3L75J

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l75J00
3CWBJ 1KYOI 1L0NJ 3BCCJ 3L70J 2IBZI 4U3FJ 1SQBJ 1BGYJ 1NTKJ 3L74J 1SQQJ 3H1KJ 3L73J 3H1HJ 1P84I 1EZVI 3CX5I 3H1IJ 3L72J 3L71J 4D6TJ 1NTMJ 2FYUJ 4PD4I 1SQVJ 1L0LJ 1SQXJ 3L75J 3CXHI 1BE3J 1NU1J 2BCCJ 1BCCJ 1SQPJ 3H1LJ 1PP9J 1KB9I 3H1JJ 1NTZJ 5KLVJ 3TGUJ
chains in the Genus database with same CATH superfamily
1N7SD 1ZXGA 5KTBA 3CMAP 2A06D 4GOFA 2Q7CA 1PZQA 1OMIA 4KHXA 3KZIE 1LTGC 2O1JA 1LTAC 2E76D 1LTTC 3AE4C 2HODA 3H25A 1VQ4P 2KZJA 3FXEA 5AW0B 3RK3C 3F5HA 2FKWB 4H44B 2QEXP 1AJYA 2R5BA 5B66H 3ITKA 3CWBD 2FYUJ 2UWJE 1S2EA 2QG4A 2V4HA 1PFIA 3JCUH 1SQQK 2D2CB 2K88A 3B71A 2WTYA 3B8EB 2QIWA 5K5GB 2HODB 1YJWP 1T3JA 4BRYA 4HH2A 3Q1MA 3CCVP 4K3AA 4H0LB 1PP9G 4IFFA 1KILD 1T8ZA 3GW6A 1Y9BA 1YTZI 1U7JA 2PFXA 4U3FJ 4WWIA 1GMJA 3E1RA 1H88A 2IBZD 2BASA 5CJ0A 1T2KC 3H1JG 3HUSA 1RE3A 1ZW0A 2QM8A 1FC2C 1URQB 3Q5SA 1LJ2A 3RL0C 3L4FA 1EXIA 1JY2N 1Y8AA 2WPQA 3V4QA 2DW3A 3H32A 5AW7B 1QVFO 2FYNC 3VMZA 1EZVE 3PTZA 2M0BA 1ZP0C 4O9BA 2P2UA 1ZR4A 2KNCB 2PRRA 1LT9C 1SP4A 5EFWB 3H1LE 1VQPP 2HPCA 1N7SA 2OTKE 1KTMA 4DOJA 1LTBC 4Z1MH 2M5AB 5KLVG 2HFED 3H32B 3Q5RA 2OTJP 2QJYB 2IFNA 3V6IA 2ZAEB 1YI2P 3VMXA 3M0AA 4C7NB 3VMYA 3A5TA 3L72G 1N7SB 3VP9A 5KLVE 1JY3P 3UIAA 5KKZB 4XFJA 2JEEA 5AVUB 2E76B 4GIFA 1PGJA 3AEFC 1IJDB 3AEEC 2YKPA 4AYCA 3HRNA 2CPSA 3KXDA 5M1BA 1VQLP 4ASVA 2IPPA 3A0HH 3E1IA 4N78E 1VDFA 1MUUA 4H44C 1KILA 4JQ0D 4UB8E 1SQQJ 2PP6A 1FZGA 2YO3A 2FXMA 3L71G 2FYUG 1G1IA 2D2CC 2FBWC 2QM7A 2KOGA 1YYCA 4C7RA 2LR2A 2JWDA 2E43A 2KYVA 4PV1D 3CXHH 2P1JA 4TT3H 1G1JA 3H1IJ 4H0LC 3HD7D 2AXTH 1JUNA 1L4AD 2KLVA 1OX3A 3E7KA 1EZVD 4N6JA 3RGUA 3G4SP 4AQRD 1CI6B 1HTLC 4U3FG 4WVZA 1M7LA 3BRTB 1VQNP 1SQVE 1J1EB 3R2PA 2B87A 2YMYA 3H1LD 2HLOA 5TISH 5TJHA 1FBMA 4IL6H 1S4XA 3FX0A 4U3FE 2L5GB 1S3JA 1URQC 1GK6A 2WPSA 4UB6H 1RE4A 1N73A 3RL0g 4PD4H 4A7PA 2WVRA 2E42A 4RKUJ 2B87B 4M3LA 1DD4A 2ZXXA 5KLVD 2XNDH 1DD3A 1KQGB 2P10A 1P84E 2I1KA 2Z5HA 3CPWO 1SFCD 2JDIH 4D6TE 2HR3A 5AVYB 3CCQP 5H2FE 1LTJA 1NKZB 1SQPE 2Q3EA 1KYOE 2LXCB 4AUWA 2WWWA 1GU5A 2QJYC 2Z4EA 1KQLA 4N78D 3HE4A 1BDDA 1NYHA 1FS0E 2C9NY 3V5BA 1N7SC 3GF7A 1GK4A 1GDTA 5KKZC 5KLVK 1LTJB 1IFNA 1M1KQ 2H89C 2E74B 2WZ7A 1M90Q 2R5DA 3BVHA 4EOTA 4GODA 4W80A 2E76C 2OYOA 2IBZI 3HE4B 3C9IA 2CPBA 3FXDA 3HTKA 4PJ0E 1OXZA 2A45I 2OYIB 3M9QA 3PH0A 1VQ5P 1NAFA 1VF5D 4C46A 3HD7A 2ZFCA 1L4AA 1H8AA 1XTCC 1QGKB 1SQVD 1SQQG 3SSUA 3HE5A 3HTKB 5AW3B 1SQXE 1YQ3C 2P7JA 3M91A 3CD6P 2VRSA 3RK2D 4WY4D 4PV1B 1QVGO 1BE3J 1YTZT 2A06G 1BGYE 1WT6A 1L4AB 1PGPA 3CX5H 1H0TA 3SWFA 2B88A 2OTLP 3H1IG 2N1TB 5B66E 1HGVA 4JBZA 3JCUE 1S5LH 1P84D 4I2LC 5APUA 1ZR2A 3Q5PA 3O6QB 4D6TD 1J1EC 2QSIA 1SQVK 1H0TB 3H1IE 3RBXA 1SQPD 1SFCA 1KYOD 1GU4A 2KLUA 3EWKA 4DZOA 1KV4A 3H1HE 2OYHB 1W2EA 2N9BA 1IK7A 3AE7C 1RF0C 5L8RJ 2GUSA 3B5ND 2XKMA 1SFCB 1NTMJ 2YIUB 1NO4A 1OIPA 1HH0A 4GT1A 3AECC 3H1LJ 4KT0J 2IYOA 3OW2O 3W68A 2IBZG 1PL5A 1RE4C 1YJNP 2NZ2A 2XDJA 2FXOA 2A45G 3PLNA 1SQPK 2Y0EA 1K04A 5GTHH 2W27A 1J2JB 3B4SA 2O01H 3L74E 5CCHC 4KJMA 1SQXD 1LTJC 1EZVI 2E74C 1USDA 3O8ZA 1OW8A 5CJ4A 4YXDC 1BGYD 4NPEA 5AVRB 2W6JH 4EYYQ 1JY2P 2PGDA 1HBWA 3TGUJ 4WY4A 5CBOA 1OW6A 1VF5B 2OYIC 3NTNA 2XV5A 5APYA 3AE6C 1LT1A 5AW5B 3TDKA 4HKZH 3RK2B 4WY4B 3H1ID 4L74A 1SQXK 3AE3C 2LXBA 3CMEP 1CZQA 4PV1C 4JYBA 2ZYGA 1N8RQ 2QJPB 1YHQP 1BE3G 3A0HE 3TF5A 1Q7YQ 3H1HD 1RQVA 3W67A 2R3SA 1JB0J 2Q1KA 1FZEA 5KAFH 1HJ0A 2IFMA 2N1TC 1VQMP 2J5UA 1PPJE 1EQ7A 2QVAA 2G3AA 3LW5H 2KK7A 1BE3E 2BCCE 1SQVJ 4IOIH 2ZVOB 2K9JA 1N2DC 3B5NA 3IFMA 1IFMA 1BCCJ 2JKVA 2YXRB 3IN6A 3AE9C 1OVVA 2WSCH 3S9OA 3M9BA 2ITAA 1L0LE 3CXHE 1KZUB 2POHA 1Q82Q 2AXTE 1R8EA 4H13C 1NTZE 2KIKA 4BRYB 1R5LA 3Q3DA 2K9JB 3B5NB 1AQ5A 2OYHC 3L74D 1K9MQ 3TYYA 1RY3A 3NFQA 1EZVG 1HUCA 1SFCC 2YIUC 5TISE 1RF1A 4IL6E 1NTMG 4D6TJ 2R44A 1KFNA 1UIXA 2WQYC 1EXJA 3H1LG 1SQPJ 1X22A 3II6A 3HUSB 4UB6E 1A02F 4EDFA 2WSEH 4PD4E 1NTME 3G6EP 4RO0A 1RF1B 2B9BA 3BCCE 3SFEC 2XZRA 4I1LA 1RH5B 3M0DA 1IFIA 1M8OB 1FJPA 3KQGA 2W90A 1DEBA 2LKMA 1P84I 3C1LA 1MV8A 1L0NE 2HPCB 3L70E 4K35A 1MFTA 1N86A 3TGUG 1GZLA 1KYOI 1VF5C 5AVTB 4B86A 2W6AA 1PPJD 1KD1Q 3OAKA 3U1CA 1KC8Q 1HGZA 1PGOA 1BE3D 2BCCD 2J59M 1WRGA 1GW3A 3D6YA 3TGUE 1SQXJ 3GF3A 3RK2C 4WY4C 3VOPA 1FZAA 1BGYJ 1L0LD 3CXHD 1EDJA 2QJPC 3BATA 2KZIA 3GMAA 2NRGA 1NTZD 1VQOP 1KB9H 3SFDC 3MIWA 3MHVA 3A7OA 5AW2B 1FDIA 1JTHA 3P7KA 1KFMA 1Q86Q 2K9YA 4ASWA 1X0TA 2M3BA 1KILB 4CPGA 3G9RA 3CL3D 4OGQD 1SQVG 4IL6X 3G71P 1BCCG 4L73A 1SQBE 3D6ZA 3IAOA 1JTHB 4RESB 4PD4D 1DX7A 1L0LK 1NTMD 4N3YB 3H1HJ 1LWUA 1FAVA 1NKNA 1PIXA 1NTZK 5AVQB 4YXWH 1BCCE 3BCCD 2YKQA 1JOCA 1S5LE 5BU8B 1Q2NA 5CCGD 1USEA 1LP1A 3CCUP 3TSIA 5AVXB 1JM0A 3VN0A 1NH4A 4GDOA 3G3ZA 1JCDA 1LWUB 3M06A 4D6TG 2E5YA 1L0ND 3L70D 1JY3O 5AVSB 1SQPG 3HUSC 1RE3C 3CCSP 4NPDA 1GTWA 3OA7A 1NTMK 2QJKB 3L74J 1LGHB 1PGQA 3EFGA 1JY3N 1N73B 2Y9YA 3CC7P 2K1AA 1IC2A 1T2KD 5KLIB 3TGUD 5GTIH 1VQ8P 1ZRTE 2V7QH 2YKOA 1VL2A 1NVOA 3AEDC 1EDIA 3PJSK 1N7LA 1S72P 1NWQA 1L0NK 5GTHE 2WT7A 2Q5UA 3GHGA 2AEMA 1VQ9P 1CSBA 3M0DC 2KB7P 3C8VA 5KJ7D 1FE6A 2H88C 3MGNA 1IFPA 1LTSC 3WUVA 2WSFH 1HWTC 4NPFX 1R5SA 1SQXG 3GHGB 3Q2YA 1SQBD 1IK9A 1J1DB 3CX5D 2K3RA 1BDCA 4OVNF 1BGYG 5CMZA 1IZNB 1W2BO 1BCCD 1NAYA 4OWFA 1E5WA 3SWYA 3IR9A 1ZN5A 1S5LX 2BCCJ 3FWNA 4OGQB 3HD7B 5CCGA 1KILC 3HE5B 2P67A 3V2PA 1SQBK 1L0LJ 3MZWB 5CHXA 3MTUE 1BSNA 4I7ZB 5KAFE 1NTZJ 1U57A 2CK3H 2QA4P 3PHLA 1SS1A 5AW8B 4WB4A 4YPCA 3H1HG 1LNQA 2IZ0A 2JJLA 1ZRTD 3R4YA 4YTPC 1T6AA 4Y28J 1GW4A 1NOHA 4TLFA 2QE7H 2WPRA 3PRJA 4L75A 1LWUC 1QX8A 4GKGA 1NU1E 5AVWB 2KUBA 1GL2D 3CXHI 2O1KA 3CC4P 1Q81Q 2OQQA 4U7JA 3BCCJ 1YQ4C 2QJKC 2JP3A 2W83C 1ZOYC 1AQTA 1N73C 3H6PA 3MD0A 5KJ7A 3L74G 3I5CA 5KLIC 3WMM0 3CCMP 1LT9A 4DJGA 2M3EA 4HB1A 3F89A 1URQD 5B5EH 1A02J 1L0NJ 3L70J 2IDBA 1JNMA 2C0WA 3MP7B 1VQ6P 1AFOA 3VP8A 4OH8B 2W8ZA 3M9HA 2R32A 2WITA 3T97A 1JCCA 4PD4I 1VQ7P 1HF9A 1NTKE 2YMKA 2FYZA 1K8AQ 2AXCA 3KPEA 1AV1A 2OGUA 1JO5A 1JMBA 3GHGC 3L37A 3D71A 1MFZA 1J1DC 2MJZA 2HYNA 1DH3A 3AE1C 4GOEA 3H1KE 1W5CE 3L75D 5BVZA 2KS1A 1NJIQ 5AVZB 5AVVB 2KSJA 5CBNA 1PPJG 2ZVNB 3BRVB 1YBKA 1ZLLA 4OGQC 2BCCG 3HD7C 1L4AC 1RHZB 2Q9IA 1Q90D 4DCKA 4EI2A 3K5BA 1IO4A 3EFFK 3PP5A 2JWAA 1SQBJ 5E79H 5APTA 1NU1D 1TU3F 2Y0CA 4Y99B 2NPSD 1JMMA 2KS1B 1KB9E 3L71J 1H89A 1L0LG 4I7ZC 3N4XA 3AEAC 4JYCA 3A0BH 1NTZG 5CCGC 1S1CX 2BEQD 4R4MA 1GL2A 1EDLA 2ZJSE 1X9VA 5KAIH 2RN0A 1U7MA 2G8YA 2ZT9D 2Q3IA 2RKLA 3JC22 2Y0DA 3AEGC 2Z5IA 5APSA 1ZMEC 5BU5A 1QL2A 2YO2A 1GL2B 1URQA 1WMKA 4ZMDA 1UIIA 1NU1K 2N9YB 3CX5I 2L91A 2YXQB 5APVA 1PP9E 1K05A 1JEKA 2Q6QA 2FFDA 2R3CA 3AE2C 4EIJA 1JY2O 1NTKD 3BCCG 2RH0A 3VMAA 2O3JA 4DT0A 1FDMA 2KNCA 2FXPA 3WU2H 3RK3E 3N7NA 3USSA 1YJ9P 1G2CA 3SWKA 3VYIA 3H1JE 4ZKUA 2XNXA 2M5AA 2FFDB 3KHUA 1ZV8A 3H1KD 1IFDA 1L0NG 3AEBC 3L70G 2A45H 5KJ7C 2JO1A 3WUUA 1FZCA 2O01J 1MKMA 4C7NA 3L73J 1OVUA 2E5TA 1G2CB 5GTIE 1NTKK 3ZDMA 2IZ1A 5AW4B 1KQFB 3AE5C 3VTPC 1FZCB 2GA1A 1KB9D 3FGAD 2H7HA 1PV3A 2E75D 3S4RA 2WSSH 3KZIH 3CCEP 2NPSA 5CCHD 2QRXA 2I8DA 3L72E 2O01N 2E74D 1XTGB 1RQUA 5APQA 3KDPB 3A3YB 3QWOC 2KXPB 2NPSB 1OW7A 4JPZB 1L2PA 2RMZA 5AW6B 3U59A 1SQBG 2YNYA 4Y99C 1EDKA 1YIJP 1FZFA 1KMIZ 3WUTA 1PP9D 1T3UA 3TK1A 1S9KE 3LW5J 3L75J 2H43A 2HG5D 4XE5B 1CI6A 2Y9ZA 3CX5E 1E79H 1AVYA 3L36A 4LGDE 3RK3D 2ZT9B 3L71E 2FYUE 1NGMB 2WSCJ 1KORA 3H1JD 1CW5A 3B5NC 1X8YA 4ZKPA 1NU1J 1GL2C 2N1TD 3CWBJ 1HJBA 1OZHA 1QLED 2C0XA 1RF0A 3NXSA 3P8CE 2ZYAA 1OVRA 5DJTB 4HYTB 3MUDA 1SLQA 1LP1B 2KSEA 4ZNCA 1RF1C 4H13D 3I55P 2BEZF 2WSEJ 3CCJP 2FFDC 3KYQA 3V2NA 1D7MA 1VQKP 2H8PD 2K37A 1VPCA 3L72D 5CCHA 2OARA 3L73G 1NTKJ 3RL0D 1KN7A 2GUVA 3CCRP 3ABVC 1M1JA 3GG2A 4I6MC 3BASA 5B5EE 2KP8A 3FWLA 1EC5A 1OFCX 1QL1A 4MN4C 1FZCC 3L73E 2E75B 5DJUB 3LIDA 2WMMA 2OYIA 3H1KJ 1BSHA 4RJTA 4IFDK 1S9KD 2M8RA 1Z56A 1M1JB 2WT7B 2FY8A 1SVFA 2WPVB 3L71D 2FYUD 1OWAA 3L35A 2IX7C 4UB8H 2AEJA 2KI7B 4WBAA 3CLQA 4BWNA 2NPSC 3EQ2A 1FZBA 2P58A 1AVOA 1FU1A 3P32A 5C39A 1FOSF 1FDOA 3RBZA 1DIPA 2N1TA 3V2QA 3I56P 2W6BA 3RK3B 1M56D 3P8CD 3L75G 4U3FD 1KQSO 1Y47A 3TNUA 1AA0A 2ZT9C 3O6QA 1SQQE 1GD2E 4H44D 4LC1A 5E79E 2FYUK 3AE8C 3LIEA 1LTIC 3NMDA 3L75E 3V2RA 2D2CD 1FOSE 2A06E 2MKVA 2ZYDA 3A2AA 3GLMA 1NU1G 3A0BE 2J58A 1HVVA 1PP9J 2OYHA 1KB9I 3CWBG 5AW9B 4XA4A 3TNUB 3CCLP 1X79B 3D70A 5KAIE 2XU6A 4H0LD 4HJGH 3U1AA 3V4WA 2C9LY 3CWBE 4H13B 2IYPA 3L73D 3H1JJ 1P84H 2SPZA 2ZXEB 5H2FH 4IFMA 3S1KA 4LLHA 4W7ZA 1DEEG 1KYOH 3RL0B 4R4LA 3QH9A 3MUDC 3CC2P 1KILE 3P8MC 2V7QJ 2PAJA 3WU2E 5APXA 2FYNB 4JF7A 2AEFA 3CI9A 1NTKG 1IFJA 3OJAB 1M57D 2I1JA 1LT9B 3JSVC 2IBZE 2E75C 2JR8A 1NHLA 5AW1B 5KLVJ 1MZ9A 3H1KG 2GM4A 4W7YA 1QEXA 4PJ0H 2B89A 1K73Q 4BXLA 1M1JC 3IF4A 3L72J 1FJKA 5APWA 3T97B 2WSFJ 4L76A 4QMAA 1YITP 1SQQD
chains in the Genus database with same CATH topology
3CWBJ 1KYOI 1L0NJ 3BCCJ 3L70J 2IBZI 4U3FJ 1SQBJ 1BGYJ 1NTKJ 3L74J 1SQQJ 3H1KJ 3L73J 3H1HJ 1P84I 1EZVI 3CX5I 3H1IJ 3L72J 3L71J 4D6TJ 1NTMJ 2FYUJ 4PD4I 1SQVJ 1L0LJ 1SQXJ 3L75J 3CXHI 1BE3J 1NU1J 2BCCJ 1BCCJ 1SQPJ 3H1LJ 1PP9J 1KB9I 3H1JJ 1NTZJ 5KLVJ 3TGUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  1KYO I;  1L0N J;  3BCC J;  3L70 J;  2IBZ I;  4U3F J;  1SQB J;  1BGY J;  1NTK J;  3L74 J;  1SQQ J;  3H1K J;  3L73 J;  3H1H J;  1P84 I;  1EZV I;  3CX5 I;  3H1I J;  3L72 J;  3L71 J;  4D6T J;  1NTM J;  2FYU J;  4PD4 I;  1SQV J;  1L0L J;  1SQX J;  3L75 J;  3CXH I;  1BE3 J;  1NU1 J;  2BCC J;  1BCC J;  1SQP J;  3H1L J;  1PP9 J;  1KB9 I;  3H1J J;  1NTZ J;  5KLV J;  3TGU J; 
#chains in the Genus database with same CATH topology
 1N7S D;  1ZXG A;  5KTB A;  3CMA P;  2A06 D;  4GOF A;  2Q7C A;  1PZQ A;  1OMI A;  4KHX A;  3KZI E;  1LTG C;  2O1J A;  1LTA C;  2E76 D;  1LTT C;  3AE4 C;  2HOD A;  3H25 A;  1VQ4 P;  2KZJ A;  3FXE A;  5AW0 B;  3RK3 C;  3F5H A;  2FKW B;  4H44 B;  2QEX P;  1AJY A;  2R5B A;  5B66 H;  3ITK A;  3CWB D;  2FYU J;  2UWJ E;  1S2E A;  2QG4 A;  2V4H A;  1PFI A;  3JCU H;  1SQQ K;  2D2C B;  2K88 A;  3B71 A;  2WTY A;  3B8E B;  2QIW A;  5K5G B;  2HOD B;  1YJW P;  1T3J A;  4BRY A;  4HH2 A;  3Q1M A;  3CCV P;  4K3A A;  4H0L B;  1PP9 G;  4IFF A;  1KIL D;  1T8Z A;  3GW6 A;  1Y9B A;  1YTZ I;  1U7J A;  2PFX A;  4U3F J;  4WWI A;  1GMJ A;  3E1R A;  1H88 A;  2IBZ D;  2BAS A;  5CJ0 A;  1T2K C;  3H1J G;  3HUS A;  1RE3 A;  1ZW0 A;  2QM8 A;  1FC2 C;  1URQ B;  3Q5S A;  1LJ2 A;  3RL0 C;  3L4F A;  1EXI A;  1JY2 N;  1Y8A A;  2WPQ A;  3V4Q A;  2DW3 A;  3H32 A;  5AW7 B;  1QVF O;  2FYN C;  3VMZ A;  1EZV E;  3PTZ A;  2M0B A;  1ZP0 C;  4O9B A;  2P2U A;  1ZR4 A;  2KNC B;  2PRR A;  1LT9 C;  1SP4 A;  5EFW B;  3H1L E;  1VQP P;  2HPC A;  1N7S A;  2OTK E;  1KTM A;  4DOJ A;  1LTB C;  4Z1M H;  2M5A B;  5KLV G;  2HFE D;  3H32 B;  3Q5R A;  2OTJ P;  2QJY B;  2IFN A;  3V6I A;  2ZAE B;  1YI2 P;  3VMX A;  3M0A A;  4C7N B;  3VMY A;  3A5T A;  3L72 G;  1N7S B;  3VP9 A;  5KLV E;  1JY3 P;  3UIA A;  5KKZ B;  4XFJ A;  2JEE A;  5AVU B;  2E76 B;  4GIF A;  1PGJ A;  3AEF C;  1IJD B;  3AEE C;  2YKP A;  4AYC A;  3HRN A;  2CPS A;  3KXD A;  5M1B A;  1VQL P;  4ASV A;  2IPP A;  3A0H H;  3E1I A;  4N78 E;  1VDF A;  1MUU A;  4H44 C;  1KIL A;  4JQ0 D;  4UB8 E;  1SQQ J;  2PP6 A;  1FZG A;  2YO3 A;  2FXM A;  3L71 G;  2FYU G;  1G1I A;  2D2C C;  2FBW C;  2QM7 A;  2KOG A;  1YYC A;  4C7R A;  2LR2 A;  2JWD A;  2E43 A;  2KYV A;  4PV1 D;  3CXH H;  2P1J A;  4TT3 H;  1G1J A;  3H1I J;  4H0L C;  3HD7 D;  2AXT H;  1JUN A;  1L4A D;  2KLV A;  1OX3 A;  3E7K A;  1EZV D;  4N6J A;  3RGU A;  3G4S P;  4AQR D;  1CI6 B;  1HTL C;  4U3F G;  4WVZ A;  1M7L A;  3BRT B;  1VQN P;  1SQV E;  1J1E B;  3R2P A;  2B87 A;  2YMY A;  3H1L D;  2HLO A;  5TIS H;  5TJH A;  1FBM A;  4IL6 H;  1S4X A;  3FX0 A;  4U3F E;  2L5G B;  1S3J A;  1URQ C;  1GK6 A;  2WPS A;  4UB6 H;  1RE4 A;  1N73 A;  3RL0 g;  4PD4 H;  4A7P A;  2WVR A;  2E42 A;  4RKU J;  2B87 B;  4M3L A;  1DD4 A;  2ZXX A;  5KLV D;  2XND H;  1DD3 A;  1KQG B;  2P10 A;  1P84 E;  2I1K A;  2Z5H A;  3CPW O;  1SFC D;  2JDI H;  4D6T E;  2HR3 A;  5AVY B;  3CCQ P;  5H2F E;  1LTJ A;  1NKZ B;  1SQP E;  2Q3E A;  1KYO E;  2LXC B;  4AUW A;  2WWW A;  1GU5 A;  2QJY C;  2Z4E A;  1KQL A;  4N78 D;  3HE4 A;  1BDD A;  1NYH A;  1FS0 E;  2C9N Y;  3V5B A;  1N7S C;  3GF7 A;  1GK4 A;  1GDT A;  5KKZ C;  5KLV K;  1LTJ B;  1IFN A;  1M1K Q;  2H89 C;  2E74 B;  2WZ7 A;  1M90 Q;  2R5D A;  3BVH A;  4EOT A;  4GOD A;  4W80 A;  2E76 C;  2OYO A;  2IBZ I;  3HE4 B;  3C9I A;  2CPB A;  3FXD A;  3HTK A;  4PJ0 E;  1OXZ A;  2A45 I;  2OYI B;  3M9Q A;  3PH0 A;  1VQ5 P;  1NAF A;  1VF5 D;  4C46 A;  3HD7 A;  2ZFC A;  1L4A A;  1H8A A;  1XTC C;  1QGK B;  1SQV D;  1SQQ G;  3SSU A;  3HE5 A;  3HTK B;  5AW3 B;  1SQX E;  1YQ3 C;  2P7J A;  3M91 A;  3CD6 P;  2VRS A;  3RK2 D;  4WY4 D;  4PV1 B;  1QVG O;  1BE3 J;  1YTZ T;  2A06 G;  1BGY E;  1WT6 A;  1L4A B;  1PGP A;  3CX5 H;  1H0T A;  3SWF A;  2B88 A;  2OTL P;  3H1I G;  2N1T B;  5B66 E;  1HGV A;  4JBZ A;  3JCU E;  1S5L H;  1P84 D;  4I2L C;  5APU A;  1ZR2 A;  3Q5P A;  3O6Q B;  4D6T D;  1J1E C;  2QSI A;  1SQV K;  1H0T B;  3H1I E;  3RBX A;  1SQP D;  1SFC A;  1KYO D;  1GU4 A;  2KLU A;  3EWK A;  4DZO A;  1KV4 A;  3H1H E;  2OYH B;  1W2E A;  2N9B A;  1IK7 A;  3AE7 C;  1RF0 C;  5L8R J;  2GUS A;  3B5N D;  2XKM A;  1SFC B;  1NTM J;  2YIU B;  1NO4 A;  1OIP A;  1HH0 A;  4GT1 A;  3AEC C;  3H1L J;  4KT0 J;  2IYO A;  3OW2 O;  3W68 A;  2IBZ G;  1PL5 A;  1RE4 C;  1YJN P;  2NZ2 A;  2XDJ A;  2FXO A;  2A45 G;  3PLN A;  1SQP K;  2Y0E A;  1K04 A;  5GTH H;  2W27 A;  1J2J B;  3B4S A;  2O01 H;  3L74 E;  5CCH C;  4KJM A;  1SQX D;  1LTJ C;  1EZV I;  2E74 C;  1USD A;  3O8Z A;  1OW8 A;  5CJ4 A;  4YXD C;  1BGY D;  4NPE A;  5AVR B;  2W6J H;  4EYY Q;  1JY2 P;  2PGD A;  1HBW A;  3TGU J;  4WY4 A;  5CBO A;  1OW6 A;  1VF5 B;  2OYI C;  3NTN A;  2XV5 A;  5APY A;  3AE6 C;  1LT1 A;  5AW5 B;  3TDK A;  4HKZ H;  3RK2 B;  4WY4 B;  3H1I D;  4L74 A;  1SQX K;  3AE3 C;  2LXB A;  3CME P;  1CZQ A;  4PV1 C;  4JYB A;  2ZYG A;  1N8R Q;  2QJP B;  1YHQ P;  1BE3 G;  3A0H E;  3TF5 A;  1Q7Y Q;  3H1H D;  1RQV A;  3W67 A;  2R3S A;  1JB0 J;  2Q1K A;  1FZE A;  5KAF H;  1HJ0 A;  2IFM A;  2N1T C;  1VQM P;  2J5U A;  1PPJ E;  1EQ7 A;  2QVA A;  2G3A A;  3LW5 H;  2KK7 A;  1BE3 E;  2BCC E;  1SQV J;  4IOI H;  2ZVO B;  2K9J A;  1N2D C;  3B5N A;  3IFM A;  1IFM A;  1BCC J;  2JKV A;  2YXR B;  3IN6 A;  3AE9 C;  1OVV A;  2WSC H;  3S9O A;  3M9B A;  2ITA A;  1L0L E;  3CXH E;  1KZU B;  2POH A;  1Q82 Q;  2AXT E;  1R8E A;  4H13 C;  1NTZ E;  2KIK A;  4BRY B;  1R5L A;  3Q3D A;  2K9J B;  3B5N B;  1AQ5 A;  2OYH C;  3L74 D;  1K9M Q;  3TYY A;  1RY3 A;  3NFQ A;  1EZV G;  1HUC A;  1SFC C;  2YIU C;  5TIS E;  1RF1 A;  4IL6 E;  1NTM G;  4D6T J;  2R44 A;  1KFN A;  1UIX A;  2WQY C;  1EXJ A;  3H1L G;  1SQP J;  1X22 A;  3II6 A;  3HUS B;  4UB6 E;  1A02 F;  4EDF A;  2WSE H;  4PD4 E;  1NTM E;  3G6E P;  4RO0 A;  1RF1 B;  2B9B A;  3BCC E;  3SFE C;  2XZR A;  4I1L A;  1RH5 B;  3M0D A;  1IFI A;  1M8O B;  1FJP A;  3KQG A;  2W90 A;  1DEB A;  2LKM A;  1P84 I;  3C1L A;  1MV8 A;  1L0N E;  2HPC B;  3L70 E;  4K35 A;  1MFT A;  1N86 A;  3TGU G;  1GZL A;  1KYO I;  1VF5 C;  5AVT B;  4B86 A;  2W6A A;  1PPJ D;  1KD1 Q;  3OAK A;  3U1C A;  1KC8 Q;  1HGZ A;  1PGO A;  1BE3 D;  2BCC D;  2J59 M;  1WRG A;  1GW3 A;  3D6Y A;  3TGU E;  1SQX J;  3GF3 A;  3RK2 C;  4WY4 C;  3VOP A;  1FZA A;  1BGY J;  1L0L D;  3CXH D;  1EDJ A;  2QJP C;  3BAT A;  2KZI A;  3GMA A;  2NRG A;  1NTZ D;  1VQO P;  1KB9 H;  3SFD C;  3MIW A;  3MHV A;  3A7O A;  5AW2 B;  1FDI A;  1JTH A;  3P7K A;  1KFM A;  1Q86 Q;  2K9Y A;  4ASW A;  1X0T A;  2M3B A;  1KIL B;  4CPG A;  3G9R A;  3CL3 D;  4OGQ D;  1SQV G;  4IL6 X;  3G71 P;  1BCC G;  4L73 A;  1SQB E;  3D6Z A;  3IAO A;  1JTH B;  4RES B;  4PD4 D;  1DX7 A;  1L0L K;  1NTM D;  4N3Y B;  3H1H J;  1LWU A;  1FAV A;  1NKN A;  1PIX A;  1NTZ K;  5AVQ B;  4YXW H;  1BCC E;  3BCC D;  2YKQ A;  1JOC A;  1S5L E;  5BU8 B;  1Q2N A;  5CCG D;  1USE A;  1LP1 A;  3CCU P;  3TSI A;  5AVX B;  1JM0 A;  3VN0 A;  1NH4 A;  4GDO A;  3G3Z A;  1JCD A;  1LWU B;  3M06 A;  4D6T G;  2E5Y A;  1L0N D;  3L70 D;  1JY3 O;  5AVS B;  1SQP G;  3HUS C;  1RE3 C;  3CCS P;  4NPD A;  1GTW A;  3OA7 A;  1NTM K;  2QJK B;  3L74 J;  1LGH B;  1PGQ A;  3EFG A;  1JY3 N;  1N73 B;  2Y9Y A;  3CC7 P;  2K1A A;  1IC2 A;  1T2K D;  5KLI B;  3TGU D;  5GTI H;  1VQ8 P;  1ZRT E;  2V7Q H;  2YKO A;  1VL2 A;  1NVO A;  3AED C;  1EDI A;  3PJS K;  1N7L A;  1S72 P;  1NWQ A;  1L0N K;  5GTH E;  2WT7 A;  2Q5U A;  3GHG A;  2AEM A;  1VQ9 P;  1CSB A;  3M0D C;  2KB7 P;  3C8V A;  5KJ7 D;  1FE6 A;  2H88 C;  3MGN A;  1IFP A;  1LTS C;  3WUV A;  2WSF H;  1HWT C;  4NPF X;  1R5S A;  1SQX G;  3GHG B;  3Q2Y A;  1SQB D;  1IK9 A;  1J1D B;  3CX5 D;  2K3R A;  1BDC A;  4OVN F;  1BGY G;  5CMZ A;  1IZN B;  1W2B O;  1BCC D;  1NAY A;  4OWF A;  1E5W A;  3SWY A;  3IR9 A;  1ZN5 A;  1S5L X;  2BCC J;  3FWN A;  4OGQ B;  3HD7 B;  5CCG A;  1KIL C;  3HE5 B;  2P67 A;  3V2P A;  1SQB K;  1L0L J;  3MZW B;  5CHX A;  3MTU E;  1BSN A;  4I7Z B;  5KAF E;  1NTZ J;  1U57 A;  2CK3 H;  2QA4 P;  3PHL A;  1SS1 A;  5AW8 B;  4WB4 A;  4YPC A;  3H1H G;  1LNQ A;  2IZ0 A;  2JJL A;  1ZRT D;  3R4Y A;  4YTP C;  1T6A A;  4Y28 J;  1GW4 A;  1NOH A;  4TLF A;  2QE7 H;  2WPR A;  3PRJ A;  4L75 A;  1LWU C;  1QX8 A;  4GKG A;  1NU1 E;  5AVW B;  2KUB A;  1GL2 D;  3CXH I;  2O1K A;  3CC4 P;  1Q81 Q;  2OQQ A;  4U7J A;  3BCC J;  1YQ4 C;  2QJK C;  2JP3 A;  2W83 C;  1ZOY C;  1AQT A;  1N73 C;  3H6P A;  3MD0 A;  5KJ7 A;  3L74 G;  3I5C A;  5KLI C;  3WMM 0;  3CCM P;  1LT9 A;  4DJG A;  2M3E A;  4HB1 A;  3F89 A;  1URQ D;  5B5E H;  1A02 J;  1L0N J;  3L70 J;  2IDB A;  1JNM A;  2C0W A;  3MP7 B;  1VQ6 P;  1AFO A;  3VP8 A;  4OH8 B;  2W8Z A;  3M9H A;  2R32 A;  2WIT A;  3T97 A;  1JCC A;  4PD4 I;  1VQ7 P;  1HF9 A;  1NTK E;  2YMK A;  2FYZ A;  1K8A Q;  2AXC A;  3KPE A;  1AV1 A;  2OGU A;  1JO5 A;  1JMB A;  3GHG C;  3L37 A;  3D71 A;  1MFZ A;  1J1D C;  2MJZ A;  2HYN A;  1DH3 A;  3AE1 C;  4GOE A;  3H1K E;  1W5C E;  3L75 D;  5BVZ A;  2KS1 A;  1NJI Q;  5AVZ B;  5AVV B;  2KSJ A;  5CBN A;  1PPJ G;  2ZVN B;  3BRV B;  1YBK A;  1ZLL A;  4OGQ C;  2BCC G;  3HD7 C;  1L4A C;  1RHZ B;  2Q9I A;  1Q90 D;  4DCK A;  4EI2 A;  3K5B A;  1IO4 A;  3EFF K;  3PP5 A;  2JWA A;  1SQB J;  5E79 H;  5APT A;  1NU1 D;  1TU3 F;  2Y0C A;  4Y99 B;  2NPS D;  1JMM A;  2KS1 B;  1KB9 E;  3L71 J;  1H89 A;  1L0L G;  4I7Z C;  3N4X A;  3AEA C;  4JYC A;  3A0B H;  1NTZ G;  5CCG C;  1S1C X;  2BEQ D;  4R4M A;  1GL2 A;  1EDL A;  2ZJS E;  1X9V A;  5KAI H;  2RN0 A;  1U7M A;  2G8Y A;  2ZT9 D;  2Q3I A;  2RKL A;  3JC2 2;  2Y0D A;  3AEG C;  2Z5I A;  5APS A;  1ZME C;  5BU5 A;  1QL2 A;  2YO2 A;  1GL2 B;  1URQ A;  1WMK A;  4ZMD A;  1UII A;  1NU1 K;  2N9Y B;  3CX5 I;  2L91 A;  2YXQ B;  5APV A;  1PP9 E;  1K05 A;  1JEK A;  2Q6Q A;  2FFD A;  2R3C A;  3AE2 C;  4EIJ A;  1JY2 O;  1NTK D;  3BCC G;  2RH0 A;  3VMA A;  2O3J A;  4DT0 A;  1FDM A;  2KNC A;  2FXP A;  3WU2 H;  3RK3 E;  3N7N A;  3USS A;  1YJ9 P;  1G2C A;  3SWK A;  3VYI A;  3H1J E;  4ZKU A;  2XNX A;  2M5A A;  2FFD B;  3KHU A;  1ZV8 A;  3H1K D;  1IFD A;  1L0N G;  3AEB C;  3L70 G;  2A45 H;  5KJ7 C;  2JO1 A;  3WUU A;  1FZC A;  2O01 J;  1MKM A;  4C7N A;  3L73 J;  1OVU A;  2E5T A;  1G2C B;  5GTI E;  1NTK K;  3ZDM A;  2IZ1 A;  5AW4 B;  1KQF B;  3AE5 C;  3VTP C;  1FZC B;  2GA1 A;  1KB9 D;  3FGA D;  2H7H A;  1PV3 A;  2E75 D;  3S4R A;  2WSS H;  3KZI H;  3CCE P;  2NPS A;  5CCH D;  2QRX A;  2I8D A;  3L72 E;  2O01 N;  2E74 D;  1XTG B;  1RQU A;  5APQ A;  3KDP B;  3A3Y B;  3QWO C;  2KXP B;  2NPS B;  1OW7 A;  4JPZ B;  1L2P A;  2RMZ A;  5AW6 B;  3U59 A;  1SQB G;  2YNY A;  4Y99 C;  1EDK A;  1YIJ P;  1FZF A;  1KMI Z;  3WUT A;  1PP9 D;  1T3U A;  3TK1 A;  1S9K E;  3LW5 J;  3L75 J;  2H43 A;  2HG5 D;  4XE5 B;  1CI6 A;  2Y9Z A;  3CX5 E;  1E79 H;  1AVY A;  3L36 A;  4LGD E;  3RK3 D;  2ZT9 B;  3L71 E;  2FYU E;  1NGM B;  2WSC J;  1KOR A;  3H1J D;  1CW5 A;  3B5N C;  1X8Y A;  4ZKP A;  1NU1 J;  1GL2 C;  2N1T D;  3CWB J;  1HJB A;  1OZH A;  1QLE D;  2C0X A;  1RF0 A;  3NXS A;  3P8C E;  2ZYA A;  1OVR A;  5DJT B;  4HYT B;  3MUD A;  1SLQ A;  1LP1 B;  2KSE A;  4ZNC A;  1RF1 C;  4H13 D;  3I55 P;  2BEZ F;  2WSE J;  3CCJ P;  2FFD C;  3KYQ A;  3V2N A;  1D7M A;  1VQK P;  2H8P D;  2K37 A;  1VPC A;  3L72 D;  5CCH A;  2OAR A;  3L73 G;  1NTK J;  3RL0 D;  1KN7 A;  2GUV A;  3CCR P;  3ABV C;  1M1J A;  3GG2 A;  4I6M C;  3BAS A;  5B5E E;  2KP8 A;  3FWL A;  1EC5 A;  1OFC X;  1QL1 A;  4MN4 C;  1FZC C;  3L73 E;  2E75 B;  5DJU B;  3LID A;  2WMM A;  2OYI A;  3H1K J;  1BSH A;  4RJT A;  4IFD K;  1S9K D;  2M8R A;  1Z56 A;  1M1J B;  2WT7 B;  2FY8 A;  1SVF A;  2WPV B;  3L71 D;  2FYU D;  1OWA A;  3L35 A;  2IX7 C;  4UB8 H;  2AEJ A;  2KI7 B;  4WBA A;  3CLQ A;  4BWN A;  2NPS C;  3EQ2 A;  1FZB A;  2P58 A;  1AVO A;  1FU1 A;  3P32 A;  5C39 A;  1FOS F;  1FDO A;  3RBZ A;  1DIP A;  2N1T A;  3V2Q A;  3I56 P;  2W6B A;  3RK3 B;  1M56 D;  3P8C D;  3L75 G;  4U3F D;  1KQS O;  1Y47 A;  3TNU A;  1AA0 A;  2ZT9 C;  3O6Q A;  1SQQ E;  1GD2 E;  4H44 D;  4LC1 A;  5E79 E;  2FYU K;  3AE8 C;  3LIE A;  1LTI C;  3NMD A;  3L75 E;  3V2R A;  2D2C D;  1FOS E;  2A06 E;  2MKV A;  2ZYD A;  3A2A A;  3GLM A;  1NU1 G;  3A0B E;  2J58 A;  1HVV A;  1PP9 J;  2OYH A;  1KB9 I;  3CWB G;  5AW9 B;  4XA4 A;  3TNU B;  3CCL P;  1X79 B;  3D70 A;  5KAI E;  2XU6 A;  4H0L D;  4HJG H;  3U1A A;  3V4W A;  2C9L Y;  3CWB E;  4H13 B;  2IYP A;  3L73 D;  3H1J J;  1P84 H;  2SPZ A;  2ZXE B;  5H2F H;  4IFM A;  3S1K A;  4LLH A;  4W7Z A;  1DEE G;  1KYO H;  3RL0 B;  4R4L A;  3QH9 A;  3MUD C;  3CC2 P;  1KIL E;  3P8M C;  2V7Q J;  2PAJ A;  3WU2 E;  5APX A;  2FYN B;  4JF7 A;  2AEF A;  3CI9 A;  1NTK G;  1IFJ A;  3OJA B;  1M57 D;  2I1J A;  1LT9 B;  3JSV C;  2IBZ E;  2E75 C;  2JR8 A;  1NHL A;  5AW1 B;  5KLV J;  1MZ9 A;  3H1K G;  2GM4 A;  4W7Y A;  1QEX A;  4PJ0 H;  2B89 A;  1K73 Q;  4BXL A;  1M1J C;  3IF4 A;  3L72 J;  1FJK A;  5APW A;  3T97 B;  2WSF J;  4L76 A;  4QMA A;  1YIT P;  1SQQ D; 
#chains in the Genus database with same CATH homology
 3CWB J;  1KYO I;  1L0N J;  3BCC J;  3L70 J;  2IBZ I;  4U3F J;  1SQB J;  1BGY J;  1NTK J;  3L74 J;  1SQQ J;  3H1K J;  3L73 J;  3H1H J;  1P84 I;  1EZV I;  3CX5 I;  3H1I J;  3L72 J;  3L71 J;  4D6T J;  1NTM J;  2FYU J;  4PD4 I;  1SQV J;  1L0L J;  1SQX J;  3L75 J;  3CXH I;  1BE3 J;  1NU1 J;  2BCC J;  1BCC J;  1SQP J;  3H1L J;  1PP9 J;  1KB9 I;  3H1J J;  1NTZ J;  5KLV J;  3TGU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...