 2E43A 1SFCD 3L75E 4H13C 1XTGB 2WT7B 2Z5HA 1EDJA 1KQGB 3VYIA 4RJTA 5DJTB 1S4XA 4M3LA 3GLMA 1SQQK 3B5NC 2C0XA 1WRGA 1JM0A 2JO1A 1N2DC 2A06G 1HGVA 2D2CB 1NU1J 3H1LG 3WUTA 1DD3A 2YO2A 1A02F 3SFDC 2KK7A 3AE4C 5DJUB 3V2RA 2L91A 2O01J 3HUSB 5AW0B 3EFFK 1PGOA 3H32B 3G71P 3L71G 3TGUG 1GU4A 2Z4EA 1S5LX 3L70E 1YQ4C 3V2QA 1YJNP 3TYYA 3KZIE 4PV1C 2QJPC 2I1KA 3BATA 4Y99B 3PJSK 3EWKA 2FYZA 1SQBD 2FKWB 1QGKB 3CX5E 2WT7A 2BEZF 2QSIA 1VQPP 3AE5C 3JCUH 2E42A 2H43A 1SQVJ 1SQPK 3AEDC 1SQPE 1KILB 1J1EB 3M0DA 2AEFA 1OX3A 4R4MA 2OYIB 1S3JA 3D6YA 5EFWB 1AV1A 2LXBA 1S9KE 2AEJA 2H89C 1PP9J 1CI6A 3I55P 4WY4D 1VQOP 3CC4P 3IF4A 1LT9B 2GA1A 1NOHA 4OH8B 1KN7A 4I7ZC 2XZRA 1T6AA 3HD7D 3S4RA 2KS1B 4EIJA 5KAFH 1SFCC 1URQB 3Q5SA 3GHGB 1G1JA 2UWJE 1IK9A 4I6MC 2FYNB 1FU1A 4PD4D 1JCCA 1JY2O 1NYHA 1QVGO 2BEQD 2D2CD 4GT1A 1H0TB 5K5GB 1EDLA 3CXHI 1E79H 1AQ5A 1BE3J 1T3UA 1FJKA 3CWBD 1L0NG 2QJKB 5H2FE 1Q82Q 2HPCB 3BCCD 1KILA 4H44D 1BSHA 1PPJD 3KHUA 2OYIA 1HWTC 4HJGH 1KTMA 2E76D 2WPSA 3PH0A 1RY3A 4HB1A 2YKPA 1ZN5A 5AW8B 5E79E 1HVVA 3SFEC 1NTZJ 2OTJP 1MZ9A 1YYCA 3F89A 1CZQA 1LT9A 5TJHA 2QIWA 3L74G 3WU2E 2YIUB 2P58A 2HODA 1VQMP 2MJZA 4YPCA 2KS1A 2YNYA 1GU5A 2Q5UA 2FXPA 3U59A 4L75A 2H7HA 1L0LJ 4C7NB 1M1JB 4A7PA 5APTA 4BWNA 3P8CE 2BASA 4IFMA 1KQFB 2CK3H 2E75B 2N9BA 3CCJP 2JP3A 2QJYC 1SQBE 1FAVA 2FFDC 4JQ0D 1BDCA 2JWAA 2IFNA 2ZAEB 1NKNA 2KZIA 4WY4C 1RF1A 4OWFA 1VF5D 5CCGA 1RE4A 3KXDA 3HD7C 3SSUA 1Q90D 3BRTB 2BCCD 2WSEJ 1N7SB 2E5YA 3TF5A 5BU8B 1IFJA 3M0DC 1EDIA 2R32A 1LTGC 2R3SA 4N78D 1U57A 3L72J 5GTHH 3NTNA 2G3AA 1FOSF 2N1TA 3G6EP 3AEFC 4C7RA 3M9QA 1PIXA 1X8YA 1MKMA 5AW2B 3CCUP 5CCGD 2WSCJ 1HTLC 4RO0A 1S1CX 4RKUJ 4PD4E 1VL2A 2RN0A 4H44C 4H13B 1VQ6P 3AEEC 2M8RA 1NTKG 2E76C 3AE8C 1Y9BA 2ZT9B 2O1KA 2WQYC 4Z1MH 1USDA 3B5NB 3NMDA 3CLQA 2RH0A 3CWBE 1LNQA 4DJGA 1LTIC 5B66H 1IFDA 4BRYB 3BCCE 2AXTH 1PPJE 1JY2P 4GDOA 2HG5D 2N1TD 2XDJA 1IK7A 1N7SA 3Q2YA 1NHLA 1ZRTD 1GZLA 3AE3C 5APWA 1YIJP 3KQGA 1S2EA 2QVAA 3NXSA 1LTBC 3O6QA 2XNDH 3M9BA 2YMKA 1SQVD 1DIPA 3M06A 5KLIC 1JNMA 1L0NJ 4PV1B 2QJPB 1DD4A 3FWLA 2Y0DA 3G4SP 3H1IJ 4U7JA 2KNCA 2P67A 4UB6E 3WUUA 1T2KD 1VF5C 1PP9D 1KYOI 1FJPA 2KXPB 1OVRA 3VN0A 1GK6A 1BGYG 3VP9A 4BRYA 1PFIA 1KYOH 1X0TA 1Q86Q 2M3BA 1EZVD 3EFGA 1IFIA 1K9MQ 1G2CA 3U1CA 2Y9YA 3H1JJ 3KZIH 2NPSC 1LGHB 4H13D 1K73Q 2K9JA 2JEEA 2BCCE 4I7ZB 2L5GB 4D6TG 1M8OB 1NAYA 1RF1C 1T8ZA 5APYA 1HUCA 3CX5H 4DOJA 1SFCB 4N78E 5GTIH 1J2JB 1RF0C 2J59M 1QX8A 2YO3A 1JUNA 4JYCA 3L70D 3CMAP 1D7MA 5AW6B 1HJ0A 1JY3O 3MD0A 3FWNA 2KLVA 3E7KA 1NTZD 2N1TC 3VTPC 2ZXEB 1PV3A 3H6PA 5C39A 2IYPA 5KLVG 1A02J 2B88A 1BSNA 2Q7CA 1OWAA 2CPSA 1L0LD 3L75G 2HR3A 5APSA 4TLFA 2IBZD 2W8ZA 2ITAA 2LXCB 1HGZA 1CSBA 1KV4A 5TISE 1S5LH 2K88A 3Q5PA 1ZRTE 4UB8E 1SFCA 3CC7P 4DCKA 2ZFCA 1NTKJ 5H2FH 1BCCJ 3AEBC 4L73A 1NTMJ 1SQVK 4NPDA 1SQVE 2QM7A 3GF3A 4GIFA 2NRGA 1DH3A 2NZ2A 2QJYB 2Q9IA 5E79H 2OYHC 1H8AA 3H1KJ 2FFDB 2IFMA 1NKZB 1P84H 5KJ7A 2R44A 5CHXA 3P8MC 1PP9E 3L70G 1ZOYC 4WY4B 2KYVA 3L72D 2WSSH 3B4SA 1K04A 3HD7B 1NH4A 3V5BA 1LTJC 5AW5B 1EZVE 2OTLP 1NGMB 2JJLA 1AQTA 1SQPG 2M5AA 2GUVA 3B71A 5KJ7D 1RE3A 2WVRA 3VMYA 1FZFA 2QA4P 2PP6A 2XNXA 1CI6B 4JF7A 5APQA 1SQXJ 2JDIH 4NPEA 1EDKA 4WVZA 5KAIE 3TDKA 2HFED 3UIAA 2I1JA 4H44B 3OJAB 3P8CD 1R5SA 3L73D 4IL6X 1W5CE 2E76B 2SPZA 3II6A 2FFDA 3PTZA 5KKZC 1GK4A 1QVFO 2ZXXA 1NTZE 3RGUA 4WY4A 4CPGA 1UIXA 4H0LD 5AVWB 5APXA 3HD7A 4LLHA 3PP5A 3RBXA 1WT6A 3MP7B 1L0LE 1VQNP 1JO5A 3V4WA 2IBZE 3HTKA 1SP4A 1JY3P 2W83C 2OARA 3AE9C 2FYUD 5AVQB 2J58A 3H1ID 1IZNB 3H1HJ 4JPZB 3FGAD 3CCMP 4AQRD 5B5EE 4HKZH 2QRXA 4I2LC 1G1IA 2W27A 3A0HE 5KLIB 4DT0A 2YXRB 3JC22 1VQKP 1YTZT 3IAOA 5BU5A 1JCDA 2HODB 1M1KQ 3VOPA 2P2UA 1IFMA 3RK2C 1CW5A 1NO4A 2JR8A 3WUVA 2XU6A 1JB0J 3CCSP 4EDFA 1VF5B 1NJIQ 4U3FJ 5AVVB 3H1JD 3EQ2A 4KJMA 4IL6E 1FS0E 2WPVB 2FY8A 3KDPB 1SQQJ 5AW3B 2K9YA 2WMMA 3L72E 2QE7H 1IC2A 2NPSB 5KJ7C 1ZW0A 4R4LA 1SQBG 1RF1B 3CPWO 4UB6H 1KFMA 1VQLP 4IOIH 2Y0CA 4KHXA 1RE3C 4H0LC 3L73E 4YTPC 2N1TB 2AXCA 3V4QA 4W7YA 1OZHA 2N9YB 4IFDK 3OAKA 3CXHD 5CBOA 1SQBK 1EQ7A 2ZVNB 3H1LJ 2WPRA 1BCCD 1RQUA 1FDIA 1L2PA 1OVVA 2NPSA 1NTMD 1MFTA 3K5BA 1HBWA 4LC1A 3CWBG 3GW6A 4W80A 1YJWP 2FYUK 3BCCG 2FYUE 3H1IE 3I5CA 1PPJG 3H1KD 3L71J 3TGUJ 1HJBA 1RF0A 1PGJA 4YXDC 3Q5RA 5CMZA 1KB9H 3M9HA 3CI9A 2PAJA 3FX0A 4HH2A 2J5UA 1KFNA 3A0BE 2NPSD 2OYHB 3O6QB 4GKGA 3F5HA 2OGUA 3IR9A 2ZVOB 1FZCC 1VQ5P 1W2BO 1YBKA 5AW4B 3Q1MA 4AUWA 3H1JE 3T97B 2IDBA 2KNCB 3CCEP 1L4AA 5AVXB 2B87B 1NU1D 2P7JA 4OGQD 5KTBA 1LTJB 1JTHA 3D71A 4K3AA 1SQXD 4LGDE 1U7JA 3PHLA 2YKQA 3HUSC 2KB7P 1M7LA 1LT1A 2FBWC 3GG2A 1GMJA 3L36A 1G2CB 1YITP 2K9JB 1H88A 1GW4A 1L4AD 4KT0J 2B9BA 1JMMA 2BCCG 4EYYQ 4ZNCA 2OYHA 2E74D 2KZJA 2O3JA 3N4XA 5KKZB 2Q6QA 2RKLA 1GTWA 1GD2E 1K05A 3T97A 1NVOA 5AVTB 5AW9B 3KYQA 1X22A 1KORA 2R5BA 2B87A 1LTJA 1M57D 3CXHE 2KSJA 2G8YA 1QLED 3S1KA 2QG4A 4N6JA 3L74J 1BCCE 5KAIH 1LTAC 1VQ9P 1NTME 1FBMA 5AVYB 1URQC 2A45G 1N8RQ 3P7KA 2LR2A 3L35A 3TNUA 1FZBA 2FYNC 4GOFA 1SVFA 2XKMA 4U3FD 1BDDA 4ASVA 2FXOA 3CX5I 3H1KE 1M56D 3RK2B 2AEMA 2W90A 1DX7A 1N73C 1HF9A 4IFFA 1BE3D 1SQQD 4N3YB 3VMZA 1SLQA 4PJ0E 1PL5A 2O01N 1YI2P 3FXEA 4OGQC 3BVHA 3AECC 2C0WA 1S72P 2KIKA 4JBZA 1SQVG 3CWBJ 3V6IA 3HE5A 5CBNA 2KSEA 4B86A 1T3JA 3RL0D 1NU1K 1KYOD 1X9VA 1NU1E 3LIEA 3H25A 1YHQP 1SQXK 5CCHA 1GL2C 1SQXE 4K35A 1M1JC 1PP9G 3AE1C 1L4AC 1RH5B 3JSVC 2QM8A 5AW7B 2VRSA 5M1BA 2E74C 3AE2C 1EZVG 2P10A 2M3EA 5GTHE 3M0AA 2H8PD 1H89A 2M5AB 3MUDA 2A06D 4H0LB 4QMAA 3H1LD 1LP1B 1FZEA 5CCHD 5CJ4A 3BRVB 2YXQB 1USEA 1VQ7P 2OTKE 4XA4A 1NWQA 1WMKA 1ZR2A 1P84I 2PFXA 1Y47A 4HYTB 5L8RJ 3L71D 3TGUD 3RK2D 3MGNA 5B66E 3WU2H 1MUUA 4RESB 1GW3A 1Z56A 2W6BA 1K8AQ 1SS1A 1NTZG 1KD1Q 3B8EB 3MZWB 3LIDA 1GDTA 4YXWH 2V7QJ 3IN6A 3HTKB 1EXJA 4U3FE 1L0LG 3CD6P 2IBZG 2ZT9C 1LP1A 3A3YB 2Z5IA 2XV5A 1BE3E 1SQQE 2DW3A 1FZCB 2JKVA 3RL0C 4Y28J 1Q81Q 1E5WA 2POHA 2WWWA 1BGYJ 4JYBA 3VP8A 1P84D 3ZDMA 1OW7A 3G9RA 4OVNF 2B89A 1FOSE 5CJ0A 2C9LY 1J1DC 1DEBA 3V2PA 2K37A 1NTZK 2MKVA 1KYOE 1RQVA 4DZOA 3IFMA 4D6TJ 3M91A 1YTZI 3SWYA 2QEXP 3A0BH 2R3CA 3N7NA 1L0LK 4EI2A 4PD4I 1L0ND 4XE5B 1OFCX 3L72G 4ZMDA 4PD4H 5CCHC 1FDOA 1OW8A 3E1IA 3RK3D 4WB4A 1AJYA 1LTSC 5GTIE 1UIIA 3A5TA 1QL2A 1ZR4A 3VMXA 1FZCA 2A06E 1VQ8P 3C1LA 3H1LE 3L74D 1JY2N 2M0BA 1AVOA 3RBZA 5KLVJ 2Y9ZA 2WSFH 1W2EA 1FZAA 3MUDC 3L75J 1YJ9P 1OVUA 5AVUB 3E1RA 1ZP0C 4L74A 3L71E 3L73G 3TGUE 5BVZA 3ABVC 3HUSA 3FXDA 1OMIA 3H32A 2LKMA 2KOGA 2WITA 1X79B 1IJDB 5APUA 1FE6A 1PGPA 3R2PA 1KQSO 1ZMEC 5AW1B 1S5LE 3D6ZA 1N73B 2R5DA 1EC5A 3CXHH 1FZGA 3WMM0 1LWUC 3ITKA 2FYUG 2WPQA 4BXLA 4OGQB 3H1IG 2IYOA 1Q2NA 3L70J 1VPCA 1Y8AA 2IZ1A 1IO4A 3CCRP 1MV8A 1P84E 4NPFX 1U7MA 1GL2B 3A2AA 1URQA 2V7QH 1FDMA 1SQPJ 1M90Q 4L76A 1KILD 1L4AB 3GHGA 3H1JG 1KQLA 4PJ0H 1NTKD 1JTHB 3AEAC 3RK3C 1OXZA 1AFOA 1L0NK 2E74B 1H0TA 3VMAA 1L0NE 4GODA 1N73A 1KB9I 4ASWA 4W7ZA 2KI7B 3G3ZA 1AA0A 3PRJA 2A45I 2HPCA 3RK3E 3SWKA 1TU3F 2YKOA 3HE4B 1URQD 3GF7A 2A45H 1ZV8A 3OW2O 3L74E 2O01H 3O8ZA 2ZYAA 1JMBA 2PGDA 3KPEA 3LW5J 2KUBA 1QL1A 2GUSA 1GL2A 4C7NA 1M1JA 5TISH 2D2CC 1VDFA 4UB8H 3JCUE 2GM4A 2E5TA 2JWDA 2W6AA 3C9IA 2IZ0A 1QEXA 2OQQA 2FXMA 2PRRA 3PLNA 2ZJSE 4XFJA 2IPPA 4WWIA 1PGQA 1BGYD 3L4FA 1KB9D 1BCCG 3CC2P 1VQ4P 1NTMG 1RHZB 2P1JA 3TNUB 1R5LA 1GL2D 3HRNA 1N86A 3HE4A 3RL0B 1EXIA 3AE7C 4Y99C 1JOCA 3BASA 5KAFE 3L73J 2H88C 3MHVA 1EZVI 4D6TD 1FC2C 2RMZA 3H1KG 3QH9A 3R4YA 2E75D 1J1DB 3QWOC 1KILC 1J1EC 3OA7A 1YQ3C 2OYIC 1Q7YQ 3W68A 1LTTC 2K1AA 1SQBJ 4WBAA 3H1HD 1NAFA 3HE5B 1KILE 1LT9C 5AVZB 2Q3IA 1NTKK 2CPBA 4GOEA 5APVA 1NTKE 1NTMK 2FYUJ 3USSA 2KLUA 1NU1G 5KLVD 1N7SD 3GHGC 3B5NA 3AEGC 1SQXG 3L75D 3W67A 1N7LA 1ZXGA 2Q1KA 1DEEG 4C46A 3A7OA 3NFQA 1KZUB 2O1JA 2I8DA 2QJKC 1ZLLA 4I1LA 5AVSB 2IBZI 2W6JH 1JY3N 2IX7C 1R8EA 1IFNA 2ZYDA 2ZT9D 3MIWA 3D70A 5CCGC 3C8VA 3B5ND 3AE6C 2YMYA 3TSIA 1RE4C 1HH0A 3V2NA 5B5EH
chains in the Genus database with same CATH topology
3BCCJ 1KYOI 1KB9I 1L0LJ 1SQPJ 3CXHI 5KLVJ 1L0NJ 3H1JJ 1BE3J 1SQQJ 3H1HJ 1BGYJ 3CX5I 4D6TJ 3H1LJ 3L71J 3TGUJ 1NTZJ 3L74J 1NU1J 1PP9J 1SQVJ 4U3FJ 2FYUJ 3L75J 1P84I 1SQBJ 3H1IJ 3CWBJ 4PD4I 2BCCJ 3H1KJ 3L73J 1NTKJ 1BCCJ 1EZVI 3L72J 2IBZI 3L70J 1SQXJ 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC J;  1KYO I;  1KB9 I;  1L0L J;  1SQP J;  3CXH I;  5KLV J;  1L0N J;  3H1J J;  1BE3 J;  1SQQ J;  3H1H J;  1BGY J;  3CX5 I;  4D6T J;  3H1L J;  3L71 J;  3TGU J;  1NTZ J;  3L74 J;  1NU1 J;  1PP9 J;  1SQV J;  4U3F J;  2FYU J;  3L75 J;  1P84 I;  1SQB J;  3H1I J;  3CWB J;  4PD4 I;  2BCC J;  3H1K J;  3L73 J;  1NTK J;  1BCC J;  1EZV I;  3L72 J;  2IBZ I;  3L70 J;  1SQX J;  1NTM J; 
#chains in the Genus database with same CATH topology
 4EOT A;  3BCC J;  3A0H H;  2V4H A;  3RL0 g;  2YIU C;  2OYO A;  5AVR B;  3CCL P;  2WSF J;  3H1H G;  4MN4 C;  3MTU E;  2KP8 A;  1BGY E;  1AVY A;  1KB9 E;  3GMA A;  1LWU B;  2WTY A;  4ZKP A;  4AYC A;  1MFZ A;  3CX5 D;  2C9N Y;  2E75 C;  3CCV P;  2WSE H;  4IL6 H;  1LJ2 A;  1JEK A;  2Y0E A;  4U3F G;  4PV1 D;  1SQP D;  3LW5 H;  3P32 A;  3S9O A;  2K3R A;  1IFP A;  4D6T E;  2ZYG A;  1OW6 A;  3L37 A;  2HLO A;  1XTC C;  1S9K D;  1BE3 G;  1SQQ G;  3CME P;  3SWF A;  1KMI Z;  2WSC H;  3CL3 D;  4ZKU A;  2WZ7 A;  3U1A A;  1N7S C;  3H1H E;  3RK3 B;  1PZQ A;  1OIP A;  2Q3E A;  3TK1 A;  1T2K C;  2AXT E;  3I56 P;  3Q3D A;  4O9B A;  2HYN A;  5KLV K;  2BCC J;  5KLV E;  1KC8 Q;  1LWU A;  3CCQ P;  4TT3 H;  2E43 A;  1SFC D;  3L75 E;  4H13 C;  1XTG B;  2WT7 B;  2Z5H A;  1EDJ A;  1KQG B;  3VYI A;  4RJT A;  5DJT B;  1S4X A;  4M3L A;  3GLM A;  1SQQ K;  3B5N C;  2C0X A;  1WRG A;  1JM0 A;  2JO1 A;  1N2D C;  2A06 G;  1HGV A;  2D2C B;  1NU1 J;  3H1L G;  3WUT A;  1DD3 A;  2YO2 A;  1A02 F;  3SFD C;  2KK7 A;  3AE4 C;  5DJU B;  3V2R A;  2L91 A;  2O01 J;  3HUS B;  5AW0 B;  3EFF K;  1PGO A;  3H32 B;  3G71 P;  3L71 G;  3TGU G;  1GU4 A;  2Z4E A;  1S5L X;  3L70 E;  1YQ4 C;  3V2Q A;  1YJN P;  3TYY A;  3KZI E;  4PV1 C;  2QJP C;  2I1K A;  3BAT A;  4Y99 B;  3PJS K;  3EWK A;  2FYZ A;  1SQB D;  2FKW B;  1QGK B;  3CX5 E;  2WT7 A;  2BEZ F;  2QSI A;  1VQP P;  3AE5 C;  3JCU H;  2E42 A;  2H43 A;  1SQV J;  1SQP K;  3AED C;  1SQP E;  1KIL B;  1J1E B;  3M0D A;  2AEF A;  1OX3 A;  4R4M A;  2OYI B;  1S3J A;  3D6Y A;  5EFW B;  1AV1 A;  2LXB A;  1S9K E;  2AEJ A;  2H89 C;  1PP9 J;  1CI6 A;  3I55 P;  4WY4 D;  1VQO P;  3CC4 P;  3IF4 A;  1LT9 B;  2GA1 A;  1NOH A;  4OH8 B;  1KN7 A;  4I7Z C;  2XZR A;  1T6A A;  3HD7 D;  3S4R A;  2KS1 B;  4EIJ A;  5KAF H;  1SFC C;  1URQ B;  3Q5S A;  3GHG B;  1G1J A;  2UWJ E;  1IK9 A;  4I6M C;  2FYN B;  1FU1 A;  4PD4 D;  1JCC A;  1JY2 O;  1NYH A;  1QVG O;  2BEQ D;  2D2C D;  4GT1 A;  1H0T B;  5K5G B;  1EDL A;  3CXH I;  1E79 H;  1AQ5 A;  1BE3 J;  1T3U A;  1FJK A;  3CWB D;  1L0N G;  2QJK B;  5H2F E;  1Q82 Q;  2HPC B;  3BCC D;  1KIL A;  4H44 D;  1BSH A;  1PPJ D;  3KHU A;  2OYI A;  1HWT C;  4HJG H;  1KTM A;  2E76 D;  2WPS A;  3PH0 A;  1RY3 A;  4HB1 A;  2YKP A;  1ZN5 A;  5AW8 B;  5E79 E;  1HVV A;  3SFE C;  1NTZ J;  2OTJ P;  1MZ9 A;  1YYC A;  3F89 A;  1CZQ A;  1LT9 A;  5TJH A;  2QIW A;  3L74 G;  3WU2 E;  2YIU B;  2P58 A;  2HOD A;  1VQM P;  2MJZ A;  4YPC A;  2KS1 A;  2YNY A;  1GU5 A;  2Q5U A;  2FXP A;  3U59 A;  4L75 A;  2H7H A;  1L0L J;  4C7N B;  1M1J B;  4A7P A;  5APT A;  4BWN A;  3P8C E;  2BAS A;  4IFM A;  1KQF B;  2CK3 H;  2E75 B;  2N9B A;  3CCJ P;  2JP3 A;  2QJY C;  1SQB E;  1FAV A;  2FFD C;  4JQ0 D;  1BDC A;  2JWA A;  2IFN A;  2ZAE B;  1NKN A;  2KZI A;  4WY4 C;  1RF1 A;  4OWF A;  1VF5 D;  5CCG A;  1RE4 A;  3KXD A;  3HD7 C;  3SSU A;  1Q90 D;  3BRT B;  2BCC D;  2WSE J;  1N7S B;  2E5Y A;  3TF5 A;  5BU8 B;  1IFJ A;  3M0D C;  1EDI A;  2R32 A;  1LTG C;  2R3S A;  4N78 D;  1U57 A;  3L72 J;  5GTH H;  3NTN A;  2G3A A;  1FOS F;  2N1T A;  3G6E P;  3AEF C;  4C7R A;  3M9Q A;  1PIX A;  1X8Y A;  1MKM A;  5AW2 B;  3CCU P;  5CCG D;  2WSC J;  1HTL C;  4RO0 A;  1S1C X;  4RKU J;  4PD4 E;  1VL2 A;  2RN0 A;  4H44 C;  4H13 B;  1VQ6 P;  3AEE C;  2M8R A;  1NTK G;  2E76 C;  3AE8 C;  1Y9B A;  2ZT9 B;  2O1K A;  2WQY C;  4Z1M H;  1USD A;  3B5N B;  3NMD A;  3CLQ A;  2RH0 A;  3CWB E;  1LNQ A;  4DJG A;  1LTI C;  5B66 H;  1IFD A;  4BRY B;  3BCC E;  2AXT H;  1PPJ E;  1JY2 P;  4GDO A;  2HG5 D;  2N1T D;  2XDJ A;  1IK7 A;  1N7S A;  3Q2Y A;  1NHL A;  1ZRT D;  1GZL A;  3AE3 C;  5APW A;  1YIJ P;  3KQG A;  1S2E A;  2QVA A;  3NXS A;  1LTB C;  3O6Q A;  2XND H;  3M9B A;  2YMK A;  1SQV D;  1DIP A;  3M06 A;  5KLI C;  1JNM A;  1L0N J;  4PV1 B;  2QJP B;  1DD4 A;  3FWL A;  2Y0D A;  3G4S P;  3H1I J;  4U7J A;  2KNC A;  2P67 A;  4UB6 E;  3WUU A;  1T2K D;  1VF5 C;  1PP9 D;  1KYO I;  1FJP A;  2KXP B;  1OVR A;  3VN0 A;  1GK6 A;  1BGY G;  3VP9 A;  4BRY A;  1PFI A;  1KYO H;  1X0T A;  1Q86 Q;  2M3B A;  1EZV D;  3EFG A;  1IFI A;  1K9M Q;  1G2C A;  3U1C A;  2Y9Y A;  3H1J J;  3KZI H;  2NPS C;  1LGH B;  4H13 D;  1K73 Q;  2K9J A;  2JEE A;  2BCC E;  4I7Z B;  2L5G B;  4D6T G;  1M8O B;  1NAY A;  1RF1 C;  1T8Z A;  5APY A;  1HUC A;  3CX5 H;  4DOJ A;  1SFC B;  4N78 E;  5GTI H;  1J2J B;  1RF0 C;  2J59 M;  1QX8 A;  2YO3 A;  1JUN A;  4JYC A;  3L70 D;  3CMA P;  1D7M A;  5AW6 B;  1HJ0 A;  1JY3 O;  3MD0 A;  3FWN A;  2KLV A;  3E7K A;  1NTZ D;  2N1T C;  3VTP C;  2ZXE B;  1PV3 A;  3H6P A;  5C39 A;  2IYP A;  5KLV G;  1A02 J;  2B88 A;  1BSN A;  2Q7C A;  1OWA A;  2CPS A;  1L0L D;  3L75 G;  2HR3 A;  5APS A;  4TLF A;  2IBZ D;  2W8Z A;  2ITA A;  2LXC B;  1HGZ A;  1CSB A;  1KV4 A;  5TIS E;  1S5L H;  2K88 A;  3Q5P A;  1ZRT E;  4UB8 E;  1SFC A;  3CC7 P;  4DCK A;  2ZFC A;  1NTK J;  5H2F H;  1BCC J;  3AEB C;  4L73 A;  1NTM J;  1SQV K;  4NPD A;  1SQV E;  2QM7 A;  3GF3 A;  4GIF A;  2NRG A;  1DH3 A;  2NZ2 A;  2QJY B;  2Q9I A;  5E79 H;  2OYH C;  1H8A A;  3H1K J;  2FFD B;  2IFM A;  1NKZ B;  1P84 H;  5KJ7 A;  2R44 A;  5CHX A;  3P8M C;  1PP9 E;  3L70 G;  1ZOY C;  4WY4 B;  2KYV A;  3L72 D;  2WSS H;  3B4S A;  1K04 A;  3HD7 B;  1NH4 A;  3V5B A;  1LTJ C;  5AW5 B;  1EZV E;  2OTL P;  1NGM B;  2JJL A;  1AQT A;  1SQP G;  2M5A A;  2GUV A;  3B71 A;  5KJ7 D;  1RE3 A;  2WVR A;  3VMY A;  1FZF A;  2QA4 P;  2PP6 A;  2XNX A;  1CI6 B;  4JF7 A;  5APQ A;  1SQX J;  2JDI H;  4NPE A;  1EDK A;  4WVZ A;  5KAI E;  3TDK A;  2HFE D;  3UIA A;  2I1J A;  4H44 B;  3OJA B;  3P8C D;  1R5S A;  3L73 D;  4IL6 X;  1W5C E;  2E76 B;  2SPZ A;  3II6 A;  2FFD A;  3PTZ A;  5KKZ C;  1GK4 A;  1QVF O;  2ZXX A;  1NTZ E;  3RGU A;  4WY4 A;  4CPG A;  1UIX A;  4H0L D;  5AVW B;  5APX A;  3HD7 A;  4LLH A;  3PP5 A;  3RBX A;  1WT6 A;  3MP7 B;  1L0L E;  1VQN P;  1JO5 A;  3V4W A;  2IBZ E;  3HTK A;  1SP4 A;  1JY3 P;  2W83 C;  2OAR A;  3AE9 C;  2FYU D;  5AVQ B;  2J58 A;  3H1I D;  1IZN B;  3H1H J;  4JPZ B;  3FGA D;  3CCM P;  4AQR D;  5B5E E;  4HKZ H;  2QRX A;  4I2L C;  1G1I A;  2W27 A;  3A0H E;  5KLI B;  4DT0 A;  2YXR B;  3JC2 2;  1VQK P;  1YTZ T;  3IAO A;  5BU5 A;  1JCD A;  2HOD B;  1M1K Q;  3VOP A;  2P2U A;  1IFM A;  3RK2 C;  1CW5 A;  1NO4 A;  2JR8 A;  3WUV A;  2XU6 A;  1JB0 J;  3CCS P;  4EDF A;  1VF5 B;  1NJI Q;  4U3F J;  5AVV B;  3H1J D;  3EQ2 A;  4KJM A;  4IL6 E;  1FS0 E;  2WPV B;  2FY8 A;  3KDP B;  1SQQ J;  5AW3 B;  2K9Y A;  2WMM A;  3L72 E;  2QE7 H;  1IC2 A;  2NPS B;  5KJ7 C;  1ZW0 A;  4R4L A;  1SQB G;  1RF1 B;  3CPW O;  4UB6 H;  1KFM A;  1VQL P;  4IOI H;  2Y0C A;  4KHX A;  1RE3 C;  4H0L C;  3L73 E;  4YTP C;  2N1T B;  2AXC A;  3V4Q A;  4W7Y A;  1OZH A;  2N9Y B;  4IFD K;  3OAK A;  3CXH D;  5CBO A;  1SQB K;  1EQ7 A;  2ZVN B;  3H1L J;  2WPR A;  1BCC D;  1RQU A;  1FDI A;  1L2P A;  1OVV A;  2NPS A;  1NTM D;  1MFT A;  3K5B A;  1HBW A;  4LC1 A;  3CWB G;  3GW6 A;  4W80 A;  1YJW P;  2FYU K;  3BCC G;  2FYU E;  3H1I E;  3I5C A;  1PPJ G;  3H1K D;  3L71 J;  3TGU J;  1HJB A;  1RF0 A;  1PGJ A;  4YXD C;  3Q5R A;  5CMZ A;  1KB9 H;  3M9H A;  3CI9 A;  2PAJ A;  3FX0 A;  4HH2 A;  2J5U A;  1KFN A;  3A0B E;  2NPS D;  2OYH B;  3O6Q B;  4GKG A;  3F5H A;  2OGU A;  3IR9 A;  2ZVO B;  1FZC C;  1VQ5 P;  1W2B O;  1YBK A;  5AW4 B;  3Q1M A;  4AUW A;  3H1J E;  3T97 B;  2IDB A;  2KNC B;  3CCE P;  1L4A A;  5AVX B;  2B87 B;  1NU1 D;  2P7J A;  4OGQ D;  5KTB A;  1LTJ B;  1JTH A;  3D71 A;  4K3A A;  1SQX D;  4LGD E;  1U7J A;  3PHL A;  2YKQ A;  3HUS C;  2KB7 P;  1M7L A;  1LT1 A;  2FBW C;  3GG2 A;  1GMJ A;  3L36 A;  1G2C B;  1YIT P;  2K9J B;  1H88 A;  1GW4 A;  1L4A D;  4KT0 J;  2B9B A;  1JMM A;  2BCC G;  4EYY Q;  4ZNC A;  2OYH A;  2E74 D;  2KZJ A;  2O3J A;  3N4X A;  5KKZ B;  2Q6Q A;  2RKL A;  1GTW A;  1GD2 E;  1K05 A;  3T97 A;  1NVO A;  5AVT B;  5AW9 B;  3KYQ A;  1X22 A;  1KOR A;  2R5B A;  2B87 A;  1LTJ A;  1M57 D;  3CXH E;  2KSJ A;  2G8Y A;  1QLE D;  3S1K A;  2QG4 A;  4N6J A;  3L74 J;  1BCC E;  5KAI H;  1LTA C;  1VQ9 P;  1NTM E;  1FBM A;  5AVY B;  1URQ C;  2A45 G;  1N8R Q;  3P7K A;  2LR2 A;  3L35 A;  3TNU A;  1FZB A;  2FYN C;  4GOF A;  1SVF A;  2XKM A;  4U3F D;  1BDD A;  4ASV A;  2FXO A;  3CX5 I;  3H1K E;  1M56 D;  3RK2 B;  2AEM A;  2W90 A;  1DX7 A;  1N73 C;  1HF9 A;  4IFF A;  1BE3 D;  1SQQ D;  4N3Y B;  3VMZ A;  1SLQ A;  4PJ0 E;  1PL5 A;  2O01 N;  1YI2 P;  3FXE A;  4OGQ C;  3BVH A;  3AEC C;  2C0W A;  1S72 P;  2KIK A;  4JBZ A;  1SQV G;  3CWB J;  3V6I A;  3HE5 A;  5CBN A;  2KSE A;  4B86 A;  1T3J A;  3RL0 D;  1NU1 K;  1KYO D;  1X9V A;  1NU1 E;  3LIE A;  3H25 A;  1YHQ P;  1SQX K;  5CCH A;  1GL2 C;  1SQX E;  4K35 A;  1M1J C;  1PP9 G;  3AE1 C;  1L4A C;  1RH5 B;  3JSV C;  2QM8 A;  5AW7 B;  2VRS A;  5M1B A;  2E74 C;  3AE2 C;  1EZV G;  2P10 A;  2M3E A;  5GTH E;  3M0A A;  2H8P D;  1H89 A;  2M5A B;  3MUD A;  2A06 D;  4H0L B;  4QMA A;  3H1L D;  1LP1 B;  1FZE A;  5CCH D;  5CJ4 A;  3BRV B;  2YXQ B;  1USE A;  1VQ7 P;  2OTK E;  4XA4 A;  1NWQ A;  1WMK A;  1ZR2 A;  1P84 I;  2PFX A;  1Y47 A;  4HYT B;  5L8R J;  3L71 D;  3TGU D;  3RK2 D;  3MGN A;  5B66 E;  3WU2 H;  1MUU A;  4RES B;  1GW3 A;  1Z56 A;  2W6B A;  1K8A Q;  1SS1 A;  1NTZ G;  1KD1 Q;  3B8E B;  3MZW B;  3LID A;  1GDT A;  4YXW H;  2V7Q J;  3IN6 A;  3HTK B;  1EXJ A;  4U3F E;  1L0L G;  3CD6 P;  2IBZ G;  2ZT9 C;  1LP1 A;  3A3Y B;  2Z5I A;  2XV5 A;  1BE3 E;  1SQQ E;  2DW3 A;  1FZC B;  2JKV A;  3RL0 C;  4Y28 J;  1Q81 Q;  1E5W A;  2POH A;  2WWW A;  1BGY J;  4JYB A;  3VP8 A;  1P84 D;  3ZDM A;  1OW7 A;  3G9R A;  4OVN F;  2B89 A;  1FOS E;  5CJ0 A;  2C9L Y;  1J1D C;  1DEB A;  3V2P A;  2K37 A;  1NTZ K;  2MKV A;  1KYO E;  1RQV A;  4DZO A;  3IFM A;  4D6T J;  3M91 A;  1YTZ I;  3SWY A;  2QEX P;  3A0B H;  2R3C A;  3N7N A;  1L0L K;  4EI2 A;  4PD4 I;  1L0N D;  4XE5 B;  1OFC X;  3L72 G;  4ZMD A;  4PD4 H;  5CCH C;  1FDO A;  1OW8 A;  3E1I A;  3RK3 D;  4WB4 A;  1AJY A;  1LTS C;  5GTI E;  1UII A;  3A5T A;  1QL2 A;  1ZR4 A;  3VMX A;  1FZC A;  2A06 E;  1VQ8 P;  3C1L A;  3H1L E;  3L74 D;  1JY2 N;  2M0B A;  1AVO A;  3RBZ A;  5KLV J;  2Y9Z A;  2WSF H;  1W2E A;  1FZA A;  3MUD C;  3L75 J;  1YJ9 P;  1OVU A;  5AVU B;  3E1R A;  1ZP0 C;  4L74 A;  3L71 E;  3L73 G;  3TGU E;  5BVZ A;  3ABV C;  3HUS A;  3FXD A;  1OMI A;  3H32 A;  2LKM A;  2KOG A;  2WIT A;  1X79 B;  1IJD B;  5APU A;  1FE6 A;  1PGP A;  3R2P A;  1KQS O;  1ZME C;  5AW1 B;  1S5L E;  3D6Z A;  1N73 B;  2R5D A;  1EC5 A;  3CXH H;  1FZG A;  3WMM 0;  1LWU C;  3ITK A;  2FYU G;  2WPQ A;  4BXL A;  4OGQ B;  3H1I G;  2IYO A;  1Q2N A;  3L70 J;  1VPC A;  1Y8A A;  2IZ1 A;  1IO4 A;  3CCR P;  1MV8 A;  1P84 E;  4NPF X;  1U7M A;  1GL2 B;  3A2A A;  1URQ A;  2V7Q H;  1FDM A;  1SQP J;  1M90 Q;  4L76 A;  1KIL D;  1L4A B;  3GHG A;  3H1J G;  1KQL A;  4PJ0 H;  1NTK D;  1JTH B;  3AEA C;  3RK3 C;  1OXZ A;  1AFO A;  1L0N K;  2E74 B;  1H0T A;  3VMA A;  1L0N E;  4GOD A;  1N73 A;  1KB9 I;  4ASW A;  4W7Z A;  2KI7 B;  3G3Z A;  1AA0 A;  3PRJ A;  2A45 I;  2HPC A;  3RK3 E;  3SWK A;  1TU3 F;  2YKO A;  3HE4 B;  1URQ D;  3GF7 A;  2A45 H;  1ZV8 A;  3OW2 O;  3L74 E;  2O01 H;  3O8Z A;  2ZYA A;  1JMB A;  2PGD A;  3KPE A;  3LW5 J;  2KUB A;  1QL1 A;  2GUS A;  1GL2 A;  4C7N A;  1M1J A;  5TIS H;  2D2C C;  1VDF A;  4UB8 H;  3JCU E;  2GM4 A;  2E5T A;  2JWD A;  2W6A A;  3C9I A;  2IZ0 A;  1QEX A;  2OQQ A;  2FXM A;  2PRR A;  3PLN A;  2ZJS E;  4XFJ A;  2IPP A;  4WWI A;  1PGQ A;  1BGY D;  3L4F A;  1KB9 D;  1BCC G;  3CC2 P;  1VQ4 P;  1NTM G;  1RHZ B;  2P1J A;  3TNU B;  1R5L A;  1GL2 D;  3HRN A;  1N86 A;  3HE4 A;  3RL0 B;  1EXI A;  3AE7 C;  4Y99 C;  1JOC A;  3BAS A;  5KAF E;  3L73 J;  2H88 C;  3MHV A;  1EZV I;  4D6T D;  1FC2 C;  2RMZ A;  3H1K G;  3QH9 A;  3R4Y A;  2E75 D;  1J1D B;  3QWO C;  1KIL C;  1J1E C;  3OA7 A;  1YQ3 C;  2OYI C;  1Q7Y Q;  3W68 A;  1LTT C;  2K1A A;  1SQB J;  4WBA A;  3H1H D;  1NAF A;  3HE5 B;  1KIL E;  1LT9 C;  5AVZ B;  2Q3I A;  1NTK K;  2CPB A;  4GOE A;  5APV A;  1NTK E;  1NTM K;  2FYU J;  3USS A;  2KLU A;  1NU1 G;  5KLV D;  1N7S D;  3GHG C;  3B5N A;  3AEG C;  1SQX G;  3L75 D;  3W67 A;  1N7L A;  1ZXG A;  2Q1K A;  1DEE G;  4C46 A;  3A7O A;  3NFQ A;  1KZU B;  2O1J A;  2I8D A;  2QJK C;  1ZLL A;  4I1L A;  5AVS B;  2IBZ I;  2W6J H;  1JY3 N;  2IX7 C;  1R8E A;  1IFN A;  2ZYD A;  2ZT9 D;  3MIW A;  3D70 A;  5CCG C;  3C8V A;  3B5N D;  3AE6 C;  2YMY A;  3TSI A;  1RE4 C;  1HH0 A;  3V2N A;  5B5E H; 
#chains in the Genus database with same CATH homology
 3BCC J;  1KYO I;  1KB9 I;  1L0L J;  1SQP J;  3CXH I;  5KLV J;  1L0N J;  3H1J J;  1BE3 J;  1SQQ J;  3H1H J;  1BGY J;  3CX5 I;  4D6T J;  3H1L J;  3L71 J;  3TGU J;  1NTZ J;  3L74 J;  1NU1 J;  1PP9 J;  1SQV J;  4U3F J;  2FYU J;  3L75 J;  1P84 I;  1SQB J;  3H1I J;  3CWB J;  4PD4 I;  2BCC J;  3H1K J;  3L73 J;  1NTK J;  1BCC J;  1EZV I;  3L72 J;  2IBZ I;  3L70 J;  1SQX J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...