3L7NA

Crystal structure of smu.1228c
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
234
structure length
234
Chain Sequence
b'MRIHFILHETFEAPGAYLAWAALRGHDVSMTKVYRYEKLPKDIDDFDMLILMGGPQSPSSTKKEFPYYDAQAEVKLIQKAAKSEKIIVGVCLGAQLMGVAYGADYLHSPKKEIGNYLISLTEAGKMDSYLSDFSDDLLVGHWHGDMPGLPDKAQVLAISQGCPRQIIKFGPKQYAFQCHLEFTPELVAALIAQEDDLDTQSQTETYVQTAEEMQTFDYSSMNQALYSFLDRLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of SMU.1228c
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 75
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7nA00
3UK7A 4B5KA 1IZZA 1PDWA 3TTTA 2YWDA 2ZUSA 4AUNA 2LXNA 4ENVA 2RK4A 1M6VB 1VCNA 2VXOA 3F71A 4K2HA 1T36B 2YWBA 4OFWA 4Y1EA 4UOZA 1PDVA 3N7TA 3TTXA 3B3AA 4ENTA 4ZDJA 1QWSA 4AUEA 3TTYA 4ZDKA 4P36A 4LGYA 4BTEA 4LRUA 4JQSA 1I1QB 3CNEA 2ABWA 4AJ9A 3MGKA 2R1VA 4ENWA 3F5DA 4P2GA 4OGFA 4Y1GA 1QVVA 5LIRA 3CZAA 2RK3A 3NOQA 3EJ6A 4P34A 3ZJ4A 1BXRB 1C3OB 2ZUVA 3EFEA 4R7GA 1P7ZA 1C30B 1T0BA 4B2YA 3L7NA 4QYXA 3TTUA 1GGEA 3UGJA 1T3TA 4L78A 1OX4A 4B7AA 3PQ2A 3WFZA 1SY7A 3L4EA 4UCFA 5E9AA 1GPWB 1ONSA 2VDJA 3RHTA 4AULA 2A9VA 4OIFA 3NVAA 3ZJ5A 4E08A 4WINA 3EN0A 3TTVA 1QF7A 1VCMA 1IZYA 1GGJA 1GPMA 4Y1RA 1PE0A 4GUDA 3EZGA 3PQ3A 1KXJA 4RKWA 5SY6A 4ENSA 1N57A 3ER6A 1KA9H 3EWNA 3KKLA 3P9PA 3PQ5A 4ENRA 1CS0B 5IP5A 1Q2UA 4I46A 3NOVA 2OR3A 3SF8B 1FYEA 1P80A 2ZUUA 2VPIA 4WXYB 3R74A 4MTCA 4L8WB 2V4UA 1GGKA 1UCFA 3PQ8A 1CF9A 2ISSD 3CZ9A 4L8FA 3GRAA 4N12A 3PQ7A 3OT1B 4L95C 1IPHA 1G2IA 2ZUWA 2D7JA 4ADSG 4RKYA 3UOWA 5SYAA 4P5PA 3BHNA 4UZSA 3CY6A 4HCJA 1I7SB 3VU3A 1WL8A 1JVNA 1OI4A 1R9GA 2AB0A 2R1TB 4P35A 4UOQA 5DFAA 1I7QB 3ZR4B 1QDLB 1P81A 3TTWA 4ENPA 4L8YA 1SOAA 3D54D 1KEEB 2GK3A 5JZOA 1OY1A 1OX5A 3B36A 3SOZA 1GGFA 2VKTA 4XLLA 3P9QA 3UJNA 1O1YA 4AUMA 1J42A 3NONA 1L9XA 1P5FA 3TTSA 2ZUTA 5K4AA 2YWCA 1VCOA 1FY2A 1PV2A 4ENQA 3UMMA 5SY4A 2R1TA 1Q7RA 3FSEA 2RK6A 1GGHA 3BWEA 3FIJA 3B38A 2R1VB 1JDBC 3L18A 3MIIA 3PQ6A 4BIMA 2H2WA 4QYTA 4ZDIA 4ENUA 1OX6A 2W7TA 4OJYA 2VRNA 4N0MA 2XF2A 1KWKA 3NORA 1GG9A 4I4NA 2NV2B 3SF8A 5JZMA 1KWGA 4OQ4A 5SY9A 4MNTA 4BFLA 1OX4B 2IUFA 2GHRA 3L3BA 4L7QA 1A9XB 4OGGA 4PXYA 2AD5A 3M3PA 4MGHA 4E5VA 1K9VF 1VHQA 3PQ4A 3R75A 3OT1A 3P9RA 3CYFA 4UNIA 2NV0A 1S1MA 4GE3A 4S0ZA 4I2NA 5BV2P 1QVZA 2R1UA 4Y1RB 3TQIA 3P9SA 1QVWA 4B40A 3R76A 3NOOA 2FEXA 4ZGGA 4Y0NA 4Y1FA 1P7YA 4B31A 4D1YA 4GE0A 1U9CA 2YWJA 1CE8B 2WJZB
chains in the Genus database with same CATH superfamily
4LZPA 2AQHA 1E3LA 2J3EA 4R6WA 4Y3UA 3O4GA 5TE9A 3WAGA 3DV9A 3SPXA 1NXXA 1S8AA 4IIBA 1DC8A 1QBKC 1RDFA 2IPXA 2XX3A 3PP8A 5K2MA 1QHEA 3G8YA 2BGIA 4ZCQA 1G59A 3LQFA 1CQZA 4CG1A 4PX2A 3Q98A 4BTEA 3R3JA 1PR3A 2CFTA 3VPFA 1R66A 2WJGA 3WL6A 2IYTA 2VRWA 3OKFA 4FLEA 4HPJB 4QX6A 2V4ZA 3U1BA 1QR2A 1W2GA 4NEHB 3AVWA 1D9ZA 2YQ4A 1VJTA 4PC6A 1IM5A 2Y1DA 2F1OA 2L19A 2WFLB 1NOKA 2PU5A 3CLUD 3DPUA 4RADA 4EPXA 1U5AA 4NBRA 3G0OA 4O0MA 5BNTA 1MFZA 5FBRB 3STVA 2QRLA 2C57A 3NAMA 4OXIA 5A71A 1GDTA 3W3AD 1SEVA 1SNYA 1GCOA 1Z2DA 2FPUA 4OL9A 5HMLA 2PKCA 2PKWA 4GZLA 2QOEA 3KB6A 5AK6A 2O2EA 1ZA1A 5HHTA 1UKZA 4Y2QA 2VDKB 2XT6A 3NBUA 5L45A 4DNOA 2XTJA 2W2LD 4KMRA 3TFOA 1RNLA 4N7BA 1EDZA 1MRSA 3THXA 4TXHA 1JR2A 3HU3A 4N03A 4Y9DA 3GJQA 1VGVA 2NM0A 2IYNA 5I47A 3RUPA 2ZT5A 5JCPA 3I64A 3Q3IA 3AOEC 3QU5A 4JLMA 1A5ZA 1P9OA 4RKQA 4NBSA 4BQQA 4N82A 4F60A 3CWQA 3HWSA 3CX7A 1KR2A 1PT9A 3LL4A 4IXDA 1QTIA 4MDEA 2XRYA 4G0YA 3GPLA 4KDEA 2W6ZA 5DDIP 1RHQA 1YA8A 1IWOA 2OK8A 4DUGA 5FX2A 3OWXA 1SIUA 4JJFA 1P8JA 1SA0A 4B0PA 4JCCA 4PZZA 3PITA 5JY6A 3R3WA 3EMKA 3VTKA 4MKHA 3VXKA 1AOXA 4B6JA 1JJIA 2R00A 1MUUA 1OX5A 2IZ0A 3MA0A 1ZOOA 5AJTA 2OORA 1NVVQ 3HP7A 3LBHA 3RTCA 4OAOA 5K5EA 1NMZA 3PJDA 1A95A 1U3TA 5E1MA 1KDVA 3SS9X 4M98A 3I28A 3LKDA 4FC6A 2BFDB 3ZV3A 4ENQA 4RSHA 2R1TA 1JMKC 4UHJA 4S05A 1Q91A 4C7KA 4C7OA 2PYDA 1FFXA 1ATZA 2JATA 1I5OA 4RD0A 2WFMA 2H1FA 1IZ8A 3LAWA 3PA6A 4UVEA 3AHHA 2MCFA 3U9TA 2FLWA 3ZY4A 3LVBA 4DR4B 2ZRDA 2CDNA 3RH0A 3FUXA 1AIPA 4M7PA 3ZLBA 2WILA 3WOVA 1O8CA 2HWXA 1R50A 3OOSA 3L7OA 3PUHA 4A0FA 2JFZA 3A8TA 3Q8WA 3CW9A 2CXPA 2Z1MA 3RVRA 1QMGA 3ZE2B 3DE6X 3L7AA 1ODFA 4X60A 3NHSA 4U7WA 3PNSA 2HA2A 3LC0A 4ITVA 4LBWA 1VXOA 4JY7A 4PXYA 4RF2A 1KC3A 2OENG 2W2PA 3V5NA 2AK3A 4IZ6A 3MGAA 2V7VA 4NEQA 1V5WA 5J2UA 3ICWA 4H27A 5FPQA 1M2VB 4P80A 4CRWB 5BURA 2AHRA 2VJDA 1V8BA 1QIIA 1UJ4A 5FA6A 3V7YA 1BWSA 1J24A 3N53A 2JAQA 4URHA 4B46A 3AUTA 2ZBVA 4RDHA 5IK2A 1RT9A 5LBUA 1QGZA 2JFFA 2QN3A 2XHZA 5IEBA 1ISHA 3Q7RA 2QZSA 3T38A 3FBTA 4M53A 3VSCA 5JDIC 1J1UA 3CWCA 1Y33E 4JQCA 4J1TA 1DRWA 4CV2A 2RBEA 4UBOA 2KPOA 5LZ9A 1D2RA 2HH9A 4Z7OB 3ITNA 1OTYA 3T5GA 2MHCA 2PSEA 3AKEA 2X2EA 4Q9JA 4YB8A 3O4RA 4P82A 1LPNA 5A4FS 4XDGA 3KSAC 1XPRA 3SHQA 4GMFA 1KI1A 3H9BA 4BRSA 3W8NA 3TLXA 4EY3A 4ABYA 3EW9A 4JB8A 2WM8A 1SG0A 1TYAE 2XVXA 5FUYA 2F00A 2Q2NA 3FMPB 2FZLA 2C7VA 1U0RA 5G41A 1LS6A 1GGEA 3LRXA 1E4VA 4MEBA 5J4LA 4Q7KA 3OJLA 1Q20A 5D87A 3L6BA 4EY7A 3V42A 2I4OA 3H7AA 1W4RA 2EF0A 3HU5A 3QHAA 2Y68A 3T7TA 2VRCD 1TRKA 1GU0A 1RXUA 1DLJA 2K4MA 2C9ZA 3QWAA 1OUMA 5T4EA 4ZD6A 2A1TS 1Q1QA 1IK4A 1IBSA 3CU5A 4B4UA 4AU1A 1WTCA 1ZJYA 3JQ8A 4ZV9A 4CMCA 3ZEIA 1UKBA 4EDFA 4OLAA 3D7NA 1SXJC 1UMDA 4J07A 4E12A 1WR8A 2P7HA 4GXRA 1EFCA 3OEEA 3CX3A 4MMZB 4YTEA 3D1VA 4UE6A 3MWKA 4FOLA 3VPBA 5JVDF 3QWFA 3GLRA 1RQXA 4BO2A 1U8ZA 4N12A 3C7KA 5KKAA 3WA6A 4XSVA 3IUSA 3SXUB 3FNEA 3O2QB 1DFIA 2JL1A 4UOQA 3N76A 1S2GA 5C2JB 2DT5A 3ND9A 4JEHA 2RGUA 3H8VA 5EZSA 3H1GA 1AX9A 1GR1A 3E3NA 3FTPA 3LWDA 3B8EA 4QBIA 4WVFA 4OX9Y 2FEKA 1CEYA 4PO1A 4TLEA 4AB1A 2E49A 1KPHA 1HH4A 1L9XA 1XKQA 2EP7A 3J7TA 3L82B 2AQKA 2QUAA 2VJQA 3C3JA 5ITZA 2AGVA 2DP4E 2H9AA 2VQ3A 2XKJE 4WZAE 1ENPA 1LI5A 3HLKA 2JAPA 3Q5DA 1R0ZA 3PNQA 5E0OA 1EWKA 3I9KA 3O8QA 4ANFA 3NS7A 2PAAA 3HY6A 3VNQA 1FP2A 1KZ1A 3KE8A 4BJ3A 3NRJA 5BUZA 4W9RA 2G4LA 1G4AE 4QQRA 3DYIA 3MMZA 2H92A 1MP0A 4YVFA 5G3ZA 5ARCA 1UMCA 3PDJA 4UDXX 3CT4A 1E0AA 1TCCA 1KS2A 4X85A 1FDVA 1TO1E 5ERXA 4ZI7F 3H1FA 4RXUA 1OX4B 3GDOA 2Y6VA 3OPVA 5BQFA 3IP5A 2ID8A 1Z3IX 3FR7A 4OP1A 4BQSA 3PCXA 1V4NA 4FEAA 3Q7TA 4YRTA 1KI2A 3CXUA 3AV0B 3AJDA 1CRWG 4NENA 4XVQA 3V1YA 1XCBA 5IC5A 4JGIA 4O02B 3FNGA 3VYWA 3NX4A 4BO0A 1QVWA 3A7EA 3AF1A 1AE1A 2FX5A 4H7JA 4Y0NA 3HS3A 4D9JA 3R20A 3ZPXA 3PDUA 5FKJA 2CLFB 3KYJB 4OAQA 4GI2A 5UKDA 1WCIB 1PFWA 2Z8ZA 1DPFA 1AKYA 1NHGA 2YWBA 4JDUA 3NBFA 4F8JA 4WOCA 2X5OA 1KORA 1H8EA 3NC4A 1KEUA 4Q16A 4DKXA 5HUQA 4MLDA 2GZDA 1UEXC 2HMUA 2JD0A 3B1VA 1K0FA 4WN3A 4WFKA 1D1PA 3II6X 4Q3KA 2H06A 4IY1A 2A6PA 4NMMA 1U6KA 2ZTVA 4KXUA 1NR1A 2Q4OA 3ZG6A 3QG5A 1XAHA 4MWZA 4IS3A 3EODA 2PUGA 3FJOA 3KOXA 4TUYF 3EWAA 2AEEA 2FWPA 4HTAA 4U7TB 2BH2A 2BMAA 3SE7A 2QN7A 1K5DA 4O2AB 2MYPA 4QQFA 4AJNA 3TQHA 2PX5A 4D3DA 1DEXA 3Q0EA 4KKVA 3STXA 1WLYA 1P1KA 4KFCA 5FFFA 2XUOA 4BE9A 4OPMA 2PX8A 2HBZA 2ZIVB 2HA4A 3NGLA 4FK8A 4MR7A 1QTRA 2P8SA 5B2FA 1ZJZA 1RYEA 2RAUA 2XWBF 3FNHA 3IEIA 2FWNA 1KY2A 1N2JA 3L8DA 4GUDA 4AY3A 1P1BA 1ZIPA 3E22B 1XU7A 4E7PA 3K4HA 2IYYA 3HV2A 4BTVA 3NTLA 1UPBA 1N9ZA 1CJMA 3PGMA 2ON6A 1JTVA 3WB0A 2VPPA 1FX0B 4LCEA 1CQIA 1R27A 3GAZA 1MOZA 4KLRA 5H83A 3VAZA 2O2SA 4DMMA 1B26A 2GAAA 4UVHA 1FYDA 2ISSD 3FKSA 4M46A 4NC9A 3CBQA 3C6MA 5BN1A 1N77A 4B4WA 3WLRA 5KJFA 1ZW1A 3I8SA 5T64A 1EWTA 3BHNA 1E8DA 1VIYA 3H5IA 4F96A 2UXDB 4COOA 2J9FB 3FZQA 4RZIA 5EVJA 2FU5C 2NT3A 2RHHA 1J1ZA 1EFVB 2GO7A 4IJKA 3TAXA 1F2UB 1MR3F 3M1LA 4RF5A 1Q14A 4OUKX 4UNRA 4DPMA 1ACJA 5J4KA 3QM1A 3DT9A 3KZVA 4YCSA 4K0KB 3ONNA 3PX3A 3LX6A 3DGFC 4PRLA 2YWCA 4XGQA 5F73A 4RTQA 5KSWB 1EK5A 8ABPA 2GASA 1U3GA 3MCVA 3K0KA 4KQWA 1G8HA 2Q5LA 3PUKA 4C0JA 3CRW1 3H18A 1NYLA 3VPSA 4B47A 4DUGD 5D7BA 4RZQA 2A33A 4C1NA 5AVQA 3FCSB 1TM5E 5ANRB 2VFAA 5THXA 4YIHA 4R1UA 4LXTA 3MYYA 1V41E 4J6EA 4IYRA 2FPIA 2NXEA 1SCDA 2JA1A 2XXBA 2REQB 2WIFA 1B6RA 4LXIA 3FUCA 1Z36A 4D0RA 5CUQA 1UPFA 3ESAA 2AUMA 3GGCA 5B2ZA 4G67A 4PF1A 1C9NA 2YMMA 3RCBA 2LV8A 2VHYA 1W2WB 3D7LA 3N7UA 4UNNA 5E95A 3TEMA 3ZK8A 2JD1A 1PCXA 1L6IA 4C3UA 4G36A 3V3TA 2XKBA 4QAJA 1YA4A 4QUBA 3TB4A 3OCCA 5F35A 2Q0QA 2WKRA 1H1LA 3PZBA 4KHZA 3RJMA 1C1DB 3DFIA 4E2FA 1I2BA 2BEKA 2R7LA 3N6RA 3Q40A 1A04A 5DJ5A 1KFKB 3JARB 1GNSA 2RI6A 4X93A 2EW1A 3CF6R 1OU0A 3BKXA 2AK2A 3CEPB 3OJOA 4YMVA 1XRSB 2O2YA 4H31A 2J3QA 3O47A 4JMLA 4FKMA 4NAUA 4KPEC 5JHHB 1KZYC 3VBEA 1Q83A 1P0CA 4B3CA 2HD4A 4HQ6A 1FPQA 3QKRA 5KDOA 4HQOA 1FVHA 1YKSA 4L2IA 3VMMA 1G3UA 3R7SA 3P9XA 2JANA 5K8JB 4MQBA 1A50B 2B2CA 1P0MA 1SBHA 2AYXA 2GTIA 5IK2D 3F5DA 2PHZA 3GWGA 1OXSC 1GP2A 4GVXA 4LC9A 4Z4QA 4XPIA 4QPJC 5LKRA 1JPVA 3ZJ4A 1M2KA 4W1QA 3NBAA 1RPJA 4UBJA 2BMVA 2JNWA 2AMFA 3HMQA 3TJZA 1W4CA 4MR9A 5AM5A 3ZCQA 5JNRA 4DV7B 4D9FA 3O95A 4JA2A 5BVHA 3TGPA 1IXYA 1UKVY 3Q72A 4FYXA 3MD0A 4KPGA 4WLFA 1W0CA 3L6DA 4DWWA 5K3OA 1TGVA 4V0RA 5KU1A 2WTAA 4B3DA 2Q0SA 2CFCA 2QR5A 2OCKA 4PCUA 2DQYA 5I9MA 2JPDA 2DFPA 1Y8RA 1YS9A 3X0DA 2IVFA 1UQTA 2ZITA 1E9SA 1QB8A 4NOJA 3FJYA 4BHTA 5JBQA 3I83A 2WJHA 2L82A 5DN9A 2P2LA 1YKFA 1F7VA 4HNUA 2CVZA 4CIVA 3IR6A 4E33A 1Z2NX 2PS0A 3FFBA 1GQQA 1KMNA 5JSKA 4TYNA 1H2FA 2R6AA 1HYGA 4LXGA 1Z0ZA 1XL0A 1J70A 5AVKA 2HPZA 1MXFA 3O4IA 2DULA 1S3SA 3G7NA 3G2KA 4FHGA 1XMQB 3I5XA 4FFBA 4YJ3A 3IBCA 3TSAA 3IHKA 5ARBA 2FK8A 4JAVC 4LG1A 1UFQA 3ABOB 5PNTA 2O2GA 1E2BA 2QUHA 3A9VA 2JHAA 3OEED 3GMTA 1BNCA 1RHJA 2R751 2OO3A 1A7JA 3DR5A 4U4AA 4FD2A 3IUEA 2RJOA 2D1RA 1NVEA 3HI6A 5G1OA 3WLHA 2IYVA 3GVPA 4GI3A 2BHSA 3CMCO 4ZYZA 5LM3A 1ACLA 5AR1A 4QPPA 3W2HA 1OWOA 3V4RA 2AG5A 3AEUA 5K6RA 3I34X 2HF2A 5JYDA 1FDOA 1OXTA 2HK7A 2ZREA 1POWA 2RK6A 4A8TA 1NRIA 4DV1B 2G72A 3JWIA 3RSQA 1QF6A 2POQX 1U9IC 3HKBB 3L43A 4R2JA 4QYTA 4TM8A 2NSHA 3CX6A 4S0XA 1FB5A 4EJSC 5TS2A 3P0RA 3CZCA 4BV3A 3G8BA 2FFHA 4XQGA 2VNHA 4MAFA 3QOXA 3RYIA 5D00A 5C8ZA 4TV8F 3IMKA 4R3NA 3LUBA 3AG5A 4BQIA 4OD0A 1M2FA 2ACWA 5KYUB 1AA6A 2I7TA 2O8EB 4A2WA 2CJPA 5FUBA 1MORA 2VZEA 5CPBA 2LRHA 4CETA 1XEWX 3LBNA 3MBOA 4C0KA 3K70D 1XA0A 4GMXA 4JX8A 5LA6B 1ECCA 2BLLA 2VHTA 3VU9B 4AJEA 2JIZA 2IV3A 1UQUA 2P41A 2QM8A 1LUAA 4GBGA 3U26A 3VOSA 5F7OA 1IY9A 4QM6A 5FUWA 3PNOA 5JAIA 1LDMA 4YUWA 2C92A 2YWXA 1PDWA 4DQLA 2WAYA 3LKVA 3SYLA 1L4UA 3C3DA 4AKHA 4J0JA 2GERA 1L5YA 1TADA 4KXXA 2JGNA 4ZC8A 3HRKA 4TTSA 1TEHA 2XZLA 3SSNA 2JBAA 1VBKA 5EWLB 4RJLA 2GBLA 3GT3A 1ZNYA 3PPYA 3RU9A 5KI6A 3WP1B 3IIMA 5GOTA 4KXQA 3NAZA 4TMWA 3AESB 5IANA 3IV9A 4K9RA 2O0HA 3JD4A 2HMVA 3FZEA 2HC9A 2R8RA 5CCXA 3VR3A 3V7UA 2FQXA 4U1RA 5FWNA 3U5TA 4R2IA 4A5SA 3GLFA 1E8NA 1XMXA 1KI8A 3Q3GE 4ID9A 1H8ED 2CB9A 2VPXA 2PKRA 2XOEA 5KINB 1QR6A 4GZ3A 2ZPTX 5E9AA 4ZAVA 4C4RA 1Q1GA 3GU3A 4UHEA 1XHEA 2EFJA 1TX4B 3VR2A 5LMNB 5HDBB 4TS1A 5ISMA 3IQXA 3TBFA 2XE7A 2ZYVX 4MUXA 4UULA 1GPMA 5JAQA 3ZWBA 4H7PA 1BH6A 5JNTA 3PRYA 3STWA 1T8UA 4UM5A 3FHTA 1KJ8A 4URFA 4X92A 4LOAA 1FS4A 1WJGA 2PLNA 4HS4A 4M9SA 5IP5A 3EOAI 3VAAA 4OBWA 3ZW8A 1CJSA 3JWEA 4DAOA 2OZPA 3AI2A 1R0XA 2WABA 4CI9A 2YKGA 1JJ7A 2LE0A 4B6SA 3ZVMA 1H2YA 1A97A 4EHIA 3RHSA 1U02A 4NZZA 1OU4A 4OAPA 5L6MB 4L8VA 2NTJA 2FW9A 3I2KA 3WWZA 2NVUA 3EPHA 5DHFA 1V5FA 2VAXA 1OYOA 4ZQGA 4M4SA 4G4GA 1HZZC 4WN9A 3NEAA 3Q9LA 3H9UA 1RQPA 4KIWA 5HF5A 2ESRA 2X0EA 1UAYA 4PHGA 5JO9A 2FCAA 4I1UA 3H8SA 1Q3KA 2Q5JA 2VBIA 3V32A 4K9QA 5AJUA 1FLDA 4GOOD 1E69A 2I6FA 2RH4A 3JZAA 3BE8A 1I9GA 2SKEA 2J4FA 1TQHA 3ZE1B 3FKSD 5DHQA 4E88A 4ZCIA 2A5YB 3KUXA 5JEDA 4QEKA 3PUXA 3U37A 5BW8A 1JIQA 1PGQA 3C8MA 3H75A 4WBNF 5JSFA 1AKVA 2EYQA 3I76A 3BWEA 5DW3A 3QPWA 3RTAA 2N3ZA 3R9XA 1DP4A 4M89A 5F5LA 5IWAB 4EGCB 2YVAA 1QRRA 3R3YA 4TVSA 3GLIB 1XR3A 5IS2A 2WSBA 1T29A 1ZAKA 4KN5A 4BBPA 4YPOA 5JROA 2H3HA 4PLPA 2IUFA 4RM3A 4TYYA 5TPWA 3EZXA 3OZIA 4E3WA 1J49A 1NHWA 1VPVA 3Q9UA 1XU9A 1XKLA 1Z6QA 1CDOA 3C74A 2XT9A 5CCEA 1CY6A 4HDMB 3P9KA 2WTBA 4D9IA 3K71B 1FBNA 1WUJS 2QQ0A 2YR0A 3NWBA 4ZT6A 1U7ZA 3JD0A 3V00A 1R6XA 3WNDA 4LRXA 3RAJA 2IYRA 3Q7SA 4ZGGA 1KY5A 1PX2A 1UT8A 2EGUA 3BVPA 1OBFO 3OCVA 4ZU6X 3VYVA 2G06A 4OQEA 1KGSA 4HK4A 2H4WA 4PNEA 5CB0A 3GDFA 4N8DA 3MXOA 4CKCA 3WA7A 2O2XA 1P75A 4RDXA 3OU7A 1KKMA 1E1RA 1Y5IA 2D1QA 3TEJA 2FG5A 4PYJA 1N5OX 2GEKA 3I53A 4Z6KA 4NRDA 4NE9A 1L7VC 1IJKA 1FNDA 3FWZA 3EZYA 1LQ2A 2OQIA 4NCJA 5EJAA 1L7BA 2HRCA 2YRFA 4ML3A 1R5BA 4Q9LA 4XTCS 1JHZA 4FGZA 5ETJA 4UVGA 1E1MA 3ZHVA 3RJZA 4DSUA 2CL6X 3M9LA 4MUBA 1IZ9A 4LRYA 1PTKA 4E2WA 1EGQA 5C8YF 2ZWVA 4DT1B 2C3YA 2HCRA 4YCAA 3IO3A 4P2BA 4INAA 1WVMA 4AM8A 1KHTA 1Z17A 5BN5B 3T9EA 1IBMB 3R6LA 3FDZA 2QLJA 1VJ5A 5GMOA 1UXOA 4NOLA 3MWJA 4TM7A 1U11A 2R2AA 2XNCA 4RFSA 4V0SA 4Z0HO 4TSRA 4RD6A 2W2OA 1FNBA 1RYMA 4IIXA 2UUAB 1SHTX 4C2UA 1LPBB 3AILA 3HZHA 3VJLA 2PBLA 3PC3A 4PFSA 2WP0A 2X7XA 5HKBA 3DEYX 3OSUA 4XD2A 4GFDA 1GFWA 2XBUA 3RYTC 3TE6A 4M3NA 3RWMB 4ZYWA 1F2TB 1V9LA 3IP8A 3PGVA 4BVJA 3DXXA 2EFYA 3I1YA 5EJFA 3W90A 4RLHA 2HYIC 4J49A 1VSVA 3CPJB 3R0XA 2AFVA 4DQXA 2PDAA 2W37A 1JG1A 4LQ4A 1MB0A 1XCGB 5CR9A 2K87A 3RWOA 1F9AA 3UFBA 1GPLA 4KPUB 4IHQA 3L0ZA 5KDDA 3BQ9A 2ZIWB 5DWVA 4M1YA 2HWYA 2EFEB 5DFAA 1W5BA 3CVWA 4X20B 3T1VA 1WXXA 1YXMA 4I50F 1OIVA 4DCCA 4ENPA 4YAJA 4Q9AA 1T2UA 4Y9UA 4HUTA 4J6FA 3ZJUA 2AFRA 1HOTA 1YC2A 3M1YA 4I81A 2M32A 1GGFA 1J8MF 2F43A 5JG7A 5KHAA 1GUYA 1FDTA 3UJNA 3OP4A 4A73A 4TRNA 1MO3A 4U0KA 3AV3A 2DF8A 3WSTA 4WFIA 2OC4A 2X86A 1ZGAA 5IDWA 3BHJA 3WHIA 2GPAA 2RBKA 3VHXA 4CKBA 1SZPA 4QUJA 2V6JA 5A4IS 2JFWA 1TW3A 1ZEMA 4WDRA 5FPHA 1RI1A 4KUGA 4MP8A 4E2YA 1W59A 4JOSA 1HQDA 2FFQA 3MINB 3C98A 4BMZA 2H0AA 3KZKA 5KVVA 1YGYA 1KVRA 2Y1WA 4HXGA 5JZMA 1JWBB 1U0NA 2EATA 3P2JA 3LK7A 4MV9A 3EPRA 3NNNA 3S1AB 3RRJA 2Z9BA 5CBPB 4L3WA 3UMJA 1E2KA 4EKDA 1HEYA 1TM7E 3HZOA 3QJ5A 3CYFA 4YMHA 1P4HA 4V1CI 4WA7A 1E9EA 2HM7A 1RACA 4OHZA 2MU1A 5KC9A 1AS2A 2OV8A 1E7RA 3O8BA 3OICA 3GK3A 3DFFA 4S1WA 3GCWA 1DKOA 3LVFO 4XDHA 4C0LA 5BQ3A 4G1CA 5CXUA 4MVXA 3U44A 4P34A 4MB0A 4CLXA 4DM3A 1D0VA 4K40A 5HKKA 1J0AA 1X1QA 4LRTB 3EIUA 3MPUA 4GR5A 1JALA 3H2YA 3DWGA 1VL2A 4ZQCB 2SBTA 3WRWA 1O87A 5I7FA 1CJKC 2OFXA 4GR9A 4IUDS 5C32A 1YQQA 3ET4A 3QZUA 3EDCA 1HUQA 2JIZD 3BBLA 2R66A 1JW9B 1Z45A 1KO5A 2F3SA 3W9SA 4A4DA 1OILA 2CLHB 1EU1A 1OLXB 3ETEA 5IG2A 1GPUA 3O4HA 1SZCA 4PNHA 2YZGA 3DDSA 3OJEA 4HGQA 4QDZA 4W9NA 5G2OA 1I94B 5AW3A 5JHGB 4ZI5A 4GOLD 2SECE 1UBTS 2WUWE 5EJGA 3M6IA 2WINI 4DG8A 2RGAA 5TEWA 3FTDA 3TAHA 4L3VA 3DKPA 1U2DA 2Q3EA 2FSUA 3SF0A 3VU8A 1YCDA 3GRUA 1LI4A 3IPYA 5HG0A 1W4LA 2R79A 3UMFA 3N9IA 5K0TA 3A6HA 4L1KA 1YAHA 1P6QA 1OLSA 4GGOA 2WZCA 4K5QA 3TVTA 3ZJ5A 1WX1A 3PYXA 4GZ5A 4PGAA 4BO6A 2AMYA 3W8DA 4GBMA 1PUJA 5TJ9A 3VR3D 1NWCA 3HCWA 3H13A 3L7IA 1PLJA 3ZVLA 5IABA 2Q4DA 1E2PA 2IY9A 4MVJE 2OZKA 3FUTA 4P8RA 3QP9A 2ZSDA 4FFMA 4TMKA 1ZH4A 3M81A 3GEEA 1L7QA 1MD9A 2Z2KA 4GKBA 5T3YA 2ANCA 2DEUA 1ZUIA 3KM0A 1JEDA 4FYVA 1OCEA 3VHQA 2HIAA 3GEIA 3SC2A 4E6PA 1N7JA 3MK31 4G5XA 2QTGA 3ESXA 1PGJA 1X7ZB 4FFNA 4HQRA 4PAQA 5L7YA 4BRZA 4D02A 5KTSA 4M55A 2PH5A 4DC0A 2XNJA 1N8SA 2BI4A 3QW4B 5FRDA 2XQFA 3ETNA 2D5IA 3HFGA 4N6OA 4KP7A 5EXXA 4RY9A 4XQCA 3G49A 5IAEA 2QZJA 3FRJA 1WMSA 1E64A 2YY5A 3K0EA 4TL9A 4Q3NA 3WB2A 2CDRA 4F2GA 3QVOA 3S2GA 4R6XA 4GHWA 3CEJA 3M1AA 3QVGA 4MHOA 3M9WA 2YYZA 4MTLA 1I1HA 2R5NA 1LTQA 3GFGA 3LNCA 1NG1A 3VKGA 5EE9A 4IG9A 3I2FA 3D4OA 1KZ4A 1WETA 5IYZA 2FEAA 2X8LA 5IFKA 4M6WA 4X84A 3ZGVA 5AD1A 3IOBA 3S99A 5D5HA 3ZBPA 4OHFA 1V96A 4PBRA 3L8MA 3T34A 5DNUA 4Q12A 5CT5A 3OMWA 3QUAA 5F21A 1LFDB 1EFDN 2QU8A 1W5SA 4ZOLF 3L46A 1XVAA 1TJ5A 4FB4A 5LB2A 2HBQA 1RMYA 2XBLA 5A06A 5L40A 1DTWB 1YQWA 3KOOA 1MG5A 3PDIB 2A0YA 3QXCA 3BMCB 1AKMA 1W2HA 2ZT6A 3CF2A 4O33A 3WV4A 5JNVA 3FVTA 1KJZA 1PVVA 3IIJA 4GI5A 4LDJA 4NV3A 3ASUA 5IM4A 2HWUA 1ZQ9A 3UV3A 2RJNA 3I04A 4A03A 2OC9A 2GKOA 1J2EA 3MLAA 1GXSA 3P4YA 3ETHA 4NULA 1GNQA 5E6SA 2FPXA 5AJXA 3SBEA 3I5YA 1NBEA 1X8JA 1FVFA 1Z08A 2OD7A 4GO1A 3QPUA 4V0ME 3ZWVA 4CUKA 1MJGA 5LZ2A 1QIHA 1Q0ZA 1OFHA 1FFWA 3A6EA 5LQSA 2YWDA 4CMBA 1P73A 3ELBA 4ND5A 2VUUA 4MPPA 4ZZ1A 3RLFA 1EQAA 3IPXA 3PXEA 4ECAA 1M3SA 2FWAA 3RKRA 3TDKA 4RH3A 4AJIA 4DVGA 2CVPA 1G8PA 2R6CA 1BKDR 1N7IA 3F1LA 3HY3A 4AJ9A 3KTAA 4HEHA 2G80A 2PRKA 1QVVA 3MMSA 2JGRA 4DDUA 4BKOA 1DBVO 3HWRA 1XD2B 3OLWA 5DTJA 3KHTA 2A9JA 5LIPA 3CPHA 1VIMA 3NH6A 4WE3A 3RFXA 3V4LA 3U6KA 1C80A 4ESHA 1X87A 4B79A 3IBTA 3HVRA 1E1RD 1RKBA 2OBXA 4YAOA 1QNFA 3HXLA 5B3LA 4IVRA 1XNRB 2NUAB 1C50A 4LC1A 2RHGB 3D5QA 1FP6A 3D6FA 5CDUA 2PH7A 1BXGA 3G2LA 4JJZA 3WYDA 5EJEA 4KXFB 3EZ7A 3TLMA 2PD6A 1G5PA 4S1PA 3W8EA 1RWVA 1HNXB 3K9HA 3KQNA 4WKNA 1VLVA 4RZ2A 2HEGA 4J0FA 4JVSB 5ECDA 5TF0A 3TQRA 3OC0A 4RK5A 2V7TA 1JKIA 4HLNA 4Q6BA 4QFCA 3WX0A 2ZVJA 3OFVA 1AHPA 1R5JA 2QL6A 3H1AA 5B1YA 5AVUA 1FSFA 3FYUA 3IP9A 4H6XA 4OLBA 3RADC 1XZHA 4JEMA 1EUZA 2J5XA 3JD2A 2YFYA 1J9ZA 2ZXUA 2UVQA 2XCUA 1HG0A 2X1MA 3KWLA 3N8DA 4KMOA 2ZG6A 3G2OA 1NC1A 2Q5OA 3FOCA 4YACA 5KTNA 1EDBA 2DXIA 4MP6A 4N8SA 3IUYA 3GG9A 4HCJA 1RAEA 4EUNA 3IKVA 1UBFA 2O6HA 2YIDA 1KBZA 5FP0A 3VNVA 4LE0A 2YWEA 2EJUA 1LF0A 2NXCA 1JHVA 4YCNA 1KP2A 4ESOA 1TRHA 1WXQA 2AR7A 2H4ZA 2JRCA 1PL7A 2VT7A 3E6AA 3DBVO 2GPSA 4AX4A 2C7OA 3LTNC 4L85A 1MV5A 1JVSA 5KVCA 4OYLA 4PZEA 2QMEA 4QULA 5DTQA 5LU9A 3KU4A 3UMMA 4M49A 1U8UA 1Q7RA 4QDXA 1FLNA 4B4KA 3L1IA 3FYHA 1PI3A 1IRXA 2HA6A 4D3FA 2NUPA 1XQ9A 2Y9PB 4PLVA 1GSOA 4FHZA 4J0GA 4C4TA 5AVRA 1LC3A 2A7XA 2EP5A 4RFVA 3COPA 2WWXA 3C8UA 1F3OA 1K98A 5F4BA 4J94A 4AXBA 2B0CA 1FXWF 2FR0A 4HB4A 4UREA 1MQ8B 1V1RA 2CWDA 3GCDA 1D5WA 4YI5A 5JQGB 1SXJB 4DIMA 3GLIE 1BWPA 2ZRKA 3D6TB 4QU0A 3TVYA 2YXDA 4FDAA 4A6DA 2XXAB 1A9PA 3CPEA 3FBGA 1U8FO 2OXTA 4OCZA 3S7ZA 3GO4A 1M10A 3VDQA 3WKAA 2FTKE 5K3DA 4BBAA 4DBLC 3JX9A 3EEOA 3DFKA 2Q50A 3KBBA 3VU0A 1Q11A 3MS2A 1Q2XA 1U7HA 2GJKA 1L4BA 3C5VA 1DV1A 1GL3A 4QECA 5H82A 4YBRA 1ESDA 1JNXX 2BFBB 3GBVA 1JRLA 3OIDA 3DYBA 1PFYA 3F3YA 5FNVB 3LTEA 1G21B 1Z63A 4MRRA 2IEDA 3TSWA 1BA3A 4LJ4A 4FFRA 3LW7A 4Z9AA 5BQ5A 2GXUA 2XECA 2QMZA 5DMHA 4IDDA 3R5SA 4GLJA 4GM1A 1BDIA 3T1QA 4CMGA 2A2ZA 3KPJA 1S7GA 1VJGA 4WLUA 2XMQA 5CDFA 2VBCA 2QPAA 5F5XA 4MP3A 1P8AA 4URZR 2WSSD 2AFIB 4L4ZA 4D9MA 3DAGA 1JYEA 3F3SA 1G3QA 3ROXA 4ZOBA 3UF0A 3BIJA 1Z6XA 3G68A 1JQ5A 1ESEA 3PHGA 1C3OB 3B7PA 4LZOA 5HKKD 4WNAA 4G23A 4CNQA 5TARA 3VOAA 2OPHA 4QG3A 5KJ1A 2XZOA 2X0KA 2AFHA 2W5UA 3EYWA 1NFFA 1O2DA 2E6UX 4DYVA 1M8GA 2WF9A 4AN1A 4UCFA 2C8JA 4CEIA 1YJ5A 3UJCA 1OXBB 2DKNA 3SEQA 5A03A 1NBAA 2XTMA 2AMJA 3ECSA 3H11A 3L7LA 1J23A 1KYWA 1SRQA 1NT2A 2DFDA 2GTPA 3UWDA 1MC8A 1TMOA 2L0XA 4ZVSA 3JQ9A 4LJYA 2EAUA 3AKZA 2QRVA 4O4IA 2EU8A 2VP4A 3TN7A 2Z83A 4FFLA 3QV2A 4J43A 1DJNA 3V6MA 3ZWMA 3KQWA 3TVDA 1WS6A 2FFJA 3A32A 3HG7A 2YCLA 5K8LA 2J08A 3C5HA 3QKWA 1YB2A 4A1OA 5EY5B 2GRJA 3TJMA 2CMDA 1Q17A 1QIMA 3B89A 3Q12A 4KO2S 4Q21A 1ZMXA 5DSXA 2C20A 1KZ6A 3A9SA 3BK1A 3CM0A 3IALA 1A9OA 4UQOA 2FPGA 3FTFA 2PVPA 4U39A 2OBMA 4U5QA 1U2SA 4MYHA 3I42A 4M37A 3OLVA 3UJAA 1KFJB 2HJGA 4JASB 4L8GA 3L7YA 2GX6A 4M0PA 3FHJA 2FY8A 1JG6A 3R5FA 1HYBA 5BSFA 1SC9A 4G07A 3HSSA 4J75A 1Z82A 3BRWD 3VJMA 3EW7A 2JVJA 1ZXXA 2G28A 4BC1A 2JLRA 4ER7A 4PM4A 5REQB 1A2KC 1PKEA 3D8RA 4TSFD 2E85A 2P3LA 2DPLA 5CD1A 3K0AB 3I23A 3BC1A 4QBGB 3HTXA 2VJKA 1YOVA 3QUTA 1NTOA 4QOSA 1XZEA 3L93A 1PJRA 3I2GA 3H84A 2O1XA 3DBHB 4LE2A 4OMUA 2XQVA 4OOFA 5GZ3A 1SHZA 1F48A 3R8CA 1LDGA 1O5OA 1SK9A 3NO4A 1AMOA 5AK4A 4BFLA 1E1CB 3T5BA 5TQ2A 3ZEAA 3WQHA 2V7UA 3NP7A 2YFKA 4ACBA 1KKUA 2QRJA 4X61A 3D7SA 2CD7A 4LKOA 4N0EA 1NLUA 1KFEB 1V39A 5FAXA 4PHHA 3PKJA 2QVZX 4K88A 4L4XA 4YRNA 4QM7A 3VZSA 2AJLI 4AIRA 2LUOA 3K6KA 2HW8A 1ZCJA 1ORRA 1LNSA 3UMVA 1Z6TA 3WKDA 5C8VA 2ZRJA 1ZH2A 5GIOE 1EE9A 4NZOA 2C3MA 3T9FA 3CURA 1JEYB 5LC1A 5CFMA 4RS3A 2QPLA 2MSLA 3L05A 1G8MA 2P9HA 1LJUA 1ZH6A 2BSXA 1K9SA 2V7BA 4B5KA 3S81A 2PVSA 3OTIA 4JQOA 3HBAA 1VCNA 1HE5A 3O0DA 4Y1EA 3T4XA 5MGBA 1N75A 4KRXA 5ALFA 2PUCA 2C9BA 1HDOA 4RK0A 1QYXA 1V5GA 4Q05A 5CRIA 4DBZA 5A4DA 3NEYA 1W85B 1NGSA 3FMOB 4UTVA 4J7UA 4KN8A 5CP8A 3BE4A 5CNIA 1E1KA 1J7JA 1QVRA 1R6BX 1XZCA 3CJRA 3EVAA 3OHSX 4H3KB 4KIUA 4MQUA 4P1ZA 4X71A 4FOOA 2UYHA 1Z7WA 4EQ6B 4M87A 3RTGA 3OSZA 3O0TA 4FE7A 4REMA 1U63A 4LJ5A 5LXTB 1ICEA 1XIVA 1SC1A 5EWMB 3MWYW 4U2KA 5HE9A 4EKGA 1PYOA 2O8CA 3MAGA 1Q0PA 1CLUA 2B6HA 2OGUA 3DDZX 4G3XA 1OXMA 4TV9F 6YASA 3FPHA 5JJKA 1MG0A 4PYQA 1VB3A 1YBHA 1LK7A 3JQQA 3YASA 4EUSA 2JBWA 4IDEA 3WP0A 3EOZA 3MBKA 2VHEA 3FYTA 1IHYA 2ET6A 4V02A 3T3GA 4IFTA 2DBZA 1GDHA 4O8CA 1CR0A 2AW5A 4X1IA 1JU3A 2LR0A 4YMWA 3OG9A 3A4VA 3GQBB 5JC8A 3L07A 1N57A 2EERA 2O5RA 4ZHQA 3H5TA 1Z5GA 2EL9A 1VIDA 2WHXA 1HT1E 4KR0A 3HO8A 2Z6UA 1CV2A 2Z5LA 3OIGA 2IYWA 1EA5A 4S1NA 1QRDA 1XBTA 3CLUC 3JVDA 4PZCA 3DVRX 1EE1A 4UU0A 1KJYA 3L7BA 4C7BA 3HXKA 5FHRA 3CB2A 5J4VA 3RNLA 1EWYA 2XTNA 1K27A 2JCXA 4AG3A 1ML3A 1YU6A 2FETA 5ALYA 2HO4A 2OHHA 4PIMA 5JPIA 3INRA 5KOJB 1AGXA 5EKTA 4OQXA 3R9IA 3U39A 4EYGA 1K3UB 2P35A 3QF4B 2EV9A 1K8ZB 3DE1X 1QE5A 3KL2A 2GK3A 4IS2A 3ZN2A 4GOXA 2XAUA 2MIIA 3ZK7A 1EIWA 3K5PA 2C4HA 4PFJA 4S1OA 3HB5X 4Y6LA 5ALHA 1G1AA 2HRZA 2A94A 1Q77A 2YVLA 3BF7A 1Y9JA 4N0PA 1QH8A 4CIBA 4P53A 1H2HA 3IVRA 3COYA 1GAWA 4KUEA 5JRDS 1VE7A 4HQNA 5INTA 2VPWA 4JN6B 1S5PA 2DHCA 4CQMB 5C53B 4XPZA 3AKDA 5ESXA 3TNLA 3CBGA 4HH3C 1Y4ZA 1QFZA 1X1EA 2O8DB 3IE1A 3AHIA 4UAUA 5I45A 3A26A 2ORED 3DKVA 4R0MA 2W48A 2ZRBA 1L3CA 3O4VA 4R9RA 1QBGA 1X80A 2ZIAA 1QWOA 5BMVA 2I9KA 2B4KA 1QH9A 1ECGA 1EFTA 1DXQA 1UBSB 1XJQA 2VUSA 2XIJA 2C29D 4S2EA 3R5XA 2PWYA 3ZWPA 1APBA 3ZVNA 1A8UA 1UP7A 1UAAA 5JU6A 1EXNA 2O50A 4HTFA 5FQOA 5DM2A 1JFTA 2E6KA 3FX2A 4CM3A 1WPRA 4DV4B 1TUBA 3PFHA 1FX1A 1Y9ZA 2PWZA 5E3JA 1IZ0A 1SXHA 3PB3A 1K8YB 3U2QA 4ARZB 5TXGA 3LX5A 2IYOA 1OE0A 3P9SA 3Q10A 3VYUB 4YUYA 4JGBA 2SHKA 2ZI4A 2FEXA 4BAUA 1T2VA 4KYUA 3RC7A 3M6AA 3NIFB 4JUCA 5ICSA 3E8MA 2L69A 2YZ7A 3IE2A 3KPYA 3PGA1 4RZUA 3OCYA 2GAIA 1JG2A 2OCLA 4RTRA 1ZH8A 2VDRB 1NVTA 5EL0A 1SG9A 2VS1A 3B2EA 4HGOA 4XAQA 4ZEMA 1FQOA 2C78A 5BY2A 2ZCJA 4ZIRA 2R9VA 1ZSVA 3R3VA 4BO7A 4Y2XA 4C7JA 5COAA 4ZVUA 3BWXA 2VP6A 3F90A 4JKYA 1XTRA 4ZI7B 3R0IA 4AFNA 2AI1A 4YP9A 1QRTA 3H5LA 3MJDA 2YJTD 5D1NA 2G0NA 1YT5A 1AQLA 2QRUA 1XD9A 3PDHA 4OFZA 3OZUA 5B58T 4MWBA 1DWPA 3UA4A 2VDUE 5BOSB 3N8IA 3ZXUB 4RCYA 2GA8A 4QUIA 1AK1A 4NG5A 1ZVQA 1XV5A 2BV3A 2C5SA 1ZI9A 2IWHA 5C1OA 3L2OB 3OCUA 2C5HA 2O2HA 3QIAA 5D6OA 2IHZA 5T8KC 2IP2A 1RZUA 3EN0A 3ZYZA 1EX7A 3DA8A 1EAMA 1KIAA 3MRTA 4GC9A 1EDOA 3NAGA 3BH0A 3I5MA 3P71T 1XKTA 3LP8A 3KPUA 3ZJVA 3FSGD 3PJGA 3ZZMA 4BNLA 2HHJA 2F1IA 4ZO4A 1WRBA 5J2UF 5AKJA 5FYDA 3W2FA 1S02A 2ONCA 1T4CA 2X5NA 1OASA 4O08A 3GAMA 2WOOA 3H8JA 3L1JA 4QTTB 2IXAA 1KC1A 2Q0HA 3HBJA 4I3FA 2CLIB 3ZNQA 1M33A 3E35A 4LE1A 4EF4A 5K8VA 1MJFA 2HSDA 2Q1WA 2QNIA 5AW8A 4R5MA 1TZJA 1RRGA 1AKRA 3CZQA 3CZMA 1J20A 3GD7A 3LXRA 3ZD8A 4AICA 5LQKA 1RC8A 5IDQA 2P6RA 3MEQA 1I32A 2O2ZA 3DVAA 5JCZA 5K0JA 1OZAA 3EH2A 3FTQA 4E51A 1LLCA 5KOIA 5JO0A 2A1IA 4YGYA 2QV0A 2CLLB 5TQVA 4D3ZA 5L4LA 2CUTA 1C30A 4RV5A 3EEQA 1PT5A 5KX5B 1P62B 1J0EA 1UPTA 1UJ2A 3ABRB 1LPMA 1MRNA 1T4DA 1X3SA 3B13B 1RBZA 2ETXA 3B5IA 1PD1A 2XZPA 4G41A 1W0JA 1M0SA 4NMXB 4S24A 5EE1A 2WK1A 4KBFA 2O05A 2UUPA 4NCKA 3RUIA 4OXNA 1XVLA 3AL3A 3ODPA 5EN4A 4HAYA 1N25A 5CB4B 1E6WA 1BQ3A 2AN3A 2GCGA 3PRJA 2FSSA 3PYLA 4JWKA 1WW3A 4KQEA 3DDUA 2POCA 4K6HA 5D6NA 1N2ZA 3I8XA 3IQIX 5KQRA 4M1OA 1KAGA 5JH7A 1FLVA 5EMNA 2WVGA 3AONB 4NCNA 2BFFB 1HL7A 2NSJA 2W71A 2BZGA 4JCOA 5B1SA 3N5KA 1WIWA 5A3JA 2C58A 3CRNA 3RLIA 1R3DA 5CK4A 3V46A 3INNA 3DE0X 5E7JA 3VOBA 1UJNA 1UFKA 3A1EA 1EEHA 1KK0A 1HLDA 4NBTA 5KTOA 2UYQA 3U80A 1P9NA 3BFKA 1I13A 3TK1A 4HWRA 1GU1A 3KE9A 4R81A 5KCZA 4UMVA 2NTNA 4LHZA 1XJ0A 1O89A 3ROMA 1DMSA 4Q7JB 3ULKA 5BQXA 4YHHB 1LC0A 1B8OA 5CA0A 2TMDA 3JSXA 5HK8A 3N6VA 4RKRA 1CE8B 2CY0A 1T9HA 2NQ2C 1KI6B 3T9AA 3UAYA 3WL8A 3W06A 3QY0A 1PSDA 1BDMA 2PD4A 1G21E 1UJ5A 3TR5A 2JIPA 1PS9A 2QVXX 5C18A 1P1HA 3NHPA 1VYVA 2C54A 3L0DA 4FYIA 4JWTA 2C61A 4YMLA 4WCFC 1EWRA 4OFXA 2XA9A 3TLGB 5AVTA 2PGNA 2OCBA 4ZU1X 3SNHA 1U8EA 3HB1A 5ICCA 2AFIE 1LQTA 4JLJA 2RE8A 3H2JA 3DWEX 4NCBA 3HJUA 2ZB4A 1JQAA 1A77A 3U7HB 3N39C 5E2IA 3VNRA 2QYSA 1NY5A 5T6BA 2YUIA 3DVSX 3QU7A 1R0CA 4KDCA 2CYCA 2WD7A 3Q6IA 1O97D 2YHBA 2GN9A 3ID6C 1F6BA 1IXZA 5CH8A 3O2SB 3CLSD 3EAFA 4N39A 4NBKA 1VJ1A 2WSLA 2ZIXB 4Y2TA 3BDAA 1IUOA 3IAEA 3K4PA 2XMCA 3KHKA 3N58A 2Q5EA 3AFNA 3RABA 1G5TA 1EYZA 3WO1A 3O1JC 1DQSA 4G24A 5EFZA 2YOGA 3DNMA 1VE3A 4YWJA 2XTZA 4FGWA 3D59A 1Z0KA 1A8PA 1Z6YA 2OQVA 3ZWXA 4W6ZA 1KJNA 1EUDA 3KIPA 4NJOA 1LX7A 2DBVO 4HXYA 3NDRA 2BKLA 5BQOA 4D2IA 3LFHA 2QP4A 2XYHA 3IRUA 4KE9A 4NZYA 5A0FA 1AUXA 2AXEA 4JBIA 2P7IA 3GEHA 3QPBA 4QLBA 3GFPA 4HRXA 3IQZA 3VU3A 3U4GA 3THSA 3CF4G 3FKQA 2K7FA 5DP1A 3UPDA 1DKQA 3S70A 5YASA 4WKOA 4ETMA 1R8QA 2H2DA 1RFLA 2VCEA 1BS1A 4PAOA 4Y2RA 3KSBC 1JR3E 1II0A 2HIHA 2GR9A 3ENVA 2AI3A 2I6UA 2A1UB 1C7IA 4EB3A 4YT8A 4PHTA 3JQBA 1QTNA 1RWWA 1A2OA 1RLIA 2ATCA 3TRDA 1ZH0A 3AYZB 3EOBI 3G79A 4V1CA 1WSBA 2IZ1A 2Y0EA 4GM0A 3WL4A 4ZK6A 1UWVA 2Y93A 4ISBA 2GFIA 3HM2A 3CH4B 3X1WA 4R05A 4BP3A 3DOEA 2IYEA 1QG6A 5J63A 3S4YA 3F7MA 2Q8PA 3NORA 3LQ1A 4F04A 1QYVA 2IE0A 4EUHA 4HG2A 4M0EA 5I51A 2O59A 3MILA 2GHRA 1CZHA 2JCYA 5KDLA 2H1WA 4BP9A 4LHVA 4GR4A 2VA8A 5C52B 2A0XA 3CT6A 1U1CA 1R4AA 3KQKA 4A82A 3TQQA 5KQLA 4U6QA 3PJRA 2V45A 5AKKA 3VDNB 4UM9D 3ZH2A 4BQNA 4DXHA 3SHVA 2X0FA 2QVGA 4BQPA 2ZJ7A 5AI0A 3MCTA 1R00A 3GELA 4ZPXA 4CF5A 4EGAA 3SP1A 2F4VB 4F8EA 3S2EA 1ONNA 4LY0A 4BZQA 4D0SA 1H23A 3FSJX 3MT0A 3BX1A 3I4FA 1M8KA 2ACKA 1DAPA 2BWJA 3AEQA 1U04A 3K5WA 2B25A 3FZNA 2R00C 1WZUA 2YXNA 4LHYA 1W9MA 2OORC 621PA 4FP9A 4BXOA 2XQJA 1C9YA 2IGTA 3N86A 1XTZA 4C2TA 1CR4A 2FZ5A 2Q46A 5B5SA 1ZUWA 3GP8A 1QQ6A 3LT2A 3GXBA 3PC2A 4MIKA 5J2TB 2QN2A 1ZS9A 1L1QA 4HLCA 2QWXA 1U5BA 1Z83A 3S40A 5DO9A 2JIMA 3FPJA 4FKZA 1PYDA 2CJFA 4RTOA 1Z26A 4IKOA 4OQFA 3LKZA 1A8IA 1GVHA 2V8OA 2ZJ0A 3JZDA 1KJIA 2X6TA 4Q4AA 4TKVA 4MWEA 1RD4A 1UBLS 1Y8CA 2I7XA 4HXFB 2E9SA 4TQUS 4YREA 2YFQA 3ABSB 2X58A 4FCWA 4JC5A 2HF7A 3IO5A 521PA 4BFXA 4H18A 3KLBA 4ZO7A 1L1FA 3TDMA 3VC3A 4BS9A 4I9FA 3AL0C 1BXZA 2SNIE 3AXTA 1TJNA 1NBIA 3JQEA 3EEYA 2OGZA 1SC3A 2D0IA 4BMSA 1OFUX 1XF1A 3ER6A 1JR4A 1VHJA 3H83A 3D8HA 5G0WA 1SWWA 1ATIA 1OB2A 1M1NB 2H07A 2RIPA 1UANA 5HOQA 3PNBA 3HK2A 1UH5A 1G20B 4MQ4A 3D4PA 4YCMA 2IUYA 4LF5B 1S2NA 2ICAA 1XWWA 4RGQA 4B9AA 4J1TC 1OR8A 2I76A 3PNKA 1EA7A 2MSDB 2QJOA 1DAIA 2AXNA 3LWZA 3PQCA 3R0JA 4RETA 3TBKA 2HPHA 1VL0A 3ZUGA 1F2VA 4JD5A 3AWIA 2VXCA 2PUWA 2IH5A 1KQOA 2BEVB 4DEVA 3W7BA 4M7WA 3I32A 2HCTA 3I73A 2JHPA 3U3DA 3E2MA 4CIDA 3EIEA 3T1NA 1XZAA 3LPAA 1C1HA 1N2HA 3OM8A 2ZYIA 2IHBA 4C03A 3JVVA 4YC7A 2PIAA 1Z39A 1YSCA 2OYCA 2PBFA 4B32A 2IS6A 2B92A 4M8NE 3ETLA 4BMCA 1VTKA 1Y6GA 3I6IA 5LZ8A 1WKVA 2NO0A 4LVCA 1T9BA 4DOMA 2IBSA 1ZHOA 3IUMA 3WNVA 1UFRA 1NYRA 2SCUB 2EKBA 2EKLA 3G1WA 3I3SR 3CUYA 2YOFA 3TIVA 1KWKA 3O1HB 3IL2A 4QQ8A 4BLRA 3KTFA 4IGKA 4R40A 1W0JD 2X23A 4BUCA 3AVTA 2YMPA 3EVNA 4Q15A 3M4ZA 3OPYI 4MW7A 1O3YA 4KXLA 4CMEA 3VO8A 1IG3A 1HSZA 3U3JA 3VPAA 2G6TA 3C3PA 1ORHA 3B1KA 4O4LA 4LHSA 4R9NA 3B1JA 1RJFA 2ARKA 4H3VA 4L4YA 1OHHA 1QDUA 1JVBA 5CHYA 5HA5A 1NI4A 3EEIA 4BDTA 1M67A 4NEGA 3OVMA 1OF1A 3NKLA 1ULTA 4GMHA 4X5OA 1TZ2A 1V1MB 3O9VA 3FPSA 3BXGA 4XVRA 2P9TA 4E7OA 5EJMA 3RVDA 4NYMR 4PZ9A 2C42A 5A6VA 2PGOA 3D7KA 2H7VA 5BR7A 3M49A 1L0BA 4YJ3F 5IF9A 2G07A 5ED0A 3GLGA 1XMIA 2XWQA 3MSCA 4D41A 5BSRA 4G0UA 1DFHA 1MPXA 1AVTA 1R5OA 2AOUA 3CCCA 5DZSA 3TW4A 4A6EA 4BLPA 4OQQA 2X2PA 4IDFA 2AEFA 6NULA 3KPVA 3OZGA 4CCWA 2NYUA 3EXG2 4WOJA 1XJWA 3MNFA 3K70C 2CF6A 1ONOA 2G0TA 3N1UA 5AI5A 4YQFA 3SVLA 5H70A 2OBYA 3OJCA 3T9BA 2J9YB 1T8PA 1Z7EA 4NESA 2Z08A 3IIEA 4NYMQ 1ETHA 1K7EB 2EGGA 5E4FA 1LBHA 4D80A 3WQBA 2G3YA 2H0QA 4AULA 1I3CA 1QTQA 2EQAA 1JEQA 5KQMA 3VTZA 4AIIA 2XZDA 3W2IA 2W6CX 2ZM6B 1RMQA 3UGQA 821PA 4OB7A 1G2QA 4K2AA 3GEMA 4HOYA 1U8CB 5C4MA 4MV1A 1O54A 3DMPA 3CCBA 1NONA 3KJQA 2Q1UA 5ICFA 3U40A 4BX3A 4FDVA 3T8YA 2IU4A 1P9WA 2DFLA 1OWPA 3SJAA 2I03A 3UWSA 2NG1A 3F78A 3OJ0A 5FOXA 1L5HA 2B1IA 1ILWA 1HDZA 1EVQA 1R8SA 3NYWA 4LZWA 3OLXA 4G5QA 3R40A 2ZBGA 4ZCSA 4D5EA 3AKCA 3KOYA 4P3NA 4RVOA 4QARA 2OUIA 1PBTA 3ANLA 2Y9MB 3QYFA 4CM5A 4I4TB 4RX1A 1IN8A 2HWKA 1TIPA 4OV6B 3A6DA 3OT5A 2Q6OA 1XX6A 3Q85A 1ZJWA 1G0OA 3V2HA 4EIWA 1MF7A 1LW6E 4DEXA 4E21A 5H8WA 3BAZA 4QPCA 1FVXA 5A05A 3T7AA 5AVZA 1GNTA 1O1YA 2BE7A 3T95A 5EHXA 2PUAA 3NFRA 2Z9CA 3CUWA 5ECGC 1OBVA 4RLSA 3RS0A 1YK0A 4V3CA 3WHKA 3LVQE 3L79A 3QFTA 5EHZA 4BV9A 2VTBA 4AY6A 2AKEA 1CRQA 2XRFA 2IDKA 2FW6A 2I1VB 2Y27A 3EA4A 4GYJA 3O8OA 4NHOA 1E6MA 3AZPA 3KQLA 1GQ2A 2AV6A 4NNOA 2Y6UA 1KJ9A 1YH3A 1QP7A 2H4HA 1AGRA 1JQDA 3WS7A 4E11A 1UIRA 3LPLA 1VECA 1ZVKA 2P9GA 1CS0A 3FCEA 2OD2A 1E9VA 3ICCA 1HDIA 3LLUA 3RQIA 3ZY3A 3PD7A 3CCFA 5EXSA 3DZJA 2UZ1B 4LA4A 4IQ4A 5FEMA 2V1XA 1JSZA 4D43A 4ZJZA 1IDN1 1P91A 5B1DA 2AN4A 2IV7A 1U9YA 1JA1A 1U6IA 2OV4A 3GA7A 3L0SA 1C2TA 1KNXA 3HB9A 4QXPA 4KE7A 5AOVA 1L5RA 2BSAA 2R8PA 3WL7A 2C1XA 4X7PA 1ZHFA 4BFTA 3BUSA 3UT6A 4EYSA 1P4AA 1G8KA 5J1TB 3CUEF 3OHPA 1Z28A 2QRPA 4XCXA 5U1PA 4ZZIA 1T9AA 3K6JA 5ALRA 1UPXA 4JI0B 1K5HA 2EKZA 1TYBE 1JHMA 4JJIA 1MX3A 4Q82A 2WC1A 5EMMA 3GJ8A 2DVMA 4EFNA 1JF8A 2BGWA 3MLBA 4OATA 1K06A 3EGEA 1Z7GA 1SBNE 2EX1A 2PUHA 5ALEA 2D2EA 4XD7A 3FNFA 1OLOA 3VZCA 2XB2A 4M83A 2JIBA 3CX4A 4NATA 4C04A 1HE3A 1LFAA 3MJ4A 4JUAA 4E31A 3AH8A 2ZQYA 1WHSA 2IS2A 7ADHA 1NAHA 4C6TA 3VJKA 4G4IA 4A8HA 2VO1A 2LTAA 1B0ZA 3BB1A 1P17A 3GNQA 2AX4A 3AHEA 4J03A 3A6FA 3FVWA 4IOJA 3S8YA 4KAXA 1D1TA 4MUKA 5EQDA 3ZKWA 1OH6A 4G84A 4L0CA 5DTRA 1GCAA 2FGJA 3G2PA 2UUBB 4RAQA 4BYGA 1XZFA 3Q2KA 1NN3A 4RU1A 3EGCA 5LQAA 5F2OA 3KV3O 2WM3A 4WZZA 2QVBA 3WNQA 2YJ5A 2E7ZA 4OYHA 4RMIA 3V7NA 1QP8A 4I19A 3TRFA 1DKUA 3O26A 4FN4A 4HH0A 5FOWA 1UBEA 4FGUA 1GZUA 1P80A 1N6KA 1Y4UA 5D3ZA 3M5DA 4RVHA 4BNXA 4BBJA 2XDAA 4HAIA 1RHRA 4K6CA 1QVAA 1SKMA 2VQEB 2QSYA 3M1IA 5L6LB 3ENKA 1TIBA 4FQ7A 2ZGVA 4P0PB 1XLVA 3CO5A 2O8VA 1NFQA 1AHIA 2CYAA 4LYFA 2VZ0A 4IKPA 4ZRDA 4DNQA 1WF3A 2J3MA 3WWYA 1VLJA 2PGAA 2VJNA 3RTEA 4IIHA 1GFSA 3NMUF 1X86B 3OZ7A 3R7WB 4M2LA 3PC4A 4Q48A 3RASA 1G98A 2G67A 1R4NB 1YDWA 2QNBA 3LUAA 3PENA 3IKTA 2ZSAA 2O1WA 2C8KA 1N6NA 1XRQA 1S01A 4IO0A 3AW9A 4PHFA 3U4AA 1FOEB 1PDOA 1UM9A 2JGLA 4DMCA 2V0GA 3Q41A 3U7GA 3D6UA 4CM7A 1D2NA 3SEAA 4FGLA 4A7PA 2BEUB 1YB6A 2BTOA 3RVNA 2WVHA 2YJ3A 2H2WA 2A86A 2XE6A 4ZDIA 2H7CA 2QG9A 3BHIA 4CIAA 3DTYA 4D3SA 1XOIA 1WOMA 1ZM7A 2ZI5A 3EPPA 4I1IA 4OQLA 1ECLA 2B98A 1UBUS 1L8AA 1RWOA 1XDBA 4ZVNA 2B5WA 3QFHA 1W46A 2J33A 8LDHA 2M6KA 1Z22A 4O4JA 1R0BA 5C5DA 4MVJM 3A58B 5JATA 4EMBA 1OYWA 3E61A 1K9VF 3B20A 3MVEA 3QE4A 1UK8A 4ZT7A 5FR2A 3REFA 3WLJA 5JPCA 3I01M 3A6ZA 3OLZA 3LLCA 1U2QA 3VHRA 4EOGA 1WY7A 1WEHA 3ZLUA 1EP3B 1PWEA 4F3RA 3ZW7A 2A88A 3LCUA 4P33A 2B36A 3SIWA 3NTQA 2O7SA 2YNMA 1ZD4A 2K5UA 1RP7A 4DSNA 1KDYA 4JV5B 2YWJA 4I9GA 1E3IA 4EG6A 2DKFA 3C1UA 1MJNA 3LGSA 4ONEA 5BUCA 3E3LA 3GJZA 4K7JA 3E9MA 3TUIC 1W96A 1PDVA 1LK5A 2P9FA 4TXJA 1PZGA 5DB4A 5I8ZA 5KYYA 4GLBA 1MJ5A 2BKVA 2ISCA 1NPDA 4TRRA 1WZNA 3KXIA 4NAVA 1RFGE 1LNQA 4QRDA 3HXTA 4ZOLB 1OHHD 3E9NA 1QX4A 2JHGA 4REQA 4KR9A 3RYHB 1YNOA 3Q8KA 5CLQA 3TIGA 1O03A 1LVGA 1D2HA 4J7XA 1M6VA 2JJ2A 4X97A 4XUDA 3TQSA 2G1JA 2GFHA 3HKEA 4DG5A 1ZK1A 1I4EB 1KH3A 1GZ4A 1SCJA 3MWEA 5DISB 2J6HA 1CQJB 3VAYA 2I2XB 5J47A 1FDUA 2VYCA 1FMJA 2WG2A 3F6YA 2PLAA 3MZ0A 1QORA 4UBNA 3NATA 1G291 1EIZA 4DDKA 1J25A 2BT4A 2RGXA 5AIAA 1P1FA 3NU1A 1ODKA 2QV7A 4MV3A 1R6VA 1MDFA 4W7HA 3LUJA 3E82A 1U28A 3CONA 4NV1A 1K8XB 4WEQA 2VWHA 3AT1A 4Y1RA 4D56A 2HBRA 3R3SA 4C4AA 4R5HA 2ASEA 2XDQA 4DTIA 1V71A 1DKLA 2GLUA 2QK4A 2QW0X 1WHTB 4BMNA 3R9KA 3FY4A 1NQ5A 4Q66C 2ZSJA 4FYJA 4M88A 1N6IA 1Y63A 4U8GA 2V7GA 3VC7A 4UTOA 4MI6A 4IUYA 3HRHA 1R18A 4R1NA 1CR2A 2BGGA 4LEIA 2JFPA 2N0SA 2V5UA 4J90A 4MI3A 1W52X 3VZDA 1UADA 2GBLC 4TN1A 1H0RA 1T5BA 4TYPA 4WECA 5CYFA 3NUZA 2XQGA 3ZR4B 4IX1A 3X44A 3DULA 3MHPA 4NJMB 3TLJA 3OZBA 1FYFA 2OP1A 3MIZA 4FW8A 1L8OA 2FWRA 2ZCUA 3SD7A 3GJ7A 3RVBA 4KITB 3WLOA 1J99A 1M7HA 4PLWA 4OF4A 3NIWA 2EGHA 3TTSA 1F3LA 4BWYA 3QVTA 4B17A 3ZCRA 1N0UA 2OLKA 3RSOA 2CNBA 3TRHA 1V3TA 4BWFB 3K9FC 4WY8A 4HEJA 5CVJA 3U7IA 3LO8A 2JIQA 5G0SA 1E2NA 2BUCA 4OUDA 1T8RA 3GNLA 4DUYB 1PK9A 2QZ4A 1NOJA 2VHUA 3DVQX 2GF9A 2EW2A 4KAFA 3UJ8A 2A14A 1GQYA 1NNI1 1ORDA 1UMBA 2Y76A 3GARA 2OXIA 3SS7X 3IEMA 3KKKA 1I4WA 1ITZA 5A7HA 1PAUA 2Z5FA 2IOFK 1MO4A 1IUKA 3RYFA 2P1RA 5SV2A 5FFNA 4ARAA 4US2R 5IAAA 2OYRA 2Q3BA 5ALUA 3WGNA 4XWYA 2HF8A 1TOAA 5KOYA 2I66A 3THYB 1GL6A 4TVKA 1OZHA 3OTGA 3MWDB 1ZK0A 3GUVA 3AEKB 3VVLA 1XQWA 3H9JA 4KX5A 4K9MA 2OMEA 1KSGA 2JEZA 2V0CA 3JZIA 3IP1A 2EJWA 3HWWA 5K0NA 1YR9A 3HP4A 4D3XA 1I3KA 2VQDA 4HVCA 5EYPB 2JVIA 4HAZA 1I7LA 2DM6A 1NLMA 3CN9A 1LEHA 4MINA 5KO2A 2ONZA 5B1IA 3ORYA 1BHO1 3A3YA 4OLFA 5JT1A 3MJVA 4D0GA 5EE3A 2OG2A 1DRJA 1UDBA 4CG3A 3AR7A 4L15A 4PS1A 2FCRA 2XZTA 3EMBA 4AQDA 4CDNA 1JG3A 3IP6A 1YFZA 4GU5A 1N2SA 1IEWA 3E03A 4RTLA 1KEZA 1MC5A 1XGKA 1Z0UA 4L16A 1IJFA 1W88B 1HNNA 3O8LA 5DT2A 3RG2A 3T3DA 4F3TA 4X41A 4QJ4A 1ETUA 2ZM5A 5E9WA 1BFDA 3O1LA 1L5LA 2IV2X 1QC5A 3ND6A 4G2TA 4EDHA 1B0PA 1GYPA 4Z9YA 3LLSA 3SVZA 5K9ZA 1WCV1 3RS2A 5SZKB 4OHPA 4DS3A 4EG3A 1SQFA 3C7TA 1OPRA 3EZ9A 4MSUA 4D6XA 2Y0PA 5IYZF 3DR3A 4XCVA 1OMOA 2WWGA 2WYVA 5B7NA 3RJTA 4PSAA 3AUFA 1Q3TA 2OPBA 5IW8A 1DWOA 1EHCA 2PUTA 2VBFA 3KOMA 4XD7D 1THTA 1FS5A 4QASA 4W5QA 3PS9A 1ESZA 4XX1A 2O8BA 4HR7A 1Q1ZA 1M34B 1P5HA 4O5AA 1Y4DE 1N6OA 4M38A 3OMLA 2OOSA 3ZDQA 3B70A 3W34A 2QTFA 4BX8A 3UAZA 4XWGA 2PT5A 4WZ6A 1N7HA 1XZBA 3WJAA 2CEAA 3CF4A 3UIEA 2D7DA 3ZDDA 4G8DA 2VDWB 4NFYA 1FYEA 2AUTA 4ZI3A 2BTEA 3UWOA 4XTRA 5IM4F 2QN8A 5CA1A 4LWOA 3PEVA 1GGKA 1Y3HA 2OZVA 1BHSA 1KH1A 4DN6A 2IYSA 4HQLA 4RH1A 3ZE9A 1QLWA 4DRXA 2QIPA 1T5DX 1VCHA 4EHJA 3C15C 4Q34A 2IK8A 1D8TA 1R1DA 2B61A 3MCWA 4QDJA 2BONA 3PX2A 5ESWA 1ABEA 3TOZA 4EMSA 1HTWA 1U1IA 3ITKA 1DEAA 1ZU4A 3D31A 2Q7XA 4IRXA 4OHMA 2PKEA 3WYEA 3UAWA 2H5IA 2P5UA 4JJEA 4RMJA 1P19A 2CK3A 4XH9B 2BCEA 5LJLA 2WM2A 3FOEC 2EXXA 4QVIA 5BVGA 4Z53A 1WZ2A 2I1QA 4LMPA 4FGJA 1ZUNB 2I55A 1T9CA 4NZPA 3VBCA 3ZV4A 3MXTA 2IWRA 4DLXA 4LKRA 3I45A 3UJDA 3L7DA 3B38A 4BLQA 1JDBC 2QROA 4RJJA 4XOUA 3AZQA 3U9LA 5MFPA 3BK7A 3NVKI 4AKGA 1BHQ1 1S8FA 2AS0A 1TYZA 2JGIA 1NXWA 1SB8A 2R87A 2ZQZA 2ZW9A 3MQ4A 3OO1A 1QGAA 4OB8A 4P86A 1EM8B 2VRNA 3EHEA 3SOPA 4HGYA 3QTLA 4WLNA 1SCAA 1TAHA 2AX3A 3PQDA 4WSOA 1DQRA 2PRJA 1A5BB 3H65A 1QZXA 2WHPA 3BFJA 4H4EA 4UCXA 5AIBA 4F5ZA 2BE9A 1ZC4A 3DHWC 3DWIA 5JDCA 3AR2A 2JJ1D 1GUZA 2VBGA 4BNDA 4KGDA 2JZNA 5GAJA 2GXQA 3ZWYA 1HTBA 3T3EA 1WPQA 5ELMA 2WU0A 3BBPA 3HGTA 4E32A 2QSJA 2RJ3A 2CB0A 2GJ9A 5AK0A 5GV7A 1RBMA 1GCUA 1YU9A 1I1OA 1ZUD1 3RV4A 2F6RA 2NUBA 5JYBA 3AQIA 1ADGA 5FBZA 5TQ0A 4YX9A 4PLCA 1TAUA 3Q3HA 2BVNA 4NCAA 3HNOA 5TF4A 4XDYA 1XQ6A 4O2BA 2Q6KA 1C3JA 4Q9IA 2MYTA 1CEQA 1V6SA 3N75A 4TGLA 4U7JA 5CFNA 4YV1A 2QTTA 3IQDB 1SUWA 3OD1A 1E3MA 3O2NA 4QZVA 3BJIC 1H3EA 1NDUA 2YNMD 3RJ5A 1XO1A 1YDGA 1SCBA 1QAMA 1VGQA 2WKPA 5F3WB 2J59A 5BNIA 4ACAA 2WD9A 3UG7A 1QUFA 4LRQA 3U3XA 1MT0A 1T4GA 2GJSA 4HUQA 3TRJA 2QSUA 1KI9A 3THWB 4HLUA 4A8JA 4BNYA 1H6BA 5TNXA 3D2BA 4BO1A 3GX1A 2YH2A 5EOVA 3U3RA 1SM4A 1DT5A 1BKSB 4LTDA 5GVRA 1TL7C 4A16A 2B5OA 1ENZA 2WHEA 1X6VA 1LJLA 1YBMA 3AO0B 4F3NA 2PH3A 5KTPA 3W7AA 4QELA 4UW9A 1TT5A 2JJ2D 4H15A 2I65A 3B1WA 2H11A 3CW2A 3TW6A 1NMXA 2AR0A 1B1CA 2DCUA 4FJ0A 2UKDA 4KRGA 2QVLA 2OWDA 4KZKA 4FHFA 3RAEC 1HFKA 4RHYA 1J00A 4ZEVA 2V9CA 5EI5A 3WICA 1Y5NA 2HWWA 5EIHA 4GW3A 2BFEB 5EP2A 3GRAA 1RWNA 1TA0A 5AHRA 2OV3A 2ACEA 1DAFA 4J8PA 4WCFB 4TZ6A 5IUKC 4RWZA 4HNTA 4ARCA 3VPGA 1E0KA 3ONDA 3LF1A 3UJ7A 2QL5A 3PQFA 1H0HA 3UJ9A 2JCGA 3LY5A 3Q9SA 2A67A 1Z25A 4FQ5A 1VG1A 1MX9A 4L8YA 4QAQA 4W9NC 1YHNA 2IZ7A 3KWJA 5C51B 2ZU6A 2ZSBA 5BMOA 4QO8A 4D96A 1DNPA 3Q15C 5J5CA 5FPPA 4WJKB 3IKJA 4TLBA 4GRAA 3UFXA 1XJCA 1C7FA 5BYJA 1U2DC 1P9RA 4M21A 2VDOB 1K0UA 1U3UA 4XCQA 1Z4PX 2ZYHA 5EWJB 4DREA 3NR2A 1WSAA 4WX2B 5KJCA 4FX5A 3ZY2A 4G89A 1CP2A 4J1NA 1G5FA 4G4SP 4MEJA 2QMOA 1JP7A 1S7CA 3T1HB 4O0LA 2AVDA 1R88A 3O3NB 2XNKA 2H29A 3QGMA 4WL0A 2RDMA 1RRCA 3U4QB 2E2WA 2CF5A 3F9CA 2AOWA 4WIAA 1WO8A 4OQ4A 3TZQA 2C96A 3ZOKA 3UB3A 4EI2A 2WIAA 3FPAA 1NC3A 1GZVA 1TVKA 3GJ6A 3FCOA 3OIYA 4MVJG 2PMCA 4W8HA 4WJLA 5HTOA 5LOVB 1M2JA 1NMEA 3S55A 1FTGA 4NPAA 3JALB 1D2GA 1KXZA 4FKBA 4KGZA 4O4IF 4Q7QA 3EYAA 2WTXA 3T9DA 1BMDA 5LP6B 1M1XB 5L3SA 2WPNA 5IKEA 5WRFA 3UA3A 4Q7MB 1J97A 1P7YA 4B31A 3VYSB 5A5EA 4FE4A 2G36A 2NGRA 1URPA 1B93A 3EZFA 3QBVA 5C9ZA 1O57A 1HV8A 2EBUA 3BJRA 4IR7A 3LY8A 4PLZA 3Q7EA 4WZAA 1ZICA 3D0RA 5EZ6B 3U17A 2V96A 2X8WA 1FU7A 4TMFA 3SQXA 2BMEA 4R2XA 2AOTA 5DLQC 5HQJA 1KVUA 3DOFA 4CKYA 1A8HA 3L6OO 2V7XA 1T0UA 2PS1A 3C6KA 4NABA 3GF4A 2O0KA 3WKEA 4J7AA 4ASUA 2Q2QA 3JY6A 3IEPA 1Y9DA 4JS0A 5FL7A 1DQPA 3NNSA 1SU6A 4ALJA 1IYZA 2IF2A 2IOYA 4FDTA 4I55B 5JI3E 4PW0A 1NXSA 2CNWD 3EUFA 2HK6A 4R71A 1A5SB 1WV1A 3IRVA 1XRPA 2JFBA 1Y1KE 3PFGA 3EXHB 1TF5A 2JLXA 4Q37A 1CT9A 4Q1CA 4WKGA 5C3UA 3DLTA 1TTHA 3EDQA 5HE8A 4BX9A 1UC5B 3O83A 2UVDA 4FYPA 4XR4A 1V6AA 1G4UR 3NQ41 2CUZA 4QWMA 1WG8A 1Y6JA 2WRZA 1KZGB 4B0OA 1TCAA 2IT1A 4NY1A 5FBLB 3ZHQA 4B73A 4UTRA 5CG1A 3L4BA 2WSMA 6CHYA 3GDWA 2Q49A 1QIJA 3JZMA 3OEYA 5JS1A 2JF0A 2ZJ5A 5HIKA 4GMGA 3GUZA 1XDSA 3DBRB 4B81A 1WBJB 2WR8A 4RHXA 2Z2XA 2C07A 3BREA 4GNKA 5K51A 4LJAA 3RJ9A 3GL9A 1GARA 5HCUA 3TZEA 4LYJA 4L27A 4WGFA 2X8JA 4X1YB 2N75A 2PPLA 2ZBUA 3VFDA 4R8MA 2RB5A 4GMDA 4F3YA 2I2AA 4CU5A 1L1EA 3L1KA 2XNDA 2PT6A 1P7WA 3OO0A 2YW9A 1GRCA 2QUIA 3OAAA 4X6YA 3R7LA 2FSIA 5KWVA 3WIUA 3FD8A 1HO3A 5U9CA 1PVDA 2DECA 3ENZA 3HM9A 2JIOA 1XNGA 3IUQA 1QIFA 3OX3A 3UYLA 2R1TB 3LZDA 1WEKA 2CDBA 1A76A 2EQ5A 1BXRA 4ZMSA 5CLGA 4INZA 3H6HA 1JNYA 2B94A 3ZU2A 1X1BA 3NIGB 4D81A 2FI1A 3WYGA 5JD3A 3D6NB 1BCSB 4NARA 3ZU3A 4RLFA 3NHYA 3KWFA 5K0BA 3V4OA 4GUAA 5K0LA 5LZ4A 2ORWA 2WF5A 1JB1A 4ALLA 4PQYA 1U9ZA 5IAGA 1OGJA 3TEFA 4AZTA 2C2BA 2ECFA 3IBFA 5A5DA 4GWGA 1WBDA 3IA7A 1T2FA 5DGCA 1YRQA 3G13A 4FX2A 1NP3A 2UZ4A 2VCYA 3G1UA 5DVZA 3PKZA 1K6JA 1S4QA 3LXXA 5AI4A 3VGPA 3K1AB 2FN8A 4P81A 4DUPA 5JXIA 3FOBA 4BJ6A 2DU8A 4ZK2A 1UXIA 2GGSA 4B45A 2R8EA 3AB3A 4FLMA 3LYAA 4I1OA 4F71A 2DFKB 5HQ3B 1RP1A 2CK3D 2O7QA 4RV4A 4RHUA 2VAWA 3F6PA 3FYUC 4EYKA 1ZCAA 2PXXA 4V0NA 3ZWAA 4CQJA 2OK7A 1YZYA 1E2EA 5DGXA 1PK8A 2GN6A 3A2MA 4IFBA 3C5CA 3ZHRA 3ZH9B 2H4XA 4O1HA 4WAUA 4C0QC 1ZNZA 1ECFA 4RA6A 4YP5A 3V1NA 1VE1A 3T0FA 4YXWA 4ZHQF 1CRLA 3FLEA 4KB5A 3ZS9A 4GPAA 2X0DA 1GWNA 4MWOA 1FTQA 2HIGA 1DIAA 2WBLC 2RCNA 1NPYA 4G5YA 3I0MA 4LK2A 5I9IA 4N41A 3GHHA 1B73A 1PR1A 1QHHA 4BUJA 4H7IA 2X8AA 3RAPR 4AKEA 3AI1A 4EW2A 1YJ8A 2CVQA 1AGPA 3KHUA 3LW8A 4CMHA 2QM7A 2I99A 1MNQA 1OIWA 3GPBA 2W6PA 3HQ4O 4I4IA 3FMFA 4H08A 4L07A 3COVA 3HY4A 4HDNA 4MJ3A 2JS7A 4DQDA 3SNKA 1XT6A 1QZ3A 4IHJA 2O3UA 1NVUQ 3B53X 4BNGA 2QLFA 4I66A 5KTMA 1Q0SA 4P84A 1YDHA 1GN8A 1CDEA 2VAVA 4MZDA 4KO3S 1W87A 1IJEA 3EXIA 1FNSA 3A11A 5AM4A 4AT1A 1X0XA 2HTEA 5EVCA 2GZSA 3PTZA 2FMXA 2QQGA 4PO8A 3T3IA 3GV0A 2X13A 3CNBA 1BW9A 2ZE8A 1X1AA 3REGA 1TUEA 1UMDB 5CX4A 3RU2A 5KWIA 3WKCA 1MIHA 3K9GA 4HB3A 1YZGA 4KJZA 5AHKA 2GWHA 1ZC3A 3TI7A 3ZHCA 4D26A 1TB4A 1Y9EA 4Q4HB 3TL6A 2FGKA 1G42A 1HM5A 4P38A 2G83A 3UHFA 3VPHA 4E08A 4ZYLA 4GPD1 1BDBA 3E70C 1E66A 3E5NA 3AI7A 3WMGA 4DLKA 3K7EA 4AJ2A 1EVYA 1M34E 4FYHA 2AQIA 1E9FA 4MA0A 4ROSA 2X19A 4XIYA 1JT2A 2V6FA 3QXHA 3KQMA 4L4SA 3NJ4A 2HQSA 1MDBA 3E3AA 4K87A 3FJ1A 3TKAA 1QQ5A 3D7MA 2OXCA 4OGLA 3WJ1A 4JBWA 2QA5A 3PI7A 4JDPA 1BHJA 1K08A 2DPHA 1P45A 2GA9A 5LZ7A 2FRVA 1KZHA 3BG5A 2D2FA 2WY2D 4N5IX 5JSHA 3FCXA 4G5FA 3NTUA 1G9XA 1MENA 4ADSG 1YL6A 2NSLA 3DWFA 3ILSA 2ID7A 4U3JA 4CT4B 4RL6A 4XUCA 3ZQKA 2HMSA 2PUBA 4TTQA 3QOYA 1IC6A 1YQEA 3P94A 3FLMA 1QF9A 1Y6RA 1TI7A 1SOAA 2J3DA 3EHDA 2BMJA 2HJSA 2P2SA 2WFLA 3KOUA 3I6YA 4TL7A 4QDKA 2B37A 3TGLA 1XMOB 1Y5LA 2C9CA 4K9SA 1UMCB 4UU8A 4BN5A 3A4IA 4EI9A 1ZNQO 3CVJA 2IEBA 4DJDC 5DM0A 3FTNA 2G40A 3ISTA 4NCXA 3GYBA 5FJJA 1XJ5A 3HCOA 4UZFA 2HADA 2YXEA 3DZHA 4ETIA 1KI3A 2G08A 2VDMB 3EBPA 1F17A 3ICEA 1AKNA 1JYFA 1PSWA 2J5RA 3JQ9C 4JJ7A 4XB2A 3HKCB 3UXYA 3O3OB 2C8LA 5IAOA 1Y7IA 1Z0IA 2HCFA 3OIWA 5SY9A 1O94A 3OC6A 4B3XA 5HPYB 2EG5A 3TSYA 1LKZA 3G9UA 1ZESA 2A84A 2RCYA 4Y67A 4B44A 5C7LO 2VQ6A 1LRJA 5EUQB 2I71A 1EGMB 3P32A 1CUGA 4UEQA 4EJ6A 3WKBA 3OZWA 5E4TA 5BV2P 1T5IA 3U9SA 3HYNA 4LFBB 1SULA 3H1BA 5BR4A 1GZ5A 4LBVA 1ANKA 3U31A 1KDZA 3T94A 4KQXA 4KQ2A 2O54A 4Q39A 2GSWA 4YLEA 4D4IA 1LDYA 1CDZA 1D2EA 1TPZA 1NQOA 2PMFA 3KO8A 4XR9A 5DBEX 3QJGA 3H0EA 3IH5A 4JLPA 5MN4A 3B9PA 3BL6A 1PJ3A 2I8LA 3KZ1E 1EE2A 2AEJA 4NOMA 1EJBA 3O2JA 3JVUA 2BFDA 1NVKA 4ZDJA 3D0OA 9ATCA 4JSRA 3TZKA 5GONB 3A9UA 3GGJA 3T4UA 3B52X 1EZZA 3CUVA 3G85A 1A5AB 3X1DA 4UM8B 4MS3B 2VA9A 2V97A 2OV6A 4MWTA 4F2HA 1OI3A 4MR7B 2WQZA 3C4JA 4YRJA 4DZRA 4UNPA 3RFVA 1BVRA 3LPMA 5DCLA 3WK7A 2PEZA 3ILHA 5CEFA 4XRRA 2X3YA 3RT9A 1N2XA 2MTBA 2FSVA 4MCAA 1H66A 4RCZA 4KK4A 4GP6A 3QVWA 4UUMA 2HYDA 2YRXA 3ILYA 3AWDA 4R01A 4DLBA 1WSDA 2QN1A 1F0KA 3ZLJA 1W36D 4RF3A 1BU5A 4BASA 1M2VA 2O57A 3JR7A 2P9YA 4I8XA 4NCHA 4RVSA 4U2FA 5CVCA 4ASUD 4ZFNA 5FL7D 1S2MA 3GRPA 2VTKA 2AF3C 4FNGA 5ES3A 4CL3A 5JH7F 5SYNA 1DEHA 1HETA 2VHWA 2O3RA 1YUBA 5LPNA 2CJYA 3OZEA 1W75A 3T41A 3VSDA 2FW7A 2I0FA 5LNK1 4MPDA 2VDQB 3E9ZA 4GPTA 4LYYA 3MG9A 3U7JA 5FWAA 1EM6A 1JQBA 3KQVA 3AYXB 4JT9A 5LUBA 2C0QA 3DE5X 1M1YB 4GOMD 4X7MA 1GKUB 2C2MA 3CZ9A 4ZALA 4PNZA