3L7NA

Crystal structure of smu.1228c
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
234
structure length
234
Chain Sequence
MRIHFILHETFEAPGAYLAWAALRGHDVSMTKVYRYEKLPKDIDDFDMLILMGGPQSPSSTKKEFPYYDAQAEVKLIQKAAKSEKIIVGVCLGAQLMGVAYGADYLHSPKKEIGNYLISLTEAGKMDSYLSDFSDDLLVGHWHGDMPGLPDKAQVLAISQGCPRQIIKFGPKQYAFQCHLEFTPELVAALIAQEDDLDTQSQTETYVQTAEEMQTFDYSSMNQALYSFLDRLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of SMU.1228c
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 75
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l7nA00
3B38A 3TTVA 4ADSG 3EZGA 3NOOA 3CYFA 4Y0NA 4E5VA 4GUDA 4N12A 3M3PA 3TTXA 3ER6A 3GRAA 4N0MA 1Q7RA 3OT1B 4ENPA 4JQSA 1N57A 2YWCA 3R76A 1FYEA 4L8YA 5SY4A 4AUMA 4GE0A 1ONSA 1P81A 4AJ9A 1GPMA 3BWEA 1OX6A 1I1QB 3NOVA 2YWDA 4Y1FA 4AULA 3UMMA 4BFLA 5JZOA 2ZUWA 1OI4A 1P80A 1P7YA 4B40A 2AD5A 1T36B 4K2HA 2R1VA 1QF7A 2VXOA 5SY6A 2R1TA 3TTUA 4B5KA 1OY1A 4B7AA 4RKYA 3SF8A 4OGFA 5DFAA 1IZYA 3TTSA 4L7QA 4MNTA 3L18A 1K9VF 4XLLA 1GGFA 3VU3A 2VRNA 2A9VA 3KKLA 1PV2A 1KWGA 3F5DA 3EFEA 3PQ6A 3P9RA 1P5FA 3PQ5A 4ZDJA 2RK4A 2VKTA 4Y1RA 2NV2B 1OX4A 3WFZA 4QYXA 4B31A 4RKWA 2R1VB 4UZSA 1QDLB 2R1TB 1KXJA 1CE8B 3CNEA 3NORA 4UOQA 5E9AA 4E08A 1T3TA 3SF8B 2GHRA 4ENTA 4ZDKA 1R9GA 1O1YA 1GGEA 1Q2UA 1QWSA 3TTTA 2LXNA 4UNIA 2YWBA 3NONA 4L78A 3CZ9A 3NVAA 3TTWA 1CS0B 1P7ZA 5SYAA 1IPHA 5JZMA 1WL8A 1OX4B 4ENQA 3PQ3A 4MGHA 1KWKA 3P9PA 4I4NA 5IP5A 1VCMA 5SY9A 3UJNA 1A9XB 1G2IA 2RK3A 4L8WB 4R7GA 4WXYB 3RHTA 3ZR4B 3N7TA 1VHQA 3ZJ5A 1J42A 4ENUA 1BXRB 4LGYA 4AUEA 4L95C 3F71A 4P35A 5LIRA 1QVZA 1U9CA 2ZUUA 4S0ZA 3R75A 2ISSD 3NOQA 2GK3A 4QYTA 2W7TA 3PQ7A 1VCOA 1I7SB 4MTCA 1PDVA 3B3AA 3SOZA 3EWNA 3UK7A 4D1YA 2YWJA 4Y1EA 1JVNA 2FEXA 4UCFA 4BTEA 3PQ2A 4Y1GA 1OX5A 1SY7A 5BV2P 3PQ8A 3D54D 3L3BA 3TTYA 4Y1RB 1SOAA 2XF2A 4GE3A 1KA9H 4I46A 1C3OB 1UCFA 3UGJA 2R1UA 2VDJA 3B36A 3BHNA 4B2YA 3P9QA 2H2WA 3EN0A 3PQ4A 3FSEA 1GGJA 1GG9A 1QVWA 4AUNA 4ZDIA 4OJYA 2VPIA 2NV0A 2RK6A 1KEEB 3CY6A 4PXYA 3ZJ4A 2OR3A 4ENWA 4P5PA 3FIJA 3L4EA 4HCJA 4L8FA 2IUFA 4P2GA 2WJZB 1L9XA 4WINA 3TQIA 1PE0A 1T0BA 2V4UA 1CF9A 2AB0A 1M6VB 3UOWA 1PDWA 1FY2A 1GGHA 4UOZA 1JDBC 3OT1A 2ABWA 1GGKA 2D7JA 3CZAA 1VCNA 1C30B 1IZZA 4OGGA 3L7NA 4LRUA 3MGKA 4OIFA 4ENVA 2ZUTA 4ZGGA 3P9SA 3MIIA 4OFWA 4ENSA 1QVVA 3EJ6A 1S1MA 4OQ4A 1I7QB 3R74A 4P34A 4I2NA 5K4AA 4BIMA 2ZUVA 1GPWB 4ENRA 2ZUSA 4P36A
chains in the Genus database with same CATH superfamily
1Z7EA 1B15A 3WKCA 4PFJA 1PGQA 3P9CA 4QUGA 2I34A 3PUXA 2CLCX 2WWTA 3U17A 4QYSA 4KJZA 4E5VA 1AHPA 2HJHA 5IM4A 1USKA 2OD9A 3A26A 4CN8A 3Q0EA 3L8MA 4DKXA 1VIAA 3QUQA 5IZ4A 1RPAA 3MXTA 4B87A 2HSWA 2PR2A 5FIUA 4AP5A 2QDXA 4F5DA 4MHSA 1Z4OA 3V7NA 5L4SA 1HNZB 3ECAA 4IFEA 3K8YA 3LLUA 1U1CA 2WKSA 1NQVA 4HTAA 1BHQ1 5G0WA 1AK1A 5L51A 2MHCA 3RKSA 2XWJI 2OXIA 1DO2A 2M2IA 2NSJA 3RUAA 1C80A 3E82A 2YJ5A 3FGPA 1BMTA 3TB4A 1R00A 4LOHA 1OFHA 2O7QA 3EFEA 2B0CA 1ZL0A 3VTAA 2WG1A 4D3ZA 1DC8A 3H5TA 4LJ9A 3HM9A 5F64A 2HR1A 2IE8A 2HY7A 5JQGB 3K6JA 1OBOA 3SR4A 4I4CA 4KV9A 5D3MB 4PQGA 4LXGA 1TNDA 3GFRA 2OCDA 4O2BF 4IVRA 3UATA 4RXTA 1R9GA 2WOOA 4HWKA 2ZSHA 4OBWA 3EISA 4A27A 5ALUA 4BCCA 3BXEA 3I3OA 4H18A 3PNQA 2QUIA 2ICAA 3GDFA 4GL2A 1WR8A 4V0MA 3ZQUA 5IHPA 1L3BA 3LX8A 5JZMA 4ZCRA 2QSUA 3FF1A 4BFSA 1RXWA 2D06A 1M33A 3QX8A 1YRHA 4RSMA 3UJHA 5LWQA 3OQMA 1C9YA 1ONNA 2ZBEA 3CUSA 1JHZA 1KO1A 3ZZ1A 3KR1A 5BR4A 4RTPA 5EP4A 1F3OA 5EHGA 3C5HA 1L2TA 1RDFA 2D8AA 1U3TA 4DLZA 4URUR 1XPOA 3LX4A 2VK4A 2F90A 4JN6B 3PEYA 1RBMA 3EXG2 3HA2A 1N4AA 3CH6A 2A5GA 4EDHA 4KNWA 1RM0A 3NWBA 4WESA 4XDGA 1G8GA 4B44A 4LXIA 2ZAMA 1PRYA 4EG3A 2IS1A 1KR2A 1UP7A 2VT2A 2DPHA 4PZCA 4D4MA 4PZ0A 3AF3A 5AI6A 3AG5A 3K0AA 1JLLA 4Y1EA 1DINA 4BNUA 1WG8A 3H2ZA 5HM6A 1BMFD 1TADA 3SZRA 5FADA 2X1VA 3PRKE 4U9IS 4DQXA 1T5IA 3W3ZB 1CX9B 3C3EA 5AHKA 4G07A 1VIMA 1RLJA 4HGOA 5KPJA 3CZPA 4ZOCA 3EN0A 1P61B 2OT3B 1XLWA 2C5FA 3KQOA 4HDMA 4KQ1A 1RTKA 1UIMA 4D8UA 3PNPA 4I5FA 3RIMA 4CCYB 3GH1A 3C3JA 4KK4A 1YDGA 4G4JA 1HYEA 4RWZA 3SE7A 1RZ3A 5D84A 4TOIA 4Y67A 1W5SA 3PGA1 3L4EA 3Q7TA 2H29A 1MG5A 3UN1A 3LYLA 4ND1A 4D0NA 4D4GA 1WVIA 2ACEA 2COKA 3WR5A 4DBZA 5K3SA 3O26A 3OM1A 2WV9A 5ALHA 4MQUA 2BGNA 4BVKA 4OXYA 1A8IA 3KPJA 1A71A 2K5UA 3OT1A 3DJYA 4B76A 1QRRA 1V37A 4NAVA 4EPVA 1C1DB 2FWBA 2H06A 4IEEA 1SULA 2JGNA 2IV2X 1M1ZA 3WMGA 5F7XA 5KDOA 1W4CA 3OTHA 5IAAA 4A82A 3ZWBA 1OMOA 1VKOA 1ADYA 3GB9A 3IUQA 4B3DA 1PQUA 3F67A 2UUPA 4RF4A 3NU1A 1Z17A 4ALIA 4XX0B 3EXG1 3TTXA 1DQZA 3AHFA 5JMPA 1NDHA 1QH8A 1XMVA 2JGLA 3I6YA 3RG8A 3THXA 1JYFA 1O0SA 1H4TA 2NNWB 2IHKA 1ZW1A 2RAVA 4PLCA 5H4HA 1QR2A 2GBPA 2IY9A 2IZ0A 1AT1A 2ZWIA 1UJMA 5G3YA 4RL6A 4F6RA 4W5TA 4PV7A 3GRYA 1QLWA 2BFMA 2ERXA 3E1SA 3QELA 4G3XA 2C9DA 4OSOA 2K2WA 5NULA 3HXLA 3VJRA 4N54A 2HK9A 3BQMB 1V3VA 3N7AA 2A57A 1OYWA 2OP1A 3I2GA 2XE4A 3MS2A 1V1MA 4PE5B 5BQ3A 3HB4X 2QTFA 3LLSA 4G26A 3F9CA 2HUNA 4UOEA 4Q9IA 3CUTA 4CJXA 2XLBA 4PRKA 2PYDA 3B5JA 2DFTA 2Q8QA 1I4OA 4MVJH 2C4UA 3WIDA 2HJGA 4CMAA 4N8SA 1JDZA 5JMTA 5FLKA 4CIVA 2C97A 4DNPA 1MPXA 2VQ6A 2ZSAA 2ZSIA 5JW6A 4K81B 2O07A 2I8LA 3LKVA 5AVOA 2QSZA 1XYYA 4JBWA 2C9OA 1ZJZA 1FUYB 2YJ6A 2R66A 3IALA 4G84A 5D01A 1K0FA 3IDQA 3WGLA 2QBYA 3ZHOA 3NX4A 3UAYA 2N46A 5FNZA 5KMGB 4JJFA 1L7DA 1O4VA 3IGFA 4Q12A 4MS1B 4KH0A 2VIIA 3GFPA 3CW2A 2YCBA 4L3VA 1QHSA 2Q46A 4H0CA 3SK0A 4UFPA 1J1UA 2VXYA 2RH5A 4KIJA 4EVIA 1H6BA 5C18A 4BMDA 5B7GA 1CYEA 2W6MA 5JXIA 2YOFA 2OFOA 5F3DA 1JG4A 3FPKA 4B1FA 4OXKA 1JGTA 2JGIA 3G2MA 4WBNB 1BW9A 1KIFA 1PJZA 3N8IA 5I4CA 1TM1E 1GAXA 3OBBA 3EMBA 2NU7B 1HDIA 1KEPA 4FNOA 4WY2A 3GJ3A 1M0TA 4N5HX 1VE7A 4R3UC 3R75A 3GHHA 4QAJA 5IVIA 3NOQA 2FMXA 3EG5A 4G0ZA 5HKBA 4WOJA 3THWA 5IN4A 2FN7A 1H65A 2OKGA 1PYOA 2QENA 1ISFA 3N5CA 4BX3A 4C5AA 5EJ6A 2C31A 2PKYX 3KLOA 4QM6A 1QC5A 6REQB 5FBKA 1HE1C 1XRRA 3B7PA 5FWYB 1PVDA 4UMDA 2A1IA 3GA0A 3J80A 2BUAA 1NULA 1IY2A 3Q6NA 5ESXA 1CRLA 3GYBA 3VR5D 2EFGA 3EHEA 1SAYA 1XOIA 2C4VA 1AQIA 4CW7A 2HT1A 4Y2SA 2PH3A 3PR1A 5T4FA 4MROA 1K8RA 3LI2A 1KYTA 4NOJA 2XE8A 4JC4A 3EUEA 3SP1A 4DSZA 1W5AA 1G7TA 3CVOA 3HU2A 4PXYA 4U2DA 1R6DA 4M38A 5G1NA 5B3JA 4XFDA 1ODCA 4ZWNA 5JI2E 2AR7A 2JZOA 3EULA 4XYLA 1YAHA 3EA0A 5HQ3A 4AZ3B 1GUYA 1KC3A 4FLFA 3SF0A 2IYNA 5L3ZA 3W4JA 1T0BA 2IHUA 3H19A 1WO8A 3KZNA 3MTJA 5FQNA 5AOCA 3VV3A 1FTWA 2VC2B 4ETMA 3E8MA 4DSTA 1HK7A 4Y6SA 1T9BA 2RSLA 1OH5A 1DQRA 2XQGA 3LC1O 4JBNA 3TBHA 4AKHA 5FJIA 2QPLA 4JBGA 1OBHA 3UCFA 1R6AA 4BVBA 1F12A 1RJWA 1Q20A 3IOBA 4CG3A 4QOSA 2WR8A 3F47A 2V6FA 3K8QA 1QQ6A 2B4KA 2RKWA 1O89A 2NTEA 3EEQA 4UEQA 2XCLA 5EIOA 3V46A 3B82A 4AUKA 4R1UA 2QS9A 2DGDA 4E3ZA 2FUG6 1JR2A 1ZD9A 1I01A 5EQFA 5BR1A 3KT6A 2WHEA 1R3UA 3SBDA 1VMEA 1RXCA 3FJOA 3HCWA 1JTFA 3DV0B 2J9ZB 4PYIA 2R84A 1E2PA 3SFVA 3V4VB 3EDMA 5LYJB 1UPXA 2HGSA 3CX8A 4ZKEA 5HSGA 1DEHA 1WB6A 2HPHA 3IH5A 3U1VA 3K9NA 5CPFA 1HO3A 4EVSA 5KWSA 1KSJA 5BQPA 3NRCA 5L6LB 5LVAA 3ETJA 3K1AA 1J2RA 1ZMXA 4FI3C 1M8GA 2YYAA 3HZOA 1GOTA 2MIIA 1PV2A 2JFFA 1XF1A 4HQKA 1NHGA 1A4XA 1Y4SA 3F9IA 2YDYA 4C05A 2XX3A 4ZQHA 1H94A 3H9JA 3HU3A 2PUFA 4IV0A 1LS1A 4EJMA 1KS2A 4R0NA 4CPDA 2A14A 2B8EA 4WY5A 2X2OA 2KLBA 4KK3A 3T61A 2VBIA 5H9WA 1A7UA 1D2MA 4GICA 1TVKA 2WYVA 3H9QA 3LUKA 1WPGA 1G0NA 3MWDA 4M55A 2IU3A 3BULA 2IF2A 5E4YA 3PE3A 2O6LA 4OHZA 1JJBA 1L8OA 1NL3A 4AZ0B 5G40A 2VJAA 2IJGX 1XXHA 1TYEB 3S1AB 3NKFA 2ZTSA 3E5HA 4HQNA 3Q72A 2CLFB 4GQIA 4CIDA 3UBTA 1A9SA 1HDYA 5CJ2A 1Q1QA 1FXUA 1S2DA 3T99A 3F7TA 1S7GA 2H00A 3CR3C 1DIHA 4ZAYA 1G19A 3ZDRA 1ZLYA 3G82C 4H59A 4M0LA 4PAMA 1GTVA 1NC1A 4LPSA 5AK6A 2ZZMA 3WYGA 5JECA 1R6XA 4EH1A 2AA3A 3NXSA 4KOAA 3OFND 3TR0A 4RPHA 3TRFA 4UFNA 5KBYA 3BZUA 3SC4A 3FYUC 4Q16A 1E7QA 1RYEA 3CZCA 4IOKA 3TQOA 1CEEA 2D0PB 4UU8A 2OSBA 2YJZA 2OWEA 3B6IA 2WWGA 1PBTA 3EXEA 2OFFA 5AK4A 1X9IA 3VOTA 4D7AA 5AOBA 3U0VA 3AP3A 1W6RA 3A4TA 5T4HA 1KE1A 1ZONA 2ATVA 2H7XA 3KR2A 2DETA 4OHOA 4PZAA 3ZUGA 5F12A 1ENOA 5ICMA 4IQGA 1JTEA 4O4HF 4O0MA 5ED4A 4HO1X 4X91A 1FUKA 3QPWA 4R8SA 2P0AA 4EHIA 1QQTA 2GR9A 4M9SA 3WYAA 3IX7A 4Y2TA 2V4MA 1J0XO 5B58T 2FE1A 1VL1A 3DBVO 1IB6A 3DCNA 2GF9A 3THYB 1EAMA 3O8LA 2W48A 4O4JB 1EGVB 3DR5A 3V9PA 1M7BA 5LYYA 2H59A 3BMNB 4P34A 2IHBA 3GDHA 5DM1A 5TJ9A 1CDDA 1COZA 3PSAA 2ZS7A 3F5FA 1OLXB 1SUPA 1TJ5A 3RU9A 2AJ8A 2R87A 6GPBA 5AI5A 4GGOA 2FZKA 2XSZD 4E03A 1M7HA 2D5BA 4IJ5A 4NE2A 5ITZA 4B2IA 4C20A 2HT6A 1F6DA 1YC5A 2W6PA 1TKAA 3O4VA 5EJFA 3UGKA 2FUKA 3RVRA 3ILYA 1POXA 3DL7A 3H11B 4BKOA 1YT5A 421PA 2COEA 2V0NA 3NBZC 2G9UA 5D1NA 2G1UA 4R9RA 2YYYA 5EUCA 2JF0A 5U9CA 4WJKB 5TMEA 2YVLA 3JR3A 4H3KB 4BDTA 2BEUA 4I9UA 4NICA 4R1NA 5DFAA 5K99A 1E4OA 4IOJA 1QIFA 4HYTA 4OATA 1DRKA 2AZTA 1L6IA 1AY0A 1H2HA 4TQAA 1M0EA 1FRFS 3GJ4A 3INYA 1UJ4A 4KPUA 4XOIA 3WWPA 4FFNA 2CVHA 2IX3A 4IJKA 5GIOE 3KZOA 4KFCA 2H6EA 5HGJA 6LDHA 2G0NA 2ID4A 5DDIP 1DQNA 1SKYE 3ABOB 4CL2A 4G5SA 1XKQA 3I30X 4DXDA 5DYYA 4YPVA 4HEHA 2YRWA 4LXUA 4UHCA 1HOXA 3QHAA 1ORTA 3TUIC 2VDKB 4HNAB 4DLVA 1KYWA 3FIUA 4QBGB 3Q8KA 4Z3DA 5JNRA 3AY7A 4RE6A 1IHPA 2I7XA 3P0JA 4PSVA 4TLDA 4D9BA 1NJGA 4GLBA 3GMSA 4Y2QA 5CFRA 3VNAA 5H7XA 5LOVB 1DQSA 4ND5A 5TS2A 3ZHSA 3B51X 3Q3GE 3B1FA 2JGAA 4HNHA 2ZBGA 5D5QA 1VC2A 4C9BA 1UXIA 4R3WA 4YXWD 4QC2A 2R8RA 2V7BA 3M6AA 4JYBA 4I50F 4LHYA 4PHFA 4QODA 3SAJA 3WADA 3AF6A 4MLCA 4YJ2B 2YL2A 4C2TA 2G5CA 1CUAA 1ZK2A 5JEEA 2D0DA 2QAJA 4LMPA 1IUPA 3HO8A 3JRWA 4DL9A 1U2QA 4PX9A 1U02A 5HJEA 5ALWA 4FX2A 4KXLA 5AESA 4EARA 3PR2B 1MAUA 3Q0TA 4E2FA 2QD1A 4A23A 4D9MA 4DYDA 1W0CA 5L8VA 3E2PA 1NZJA 5ALIA 5FCDA 1V8OA 4TLBA 3GJQA 2WFMA 1YJCA 3HEAA 3OICA 4JT4A 4F56A 1VFPA 2UZ4A 1HZZA 1WQ3A 1E94E 1KFKB 3M6MD 1C7ZA 1RHRA 4MYHA 1UL1X 3LZDA 3KHSA 4W63A 4IYRA 2FXIA 3TOCA 5CITA 4AIIA 3MWKA 3ROEA 3HU1A 3QYPA 1DOZA 3NDIA 3KAJA 4Q4JB 1PVOA 1Z7GA 4CM6A 1CR4A 1QVWA 1QAQA 4HYYA 3PXXA 1V16A 1Z2OX 3NO4A 3T1QA 4IM7A 2QLMA 3DKPA 3P4YA 3DZGA 4D9IA 4GYKA 1JLHA 1LQUA 1E1MA 2FP4B 2R7NA 2DBQA 4DAEA 3W6UA 5F2OA 2KJQA 1D2GA 3K73O 1W4BA 4J16A 1F51E 2JFPA 5JS7A 1E2DA 1NIPA 4UTXA 2GYWA 1Q92A 3SZMA 4ACAA 4RJKA 3SHFA 5BPHA 3L8CA 1HDEA 4FUTA 5BWCA 5LP1A 4DV4B 2VJKA 1KQPA 2Q7XA 1Z0FA 1E8MA 3UMGA 2DR3A 3WRYA 4GNRA 4QEDA 3SEQA 2RHCA 2PS1A 4MK4A 4IX9A 3Q15C 5K51A 4C4OA 1T36A 2GGSA 1D4OA 2QR3A 5JJCA 4DV7B 4TTIA 1Y89A 1VMAA 3GPIA 4G8BA 4F3YA 2I3ZA 5CLIA 1VIYA 1P60A 3GPLA 1YJ8A 3AC0A 3E3LA 3RTGA 1FNSA 5DMHA 1SD1A 2OQVA 1AMOA 1ECCA 2Q0HA 2R7KA 2YV5A 2P30A 4XCVA 1SCAA 1XMXA 2IW3A 1OROA 1QO0D 1QZZA 1FQOA 1KPHA 5HMMA 3EUAA 3AEKA 4BFTA 5DMXA 1O6GA 3I01A 2ADMA 3SDSA 4O3MA 2ZIUB 1KO4A 2LKCA 3DW1X 4URFA 5BWBA 4MVCA 4CE6A 3N2LA 2IQ5A 1UOQA 1V4BA 4QDOA 3DXXA 3ETDA 3GFVA 1DC5A 1SRRA 2DYKA 1B6SA 4YI3A 4R84A 4FIZA 2ZRQA 1P0PA 4ZXFA 5B3JC 3E53A 2YWEA 3JWJA 3PKJA 1U1GA 4HMQA 1XRMA 3L5OA 4F84A 4XXHA 4KGDA 1NLUA 4RW0A 4DZRA 3QG1A 1AQJA 1YIAA 2IYEA 2V7UA 3RVSA 5IWCA 5TQJA 2B20A 2MMCA 5K03A 4FE3A 3ZQ6A 4R2XA 1F14A 5LBUA 3EGWA 3AM4A 1OYVA 3T7SA 1KZ9A 1TU0A 1JB9A 1JS1X 2O9JA 3L49A 4IDFA 4RZUA 4BVEA 3EW9A 3NHAA 5EAIA 1MVOA 1L7EA 1ZJYA 1CUWA 3QYAA 1IHYA 2Q2OA 5D3ZA 3SHVA 3N8HA 1BQ4A 5KAPA 2DLCX 1JL3A 2Y2UA 1S02A 4J0CA 2OG1A 2ERYA 4Q1BA 4QICA 4O4HA 4E4RA 3F8TA 2OYSA 2JD0A 3TQRA 4Q01A 4XDHA 3QY0A 4WUTA 1GKIA 2E82A 3LBHA 4EHBA 2YS6A 4F2GA 3QKIA 3QE0A 4S1TA 1NVDA 3MUEA 4DCOA 3EZXA 2ZSBA 4LNHA 1XI2A 4X41A 1CDEA 4U7DA 3UAOA 2MMGA 3ICEA 2H1WA 1ZKDA 2APJA 3ZI0A 2C5AA 2EEZA 3RF6A 4HNRA 4DCNA 2NP6A 4QEKA 2WF7A 4B83A 2QW1A 4QU9A 1IRXA 3QU5A 3ZX4A 5H8WA 5HILA 2XT9A 2JAOA 2P6MA 4LZAA 5LZ7A 3O4RA 1NI3A 5HK8A 1FA9A 3TIGA 4HH1A 5C7IO 3AUSA 1I2MA 2X7XA 4V0OA 2WJPA 4JUIA 5LIPA 2IZOA 1ZYUA 3WDMA 3ZV7A 2ZTUA 1NP7A 3OESA 5TPZD 5KWEA 1E1NA 2GVNA 4Z1OA 2P79A 3UAXA 3VNSA 1LTQA 2FEOA 2CHEA 2QT0A 5BYAA 1CR6A 4MUYA 4RZXA 1Z5PA 1JLLB 1E7YA 3WXBA 1E1QA 4PQEA 3LDAA 4G24A 1UMBA 2C0QA 3HR7A 2RKOA 3TZLA 2B8WA 1RBQA 2CHQA 2A8YA 1U81A 3R7NA 1PZFA 3CRRA 3OHPA 3VDRA 2HRBA 4PG8A 4X94A 2GLUA 2D3TA 1CUSA 4RE5A 4KR2A 5M2QA 1UT5A 1RXUA 2J3LA 4HDMB 4DIDA 5J1TB 2IZ7A 5IJ9A 2XYRA 3DC7A 4UTZA 4OXXA 2Z04A 4LRYA 1RC0A 2W2LA 4FFBA 2BBTA 1GGMA 3VHQA 3KAQA 4AJKA 4KQEA 4MJXA 4R54A 4YRQA 1UJ2A 3Q12A 3NH9A 4P36A 5EXTA 4QG3A 1CYDA 3U48A 1WETA 3MWGA 2R6R1 3D4OA 1U2DA 1CZHA 1UXHA 3RVNA 4R8VA 4WXPA 4EHNA 3CZMA 4S05A 3OT1B 4H2DA 1QPBA 4G36A 3AR7A 4IFBA 1AZWA 2BMDA 3KJZA 3FNGA 2QPAA 2VYND 3CIFA 3BJMA 3DP9A 4HDKA 3DZ8A 3RCBA 1VKZA 1YB7A 4OLAA 1B16A 3PEUA 2A3NA 1CY1A 2ZRHA 3OOHA 3G02A 3CLTC 4B4UA 2DCMA 3VYTB 2PZLA 2J5XA 4JLWA 3V7YA 2PD4A 3ZEAA 3LKBA 2CWDA 1PUIA 4RH3A 1QH8B 3THXB 1UBEA 1L5HA 5LA6F 3TBKA 4I50A 2DTEA 2JFUA 2J3EA 5D85A 4CG2A 1HR0B 3OOEA 1SZPA 5JAUA 4FYIA 1N2XA 1VI6A 3USZA 3U13A 3U60B 4JEIA 4TTQA 2OZLA 4W9NA 4F6RB 1NBOA 4L8VA 2VSNA 4OXNA 2GDJA 3I04A 5CFMA 3N9IA 1NVXQ 1RRMA 5D5HA 3QELB 2IYWA 3RROA 2JH3A 3T9EA 3RVPA 4QUIA 3OI7A 4NG5A 4Q3LA 3RSHA 2PUBA 2GASA 4PNZA 2H4YA 4U2BA 2LVBA 2VJLA 3WMRA 1H8ED 2H31A 2Z0MA 3FNRA 1V1MB 2HF7A 4ENTA 3Q5EA 2PVSA 4RPGA 2Q2QA 3VPCA 5KZMB 2N42A 1GPJA 1DZIA 3ETCA 3HA7A 3IT1A 4TS3A 5EHZA 3WSWA 2WWIA 3CKMA 1KMNA 3FCXA 3OUZA 4YDHB 2B7BA 4Z9XA 3NXKA 1ZJ6A 2HD4A 2DPYA 4L5BA 2FMHA 2JCBA 2G72A 4ILEA 2Q5CA 4HS9A 4NPCA 4RUKA 3ZWMA 2YN4A 2DPGA 1EYZA 1R9MA 2Q1TA 3ZKAA 2QBYB 1M9NA 3ZY6A 3RHTA 4ZVRA 3M6LA 4UEJA 5B64A 1UBHS 3PF8A 3Q40A 3FBGA 2R6DA 4R2KA 1IN1A 4RVGA 4MA5A 3GROA 4IG4A 5LQDA 1N0IA 1Z29A 3ZE6A 4F4FA 1P2DA 3FROA 4YQEA 1QLHA 1UPCA 2ZI3A 1W5FA 3BB4A 4PNHA 3AKEA 3WY9A 2EXXA 1M3SA 2WJ4A 4BNIA 4ZOQI 2FN4A 3C7AA 2RGRA 5DNUA 1Y1TA 3WYCA 4L6CA 1DKRA 3IUYA 2YBDA 4I55F 4WK2B 4Y1GA 4LNUA 3KM0A 1FNBA 1PUJA 1BW9B 4DLRA 5HKOA 3IPAA 1XRSB 2LW7A 4LQ4A 1U9IA 1UPAA 2FR0A 2RHHA 1YBMA 3I9JA 1I2CA 1RPNA 4LJKA 1W49A 3LDHA 4LN1A 4TX1A 4TYYA 1T2FA 1M2GA 3OTIA 3THWB 4WD3A 5BN4A 4GVXA 2Y1WA 3DGFC 5A5GA 1W46A 3ABRB 2KI5A 1Q91A 4ND8A 1OAOC 1QC5B 1UWCA 4NCXA 3RT1A 3VBEA 4BMCA 2G28A 2XQKA 3CB4A 3OCYA 2BI7A 2P9TA 1J1ZA 3AFMA 4EUKA 1KZYC 1N2CE 4OQYA 2IY7A 3R7FA 1CF9A 1O9HA 4AZTA 1TMGE 3AP2A 1W2HA 4ZVPA 2IBMA 4KB5A 4S1NA 5FOVA 1EFPA 5LUBA 2ZI4A 1QOQB 5KSPA 1E58A 1Z75A 3ETEA 4P82A 5TEWA 1QHXA 3JYQA 4KR0A 4LOJA 4MRRA 4RTRA 1SBCA 3EDCA 4PZZA 4DXAA 4IPTA 3IQDB 4MKHA 1CLEA 2JFZA 3HC7A 4CEIB 5IDWA 4Z86A 2VPZA 4PYQA 3KFXA 2DMRA 3QSGA 4CLHA 5HQ3B 3RV4A 4OHWA 4ZO9A 2G3YA 4I5GA 4HX5A 2LPMA 3MG9A 4I8XA 1Q7RA 2AS0A 2OESA 1QHFA 3L0YA 1CR1A 1GILA 3UG6A 1Y81A 1LSOA 2NZYA 4ACBA 2ACWA 3G79A 5A9SA 3AZQA 4X54A 1UKZA 2PMKA 3G5LA 1ZQ1A 4GLFA 4NULA 4P5DA 1YBFA 2OPHA 2FPGA 2FSPA 3DYVA 4WSOA 4WZBE 4KREA 2JFOA 2JS7A 3OOWA 4ZEXA 3JPWA 2ZJ1A 1G4AE 1RQRA 2GKGA 3BL5A 3NJRA 1VPLA 3AV0B 2E21A 2R1TA 4ZZIA 2GK7A 5B1EA 2BMWA 4URHA 1JIUA 4M0UA 3IODA 2Z2ZA 4P22A 4PNEA 3KKPA 3QE3A 3CG4A 3PUHA 4X60A 1TAHA 4GP6A 3UXYA 2IUUA 2PH5A 3LFTA 4JAVC 5HFNA 2NPIA 5ALPA 1XN4A 2D2EA 4ECEA 2G1PA 2ONZA 1O6BA 1LI5A 1IM8A 1T91A 2ZT5A 3IQZA 5EXXA 3TPFA 3UM9A 4PHCA 3G0IA 1FDOA 4O5AA 4L75A 1XAIA 1GQFA 2RCYA 3OF3A 4UZSA 3V4RA 2VHWA 3D6MA 1SXJA 2ODWA 3KAKA 3SJUA 1G20E 3T5GA 1G59A 1ZHHA 1H4QA 1GHTA 2IHTA 2WG0A 1V4NA 3KVRA 4L8LA 3K1AB 1C3EA 2BFEA 3ECSA 3FMPB 3M9WA 1TX4B 3FUXA 1G8KA 3RI3A 3PUKA 1TIBA 3ZDFA 7ADHA 1QU3A 4EW3A 1PQYA 3DAOA 4FHFA 1QQ5A 1AGRA 3ENVA 1ZGJA 3ONVA 2J32A 3NIFB 5G53C 3MCUA 2F9FA 2XW6A 1GFZA 4ISBA 1TVKB 3CE9A 2O8CA 1NVFA 1KHTA 5JBNA 1XAGA 2XHEA 3L7OA 1X0XA 3A6GA 3MWDB 4ND7A 3TRIA 1N5JA 1LSUA 2J9GA 1KOFA 4LJLA 1WUJS 4EPYA 1CNEA 1E7MA 4MUJA 4NQZA 3FETA 4K88A 2FDCA 2PZBA 1W59A 1LJ8A 1XXHB 1Z8DA 2H51A 3A25A 3FTQA 2Z4TA 4Y98A 1Q7TA 4G4IA 1GNPA 3MSXA 1E6MA 1UEIA 2P9QA 3OZRA 3ANNA 4U5XA 3KDSE 2G6BA 4MYDA 3AHEA 2OCBA 4J9UE 3X0DA 2JI6A 4Y30A 4QUJA 5I51A 4ZVUA 4RCZA 3QVKA 1ML3A 1P7WA 2GLXA 4UU7A 2NO7A 3DE0X 1GZ5A 1K4MA 1M83A 4GSKA 4FR5A 2IOFA 4KYUA 3OJLA 3OUTA 4JITA 2WDZA 4MRVA 5DHFA 1A8SA 1G2QA 3RTDA 5LD2C 1NYLA 1SD2A 3MPOA 3Q0IA 3P9ZA 3RTAA 3ZOZA 3UTCA 3MUNA 3O1HB 2Z9CA 3KZCA 2H2AA 3EXEB 4OQFA 1PDWA 4DDTA 2IHZA 3R7WA 1BCSA 1XKXA 2MINA 5LA6A 1XD2A 2P8SA 3RRFA 5M34A 5ADVA 5FYDA 4NYIQ 3KZVA 4MMZB 2C1XA 1JH9A 4FT2A 1AKNA 4C1BA 3ILHA 2CXTA 2LP4Y 2YBEA 2Z1DA 4LJ6A 1A9OA 1ZISA 3B8EA 3DT6A 3N8NA 1IEQA 2WPDA 3UKOA 3IXLA 4BNYA 4A8JC 2BY4A 3C4JA 4D3FA 1S2LA 3G8CA 3T35A 1Z15A 3R3JA 1OI2A 1IG3A 1SCIA 1XZHA 1GZDA 2Z1NA 4Z3OA 5AKYA 2QAIA 1VYHA 1XVIA 2IUEA 1GZSA 2I6GA 3I83A 3IQHX 3M81A 3DPSA 5I5GA 2DUNA 5K0EA 4LJRA 3L46A 4YAWA 5K05A 4FW9A 5KTRA 2AWNA 4EK9A 1NXTA 1LVGA 2WT4A 4PZLA 2I4IA 4XSVA 1U2EA 5JCZA 3M7IA 3ZZTA 4B3RB 5DBGA 5D3QA 4XLLA 5FDFA 1HMPA 5ITZB 4ESOA 2WM8A 3QITA 1OFVA 4Y6LA 2GUGA 5CVUA 4XUGB 1WVGA 1RWNA 2IEAA 2VDLB 2UYOA 3K35A 3IO5A 4MUXA 3QJGA 4F4IA 4NCBA 4KRFA 2IP1A 4B31A 1Y5NA 3QIVA 4LXHA 3NORA 2HSEA 1YQ9A 1QIMA 4G65A 1J2YA 3CZQA 3WYNA 4JBHA 2BEUB 3M0EA 4X71A 4GMXA 3ZY4A 4DUGA 5K6TA 2FJ0A 3ZW9A 9ABPA 3GEBA 1VJGA 3LLMA 3KOYA 3P2YA 2B5WA 1GRRA 1KI7A 2DQYA 1G9SA 2LXNA 3ANMA 3O3OB 4I55A 4KPUB 1L7RA 4YRJA 3FZEA 1EFVA 3K5IA 3PRHA 4IOMA 1LDYA 4QGHA 4TV8F 2FFJA 2QRGA 2HZ7A 3E5NA 2ZSKA 1KJJA 5JYDA 4B3TB 4UHFA 4MO2A 3B12A 4HF7A 2QU8A 4JLKA 4XYMA 3FR8A 1U2DC 4RF5A 1COWD 4XYEA 1Z18A 5ENDA 3VSBA 4B79A 5FKJA 1U0EA 4WKOA 4V1CA 3CRNA 3T7KA 4CFZA 1YSCA 1EBFA 2RI1A 4IVNA 3BMQA 3P19A 4F6LA 3KZMA 4PCLA 4DLNA 5I4KA 3PHIA 4AS1A 2B9VA 3ETNA 3TWOA 2ZXFA 3H0CA 3P4XA 4O4IA 5HHTA 4O2RA 3DWEX 2ATCA 1SHLA 2NO9A 1O6FA 1VXOA 2YZMA 2GK4A 3TCNA 3K92A 5KWJA 1IRIA 1MQSA 5CHEA 4YFYA 5J4HA 3O9VA 1TK9A 4PLYA 1T9ZA 2WM3A 2JFBA 4XM2A 2G08A 4FNMA 1XQXA 3UH0A 3BICA 4W9NC 3BXZA 4A7PA 5L45A 4PO9A 2Q3FA 1RBYA 3U1TA 2YFKA 3GPDG 4AKSA 2AKEA 2I5PO 1Z4KA 2EZUA 4AXXA 1ZINA 1RQ2A 2NZ2A 2RHBA 3D3QA 2PSDA 1VXRA 1P2BA 2VP3A 1UZLA 4UU1A 3AWIA 5EMKA 4D4JA 4CTOA 5EHXA 1ORHA 4MIKA 1GVNB 2CNWD 3HB0A 4Q6WA 3UA3A 3V8EA 4F5WA 3CZ4A 1JEYA 5E1DA 3EOAI 3QXSA 1EXVA 4U00A 4JBXA 3UKDA 1SJ9A 2WSSA 2FFBA 1C7IA 5F5XA 1ECJA 4LIPD 1Z6ZA 3KXDA 1E0KA 2XKAA 4IXDA 4WVFA 5CDUA 2DCUA 3TN7A 4YMSA 5EJAA 4EEXA 3U62A 1G38A 2P69A 4C30A 4CF4A 1X15A 1OD6A 2FW0A 4B4OA 1DBWA 3MGKA 4PIVA 4W1QA 1FUEA 3LUAA 2QTAA 3PI6A 4PZYA 1EM6A 1V16B 2A0YA 3GGCA 2Y0CA 4K6CA 5K2OA 1M0SA 2AN9A 5AQ1A 3FWHA 5DLQC 2IBSA 1Y9ZA 1M74A 1XU9A 3CLKA 4RK5A 3L2OB 3QOWA 4N4AA 5BNWA 3HS3A 4AYXA 4S1OA 3RR2A 1IVYA 5CYFA 2E9SA 3AWDA 5EZSA 3P52A 4AICA 3FBWA 4M60A 3G89A 4JI6B 2Z6AA 5DNYB 3AB3A 3S6JA 4BCBA 1AMNA 1JPUA 1NR5A 3CEMA 4JVSB 4GC9A 3AI7A 4EHHA 3R7SA 5EJ8A 1UC5B 3BGIA 1BH2A 2WIBA 5CLHA 1RWQA 1T36B 5D6NA 4N3GA 4R01A 1PYDA 3HCPA 2J7KA 2NWQA 2OLEA 3TTSA 2C57A 5UKDA 3N74A 2WV7A 3T0GA 5DTRA 3T5AA 1U7PA 1NW3A 1QMPA 1YZKA 1NMXA 3A9WA 5DLYA 2UUOA 2XADA 3SOPA 1BMQA 3W5JA 1ZNQO 1WNTA 3IP7A 1CB0A 4EJFA 4JI1B 1SQFA 3AEKB 1KK1A 3NEJA 3MS4A 5DPMA 2QLFA 3IAFA 5GM2A 5JVDF 3CSSA 1CRWG 1XQVA 3NC1C 3BF8A 4FZ3A 2Y9PB 4PIPA 1PW7A 1K8XB 2ORWA 2Y0PA 3CX7A 3IIMA 3KVVA 1H2XA 5CB8A 5BRNA 3Q98A 3RTBA 3AVPA 2YY6A 5HTKA 1LKZA 2YIJA 4FS8A 2BP7A 2J5KA 3WGTA 1JLMA 2XDAA 5CFQA 1KIMA 4XUDA 1KNXA 4QFBA 1NQXA 2QY6A 1E66A 1T5SA 1UQRA 1AQYA 1HDGO 1TI7A 2YRFA 3SVZA 3GCXA 2W2LD 4ZEMA 5JZVA 3ZWYA 1ISMA 5ALEA 2FMIA 3I53A 5U1PA 2B1GA 1GT91 2V58A 2D1QA 1WEKA 1Y4DE 2R7AA 2VF4X 5EOVA 1SUCA 3KT3A 1N6LA 5IVKA 1OE0A 1DAOA 1TUBA 2VA9A 3H9BA 3VKFA 4E09A 5CFLA 1LBIA 4HMOA 2ZP1A 1BO6A 4HNSA 5BW4A 1UDRA 4LV5B 4W5RA 1NVTA 1UJNA 221PA 3EGOA 2C77A 5DXAA 1OASA 4YLYA 2PYIA 2J1LA 1EFRD 2J9YB 3WMXA 1CVLA 1VCOA 3MWEA 4F5EA 3N59A 4KQIA 5I9NA 2W0MA 1B74A 1Y4UA 2AFVA 1QO9A 1K6IA 2IX9A 3FW1A 4H15A 4O4HB 1ESZA 1BN6A 4JLVA 4RNCA 2GEKA 1NG1A 1AO3A 2V4ZA 2JFXA 3TE6A 3PQDA 4DJEC 1AK2A 1GXSA 3JWPA 3LT2A 2OYCA 1P7PA 1UM9A 1ARZA 3PDJA 2EIXA 1M1YA 1XNRB 2VRWA 3UMJA 5FFMA 5JDIA 5JD6A 1DDIA 4E5NA 2XQVA 4PBTA 5JLAA 4EBBA 1SXJC 5ICSA 2YJGA 4WI1A 3EPPA 1IE3A 3BJZA 1F8GA 5SZKB 2NOAA 1H1TA 3AHJA 3IELA 1SELA 2MYPA 3PZBA 2QUHA 3GA5A 4PYLA 4Y2JA 1LRLA 1N2JA 3F97A 1DTWA 4FDMA 3MLEA 4PIMA 3ORFA 4GKAA 3D6TB 5LR6A 3NVKI 3TSYA 3GLUA 2EW1A 4HVLA 2UYGA 1WSBA 1HY3A 3LU1A 4HB2A 3PFCA 4BQIA 1V96A 4AD8A 2D59A 1I7QB 5MF6A 2CBXA 4LTNA 3RSCA 4NH4A 3SN6A 5LZ9A 1X74A 1BKYA 2HA3A 3UICA 1UMBB 4NSNA 2A7XA 4R16A 5JO9A 5IC6A 5JANA 3VO9A 1OFGA 1Z83A 4NFHA 3AKZA 4NVRA 3HDVA 4YP6A 1CR2A 4PWYA 2P3SA 2BMEA 5CT4A 3TOVA 3B1YA 4EGAA 4IQ0A 4ZCQA 4UM9B 2D5IA 3QFRA 5IJ9B 1URPA 3ZTWA 4CMHA 4PS1A 2JIBA 3C41J 3BTVA 1W4LA 3G9XA 1VIVA 2OAEA 3CU5A 1Q21A 3IT2A 2D4HA 3OUUA 2XYPA 1DPGA 4FFBB 5IBRA 1ZR2A 2NG1A 2MR6A 3IC5A 4NKRA 1HFJA 2H8KA 1C8BA 3PCTA 1E0JA 3R7AA 3W77A 2WYOA 3DW3X 3FUWA 4KBGA 5ITWA 5CK4A 1NBAA 1ZD2P 5DASA 4E21A 5HKKA 3CF2A 2RGBA 1CJKC 4ZVLA 4Q7LA 4HDKB 1JVSA 2ECFA 2E5LB 4JLNA 2Q6IA 3A2MA 2J8ZA 3Q2IA 4D4HA 4PHTA 2FETA 3L8FA 2V3CC 2C83A 3FHJA 3FKSD 3MELA 3RFXA 5KSZA 1CWUA 5KTOA 4UFOA 3ZHCA 4MUKA 2G4CA 2BFDA 1L5HB 1KQGA 2RHDA 3R3UA 1O57A 4I50B 1X1SA 1INLA 2IS2A 3ITKA 5GOTA 1NMZA 1LRKA 3ADOA 4NCHA 4RPJA 4UNRA 1FNMA 1BWRA 1FTYA 2XVYA 3C14C 2OZLB 4EECA 2QP4A 4G89A 1A3CA 4XGNA 3TQQA 1KGDA 1F7UA 2VDQB 3MS7A 2NTYC 4GR5A 2H1IA 3NAGA 5IYZF 2CUKA 1UMCA 3ND9A 3BGVA 4K6KA 4E33A 5THKA 4OL9A 1XZNA 2QTTA 1U0JA 2GAAA 3N1UA 1PR5A 2WAAA 4GXTA 3V1NA 1EUQA 3F2IA 4RYLA 1R8QA 2Q4BA 4ZXPA 1CT9A 3Q8XB 1KARA 2QB5A 3L4SO 1C1YA 3KTAA 5K2MA 4AF8A 4E13A 1CKEA 5DWDA 2QZPA 3O9MA 5C8YF 5LN1A 2EKBA 3E61A 3OJ0A 3UHOA 1OH6A 4D9NA 1ZJJA 1EA7A 2BT4A 3EZ7A 3WK7A 5HJ7A 3S81A 1ODKA 1VE3A 1NTRA 4GZMA 4Q37A 1ODSA 1I5EA 2DPLA 2IEBA 3DTYA 4IGEA 2ZRFA 3WQRA 1Z74A 4B46A 1K9SA 4KO2S 1I3KA 3HDYA 4KODA 4JXZA 3WNBA 2X0NA 2P6NA 4FSXA 2I1LA 1QYRA 1DGQA 1MPTA 3PGMA 4F86A 1XVAA 2NXJA 2HU7A 3DO8A 1U0SY 1UF9A 4LHEA 4QPJC 4XVRA 3SFTA 2NUPA 3SXUA 4K0KB 1DCTA 1CK4A 3TZHA 2XCTB 3M5CA 1FS5A 4JT8A 1ZJ4A 4FNAA 3D31A 5FBVB 4M6WA 5HVNA 1RKQA 3LNCA 2PL1A 5MGBA 1Y4AE 3DWFA 1PWXA 4J2OA 2PUEA 4V38A 2R8XA 1QCDA 2F48A 3PUJA 2P9YA 4LNUB 4MZDA 5K01A 1RC8A 1K5GA 1EVIA 3WSTA 4IMRA 2V4UA 2CEAA 4EY6A 4DB4A 1IOWA 1A76A 3OIFA 5AKJA 4RZQA 3SQDA 4O08A 4BVAA 4PSKA 4BZWA 3OE1A 3AUTA 5GMOA 3O84A 1NWCA 4ALKA 1QTRA 3EIWA 2AOVA 3CINA 3FI9A 5BN4B 3FCUB 1PLKA 1Q6YA 2O23A 3KEMA 2O8FA 2ZSJA 4LK3A 4QLAA 4ND8B 2QRQA 2WKWA 5LDDC 3LHDA 4TWRA 4R1MA 1E1RD 4IKPA 4MP6A 1USVA 3PPWA 4OHFA 3ZIDA 4A6EA 4ZGBA 1N0UA 3KR0A 2P2SA 1B7GO 2EWWA 1GPUA 5DTIA 1OSNA 3E58A 3EK2A 1EGAA 2Q2NA 3I1FA 3LC7O 4MI3A 4URYR 4DBVO 2OP0A 3MOSA 3VNUA 1XG5A 1PGOA 1Y6JA 1SC9A 2FF7A 1EFPB 2PXHA 2BELA 1VSBA 2OVBA 3CUEF 4QO8A 4RQTA 5AVKA 2BE7A 1YWGO 2RH4A 3B3QA 4HVTA 4O8ZA 3UJBA 2FH5B 2YVKA 3CEPB 2J9XB 1J2UA 1KI6A 2GAJA 3R1IA 4FOLA 4RAOA 4JI3B 3WAKA 3WGIA 1ADGA 2QQFA 3U3JA 4B7CA 1W2GA 3BSFA 1ADBA 4OYHA 3DD1A 4F9GA 2ZJ8A 5F7OA 4YC7A 1UWLA 2ZFUA 1PSDA 3U0BA 4YXFA 3LHFA 1RXVA 2ZWMA 3GGDA 1GLVA 4JQCA 5AVUA 1EJ0A 5IDYA 5DYIA 1JX6A 2R25B 13PKA 1P9RA 4IQ8A 4LVUA 5A9SB 3RNLA 1R6UA 1EP9A 4L27A 2HPZA 2PZMA 3VU1A 3VVLA 3NASA 4GLJA 2FPGB 3QEJA 2KE5A 2CDBA 1EZ1A 2KHZA 2NQTA 2VKTA 4Y6QA 4BJ5A 3K30A 4MYSA 2FSIA 2XYHA 4LKRA 2FOIA 3PEVA 5LL6P 1Z3CA 4U7TB 4RKWA 3ZNOA 3C5WP 4E46A 5IT9A 2R1TB 1E2QA 1PBNA 1Y5LA 3HN7A 3HEBA 1HL7A 2O2ZA 4Y6GB 2C98A 3VNVA 5ES4B 1X14A 3GUHA 4YAJA 1QZUA 2I7CA 3ABSB 2Z98A 1VE9A 2CLDX 4BNNA 5AUNB 4B85A 2R7MA 2JVJA 4NONA 4UHDA 1OXSC 1R16A 3F4KA 3UNXA 4B7XA 1XTUA 3HKCA 1WABA 3HY4A 3EYWA 3NWEA 4RH1A 5A1TA 2FFRA 2UKDA 2ZSUA 1TA4A 2IYUA 2QL7A 3N8DA 1SXJB 2OGUA 2XMZA 3GXOA 3ZU5A 5JFOA 3K5HA 2VF8A 4KXWA 1YHNA 2O50A 4P31A 2G1JA 4IY1A 3LUBA 3OZUA 1E3TA 4RENA 3T7AA 4HN2A 2BFEB 4AMBA 4BO8A 1Z7BA 3GEIA 4RJ2A 1EQAA 1L7OA 2ON6A 5A3SA 1NW7A 1BE1A 1QKKA 3GNSA 4LSWA 5HZMA 4RV5A 4CL8A 1JDJA 2WFAA 2FKAA 3ROKA 4N18A 1G6KA 4C3OB 1JU9A 1U0OC 3UJAA 4V2UA 4U9HS 5K8VA 3EGEA 4U63A 1NLMA 4N48A 2O8CB 4H7JA 4RLFA 4HN4B 4FBLA 4TYQA 2NYAA 3C6KA 3UHAA 4HQOA 3PVZA 3F46A 3SXPA 5B1YA 1ZX1A 3RGGA 2H7YA 1SOAA 2ZR7A 3KAPA 4L5AA 2PT9A 1L5YA 3DEFA 3BCRA 2WBLC 4WAUA 4TN5A 1YB5A 4CLRA 5K9ZA 3A32A 4G1VA 4GOJA 3JVIA 5HOQA 3H4IA 2QU7A 4ZVOA 1Y3AA 3H0KA 5TVGA 5HF5A 3WGJA 3PICA 1E5XA 3W4KA 4KIFA 5DIFA 6NULA 1W5EA 1ZOIA 4XIGS 2HB6A 4WXRA 3QVGB 2XNSA 4B8ZA 1PNQA 2PMWB 2AW3A 3MCZA 3N05A 3IR6A 2ISQA 4FCCA 4OQXA 5AIAA 4C6SA 3GG2A 3O8DA 4BRSA 2CJPA 4JKOA 2F1HA 1NLZA 2E4VA 3UMYA 1GV1A 3QOFA 3IUBA 4U2KA 3QFTA 3FN4A 4IGAA 3IKLA 3C5EA 4L4RA 2FW6A 2WVAA 3EODA 5J2UF 4ZN6A 4U1RA 4Q4LA 1QMGA 3Q3VA 4WBXC 4XDYA 4LF9B 1EGHA 4IO1A 5KQRA 4MPJA 3GLTA 1S3GA 1BCSB 2MINB 5LA6B 4EY8A 1XD2B 5HZKA 3BB1A 1Y4ZA 4GM1A 1DXHA 3VRHA 4BRZA 2GX6A 1G4HA 3BE8A 2YV3A 4UKDA 3U4HA 2A5FA 5U4QA 2OAQ1 1MA3A 2ZJZA 1FRVA 3NH6A 4D2IA 4U0JA 4AO8A 1O87A 1P7YA 4YUWA 1NMEA 2Q5IA 4ZCPA 5EQTA 4CMJA 4D8VA 1N9GA 2ZT7A 3K0HA 4AY6A 1SUFA 2CK3D 4PZDA 4Y9TA 4QVKA 2MSLA 1NQAO 4RVUA 4OI0A 3EH2A 3FZYA 3VR3D 4DV0B 1U5BA 2PJRA 1FP7A 1R74A 1YUMA 3L40A 4TXMA 4QLOA 3OTWA 5JDIC 1WLYA 4MI6A 1A9TA 4MS4A 3WLFA 3JQRA 3PQ5A 4GSLA 4N7JA 5BNTA 2FDXA 3ZJUA 1B2RA 1LK5A 2I2XB 5IEBA 4WGFA 3EVGA 4LVCA 5JMOA 1W25A 4PRLA 1SKBA 4ER5A 2F3UA 2FRDA 4CVNA 1P7VA 3BF7A 3ZNQA 2PJUA 3FOAA 4LC9A 3U9TA 4NABA 3EQZA 2Z8XA 1T2AA 3EDYA 4C0AC 3Q85A 1KAGA 3E27A 4HAIA 3H5AA 4LMAA 5H80A 5C31A 3SIXA 4J1TC 1AS2A 3V6LA 1CCWA 4B71A 1Q1ZA 3MGBA 5CYGA 3V2GA 3ER8A 2WY2D 1N6OA 2Q2VA 1JG1A 1NQUA 1SU8A 1XTSA 2IYYA 3R3HA 4KXYA 4OFBA 1MABB 1YR7A 4PR3A 3VOAA 4C4SA 5KVVA 3FHLA 1IBLB 5CBPA 4N3AA 1C9DB 1S1CA 1D09A 4R7GA 1P2UA 1LLFA 1FW6A 2QW0X 5T8KA 5AVZA 5CYPA 4L85A 3UWSA 2WU3A 5JUWA 4I55B 1UBSB 3BA6A 1EFVB 1OBVA 2P3OA 1YVEI 4MINA 4F93B 2RGNC 5CG1A 1K63A 4MWDA 4B47A 4R8MA 3U4MA 2I2FA 2REOA 2W58A 3EFHA 4GW3A 4MYTA 4WT7A 2XKJE 3KL4A 4QKQA 1FMLA 2C94A 1RMYA 4M9QA 3TBFA 2ZRNA 3OIGA 2EIHA 1JJFA 1GYQA 2PBRA 1MRNA 1JDUA 2X0JA 3AINA 1Q1NA 3OQHA 3REOA 1QE3A 1X1AA 4V1CB 3RT7A 5JAIA 5D3KA 1Y7LA 3VR4H 4YRNA 1W8IA 3HACA 4NEQA 3LPAA 5E1BA 1KYZA 2WJ6A 3BMQB 1Q14A 1EA5A 3RAPR 1FOEB 1NV9A 1QP7A 3GK3A 2J08A 3TIXB 3OPMA 3LPDA 2V7WA 4O4IB 1ZG3A 2RAFA 3JVVA 2PU7A 3WBJA 2ILVA 3ZWKA 3G68A 3D8BA 3UF0A 2AHRA 5JY1A 1GTRA 2V5AA 3C1OA 1RYBA 4HVCA 1LS6A 2P2YA 2P9EA 4HGNA 4DCPA 1GRVA 2Z1MA 5KYTA 5EHNA 3MTDA 4QSMA 3MF4A 1I7PA 4BO2A 1ELOA 3TSZA 4ZYUA 3EF1A 4KR7A 1QGDA 3VR2A 1DKQA 4DJ5X 2ODEA 4KLZA 1WMAA 1RPTA 3OU6A 4FFSA 1BN7A 4MRMA 5D5PA 1IZZA 3WP1B 2L2QA 1WTAA 3AILA 3SIPA 5CB4F 2IS6A 4MUIA 1ZJ5A 4FYPA 2BFCB 2H2FA 3FDFA 3OWOA 3OSZA 4ZZ3A 1JEYB 4FMBB 1HSZA 4YH1A 5K5EA 4R5HA 1C8VB 1PFGA 3BMCA 2Z2KA 4EJ2A 4IQ4A 3ANLA 2YZGA 1YL6A 2DFKB 3HO1A 2FFQA 3K16A 1XP5A 3QVLA 2OXFA 4RHCA 3KQVA 4WA7A 5BXYA 4MGIR 1CVIA 2N9UA 2WJWA 5ED0A 4KIWA 4I4TF 3I62A 4G5FA 1PHPA 4UZFA 4EYSA 2PRKA 4ND6A 3ZV6A 5JZBA 5H5JA 3HBLA 5CGQB 3THSA 3PNLA 1NF8A 1ZCAA 4P54A 4ZCMA 4I1IA 1X0VA 4URZR 1R0SA 3MUFA 5LMCA 2CXSA 4QPZA 4PYOA 4I2VA 4RELA 1YRBA 3ZGLA 2VS1A 4BEWA 1SXPA 1ULZA 2J6IA 4LJYA 2Q41A 2QMQA 3CO5A 1VSVA 2HH9A 2BE9A 1DKOA 3GUCA 3MYYA 3LUHA 1OH8A 2RB4A 1UODA 1II9A 1PWHA 1NX6A 1FSGA 3AXTA 1GA6A 4KR9A 4E08A 2XTAA 2G7MC 1PG2A 3OZWA 4ON9A 2ZTMA 1QFMA 4YDQA 3RSLA 1PLLA 3HADA 4TWIA 4JJ4A 3EW7A 5EKTA 2X5NA 5FLYA 1VZ2A 3H6KA 5ULLA 3TG8A 5DNDA 4F04A 3M34A 4KXXA 1KBOA 1OUMA 3E35A 3I8OA 2G04A 1XAJA 2VBGA 2QMYA 3OFKA 5ENVA 3RBZA 3GFTA 4B0PA 3AVXA 2W2KB 4H6VA 4J0JA 2O54A 3TRHA 1SZCA 2J46A 4C29A 3GLFA 2ZBQA 3L1KA 4KQ6A 3ZLTA 2IRWA 5IMBA 1W0JD 3GMDA 2D8MA 2V0CA 1W85A 4I0WB 4JUDX 1E4VA 4BFUA 2BP7B 3HEMA 2IOQA 3PL5A 4J4TA 2JIPA 4JGIA 4TUYA 4WFIA 5BORA 2I3AA 3L01A 2FUCA 3AJRA 5DBEX 3JWEA 1KK2A 3A2NA 5DHAA 3TMKA 5EIBD 5DOZA 1LSSA 5M5BA 1XV5A 1W94A 3BQNB 4RY9A 3N0WA 2P3QA 5FLXA 3UHPA 1WZIA 1YRAA 2G06A 2PD3A 2ZAIA 4C6HA 2K4MA 4GPAA 4PXAA 1VKHA 4U2EA 3IVCA 5EESA 1TUBB 3RTEA 1UIRA 5KNDH 3H97A 4C88A 2RMKA 1DTEA 4E32A 2HWKA 4NE9A 4KQWA 3W3AH 3ZD7A 1YULA 1Q77A 4P9NA 4YPOA 1C30A 3CWQA 5LC1A 4IRUB 1F17A 3EPHA 4UVIA 3MWEB 5T4EA 2ZTHA 1FJGB 4JLJA 2RHRA 3RSFA 4C14A 1ZIOA 1NSYA 4K9LA 4AX4A 1JDBB 2HO5A 4B4DA 4PO8A 2GN0A 4D79A 1G5TA 3KLMX 5HDBB 3BG5A 5JWOA 1SR8A 1P44A 3V4ZA 1C1HA 1GXSB 4BASA 2P6OA 2X2EA 3W6NA 3UW1A 1G5FA 1M1UA 4M0PA 1UM9B 2QN9A 3IP1A 5JS8A 3VA7A 5ICEA 1EQ2A 2WTEA 1M1YB 2NLOA 2HXGA 2Y0EA 1EQUA 2Q5LA 2X5JO 2YFHA 4UXHA 4RZHA 3DMYA 1OT3A 5D2CA 4GECA 4LMBA 2FLVA 1YFJA 1ONBA 3TTVA 3A04A 5DTQA 2Z6UA 2PZKA 2C00A 4QATA 1QYDA 5C4MA 2WABA 1KAOA 3R2JA 1PJ2A 1DTWB 2ZETA 4JGBA 4JL6A 3PS9A 2ET6A 4HFRA 3WQQA 1TCUA 3O5AA 1QHEA 4ZHQF 1HE5A 2CBZA 3EAQA 1L4BA 3EIUA 3NOVA 2F4VB 4RVCA 2HSDA 3QVXA 4LJ7A 3CB2A 2QUAA 5DEOA 1GCAA 1LTKA 4BYGA 3MGAA 3R0ZA 1D6JA 1JQKA 1XSEA 2GFHA 2VWHA 3WKEA 1U8YA 3FYSA 4N5DA 1U7XA 2XAUA 5BWLA 3ON5A 3L18A 4FXPA 2VNKA 4TLAA 4Z4FA 2UVQA 3YASA 1U5AA 3OF2A 2HCJB 1DXYA 3VZPA 4CKWB 1P73A 1K5PA 2D0IA 4IMJB 2XMDA 4EITA 5KYGA 3IP3A 3OU7A 1K3UB 1BAPA 4GBED 1HNWB 4BATA 2GN4A 2WKRA 3WFZA 4DNFA 3M9XA 1OB5A 1QRUA 4FYXA 5F35A 1TQHA 2PMDA 4EZIA 3T95A 5AH0A 2YFQA 3C3WA 5FV7A 3HHEA 2OENG 3W6PA 1G17A 3SQWA 5EE1A 1E7WA 2C2YA 3WWOA 2GXAA 5TIIA 2DHEA 1TQ4A 1VSQA 3TGWA 1FP6A 3HBAA 1KJIA 4Q3BA 5LLSA 3QW4B 2FCAA 3ZWPA 4JLOA 1MA0A 3TPZA 4H1WA 2W00A 3RFTA 2IDMA 4R83A 2BFDB 1PGPA 3I9V6 2EBUA 4KJXA 4BU1A 4DIMA 3SC2A 1F6BA 2HOQA 2N0SA 4IIXA 4QU8A 3QFFA 5ARDA 4A10A 1LBSA 2GSDA 4KVGA 3AUUA 4ABYA 3R6GA 1B26A 4A15A 1ULTA 1WZUA 4Q21A 4DLKA 3OFJA 1I24A 1T4BA 2A0KA 4IUYA 1CRPA 1UMCB 3RQSA 2Q9BA 2W6JA 1PS0A 3NHYA 4Y2YA 3WNDA 1KVUA 1W96A 2ORVA 1JVBA 3NUQA 2YQZA 1XDBA 3I9V1 5DP2A 4YONB 1UEXC 1X2EA 2V9PA 2W37A 2YWJA 5T4BA 1KDVA 4D96A 1YQQA 1MG0A 1YZYA 4E1AA 4AN1A 5C5EA 3SKVA 2E2WA 5CYOA 3L3BA 3BFJA 2BFPA 3KTAB 3FB4A 1XHEA 2FX2A 2Q6OA 4HX9A 4PSCA 2GFQA 1PKEA 3BHNA 2JVKA 4GKBA 3DLPX 4A6PA 2F8SA 1AKRA 3ZK9A 4FTWA 3V8NA 1DLIA 3OA2A 3BCUA 3FTEA 1FTGA 3SJBA 3T7EA 2FRDC 1WZ2A 1BCRA 1NZDA 2IZ5A 5CNJA 3T9FA 4BUZA 2VI5A 3DO6A 4J1SA 3B1JA 1KJQA 2ZS9A 4X7BA 3IBSA 5BQ5A 4Z2YA 2Q3EA 4J7UA 4HEA6 1MJGM 1NP6A 1RAIA 2AMLA 2NZJA 4WQMA 1NBME 3EB9A 1T15A 3SXUB 3ZWVA 2G1KA 2NUPB 4CGYA 2XNHA 1MR3F 1X7YA 4E94A 1PJCA 1TYDE 2EJBA 2ZS8A 2AFRA 2WU1A 2OZKA 3DHVA 4ENVA 1RABA 4M6WB 5BV1A 1UT8A 2PZJA 4MH0R 4X8OA 4DDUA 1S8FA 3L7KA 4J4BA 3VAYA 1I3MA 1POWA 1YI0A 5C34B 2B8JA 3NOOA 1NVAA 1ZIYA 2QQ0A 4HEA1 4WN3A 1GPKA 2VTKA 4J1NA 3VH3A 4Q9LA 1A9PA 3GLHE 4C0LA 3GRFA 1AUXA 3DBLA 2W2NA 3AQIA 4HADA 3ZHRA 4I1YA 4E7OA 3TUZC 5BVGA 5EIXA 2O8FB 1VI2A 1NSFA 5B7NA 4DMMA 4N0DA 2C96A 2REBA 2XUJA 2YC2C 1G18A 1GG2A 2H2HA 1EK6A 2CF5A 2XB6A 1Z35A 3OBIA 3H13A 4HAVA 3F1KA 4HZGA 4INPA 2RCNA 2WRZA 3ZDDA 4MW1A 4QWMA 1ORVA 4MWCA 4CTKA 3HG7A 1KI6B 2RK4A 2IYAA 3EXFA 2VJDA 4ZT7A 1TU4A 1CB7A 4O2AF 1NY6A 3UOAB 2X23A 2QVYX 5GVRA 1WU8A 3KETA 2G5PA 1T3TA 1TF5A 4CI9A 4YUVA 3O47A 4M7WA 3V42A 5B57C 2VZLA 2BHRA 1SCBA 1CXZA 4JP1A 1P0QA 1Z68A 1T43A 3O93A 1XCGB 1V35A 4YFVA 4A0GA 5IAGA 5GZ1A 4BFXA 3BHJA 1U7TA 4YQYA 1P33A 1WDTA 1CY7A 1JSLA 2AJDA 4D42A 2G0TA 3TR5A 3WRXC 2IH5A 1X1QA 1BWSA 1OHHD 3DFKA 5E7MA 5C0OE 4A1FA 3V48A 3M6WA 3N7TA 2WT8A 4GKJB 1TJ4A 3EVFA 3AUJB 1PT7A 1QH0A 1K92A 1W52X 3E9EA 3FSGA 4HOYA 5E3JA 4CRWB 4OXQA 2QN1A 5HDQA 3EMDA 3WRWA 4BQSA 2R86A 2PSSA 2C20A 1JDSA 5F9HA 1U2GA 4WOKA 4ZO4A 4H60A 3BXHA 3HKCB 1RWKA 4B17A 1FFSA 5FTKA 2PGIA 2WUWE 4BP8A 3H2SA 1J00A 1O94A 4Q39A 4B3FX 3LPLA 1ORRA 5EP2A 2X4LA 1FBNA 1RI1A 3GPBA 1H2YA 1R8YA 3UGJA 1P4HA 3AU9A 1DX6A 5E7JA 3SJZA 3DR3A 3E6AA 2CDNA 2EARA 4O5OA 5DNWA 3V2IA 3BILA 3U7IA 4Z8YA 4AWXA 9LDBA 1JQBA 5KQMA 1FS4A 4ZHQA 2C4HA 4JD5A 2ASEA 1FYDA 4WN9A 3QZUA 4I19A 4LY6A 2GPAA 4MRSA 4REQA 5J5AA 2IXBA 1FC0A 4B73A 2AFHA 1JIXA 4GLOA 1Z2DA 1FU4A 1UDXA 4IJWA 3VR5H 3ET4A 3IPCA 4BAZA 3SX4A 4YDRA 1ZM9A 1Z5UA 2AJCA 3I5UA 4JODA 4YLEA 3T5CA 4CLRB 4ZVMA 3I4LA 1KP9A 2BUBA 4HB3A 1X87A 4LDPA 1AHIA 4I2NA 4U6NA 1XVLA 1F4VA 3ITDA 4YUAA 2XY4A 1OXXK 3SBXA 5L4NA 3K70C 2VRCA 3PUZA 2XEXA 3HA5A 1XDZA 5ALQA 4AMYA 5LWHA 1XBTA 3MJEA 3ES9A 2BFBA 4J76A 3U3RA 3HDGA 2XCRB 1ZK4A 3TRJA 3GBPA 3EBOA 1WMDA 3JXEA 3LDUA 4FN4A 4JMPA 4AQYB 3VC3A 3HU5A 4LF6B 4N41A 3NATA 2I33A 3ZWNA 2EKQA 2FSVA 4HG2A 3IV9A 3I9LA 4PZUA 1NXPA 1B41A 2JBHA 4G0PA 2FZVA 4DMUB 1Z6GA 4JDPA 5DE3A 3OKAA 2JJYA 5CEEA 1A77A 4HGYA 1QCYA 3ICCA 2NAPA 2PLRA 4YAFA 4KQKA 4NZPA 3ED1A 1JHRA 5AVJA 3ILVA 2QVLA 3HJFA 1JA9A 5IJXA 4J1QA 4E11A 2C03A 3HFJA 1JW9B 1ZXXA 3JWHA 4G9GA 3DHNA 5B7PA 2W8ZA 4IXMA 2E4ZA 3DNMA 3F3MA 4DFDA 1RYMA 1A2KC 1HT3A 5IZCA 4QFMA 5EZ6B 1R27A 1VLLA 1N9GB 5JAMA 4BUJA 5CNKA 3WGQA 1J20A 1CF4A 5IAJA 4FFWA 4Z0TA 1U5BB 1GGEA 1MNQA 2ZVQX 3CPHA 3GPCA 5BW8A 1HDRA 3LL4A 5I4IA 2Y67A 1ZA1A 2FQWA 1A2OA 3GU3A 3NNDA 4MS4B 3LWBA 5C8YB 2GZMA 4B45A 1ZS9A 1KZ4A 1DEKA 2JHAA 4D98A 2WG2A 3NETA 4UXIA 3U7FB 4E4TA 1BFUA 3K5PA 1XALA 3A3PA 5BT9A 2PBZA 3TSWA 1H2RS 1DKPA 2LBPA 1DBRA 3QMWA 2IOYA 2ZJFA 3RC1A 3L7JA 2CY0A 4BQFA 1V5GA 1U28A 3UH1A 2CXUA 4MITA 2PUJA 3UB3A 1E2KA 1MAWA 4BP9A 3O8CA 1XDDA 3FOEC 2QD5A 1SVSA 2HV9A 2QIPA 3KV1A 4HXEB 3O2QB 4O63O 3QU2A 1UBOS 3GBSA 3SSAA 3TVTA 4EW6A 1XU7A 4ONEA 2HF8A 5COAA 2QRZA 2AOTA 5CBPB 1KVRA 4ND4A 4QRHA 3T5MA 5BUZA 5IC4A 5KO2A 2GSWA 3CGWA 3OCVA 1Z0KA 3Q7PA 1D9ZA 4DDWA 2WIJA 1J8FA 1LSJA 2QRNA 2I3BA 5EKDA 2I6FA 1RFLA 3WFIA 1JHDA 3KVYA 1E2EA 1XCJA 4HDQB 4F9EA 1ZM2A 1BVUA 5E6SA 4LXYA 4CMGA 3B3FA 1TLLA 1CQIA 3KV3O 2CXQA 2IP4A 3TZBA 3U81A 5KVCA 2WIFA 3IOYA 1N5LA 1GUZA 3AEYA 3CLUC 3TZ6A 3EF3A 3SSOA 4TROA 5ELLA 3Q8WA 3BMOA 4W8HA 9LDTA 3PX3A 2Q3CA 1VG9B 3UQZA 5I3ZA 5F4BA 3UEOA 4FFLA 2BCGY 4PAGA 5KCZA 3LBIA 2G40A 4YV0A 4UMVA 2E55A 2FDRA 2J6HA 5IBQA 5HUQA 4NARA 2G17A 2DT8A 1ZNWA 3PC8A 4X90A 4DG5A 1IQ0A 3KQLA 4LYHA 2E4UA 3O3NB 4L50A 4OTZA 2JLBA 3ND8A 4PX2A 5C46F 1E64A 5DCLA 1C9JA 4HDNA 3RUIA 4QREA 3K8ZA 3H9EO 4B3HA 2AMFA 3W2EA 1Z37A 4R2JA 2WD7A 4I1OA 4RANA 4CETA 4NYJR 2IHNA 1K6EA 1E3EA 3L8EA 1FUUA 3Q1KA 4MRMB 4OLJA 5EJ7A 3CNBA 4CKBA 1Y7IA 1G6Q1 1GPMA 3L79A 1N1MA 2V6MA 3EXHC 4V0NA 5BSRA 3QPDA 3KQTA 3I4FA 4V3BA 5T67A 1QP8A 4HQRA 5TQ2A 3SNKA 4QGSA 4DCVA 4IV5A 1IWBB 4S24A 3BMCB 5ALSA 1ULHA 3KC2A 4UNPA 6Q21A 3BEDA 2FUEA 3RK4A 5DLDA 3LC2O 1VDMA 1GPBA 3WYBA 2P77A 2VQ3A 1T25A 1X77A 2REQA 4GRDA 4IDNA 1K9VF 4YRRA 3DL0A 4YREA 3NANA 2QY9A 3S5JA 1ANKA 4NAHA 4X62B 3DXYA 1J23A 2HRQA 5A5DA 3DQPA 3KQKA 1P2VA 2CDAA 2KM1A 3WLTA 4UHBA 4WUVA 4Z2AA 4XEUA 1HUQA 1OPRA 1GU0A 1CG6A 2PXAA 1Z6YA 2SICE 2WF8A 3M6XA 4LJ4A 1XROA 4RESA 5KU1A 3VHLB 1HG1A 3ZJVA 3LCRA 4RMHA 4Y2RA 4E5PA 2E6KA 3PDUA 5CFPA 1ZHFA 4CV3A 1LQTA 4HDAA 3VTFA 4DR6B 1V25A 4IWXA 4R2LA 4D8YA 1K6XA 1AUOA 1G8AA 3QUCA 4ZOAA 5L4LA 5EIAA 2JAPA 3ZR4B 1O4WA 3FPAA 1E5TA 4HJXA 4MIOA 4O29A 1RP7A 3IHKA 1CUJA 4Y9DA 3RYTC 1LJUA 4PGFA 5JASA 2O3QA 1SIBE 4FGSA 4RH0A 5LQSA 3CKKA 1QDEA 2O4CA 1EPUA 1Q12A 3MFQA 4M8NE 3SSNA 1JXQA 2X42A 1VL8A 4J94A 2Q28A 2CNLA 3PTLA 5AHWA 2PMEA 1AK9A 1CJVC 2GMWA 4JNCA 3RVQA 3UJCA 1YIOA 2Q45A 3D2CA 3WGOA 2OGWA 4DA0A 1W7AA 4LW8A 4TRJA 1Q0SA 3D4IA 3IJEB 5HG0A 4O0LA 2OYRA 3ZK8A 4K0RA 5JATA 4EEKA 1RJ9A 2GJ9A 2W8BA 4YWJA 5DK4A 2HREA 4KFSA 1VHJA 4LBYA 1KC1A 1WP4A 3GLFB 1NIJA 2VTVA 1FDWA 4LZJA 3LUGA 5FQOA 2CHUA 1W85B 1WMBA 2CMFA 2E1PA 3K70B 2VTEA 3GOQA 2YOGA 5E7QA 5COQA 2H17A 1YS9A 3JAKA 4TUYB 2ODPA 3MJDA 1P77A 2FSGA 4D9EA 1QYCA 1X8XA 3GAFA 4OFZA 4CMEA 5CDYA 5EZYF 3AQ4A 2JHGA 1AXGA 1YR3A 1YR8A 1NJ2A 3MJCA 2DKFA 3ZEIA 4YMLA 1KI8A 1V39A 4B5LA 3OLZA 4F2PA 1T9KA 1DT3A 2W11A 2ORYA 3L82B 5F5NA 5IUKC 1WHTA 5DB4A 3ROMA 3UJ8A 4KWHA 4BBAA 2H85A 4DA6A 1X39A 3KXIA 2Q5JA 5KUTA 5J5CA 5FI3A 4UBIA 1QGED 1IUKA 3HH8A 3R6DA 4FLEA 4MWTA 3ZVRA 1C29B 4F85A 2XT6A 1DNPA 1C30B 4PFSA 3KE8A 4MR9A 5JPCA 3UCEA 3DFMA 3GZ4A 4PLTA 1WPQA 4XM1A 5GP1A 4KO3S 1ADJA 3PTAA 5I7WA 1E5QA 5EINA 1EVJA 4DREA 4GSYA 1QE0A 4DYHA 1JZTA 1QJCA 1ZM3A 2C4KA 2ZUVA 4PF1A 1U11A 1TZ2A 4QXAA 4F2HA 5F5LA 4HNTA 4JEMA 1CEXA 1VG0B 2HSJA 4L9SA 1UBCA 1KQOA 3E03A 1ULAA 4PGAA 4YR7A 1DJMA 1ND5A 1TYCA 1UH5A 2XMQA 1I2ZA 3TXXA 3KOZA 1PTKA 2RARA 3OM8A 1Q95A 1THZA 1PJRA 2JEYA 4JI8B 1L7MA 1Z2AA 4GC5A 1O94C 4QYIA 5KREA 1P80A 2CFSA 2F2TA 3FY4A 1K3TA 5DM2A 3R09A 2R8YA 2VVTA 4G8CA 4HXGA 3AFIA 1TRHA 3U09A 5A3VA 1CQPA 3I61A 3FDZA 4K9SA 3SF8A 2ZJ3A 2C9CA 3QVOA 2BIFA 3MB8A 4BZZA 2VXBA 1HYBA 1NVMB 2C04A 3SIWA 3SJAA 1GEGA 1XQ1A 4MA0A 4TKLA 1EFLA 1GPLA 3PYLA 2O1WA 1LGYA 2JH8A 4MIEA 3URKA 3WDLA 1WUHS 3EHDA 4HLQB 4I1RA 2ERCA 1UANA 1IOLA 1RHJA 1ZC4A 4P3XA 5I7SA 1KRXA 2PGLA 5MN6A 2GHRA 5C80A 1J8VA 4MHOA 5DK6A 3TI7A 3WHKA 2DOKA 1Y1RA 4C4YA 1FXSA 3PGXA 1NZFA 1R50A 2X77A 1ZOPA 2A59A 3DDUA 4KX3A 5GGYA 5KVQA 1MX3A 1G0OA 3NGMA 4Q9JA 2Y1FA 3GF4A 1UAGA 3SMQA 3IOEA 4TKVA 2I4TA 4XGIA 2DX7A 4ZODA 5MN5A 2GEJA 1A8PA 5GV7A 4O25A 4M8LA 1TD1A 2XQJA 1JG6A 4LOKA 4IH9A 5GZ3A 1N2CA 3LCVB 3T34A 3O1IC 2ZDHA 3EMVA 4GI5A 1VTKA 2J5BA 1OA0A 2A3RA 2HLDD 3B60A 3LPCA 4FFDA 1CUVA 4RA9A 5CJJA 5THXA 1JQLB 5K3CA 3TNYA 4X3PA 4P7FA 3UMSA 4GX2A 4CZ2A 1C2TA 3EEOA 4LWOA 2F1RA 3JR7A 4IP0A 5EJ4A 1Y82A 1ZSYA 2COUA 1JEDA 3SC2B 2QX4A 2QX9A 4IFIA 1PZXA 3WWYA 2OMEA 1DO0A 3DOUA 3L7BA 1QKJA 3QVSA 5A05A 2K7ZA 1X42A 4ZRMA 5TX7A 3UK0A 2QLTA 3FDJA 4B3IA 3NV7A 2J9RA 3VC1A 3LTEA 4ZJUA 2DKNA 4YJGA 2XJ4A 3HUUA 3A9TA 1MC5A 4INZA 4JU8A 4EHDA 3FCSB 3JQ7A 5D51S 4EKYA 1KKUA 2P78A 2HRRA 2DUMA 1BS9A 1I2AA 2OV6A 3PTZA 4IIUA 1JQAA 4Q9AA 5CB4B 8LDHA 3LECA 2VNIA 1XD8A 1PNVA 3E2MA 4I3HA 1TZBA 2YC4C 4EI8A 3SXJA 5BMVF 2HFJA 2J4DA 2V96A 4X00A 2NSLA 4EDFA 1VMDA 2VH5R 3KPYA 4OQQA 1UKAA 2QVZX 3QE4A 4D8XA 2D62A 2YUIA 3B5EA 3JQQA 4XCXA 5LMZA 4EVQA 4XQ9A 1V7ZA 4Z0PA 5JADA 1H22A 2WSIA 3FFWA 1JRLA 1RYHA 3PXAA 4MV5A 4OG2A 3J81k 4I4TB 1O9BA 4UBOA 1BCRB 1VCHA 3A4VA 3PE6A 1CTQA 1IU9A 1KH3A 1MH9A 1ML4A 3LW8A 3LCMA 4K46A 2IDZA 5CLLA 1TM5E 4IIBA 1LBEA 1ZRHA 2QZJA 2YWHA 1PL0A 1V3QE 1RAGA 3RUDA 1U28C 2ZE6A 4QTUB 3SGLA 3FSGD 3UMBA 4PLFA 4HAUA 1U8UA 5DNVA 5BW5A 4A4DA 3FZGA 1X7YB 1G20A 4JQSA 4LI3X 4F97A 4TRRA 2AX4A 3H8JA 5I7OA 4C0JA 4L4ZA 2EVWX 4KQHA 1HLDA 2PBFA 3KUCA 4Q7EA 4Q3CA 1CZNA 2I87A 1BXKA 3WLLA 4ZEWA 2CF6A 3Q2KA 5JI3E 4BDSA 2GZ1A 2O7NA 3IUMA 1C1XA 1L1EA 1YBVA 3P2MA 2CFIA 1GPH1 2FW7A 3AY6A 3T4UA 3P9KA 5FV4A 4CMIB 4ZK2A 4V0QA 1FQJA 3W5IA 1DKUA 3NEYA 1T9DA 3KZXA 3DBLB 5M7EA 4MUHA 3RVMA 5BVGB 3EBPA 4UTPA 3R24A 5CDGA 4FMDF 3GGSA 4QBTA 1U8XX 2HHAA 4ARUA 1EESA 3NHKA 1QLJA 3EGXA 1IY9A 2CVFA 4C0XA 1GV0A 2BGMA 2E48A 3H1AA 3WJ2A 5HRUA 1FNNA 1E0AA 4HAOA 1AZSC 1VB3A 3FLMA 5KJCA 3C3MA 4UUBA 2GILA 4GMDA 4WGGA 2ZEJA 3LVFO 1Z0SA 4QXOA 2Z6QA 3DZFA 3NV9A 1T0IA 3W2GA 5L3VA 1ZOOA 1FPMA 2MWMA 3PXCX 5I6DA 3G5AA 5K0ZA 4IUBS 1M5RA 3BH7A 1L4HA 1ZUNA 1T0UA 4D81A 4J0FA 3GIWA 4TTRA 3U7JA 2OV1A 4BKMA 4ZYVA 1VRVA 1UK8A 3UWMA 2IW1A 2VHCA 3F8WA 4LXQA 3FVVA 4YALA 3N70A 5ALRA 2LDXA 2FE4A 2VRCD 3B2QA 1SXGA 1VJ1A 2GBGA 4H4DA 4LGYA 3TLXA 4DA7A 1W1IA 2XUQA 3CLRC 1ZIPA 2P90A 4KBYA 5BWOA 4X64B 4TYWA 2XMPA 2XNCA 1MO5A 4BN5A 3I9MA 4HS4A 3T1YB 1WPRA 4JFRA 3GXBA 4D0GA 1IUNA 1YF3A 3WB9A 2VUIB 2PEYA 4YT4A 4BQPA 2XMGA 3A6HA 3V55A 3HMQA 4JOQA 5I9BA 4UBLA 4B80A 3NBMA 3D0KA 4L76A 5EUQB 4AN4A 3B6ZA 4GUAA 1E1DA 1FU8A 2NNLD 2RG7A 3I37X 3B9PA 5FT9A 1H2ZA 4HJRA 1EUDA 3HCFA 3IBFA 2R96A 1Z2CA 1FLVA 5DISB 3C7TA 4M8IA 3LT5A 3TOXA 1Q17A 1K1EA 4UREA 1P0IA 1JFLA 1NBHA 4W7IA 2YW2A 1K7CA 3WHPA 2WE8A 1N3LA 3B20A 4XWOA 3R44A 2X3YA 4HL6A 5FUMA 2I8AA 2VNSA 5E8JA 2ABWA 2Q3HA 2ZJ7A 1DAGA 1VI5A 1AV6A 1JJVA 2HQOA 1ISHA 1JA0A 1F8YA 2X8AA 4EA7A 3DE7X 2ZBDA 3PF9A 5EVJA 2XMRA 4K8OA 4AN0A 4BGVA 2WUDA 4WN9B 4ZHQB 3CN7A 2QX6A 4REQB 3HYSA 4Z7NB 3V97A 2GZSA 3WL3A 5LZ2A 5CB0A 2AFHB 1JA1A 3KSDO 2VP4A 4H77A 2ZU6A 4DVGA 2IE0A 1PAUA 1UFOA 4XVQA 4C0SA 3R0VA 2H4XA 2JEZA 3ELUA 4KQFA 2JJ2A 4BS9A 4EHFA 3NJ8A 1NOIA 2FF5A 2QTLA 3QPVA 1H2FA 2OKCA 5GONA 2A9FA 1SKYB 4M7PA 5EN4A 3RC9A 4AJNA 4FVTA 1PL7A 2R1VA 3MQFA 3RS8A 1L1QA 2Q3LA 3DMTA 3K05A 1T3LA 3STXA 1QOZA 2BJHA 2BFBB 2D4AA 1R0YA 3B2EA 3LGXA 1YJBA 3D43A 4HAYA 1CY0A 3FKQA 1BKSB 4YA6A 1EWKA 2AXPA 2IODA 1NI4A 1XX6A 2W42A 5CD9A 3PIRA 5HUJA 1SB9A 3GLKA 5DH9A 2QV7A 3C6BA 2YV2A 2BISA 2WJAA 3CTMA 4HKTA 4R0VA 4YDSA 5B3LA 1O9GA 5F2NA 2IYOA 1V41E 1QHNA 1NXOA 3KOOA 5AVTA 5SYNA 1USGA 4UM5A 3BL8A 1F8FA 1SQ6A 2HX1A 2O8BA 1OBCA 4QOEA 1SBTA 4MGYR 2NIPA 4B75A 3AK4A 3U1BA 3WLJA 4CFYA 2ZJ4A 2Y1EA 3QXGA 5LLDA 3TL3A 2H9IA 1EUCA 5IFKA 5COBA 2PFSA 2RGGA 4YRKA 5BV7A 1T24A 3FHOA 4RGVA 4L95C 1A5TA 1ZCJA 3O2SB 1QVZA 4JU9A 1K6MA 1ZU5A 5L40A 3AR8A 2JLYA 3U44A 5FPYA 3ZGZA 3AJDA 2G09A 2P67A 3IA2A 3V4SA 5CVEA 4QYTA 1RWBA 1Y9DA 4RJJA 1QM5A 3JZMA 3LY7A 1RXSA 1S2IA 2BM1A 1A82A 2I4OA 1AB5A 5TSDA 2JLCA 3UXMA 4AJPA 2FVXA 1UKYA 4Q3NA 4DUZB 2J33A 5IX8A 3T1VA 5AI9A 2ES4A 5E9WA 4MI1A 3JAWA 1ZGGA 1NJ1A 2CXRA 1RLTA 3F78A 3HYCA 1CQXA 4WACA 4JJGA 2P5YA 2LCQA 1V5IA 4C0WA 3AI2A 3OZXA 3ZIAD 1RFGE 2H4ZA 3AGPA 2O57A 3E22A 4CBVA 1E59A 2ZTLA 2ZYVX 1DE0A 3IUJA 4U02A 4Q93A 2XR1A 1BS2A 2C5LA 1MH1A 4M4SA 4W5WA 1MAAA 4OLFA 3NS7A 4LHVA 4NEGA 4EMUA 2PVPA 3H05A 3S1LA 1I1HA 2PSEA 2AOTB 3GJTA 2ONKA 4DOMA 3MQ4A 3C3PA 4N7RA 1JLRA 3G6WA 5KTPA 1QH9A 1V1JA 3FLAA 1W34A 1HDOA 1TTPB 4M9UA 1LWNA 3QMVA 4PN7A 2OD2A 4GD3Q 4KRXA 3ZZMA 5JEDA 4CU5A 4R51A 4YPFA 4DIFA 3QVMA 3BRSA 4IF6A 2WZDA 3LOPA 4KFUA 4TMXA 5E6SB 5F76A 1CQIB 2B21A 4DARA 3EUWA 2ZRDA 3B7WA 2YXDA 1P9LA 3PGKA 5JOQA 3ZCVA 3NM6B 2FZEA 3HVKA 4BLWA 3VPFA 1PWZA 5E6RA 3WQHA 3BMOB 4DV3B 1MU0A 2HIMA 4RA6A 4U7PB 2D1SA 4OYYA 2OVFA 5FOQA 4KN9S 3SM3A 1XTIA 3VZCA 3VKHA 3RC3A 1WW2A 1K8YB 4OJQA 1WKBA 3W5VA 1DIOB 2EF1A 4QQ8A 3WG9A 1A72A 1D9XA 1NVGA 2IEYA 3QTBA 5H82A 3CVXA 4AULA 1MX9A 5A4AA 2F8MA 2ZB8A 3U5ZB 1M2KA 2AX3A 2Y9MB 3QIAA 4WH0A 3D6FA 4D3XA 3VM6A 1N2IA 3LBAA 4HDNB 3NW9A 2OHJA 4G9EA 1UKCA 5KNCD 1L5SA 4JX8A 2WD7B 2O0KA 4I5IA 1F2DA 3QU7A 3ZHVA 4CKBB 2PX3A 2FG5A 4KO8A