3L75J

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
61
structure length
61
Chain Sequence
b'ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 24
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l75J00
4D6TJ 3CX5I 1BGYJ 2FYUJ 3L71J 1BE3J 1NTKJ 2BCCJ 1SQVJ 1SQPJ 1KYOI 3H1KJ 1BCCJ 3L70J 5KLVJ 1NTMJ 3L75J 1SQBJ 3H1LJ 1L0LJ 3CXHI 4U3FJ 2IBZI 1L0NJ 1NU1J 1PP9J 3H1IJ 3L74J 3L72J 3TGUJ 1SQQJ 3H1JJ 1EZVI 3CWBJ 1NTZJ 4PD4I 1KB9I 3BCCJ 1SQXJ 1P84I 3H1HJ 3L73J
chains in the Genus database with same CATH superfamily
2Z4EA 2N9YB 5AW4B 1G1JA 4ZKPA 1NTZD 1FE6A 1RQUA 5DJTB 1KFMA 2UWJE 4L74A 2XV5A 5APSA 2E5YA 1RH5B 3AECC 1GK4A 2JEEA 2WPVB 3IR9A 3VTPC 1JNMA 1WMKA 3GF7A 2A06D 3AEBC 3O6QB 3R2PA 1RF1B 1L0LE 2OYOA 4PD4D 2W8ZA 1W2BO 1L4AA 3L70G 2AEMA 2FKWB 3H1ID 3T97B 3H25A 3LW5H 1KQLA 5B66E 5CBOA 1JCDA 3Q5RA 1VQ6P 1AQ5A 3MTUE 3IN6A 1R5SA 2KP8A 1J1EB 5APWA 2E76B 5AVUB 1IZNB 1AJYA 1YIJP 1VQ4P 2D2CC 3BATA 1HH0A 3H1LG 4BXLA 1VQ8P 5APVA 5KLVE 1SQQJ 5CCHA 3U1AA 5B5EE 4GODA 2IZ1A 2E74D 5TISH 1Z56A 1K9MQ 1IFMA 3KZIE 2R5BA 5AW6B 1YJ9P 1BGYE 4ASVA 4GIFA 1HGVA 2R32A 1R5LA 2BASA 3L73J 3L70E 2B89A 4NPFX 1KD1Q 2IDBA 1Y8AA 2QJPB 1M7LA 3M06A 3RL0B 3H1KE 1BGYJ 3AE6C 1FZCB 5KAFH 3A5TA 3V2PA 4PV1B 2K9JB 1ZRTD 4C46A 5KTBA 4OGQC 2N9BA 1SQPJ 3U1CA 3WUTA 3F5HA 4PD4H 1J1DC 5KLVJ 3U59A 4U3FD 1OZHA 1KILA 4LC1A 1GL2B 2M3EA 5CHXA 1BCCG 5KAFE 3JC22 4N3YB 1YBKA 1L0LK 1KORA 2E74B 2O01N 2K3RA 2QJPC 1LTJC 4GOEA 4JQ0D 1L0NK 3P8MC 4C7NA 4I2LC 1IFNA 2IBZI 1RE3A 1PP9G 2P1JA 2Q6QA 2NPSB 3C1LA 5KKZC 1HWTC 2B87A 3O8ZA 3PH0A 2I1JA 3HE5A 1S5LH 1GMJA 3MZWB 2D2CD 2QE7H 3L73G 4N78E 4NPDA 3AE1C 2O01H 2WSFJ 3L75G 3N4XA 5B66H 2D2CB 4RKUJ 2FYUD 4KHXA 1IK7A 2OGUA 4PJ0E 1URQB 4ASWA 2XZRA 2YIUB 1GL2D 3V2RA 1U7MA 1SQVE 2HR3A 1FBMA 1HGZA 4R4MA 1P84E 3T97A 3PHLA 2DW3A 2WTYA 2OYIA 3EWKA 3D6YA 4M3LA 1VL2A 1EDLA 1BE3J 3FXDA 1LTGC 1BE3D 2BEZF 1NAYA 3H1KJ 1MV8A 3H1HE 4RO0A 3WUUA 2RKLA 2H7HA 3D6ZA 2W90A 4DCKA 1VQ5P 2ZYGA 4U3FE 1NU1K 1S5LX 2QJKC 2N1TD 2ZT9B 1WT6A 2Y9YA 1ZOYC 3P32A 3P7KA 3Q5PA 1VQOP 2RMZA 1KILB 3GMAA 3CCJP 1FZFA 4RJTA 3CX5E 3II6A 4L76A 1RHZB 2CK3H 2ITAA 3CCQP 1OW8A 3HTKB 4PD4I 2K37A 2JP3A 2YMKA 2K9JA 5CJ4A 3RK2C 3SWYA 4EIJA 3D70A 4EDFA 2A45G 3GW6A 2J5UA 2FYUK 1GL2A 1PGQA 3MUDC 4W80A 1LTTC 1BGYG 3Q1MA 1VPCA 4AQRD 3Q5SA 1SS1A 2K88A 2YO2A 5EFWB 2P2UA 3EFGA 2WSEJ 3V4WA 1P84D 2B87B 2GUSA 1DD4A 2CPSA 3IAOA 3CC2P 1A02F 2PAJA 1Q2NA 2QSIA 3RGUA 5AVXB 1EDJA 1USDA 1N86A 1NTMK 1L4AC 2B9BA 1K05A 2W83C 1EZVD 1JTHA 1M8OB 2BCCG 1RF0A 1FJKA 2G8YA 3QWOC 3L71G 1PP9J 5AVVB 1UIIA 1URQA 2YO3A 3LIEA 4DZOA 3A0BH 4Z1MH 3LW5J 1L0LG 1SQBG 2M8RA 2YKQA 2JWDA 1YI2P 1VQLP 3AEDC 2PGDA 4GDOA 2FFDC 4YPCA 1QL1A 1SLQA 1N7SC 3TDKA 1N7LA 2WWWA 1KTMA 3HD7C 1ZLLA 2YXRB 2WZ7A 2N1TA 5AVQB 3WUVA 3S9OA 3SFDC 3CCSP 1RF0C 1OFCX 1YQ4C 4O9BA 3L71J 1DEBA 2E75C 1PGOA 2JDIH 3GG2A 2IZ0A 2W27A 1S1CX 4Y28J 3H1HG 3V5BA 1DH3A 1OVVA 2WSCH 1EZVG 2BCCD 2V7QJ 1NOHA 1SQXG 3AE8C 3RL0g 3AE4C 5KJ7D 2FYNB 4TLFA 1SQVG 3B5ND 1SQBJ 4B86A 3L72G 1L4AD 1LT9A 3HTKA 1CZQA 2N1TC 3HE4A 1CI6A 3L35A 3L70D 3OA7A 4IFFA 5CBNA 1GU4A 3L75D 2B88A 3L74J 4HYTB 1AVYA 2YKPA 2E42A 1ZMEC 2FXOA 2O3JA 2ZVOB 3V4QA 1HUCA 1PP9D 3C8VA 1NTZG 3E1RA 2JO1A 4DOJA 1ZR2A 3BASA 3E1IA 1PGPA 1BE3E 4YTPC 1GL2C 2KI7B 3H1HD 3L73D 3MUDA 2KSEA 3QH9A 4U7JA 1ZN5A 1FZEA 1N7SB 5M1BA 1N73A 5AW5B 4GOFA 1YITP 2H8PD 4AYCA 3B5NB 1YTZI 3NXSA 1D7MA 1KQSO 4RESB 1JTHB 1EC5A 1KILD 4U3FG 2WPSA 5KKZB 3CD6P 3PJSK 3BRTB 3H32A 3CCUP 4WB4A 3CCRP 1IO4A 3M9QA 3VYIA 2A06E 1G1IA 4HJGH 3G71P 5TJHA 2C0WA 3H1KG 2KSJA 4WY4B 1SQPG 3TGUE 3RBXA 5KJ7C 1RF1C 3CLQA 3B5NC 1L0LJ 4H44C 4H13B 1L0NJ 1M57D 1T6AA 1PFIA 1HBWA 2FY8A 2N1TB 1M1JC 3IF4A 2YXQB 1SVFA 1T8ZA 1OXZA 2PFXA 1AV1A 1UIXA 4WY4C 1Q86Q 1IK9A 2P67A 1K8AQ 1CI6B 2A45H 1YTZT 4OVNF 5AW7B 3RK2D 3CCMP 1Q81Q 1PPJE 3MIWA 3L73E 1KYOD 1S4XA 2I1KA 4L73A 5AW0B 2IYPA 1QGKB 5APTA 1NTKK 2LXBA 3M0DA 5E79E 5APUA 4YXWH 2I8DA 1NKZB 1LT9B 3AEFC 2O1JA 4K3AA 1HJBA 3BCCD 1SQVJ 1XTCC 1KILC 2KNCB 1FOSE 4IFMA 1KYOI 1T3JA 4HB1A 3D71A 1RY3A 2QRXA 1N73B 2WSEH 1FC2C 1S5LE 2YMYA 2HLOA 4OGQB 2HYNA 4H0LB 1FZCA 1NGMB 2WMMA 3HUSC 1JB0J 2WQYC 3VOPA 1OIPA 1M56D 1JY3O 4H44D 3S4RA 1NU1J 1NTMD 4IL6H 5BVZA 4HH2A 2QJYB 1JY2O 3Q2YA 2OYHA 2IBZG 1T3UA 1N7SD 1NTZJ 4PV1D 3G9RA 3I55P 1PPJD 2R3SA 3A0BE 3HD7D 2FYUE 2AXTH 5KLVG 3OW2O 3H32B 1VQ9P 2XKMA 1KN7A 1SQXE 1NKNA 1LTJA 1Q90D 2Z5HA 2J58A 5AVRB 4WY4A 3BCCE 3CCEP 2YIUC 2XNXA 3M91A 1K04A 4QMAA 3TSIA 3BVHA 3L70J 4GT1A 4JYCA 3AE7C 1IC2A 3CC4P 1NTMG 1S3JA 3B8EB 5H2FE 1FDMA 1URQD 3B5NA 3L75J 3S1KA 2Y9ZA 1SFCD 1L0LD 4PD4E 1N73C 3L74G 2V7QH 1SQQE 1NTME 3EFFK 2LXCB 3VMXA 1IFPA 1L0NG 2IX7C 1PIXA 1SQBK 3CCLP 1OW7A 3Q3DA 1BSNA 1KQGB 3TGUJ 3E7KA 4N6JA 4WY4D 1KB9E 2BCCE 3AE3C 3BCCG 3V2QA 2KK7A 4I6MC 4BRYB 4CPGA 2XNDH 1NU1E 2QG4A 1IFIA 2Y0CA 2KNCA 3AEGC 1MUUA 2K9YA 1SQXK 1QEXA 3RK3C 1JM0A 2OTLP 5KLVD 2L91A 1SFCB 5BU5A 1MFTA 1S72P 3KHUA 1L2PA 1SQXD 1X9VA 5APYA 1AA0A 3H1KD 2FFDB 2VRSA 3AE2C 3FGAD 1SQPE 4WBAA 1CW5A 1GZLA 3HRNA 2M3BA 4UB8E 1KYOE 1FDOA 1OX3A 2A06G 4YXDC 2V4HA 2KLUA 2OYHB 4D6TD 1RE4C 1SFCC 2AXCA 3CXHI 3H1IG 4DJGA 2KS1B 1JMBA 1KYOH 3M9HA 5AW3B 1SQQK 3L74D 3CI9A 3WU2H 3PRJA 2IPPA 5AVZB 1IFJA 3I5CA 1GU5A 1VDFA 1J1DB 3TYYA 4TT3H 3KXDA 5KLIC 1LGHB 3M0AA 1QVGO 2KLVA 1H0TA 1ZV8A 2C0XA 3B4SA 3PP5A 3RBZA 1HJ0A 2YNYA 5B5EH 1H8AA 1DIPA 4H44B 3UIAA 2WVRA 1DX7A 3RK3B 1JY2N 1SQVD 2NPSC 1NTKJ 3MHVA 5KLVK 1EQ7A 4W7YA 2POHA 3SWFA 1Q7YQ 1SQPD 5KAIH 1SQPK 1Y9BA 5CMZA 3IFMA 5AW1B 3HD7A 1AFOA 5APXA 1G2CB 1OMIA 3TGUG 1FOSF 4U3FJ 1LTBC 2M0BA 4OWFA 5C39A 1T2KD 3CPWO 4JYBA 4DT0A 5CCHD 1NYHA 4KT0J 4JBZA 2Q5UA 2AXTE 2GUVA 3H1JJ 1AVOA 5GTIE 4IL6E 2HPCA 3KDPB 3L74E 4XFJA 3K5BA 1USEA 2FXMA 1ZR4A 4ZKUA 1KB9I 3FWLA 4ZMDA 3L36A 2Z5IA 4MN4C 3W67A 4JPZB 2GM4A 3CMEP 1LWUA 1BE3G 1SQBE 1J2JB 2E75D 3CX5I 1NJIQ 4Y99B 5AVSB 4BRYA 1FS0E 1LP1A 1NTKE 1YYCA 2JJLA 2QJKB 2ZT9C 2WPRA 3L71E 1S9KE 2BCCJ 2IFMA 2NPSD 1KQFB 2KOGA 3GLMA 1HF9A 1LT1A 1QL2A 1URQC 1NU1D 2HODA 1GW3A 1N2DC 1RE4A 1SFCA 1DEEG 1U7JA 1X8YA 2HFED 3USSA 1E5WA 3H1JG 3WMM0 3NFQA 4EYYQ 1JO5A 1PV3A 3C9IA 1KFNA 2A45I 4WWIA 1ZXGA 1LT9C 2Y0DA 1EZVE 2IBZD 3KYQA 1OWAA 1X79B 2W6AA 3NMDA 4D6TG 3H1JD 1H0TB 1RE3C 1BDCA 1EZVI 3CWBJ 3M9BA 2YKOA 3A7OA 4H0LC 3VP9A 3PTZA 4HKZH 1OVUA 2KS1A 1E79H 2WITA 4LGDE 2KIKA 3BCCJ 1Q82Q 1WRGA 5CJ0A 1PZQA 2XDJA 3V2NA 1FZAA 4XA4A 1LTSC 4BWNA 1IFDA 2E76D 2FYUJ 2ZAEB 2SPZA 2WPQA 3CXHE 3I56P 1G2CA 1EXJA 3R4YA 4GKGA 4OGQD 3RK2B 3L71D 1L0ND 4A7PA 1DD3A 2H89C 1MKMA 3MP7B 3RK3E 1NH4A 1VQPP 3CX5D 1VQ7P 1OW6A 1VF5B 1MFZA 2FXPA 3EQ2A 3H1IJ 4R4LA 4UB8H 2HODB 3CMAP 2ZFCA 2P58A 2C9LY 3L72D 3VMZA 2ZYAA 1R8EA 1NHLA 2PRRA 3NTNA 5CCGA 1VQKP 4AUWA 1GK6A 2WSSH 1LP1B 4H0LD 2KUBA 3FX0A 1MZ9A 3FXEA 1BGYD 2K1AA 2KZJA 2OYIC 3WU2E 1GD2E 4I1LA 1P84I 1NAFA 3H1HJ 1VF5C 1JMMA 3L75E 3TNUA 4XE5B 3A2AA 4I7ZB 5KAIE 5AW8B 5DJUB 2KYVA 2L5GB 3VP8A 5KJ7A 2E76C 3CCVP 1A02J 1JY2P 1M90Q 1LTAC 3LIDA 2LKMA 5CCGD 1GTWA 1JCCA 1LTJB 3CWBE 5E79H 4IOIH 3VN0A 2P7JA 2OTKE 1KC8Q 2CPBA 2IFNA 2PP6A 2Y0EA 4UB6H 2Q3IA 1KB9H 1SQBD 2O01J 2M5AB 2WSFH 3CX5H 1NTZE 3H1LJ 5AW9B 5L8RJ 3VMYA 5KLIB 1U57A 3ABVC 2AEFA 2RH0A 2R5DA 1EDIA 2AEJA 3OJAB 1VQNP 3L72J 3RL0C 1S2EA 3SWKA 1FZCC 1FDIA 1KMIZ 3TGUD 3A3YB 1VQMP 2H88C 2FYNC 1KB9D 4PV1C 1CSBA 5AVYB 2OYHC 1JEKA 2W6JH 2MJZA 3L72E 1PL5A 1N8RQ 3CC7P 1QVFO 3VMAA 3MD0A 3MGNA 3M0DC 1GDTA 4D6TE 2QEXP 3AEAC 1X0TA 1IJDB 1ZP0C 3H1LE 3ZDMA 4C7RA 2ZT9D 2FYUG 2ZVNB 3HUSA 4WVZA 3H1JE 2NRGA 3AEEC 5BU8B 4I7ZC 1QLED 1NWQA 2E75B 2C9NY 2J59M 2LR2A 1JY3N 2FBWC 3TK1A 2G3AA 4EOTA 2JR8A 2P10A 1W5CE 1BCCD 2QJYC 1LNQA 4ZNCA 2Q3EA 2WT7A 1BDDA 1GW4A 1PGJA 4EI2A 5K5GB 2Q9IA 4IL6X 1QX8A 1LJ2A 3CXHD 4H13D 1EDKA 4W7ZA 1J1EC 1ZRTE 3PLNA 3KQGA 4Y99C 1S9KD 3A0HE 1FZGA 4UB6E 2QM7A 3OAKA 2E74C 3GHGC 3AE9C 2MKVA 2OARA 3H6PA 3JCUH 1XTGB 3H1IE 1VF5D 5AVWB 3CXHH 3O6QA 3RK3D 2FYZA 1KILE 5GTHH 2BEQD 2ZXEB 1M1JB 3CL3D 1YJWP 1H89A 1PPJG 2KXPB 4OH8B 1SQVK 1FJPA 2M5AA 2HPCB 2FFDA 5CCGC 3GHGB 3W68A 3TNUB 4KJMA 1BCCJ 4LLHA 1NO4A 2R44A 2W6BA 3B71A 2H43A 2JKVA 2ZYDA 1HVVA 2QVAA 1M1KQ 1FAVA 1OVRA 5GTIH 1K73Q 4K35A 3BRVB 1RF1A 1NU1G 1X22A 1KV4A 3RL0D 3TF5A 2XU6A 2OQQA 1HTLC 3G3ZA 4H13C 1SQQD 1SP4A 2ZXXA 4L75A 2Q7CA 1YHQP 1H88A 4IFDK 3P8CD 3G6EP 3HD7B 3CWBD 1JOCA 1YQ3C 3F89A 3HUSB 2WT7B 2OYIB 1L0NE 2HG5D 1LWUC 1BSHA 1NTZK 1NVOA 1SQQG 3CWBG 5APQA 1JY3P 2IYOA 3A0HH 4D6TJ 1L4AB 2KZIA 2Q1KA 2NZ2A 3JSVC 4N78D 3FWNA 4PJ0H 5H2FH 1KZUB 4JF7A 2KB7P 1NTKD 3JCUE 3HE4B 3SSUA 3L4FA 3L37A 1TU3F 2NPSA 1P84H 1LWUB 2RN0A 3N7NA 3V6IA 3ITKA 3KPEA 2QA4P 1JUNA 1NTMJ 4NPEA 2GA1A 1M1JA 2O1KA 1YJNP 2R3CA 1FU1A 5AW2B 1EXIA 5TISE 1FZBA 1T2KC 3H1LD 3KZIH 2QIWA 3GHGA 5AVTB 5CCHC 1LTIC 3AE5C 2OTJP 3GF3A 1AQTA 2E5TA 2E43A 2QM8A 2IBZE 1N7SA 3P8CE 3SFEC 1Y47A 5GTHE 1PP9E 1RQVA 4C7NB 2JWAA 2ZJSE 2WSCJ 1SQXJ 1W2EA 1NTKG 1ZW0A 3G4SP 3HE5B 1BCCE
chains in the Genus database with same CATH topology
4D6TJ 3CX5I 1BGYJ 2FYUJ 3L71J 1BE3J 1NTKJ 2BCCJ 1SQVJ 1SQPJ 1KYOI 3H1KJ 1BCCJ 3L70J 5KLVJ 1NTMJ 3L75J 1SQBJ 3H1LJ 1L0LJ 3CXHI 4U3FJ 2IBZI 1L0NJ 1NU1J 1PP9J 3H1IJ 3L74J 3L72J 3TGUJ 1SQQJ 3H1JJ 1EZVI 3CWBJ 1NTZJ 4PD4I 1KB9I 3BCCJ 1SQXJ 1P84I 3H1HJ 3L73J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T J;  3CX5 I;  1BGY J;  2FYU J;  3L71 J;  1BE3 J;  1NTK J;  2BCC J;  1SQV J;  1SQP J;  1KYO I;  3H1K J;  1BCC J;  3L70 J;  5KLV J;  1NTM J;  3L75 J;  1SQB J;  3H1L J;  1L0L J;  3CXH I;  4U3F J;  2IBZ I;  1L0N J;  1NU1 J;  1PP9 J;  3H1I J;  3L74 J;  3L72 J;  3TGU J;  1SQQ J;  3H1J J;  1EZV I;  3CWB J;  1NTZ J;  4PD4 I;  1KB9 I;  3BCC J;  1SQX J;  1P84 I;  3H1H J;  3L73 J; 
#chains in the Genus database with same CATH topology
 2Z4E A;  2N9Y B;  5AW4 B;  1G1J A;  4ZKP A;  1NTZ D;  1FE6 A;  1RQU A;  5DJT B;  1KFM A;  2UWJ E;  4L74 A;  2XV5 A;  5APS A;  2E5Y A;  1RH5 B;  3AEC C;  1GK4 A;  2JEE A;  2WPV B;  3IR9 A;  3VTP C;  1JNM A;  1WMK A;  3GF7 A;  2A06 D;  3AEB C;  3O6Q B;  3R2P A;  1RF1 B;  1L0L E;  2OYO A;  4PD4 D;  2W8Z A;  1W2B O;  1L4A A;  3L70 G;  2AEM A;  2FKW B;  3H1I D;  3T97 B;  3H25 A;  3LW5 H;  1KQL A;  5B66 E;  5CBO A;  1JCD A;  3Q5R A;  1VQ6 P;  1AQ5 A;  3MTU E;  3IN6 A;  1R5S A;  2KP8 A;  1J1E B;  5APW A;  2E76 B;  5AVU B;  1IZN B;  1AJY A;  1YIJ P;  1VQ4 P;  2D2C C;  3BAT A;  1HH0 A;  3H1L G;  4BXL A;  1VQ8 P;  5APV A;  5KLV E;  1SQQ J;  5CCH A;  3U1A A;  5B5E E;  4GOD A;  2IZ1 A;  2E74 D;  5TIS H;  1Z56 A;  1K9M Q;  1IFM A;  3KZI E;  2R5B A;  5AW6 B;  1YJ9 P;  1BGY E;  4ASV A;  4GIF A;  1HGV A;  2R32 A;  1R5L A;  2BAS A;  3L73 J;  3L70 E;  2B89 A;  4NPF X;  1KD1 Q;  2IDB A;  1Y8A A;  2QJP B;  1M7L A;  3M06 A;  3RL0 B;  3H1K E;  1BGY J;  3AE6 C;  1FZC B;  5KAF H;  3A5T A;  3V2P A;  4PV1 B;  2K9J B;  1ZRT D;  4C46 A;  5KTB A;  4OGQ C;  2N9B A;  1SQP J;  3U1C A;  3WUT A;  3F5H A;  4PD4 H;  1J1D C;  5KLV J;  3U59 A;  4U3F D;  1OZH A;  1KIL A;  4LC1 A;  1GL2 B;  2M3E A;  5CHX A;  1BCC G;  5KAF E;  3JC2 2;  4N3Y B;  1YBK A;  1L0L K;  1KOR A;  2E74 B;  2O01 N;  2K3R A;  2QJP C;  1LTJ C;  4GOE A;  4JQ0 D;  1L0N K;  3P8M C;  4C7N A;  4I2L C;  1IFN A;  2IBZ I;  1RE3 A;  1PP9 G;  2P1J A;  2Q6Q A;  2NPS B;  3C1L A;  5KKZ C;  1HWT C;  2B87 A;  3O8Z A;  3PH0 A;  2I1J A;  3HE5 A;  1S5L H;  1GMJ A;  3MZW B;  2D2C D;  2QE7 H;  3L73 G;  4N78 E;  4NPD A;  3AE1 C;  2O01 H;  2WSF J;  3L75 G;  3N4X A;  5B66 H;  2D2C B;  4RKU J;  2FYU D;  4KHX A;  1IK7 A;  2OGU A;  4PJ0 E;  1URQ B;  4ASW A;  2XZR A;  2YIU B;  1GL2 D;  3V2R A;  1U7M A;  1SQV E;  2HR3 A;  1FBM A;  1HGZ A;  4R4M A;  1P84 E;  3T97 A;  3PHL A;  2DW3 A;  2WTY A;  2OYI A;  3EWK A;  3D6Y A;  4M3L A;  1VL2 A;  1EDL A;  1BE3 J;  3FXD A;  1LTG C;  1BE3 D;  2BEZ F;  1NAY A;  3H1K J;  1MV8 A;  3H1H E;  4RO0 A;  3WUU A;  2RKL A;  2H7H A;  3D6Z A;  2W90 A;  4DCK A;  1VQ5 P;  2ZYG A;  4U3F E;  1NU1 K;  1S5L X;  2QJK C;  2N1T D;  2ZT9 B;  1WT6 A;  2Y9Y A;  1ZOY C;  3P32 A;  3P7K A;  3Q5P A;  1VQO P;  2RMZ A;  1KIL B;  3GMA A;  3CCJ P;  1FZF A;  4RJT A;  3CX5 E;  3II6 A;  4L76 A;  1RHZ B;  2CK3 H;  2ITA A;  3CCQ P;  1OW8 A;  3HTK B;  4PD4 I;  2K37 A;  2JP3 A;  2YMK A;  2K9J A;  5CJ4 A;  3RK2 C;  3SWY A;  4EIJ A;  3D70 A;  4EDF A;  2A45 G;  3GW6 A;  2J5U A;  2FYU K;  1GL2 A;  1PGQ A;  3MUD C;  4W80 A;  1LTT C;  1BGY G;  3Q1M A;  1VPC A;  4AQR D;  3Q5S A;  1SS1 A;  2K88 A;  2YO2 A;  5EFW B;  2P2U A;  3EFG A;  2WSE J;  3V4W A;  1P84 D;  2B87 B;  2GUS A;  1DD4 A;  2CPS A;  3IAO A;  3CC2 P;  1A02 F;  2PAJ A;  1Q2N A;  2QSI A;  3RGU A;  5AVX B;  1EDJ A;  1USD A;  1N86 A;  1NTM K;  1L4A C;  2B9B A;  1K05 A;  2W83 C;  1EZV D;  1JTH A;  1M8O B;  2BCC G;  1RF0 A;  1FJK A;  2G8Y A;  3QWO C;  3L71 G;  1PP9 J;  5AVV B;  1UII A;  1URQ A;  2YO3 A;  3LIE A;  4DZO A;  3A0B H;  4Z1M H;  3LW5 J;  1L0L G;  1SQB G;  2M8R A;  2YKQ A;  2JWD A;  1YI2 P;  1VQL P;  3AED C;  2PGD A;  4GDO A;  2FFD C;  4YPC A;  1QL1 A;  1SLQ A;  1N7S C;  3TDK A;  1N7L A;  2WWW A;  1KTM A;  3HD7 C;  1ZLL A;  2YXR B;  2WZ7 A;  2N1T A;  5AVQ B;  3WUV A;  3S9O A;  3SFD C;  3CCS P;  1RF0 C;  1OFC X;  1YQ4 C;  4O9B A;  3L71 J;  1DEB A;  2E75 C;  1PGO A;  2JDI H;  3GG2 A;  2IZ0 A;  2W27 A;  1S1C X;  4Y28 J;  3H1H G;  3V5B A;  1DH3 A;  1OVV A;  2WSC H;  1EZV G;  2BCC D;  2V7Q J;  1NOH A;  1SQX G;  3AE8 C;  3RL0 g;  3AE4 C;  5KJ7 D;  2FYN B;  4TLF A;  1SQV G;  3B5N D;  1SQB J;  4B86 A;  3L72 G;  1L4A D;  1LT9 A;  3HTK A;  1CZQ A;  2N1T C;  3HE4 A;  1CI6 A;  3L35 A;  3L70 D;  3OA7 A;  4IFF A;  5CBN A;  1GU4 A;  3L75 D;  2B88 A;  3L74 J;  4HYT B;  1AVY A;  2YKP A;  2E42 A;  1ZME C;  2FXO A;  2O3J A;  2ZVO B;  3V4Q A;  1HUC A;  1PP9 D;  3C8V A;  1NTZ G;  3E1R A;  2JO1 A;  4DOJ A;  1ZR2 A;  3BAS A;  3E1I A;  1PGP A;  1BE3 E;  4YTP C;  1GL2 C;  2KI7 B;  3H1H D;  3L73 D;  3MUD A;  2KSE A;  3QH9 A;  4U7J A;  1ZN5 A;  1FZE A;  1N7S B;  5M1B A;  1N73 A;  5AW5 B;  4GOF A;  1YIT P;  2H8P D;  4AYC A;  3B5N B;  1YTZ I;  3NXS A;  1D7M A;  1KQS O;  4RES B;  1JTH B;  1EC5 A;  1KIL D;  4U3F G;  2WPS A;  5KKZ B;  3CD6 P;  3PJS K;  3BRT B;  3H32 A;  3CCU P;  4WB4 A;  3CCR P;  1IO4 A;  3M9Q A;  3VYI A;  2A06 E;  1G1I A;  4HJG H;  3G71 P;  5TJH A;  2C0W A;  3H1K G;  2KSJ A;  4WY4 B;  1SQP G;  3TGU E;  3RBX A;  5KJ7 C;  1RF1 C;  3CLQ A;  3B5N C;  1L0L J;  4H44 C;  4H13 B;  1L0N J;  1M57 D;  1T6A A;  1PFI A;  1HBW A;  2FY8 A;  2N1T B;  1M1J C;  3IF4 A;  2YXQ B;  1SVF A;  1T8Z A;  1OXZ A;  2PFX A;  1AV1 A;  1UIX A;  4WY4 C;  1Q86 Q;  1IK9 A;  2P67 A;  1K8A Q;  1CI6 B;  2A45 H;  1YTZ T;  4OVN F;  5AW7 B;  3RK2 D;  3CCM P;  1Q81 Q;  1PPJ E;  3MIW A;  3L73 E;  1KYO D;  1S4X A;  2I1K A;  4L73 A;  5AW0 B;  2IYP A;  1QGK B;  5APT A;  1NTK K;  2LXB A;  3M0D A;  5E79 E;  5APU A;  4YXW H;  2I8D A;  1NKZ B;  1LT9 B;  3AEF C;  2O1J A;  4K3A A;  1HJB A;  3BCC D;  1SQV J;  1XTC C;  1KIL C;  2KNC B;  1FOS E;  4IFM A;  1KYO I;  1T3J A;  4HB1 A;  3D71 A;  1RY3 A;  2QRX A;  1N73 B;  2WSE H;  1FC2 C;  1S5L E;  2YMY A;  2HLO A;  4OGQ B;  2HYN A;  4H0L B;  1FZC A;  1NGM B;  2WMM A;  3HUS C;  1JB0 J;  2WQY C;  3VOP A;  1OIP A;  1M56 D;  1JY3 O;  4H44 D;  3S4R A;  1NU1 J;  1NTM D;  4IL6 H;  5BVZ A;  4HH2 A;  2QJY B;  1JY2 O;  3Q2Y A;  2OYH A;  2IBZ G;  1T3U A;  1N7S D;  1NTZ J;  4PV1 D;  3G9R A;  3I55 P;  1PPJ D;  2R3S A;  3A0B E;  3HD7 D;  2FYU E;  2AXT H;  5KLV G;  3OW2 O;  3H32 B;  1VQ9 P;  2XKM A;  1KN7 A;  1SQX E;  1NKN A;  1LTJ A;  1Q90 D;  2Z5H A;  2J58 A;  5AVR B;  4WY4 A;  3BCC E;  3CCE P;  2YIU C;  2XNX A;  3M91 A;  1K04 A;  4QMA A;  3TSI A;  3BVH A;  3L70 J;  4GT1 A;  4JYC A;  3AE7 C;  1IC2 A;  3CC4 P;  1NTM G;  1S3J A;  3B8E B;  5H2F E;  1FDM A;  1URQ D;  3B5N A;  3L75 J;  3S1K A;  2Y9Z A;  1SFC D;  1L0L D;  4PD4 E;  1N73 C;  3L74 G;  2V7Q H;  1SQQ E;  1NTM E;  3EFF K;  2LXC B;  3VMX A;  1IFP A;  1L0N G;  2IX7 C;  1PIX A;  1SQB K;  3CCL P;  1OW7 A;  3Q3D A;  1BSN A;  1KQG B;  3TGU J;  3E7K A;  4N6J A;  4WY4 D;  1KB9 E;  2BCC E;  3AE3 C;  3BCC G;  3V2Q A;  2KK7 A;  4I6M C;  4BRY B;  4CPG A;  2XND H;  1NU1 E;  2QG4 A;  1IFI A;  2Y0C A;  2KNC A;  3AEG C;  1MUU A;  2K9Y A;  1SQX K;  1QEX A;  3RK3 C;  1JM0 A;  2OTL P;  5KLV D;  2L91 A;  1SFC B;  5BU5 A;  1MFT A;  1S72 P;  3KHU A;  1L2P A;  1SQX D;  1X9V A;  5APY A;  1AA0 A;  3H1K D;  2FFD B;  2VRS A;  3AE2 C;  3FGA D;  1SQP E;  4WBA A;  1CW5 A;  1GZL A;  3HRN A;  2M3B A;  4UB8 E;  1KYO E;  1FDO A;  1OX3 A;  2A06 G;  4YXD C;  2V4H A;  2KLU A;  2OYH B;  4D6T D;  1RE4 C;  1SFC C;  2AXC A;  3CXH I;  3H1I G;  4DJG A;  2KS1 B;  1JMB A;  1KYO H;  3M9H A;  5AW3 B;  1SQQ K;  3L74 D;  3CI9 A;  3WU2 H;  3PRJ A;  2IPP A;  5AVZ B;  1IFJ A;  3I5C A;  1GU5 A;  1VDF A;  1J1D B;  3TYY A;  4TT3 H;  3KXD A;  5KLI C;  1LGH B;  3M0A A;  1QVG O;  2KLV A;  1H0T A;  1ZV8 A;  2C0X A;  3B4S A;  3PP5 A;  3RBZ A;  1HJ0 A;  2YNY A;  5B5E H;  1H8A A;  1DIP A;  4H44 B;  3UIA A;  2WVR A;  1DX7 A;  3RK3 B;  1JY2 N;  1SQV D;  2NPS C;  1NTK J;  3MHV A;  5KLV K;  1EQ7 A;  4W7Y A;  2POH A;  3SWF A;  1Q7Y Q;  1SQP D;  5KAI H;  1SQP K;  1Y9B A;  5CMZ A;  3IFM A;  5AW1 B;  3HD7 A;  1AFO A;  5APX A;  1G2C B;  1OMI A;  3TGU G;  1FOS F;  4U3F J;  1LTB C;  2M0B A;  4OWF A;  5C39 A;  1T2K D;  3CPW O;  4JYB A;  4DT0 A;  5CCH D;  1NYH A;  4KT0 J;  4JBZ A;  2Q5U A;  2AXT E;  2GUV A;  3H1J J;  1AVO A;  5GTI E;  4IL6 E;  2HPC A;  3KDP B;  3L74 E;  4XFJ A;  3K5B A;  1USE A;  2FXM A;  1ZR4 A;  4ZKU A;  1KB9 I;  3FWL A;  4ZMD A;  3L36 A;  2Z5I A;  4MN4 C;  3W67 A;  4JPZ B;  2GM4 A;  3CME P;  1LWU A;  1BE3 G;  1SQB E;  1J2J B;  2E75 D;  3CX5 I;  1NJI Q;  4Y99 B;  5AVS B;  4BRY A;  1FS0 E;  1LP1 A;  1NTK E;  1YYC A;  2JJL A;  2QJK B;  2ZT9 C;  2WPR A;  3L71 E;  1S9K E;  2BCC J;  2IFM A;  2NPS D;  1KQF B;  2KOG A;  3GLM A;  1HF9 A;  1LT1 A;  1QL2 A;  1URQ C;  1NU1 D;  2HOD A;  1GW3 A;  1N2D C;  1RE4 A;  1SFC A;  1DEE G;  1U7J A;  1X8Y A;  2HFE D;  3USS A;  1E5W A;  3H1J G;  3WMM 0;  3NFQ A;  4EYY Q;  1JO5 A;  1PV3 A;  3C9I A;  1KFN A;  2A45 I;  4WWI A;  1ZXG A;  1LT9 C;  2Y0D A;  1EZV E;  2IBZ D;  3KYQ A;  1OWA A;  1X79 B;  2W6A A;  3NMD A;  4D6T G;  3H1J D;  1H0T B;  1RE3 C;  1BDC A;  1EZV I;  3CWB J;  3M9B A;  2YKO A;  3A7O A;  4H0L C;  3VP9 A;  3PTZ A;  4HKZ H;  1OVU A;  2KS1 A;  1E79 H;  2WIT A;  4LGD E;  2KIK A;  3BCC J;  1Q82 Q;  1WRG A;  5CJ0 A;  1PZQ A;  2XDJ A;  3V2N A;  1FZA A;  4XA4 A;  1LTS C;  4BWN A;  1IFD A;  2E76 D;  2FYU J;  2ZAE B;  2SPZ A;  2WPQ A;  3CXH E;  3I56 P;  1G2C A;  1EXJ A;  3R4Y A;  4GKG A;  4OGQ D;  3RK2 B;  3L71 D;  1L0N D;  4A7P A;  1DD3 A;  2H89 C;  1MKM A;  3MP7 B;  3RK3 E;  1NH4 A;  1VQP P;  3CX5 D;  1VQ7 P;  1OW6 A;  1VF5 B;  1MFZ A;  2FXP A;  3EQ2 A;  3H1I J;  4R4L A;  4UB8 H;  2HOD B;  3CMA P;  2ZFC A;  2P58 A;  2C9L Y;  3L72 D;  3VMZ A;  2ZYA A;  1R8E A;  1NHL A;  2PRR A;  3NTN A;  5CCG A;  1VQK P;  4AUW A;  1GK6 A;  2WSS H;  1LP1 B;  4H0L D;  2KUB A;  3FX0 A;  1MZ9 A;  3FXE A;  1BGY D;  2K1A A;  2KZJ A;  2OYI C;  3WU2 E;  1GD2 E;  4I1L A;  1P84 I;  1NAF A;  3H1H J;  1VF5 C;  1JMM A;  3L75 E;  3TNU A;  4XE5 B;  3A2A A;  4I7Z B;  5KAI E;  5AW8 B;  5DJU B;  2KYV A;  2L5G B;  3VP8 A;  5KJ7 A;  2E76 C;  3CCV P;  1A02 J;  1JY2 P;  1M90 Q;  1LTA C;  3LID A;  2LKM A;  5CCG D;  1GTW A;  1JCC A;  1LTJ B;  3CWB E;  5E79 H;  4IOI H;  3VN0 A;  2P7J A;  2OTK E;  1KC8 Q;  2CPB A;  2IFN A;  2PP6 A;  2Y0E A;  4UB6 H;  2Q3I A;  1KB9 H;  1SQB D;  2O01 J;  2M5A B;  2WSF H;  3CX5 H;  1NTZ E;  3H1L J;  5AW9 B;  5L8R J;  3VMY A;  5KLI B;  1U57 A;  3ABV C;  2AEF A;  2RH0 A;  2R5D A;  1EDI A;  2AEJ A;  3OJA B;  1VQN P;  3L72 J;  3RL0 C;  1S2E A;  3SWK A;  1FZC C;  1FDI A;  1KMI Z;  3TGU D;  3A3Y B;  1VQM P;  2H88 C;  2FYN C;  1KB9 D;  4PV1 C;  1CSB A;  5AVY B;  2OYH C;  1JEK A;  2W6J H;  2MJZ A;  3L72 E;  1PL5 A;  1N8R Q;  3CC7 P;  1QVF O;  3VMA A;  3MD0 A;  3MGN A;  3M0D C;  1GDT A;  4D6T E;  2QEX P;  3AEA C;  1X0T A;  1IJD B;  1ZP0 C;  3H1L E;  3ZDM A;  4C7R A;  2ZT9 D;  2FYU G;  2ZVN B;  3HUS A;  4WVZ A;  3H1J E;  2NRG A;  3AEE C;  5BU8 B;  4I7Z C;  1QLE D;  1NWQ A;  2E75 B;  2C9N Y;  2J59 M;  2LR2 A;  1JY3 N;  2FBW C;  3TK1 A;  2G3A A;  4EOT A;  2JR8 A;  2P10 A;  1W5C E;  1BCC D;  2QJY C;  1LNQ A;  4ZNC A;  2Q3E A;  2WT7 A;  1BDD A;  1GW4 A;  1PGJ A;  4EI2 A;  5K5G B;  2Q9I A;  4IL6 X;  1QX8 A;  1LJ2 A;  3CXH D;  4H13 D;  1EDK A;  4W7Z A;  1J1E C;  1ZRT E;  3PLN A;  3KQG A;  4Y99 C;  1S9K D;  3A0H E;  1FZG A;  4UB6 E;  2QM7 A;  3OAK A;  2E74 C;  3GHG C;  3AE9 C;  2MKV A;  2OAR A;  3H6P A;  3JCU H;  1XTG B;  3H1I E;  1VF5 D;  5AVW B;  3CXH H;  3O6Q A;  3RK3 D;  2FYZ A;  1KIL E;  5GTH H;  2BEQ D;  2ZXE B;  1M1J B;  3CL3 D;  1YJW P;  1H89 A;  1PPJ G;  2KXP B;  4OH8 B;  1SQV K;  1FJP A;  2M5A A;  2HPC B;  2FFD A;  5CCG C;  3GHG B;  3W68 A;  3TNU B;  4KJM A;  1BCC J;  4LLH A;  1NO4 A;  2R44 A;  2W6B A;  3B71 A;  2H43 A;  2JKV A;  2ZYD A;  1HVV A;  2QVA A;  1M1K Q;  1FAV A;  1OVR A;  5GTI H;  1K73 Q;  4K35 A;  3BRV B;  1RF1 A;  1NU1 G;  1X22 A;  1KV4 A;  3RL0 D;  3TF5 A;  2XU6 A;  2OQQ A;  1HTL C;  3G3Z A;  4H13 C;  1SQQ D;  1SP4 A;  2ZXX A;  4L75 A;  2Q7C A;  1YHQ P;  1H88 A;  4IFD K;  3P8C D;  3G6E P;  3HD7 B;  3CWB D;  1JOC A;  1YQ3 C;  3F89 A;  3HUS B;  2WT7 B;  2OYI B;  1L0N E;  2HG5 D;  1LWU C;  1BSH A;  1NTZ K;  1NVO A;  1SQQ G;  3CWB G;  5APQ A;  1JY3 P;  2IYO A;  3A0H H;  4D6T J;  1L4A B;  2KZI A;  2Q1K A;  2NZ2 A;  3JSV C;  4N78 D;  3FWN A;  4PJ0 H;  5H2F H;  1KZU B;  4JF7 A;  2KB7 P;  1NTK D;  3JCU E;  3HE4 B;  3SSU A;  3L4F A;  3L37 A;  1TU3 F;  2NPS A;  1P84 H;  1LWU B;  2RN0 A;  3N7N A;  3V6I A;  3ITK A;  3KPE A;  2QA4 P;  1JUN A;  1NTM J;  4NPE A;  2GA1 A;  1M1J A;  2O1K A;  1YJN P;  2R3C A;  1FU1 A;  5AW2 B;  1EXI A;  5TIS E;  1FZB A;  1T2K C;  3H1L D;  3KZI H;  2QIW A;  3GHG A;  5AVT B;  5CCH C;  1LTI C;  3AE5 C;  2OTJ P;  3GF3 A;  1AQT A;  2E5T A;  2E43 A;  2QM8 A;  2IBZ E;  1N7S A;  3P8C E;  3SFE C;  1Y47 A;  5GTH E;  1PP9 E;  1RQV A;  4C7N B;  2JWA A;  2ZJS E;  2WSC J;  1SQX J;  1W2E A;  1NTK G;  1ZW0 A;  3G4S P;  3HE5 B;  1BCC E; 
#chains in the Genus database with same CATH homology
 4D6T J;  3CX5 I;  1BGY J;  2FYU J;  3L71 J;  1BE3 J;  1NTK J;  2BCC J;  1SQV J;  1SQP J;  1KYO I;  3H1K J;  1BCC J;  3L70 J;  5KLV J;  1NTM J;  3L75 J;  1SQB J;  3H1L J;  1L0L J;  3CXH I;  4U3F J;  2IBZ I;  1L0N J;  1NU1 J;  1PP9 J;  3H1I J;  3L74 J;  3L72 J;  3TGU J;  1SQQ J;  3H1J J;  1EZV I;  3CWB J;  1NTZ J;  4PD4 I;  1KB9 I;  3BCC J;  1SQX J;  1P84 I;  3H1H J;  3L73 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...