3L82B

X-ray crystal structure of trf1 and fbx4 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
184
Chain Sequence
VTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Selective Ubiquitination of TRF1 by SCF(Fbx4)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Telomeric repeat-binding factor 1
total genus 38
structure length 184
sequence length 221
ec nomenclature
pdb deposition date 2009-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l82B00
1CR4A 1VYUA 3GJXC 2ERYA 2GKSA 2IS6A 1EFHA 1NIPA 2AXPA 4KBFA 1P72A 3EASA 4WZBE 4F38A 1XXHB 4HB4A 4HATA 4IVPA 1SVWA 1TADA 4TMWA 2VBCA 3I8SA 1RRFA 5EE9A 1GDDA 2WPDA 2BMEA 1W0KA 3ND9A 3LNCA 2IA5A 4XVRA 4JKIA 4D82A 5FUWA 2CE2X 1JNYA 2WJHA 3P26A 5FI1B 2IL1A 1NBMA 2QRNA 3B13B 3B2EA 4PTLA 1D6JA 1NLFA 2QSZA 3DPUA 5KSYA 2O8DB 4UNQA 5FFMA 5FR1A 5B57C 2KSQA 2O52A 3UK6A 4IOKA 3ZLJA 2YC2C 4CEIA 1IBRA 4Q9KA 5JFGA 4E09A 3CX8A 3PUZA 1P60A 5FPYA 4ACAA 3SJAA 1P61B 1ZNXA 1VCOA 3C5CA 3A8TA 3AVQA 1RRGA 4C0BA 4WA7A 2BCGY 3LV8A 4IDQA 1NN1A 3BORA 2G77B 1N5LA 5G41A 1G8YA 1CU1A 4MYCA 4DCNA 2QMHA 4BLRA 3RYTC 2PT7A 2F1RA 2YHSA 2ORIA 1E1QD 1N2CE 2O8BA 4TL6A 3NH9A 1JR3D 3IIKA 3CRRA 3LW7A 4PPNA 3AVPA 1WXQA 4LYFA 1Z22A 4JYBA 4RFVA 1XMJA 4JLVA 4W5WA 4AKGA 4ARZB 4B76A 1W4BA 5FBVB 3WRXC 3TRFA 2QENA 2OT3B 1NLZA 1CIPA 3CF0A 4C3ZA 3CNNA 1VPLA 4MKHA 3WMGA 1G5PA 1TAGA 2QP9X 1KO1A 4Q1DA 4Z8XA 3TK1A 3E1SA 4ZCIA 2QT0A 1LFDB 4Z54A 1TPZA 1PLLA 5JSZB 2GZDA 4GZLA 2OXRA 2ZJ5A 2F9LA 4TSFD 4OQNA 1HURA 3IILA 4A92A 2IK8A 1YU9A 3ONWA 3C5HA 3V9PA 2PL3A 3VAAA 4P4SA 2QGZA 5D3MB 1A7JA 1J8YF 2KJQA 2OO7A 5SZHB 4PHGA 3SHFA 4D4MA 1UKVY 2WOOA 1P9WA 2R9VA 1KK0A 4A9AA 1TL7C 3OIWA 4QGAA 4HEJA 3OFNA 3O8RA 2IYVA 4R2IA 4PHHA 3IEVA 1H8ED 1G4AE 5FUYA 1PZNA 3ICQB 5FH9A 2ZJOA 1UKEA 4I1VA 1M2OB 3U2QA 2QBYA 2P0EA 1OF1A 1NG1A 1IQPA 4P4SB 1IN8A 3X1YA 2VP5A 2HYDA 1KTVA 3CM0A 2GBLC 3ZZUA 1CS4C 4KFRA 1UBGA 3C7KA 4HB2A 4ON9A 3RS0A 3TAUA 4A2QA 3U5ZB 3LLUA 3U4QA 2QL6A 1JR3E 2BBSA 4TWZA 4TN1A 2KB0A 3OESA 3AF3A 1ZM3A 4IOLA 4AI6A 2WIBA 1DAIA 3KXIA 4WVFA 4P4UA 5E3HA 3WYGA 4WZAE 4DDUA 1RC8A 3F0TA 3RVBA 2Q3FA 5CITA 3AF2A 3IBGA 5G3YA 4GOJA 3SOPA 1P7CA 1OH8A 1E2DA 4RCZA 4I4LA 1IM2A 4C0JA 3U7EB 1ZAKA 2UVQA 2XNSA 2QAGB 3CW2A 3EXAA 4O2RA 5JZVA 3IIMA 1II9A 3MD0A 3A6PC 4LV8B 2QNRA 4NYIR 1AS3A 2VL7A 2JIZD 2PZEA 1E99A 3SYKA 1T3HA 3FKSD 1KGDA 2IXEA 2ZU0C 4GP6A 3BB1A 3DHWC 1GSIA 3IQXA 3PITA 1E0SA 2VHCA 1P9NA 1W5TA 1XEWY 1BMFD 1U0HC 3CX7A 4QM7A 1R4AA 1ZCAA 4DSNA 2O0JA 5TXGA 1L4YA 2A5YB 2RB4A 2ZI9A 2F1HA 5HCIA 4L9WA 1EG7A 1PLKA 3MWLA 3VNUA 1E94E 2EW1A 2GCPA 5KO2A 1WDTA 5A5GA 2NIPA 1CBUA 4ZV4A 3HDTA 4URWR 1DO2A 4LC0A 4OI2A 1KI1A 3DOEA 3AF0A 5DIFA 5JRJA 5K8UA 1ZD9A 3AKCA 2RAPA 5CJPA 2WHXA 4YXWD 1OB2A 2IW3A 2PMKA 1JQLB 4TQ9A 4BRUA 2V6JA 1W2HA 2D4HA 5JEEA 5TDHA 2QE7A 1RRPA 4Q1BA 3CO5A 3PEUA 1OKKA 1TQ4A 1XBTA 621PA 2P5TB 1P4SA 3GFTA 4ZIRB 2YYZA 2V4ZA 3WBJA 3OHMA 4GDFA 2R6DA 2GVDC 2CL6X 3L2OB 3PEWA 2JLVA 5P21A 5DHFA 1Z28A 1E9RA 4AYTA 2GEVA 1WMSA 3WNCA 2N1BA 3SYNA 4HDCA 3VKHA 1SQ5A 4QNMA 4BECA 1IHUA 3X1XA 3B1ZA 4OHXA 3DO6A 3KKOA 3MMPA 1XCGB 3VR4A 2HJVA 4B74A 2QU8A 2BKEA 1W47A 4IXNA 2A5FA 4TMXA 2HUPA 2IBMA 3ZS8A 2P67A 2JLQA 3KTAB 1AN0A 2HEIA 5E7MA 2O8FA 4M9QA 3L82B 4HUTA 2DBYA 4B33A 5GJWC 2JLSA 1HE1C 4XWAA 1EFRA 5JWHA 4EPRA 2PEZA 4LOAA 3FVQA 4N0EA 2ANCA 4FCWA 5FBQB 4LRWA 4ILEA 4LV5B 4QJ5A 4HZUA 4EPXA 3LBHA 2X1VA 1UPTA 5E7JA 4BFSA 2FSIA 1W1WA 2V9PA 4D0NA 2OAQ1 2VLIA 2A2ZA 3VNVA 2C2HA 2E9SA 4QL3A 1S3GA 4RD6A 1AGPA 3QEJA 4PSVA 4TZ6A 2A30A 3R9WA 3SQWA 2EFDB 3N2IA 5E4FA 1E2KA 4W5HA 4O3MA 4QM6A 4L15A 3UG7A 4A1FA 2XB2A 2QM8A 2Q6TA 1NN5A 4RKFA 1E2GA 4L5BA 3T35A 5AJXA 1DARA 2FX3A 2AN9A 2P3SA 4ESVA 4DZZA 3LQRA 5KTYA 4D4KA 3RANA 3HYRA 2OXCA 4H1VA 4JLMA 4Q1FA 3X2SA 4DLYA 4UXIA 5KSOA 4FWTA 2DFKB 3B82A 1K8RA 4F4CA 1KI6A 2CLSA 3FYHA 1E9CA 1LB1B 3GJ4A 3NXSA 1XZQA 3SHWA 1U90A 4P3YA 821PA 3W8RA 1P9RA 1F2TB 4UKDA 2ZYUX 2OBMA 4G3XA 1MRNA 2VF8A 1F48A 4KHZA 4EFMA 3KQNA 1Z63A 3IIJA 2ZRFA 3B1YA 4MQBA 2OBLA 1FX0A 1L7VC 3G5UA 3RSOA 2B21A 3DMDA 1ZC4A 1YZLA 1JJVA 2IC5A 3U3MA 3ND8A 1GNPA 2C5LA 2C95A 4MDFA 1MO4A 2QRZA 4HAUA 4X8OA 4M21A 1Z5ZA 3MG9A 4MRRA 5D3MA 1ELOA 5H70A 4PO9A 3NC1C 2J46A 2REXB 1M7BA 3K8YA 1QG2A 3MRSA 1J7KA 4JLKA 1KJYA 1I4DD 4YDSA 4U7DA 2Z4SA 1CRPA 3FE2A 2FPKA 3B1WA 1VCMA 4C2UA 1IJEA 1WE2A 3BRWD 4LHZA 4RZUA 3E70C 1U94A 5EP2A 5KPJA 2OG2A 4MYUA 3RDPA 3QI2A 4JS0A 3NDPA 1EX6A 2JCSA 4CW7A 1YZKA 1EX7A 2DR3A 2N46A 4HI0E 4UNPA 1Q1QA 1RYHA 2GJ8A 4ZI2A 3EWSA 4G5OA 4B3DA 1E79D 2QPAA 4LYAA 4XVUA 3PEVA 3A1UA 2CVHA 1MOZA 4G5RA 1G8GA 3NG1A 4LJ8A 2BMDA 2FPMA 4TT3A 4LSGA 1SVIA 2BBOA 2FGKA 5CLLA 2R6AA 2VSFA 3K0FA 1IXRC 2CDNA 1CJUC 3NHBA 3IO5A 3CRVA 2ZS7A 4R9UC 3RRMA 4CDGA 4NL4H 1D8TA 4MRSA 2OEPA 3RRYA 4KFTA 5KU1A 1XU4A 3U3KA 4BFVA 2R8RA 4XIGS 3VR6A 3GEEA 3UWOA 1SGWA 1DS6A 2WAYA 3QPVA 4EJSC 2J7PA 3W3AA 1AA9A 3A36A 1GNQA 3WBKA 2JLYA 3LVQE 1NP6A 4EQ6B 1Q1EA 1Z6AA 2PT5A 3FWYA 4LPSA 3K1JA 4IOMA 4QG7A 3A1TA 4WAUA 2IXGA 5BXQC 2EU8A 4UXHA 5FPKA 1G8FA 3B1XA 3EWAA 3HU2A 3BH0A 2NPFA 1D5CA 1GNRA 2VP6A 4PPGA 1DPFA 3N2EA 2NG1A 4IRUB 1RJ9A 3QBTA 4HUQB 4MKFA 4NH0A 1YE8A 4Q7KA 2ZRBA 2W6JA 4KODA 4WBSA 3DMNA 4JVMA 3ZD6A 3T1VA 5GJVC 1HY3A 2GXQA 1N0UA 1HEIA 1G17A 1FNNA 4M4SA 2PLRA 1P75A 4RJLA 4QFMA 1NMXA 1BO6A 1XD2B 3O8DA 4KVAA 5CDFE 3QPUA 3B85A 3B7GA 4Q47A 4EJSA 3ICEA 4Q7LA 3HU1A 4RKEA 2C99A 2J1LA 2W6JD 2V6IA 1KKMA 2WAXA 1KNXA 2J45A 3Q9LA 2IEYA 1TU4A 4M1KA 1S8FA 4UXJA 3TLXA 2WTUA 3NEYA 2OBNA 1GOTA 3OEHD 3WY9A 3NWJA 3EG5A 4HAXA 1SKQA 1ZD1A 1O87A 1HT2E 1SVSA 1US8A 1YZGA 3I32A 1G7RA 1RIFA 3SJZA 4JLNA 2Q9BA 4NZYA 4Q1AA 4AYXA 1PV4A 4PC2A 1ZU5A 4DIEA 4ZI3A 5EXXA 2QQEA 4DJTA 2GJ9A 1R8SA 2R6CA 3TUZC 4Q5IA 4PAMA 3ZVNA 1IN4A 1YZNA 1E96A 3CBQA 4M1SA 3CF2A 2J7PD 4XVQA 2NO7A 3U6BA 3LBIA 2VIIA 1B23P 2GESA 5DO9A 4IEIA 1GVNB 2N42A 1JEEA 1XCMA 3MUFA 1OKKD 2GXSA 1X8KA 2HJGA 1E98A 3NTUA 2RH5A 1W0JA 1N5JA 4WZ6A 2CCGA 2WJIA 3CX6A 2REOA 1UEJA 3JVUA 4WIAA 1SKYE 2EQBA 4HLUC 4Q9LA 4NPHA 2FNAA 2CL7X 4XD7A 3N5CA 4NCIA 3OIYA 1OLOA 1HTWA 3FOZA 3K70B 4LJYA 5CIQA 4DSUA 1Q22A 4AURA 1OJLA 1IN5A 3BB3A 3QE0A 4BFZA 2FU5C 1SXJD 1AIPA 4LC1A 4K8OA 2EFCB 5AUNB 2GDJA 2EWVA 1YR9A 4MYHA 2VSXA 1CR1A 1FX0B 5HE8A 4BLSA 3AF1A 2ZVQX 4EUNA 1XEXA 4KFUA 2R2AA 2GCOB 3CRW1 2ZSDA 2R6GA 1HQYE 3AH8A 3OZXA 3X1WA 1ZM2A 4E22A 2WKRA 4Q00A 3F8TA 2JEOA 2ZPTX 2F1IA 3GFPA 1Q57A 1QBKC 1JR6A 2Z4RA 2IYXA 2V8OA 2MMCA 3SBEA 4EFNA 5G40A 2O8BB 1Q0UA 5LDDC 4LBYA 4CVNA 4PSAA 2FSFA 2YNMA 2P6UA 3REFA 2PMDA 2ZR9A 4QBIA 2PBRA 4RY2A 1LY1A 4Q19A 1N6NA 2OHFA 4LV6A 4QHTA 2H16A 5CDFA 3T1QA 1II0A 3RHFA 4BLOA 4EPVA 2YOFA 4FINA 1OFTA 1G3RA 2XOKA 4URYR 1HV8A 3B5JA 3KJGA 4XTCS 2FJUA 3MGCA 2CHGA 2QEQA 4XJXA 4ERNA 5EXSA 1VCNA 1XTRA 2VHQA 1FTSA 3P20A 1U8YA 4QRHA 1Q1BA 3KKNA 4LZZA 1ZJ6A 4TLAA 1RW4A 3GEHA 2OFWA 3TUJC 2VPPA 2F1JA 4RD0A 3OFND 2ZUBA 2B8WA 5G3ZA 4Q02A 4FWIB 2VP0A 1NVVQ 1IN7A 3AP1A 2BV3A 1OXSC 4A6XA 3UPUA 2G0NA 3Q7PA 1W46A 2EWWA 2EYQA 3N70A 3TE6A 3AGPA 1N5KA 4FD2A 2QAGA 2BBTA 2A9KA 2ZSEA 3SJBA 4TSFA 2SHKA 3KUDA 4BFUA 2ZS9A 1SXJE 2RHDA 3I73A 4BRWA 4DSOA 3L8YA 1D9ZA 1M7HA 1OHHD 2ZREA 4ZCLA 3VR2A 4D6PA 4JBXA 2B7BA 2ZI5A 2ZSBA 2P6RA 3KXKA 2C03A 1OXTA 1YR7A 5HKKA 5LPNA 3OIUA 1COWA 2QMUA 4KCGA 1FOEB 3B8HA 1ZW6A 3K9GA 1S1CA 3BOSA 1XMVA 1G9XA 4GMXA 1XEXB 3TQCA 1U98A 4Y0AA 5IDVA 3SE0A 2IUTA 2EVWX 3DKVA 1VCIA 4LYHA 1EFRD 2ASEA 3BFKA 2VHTA 4QGHA 4G5QA 5KDOA 1E1QA 1HQCA 2FSHA 4DLRA 2IWHA 1G3MA 1TF2A 5FPSA 5CB6A 5L3QA 3U60B 4Q4LA 3TKLA 1G5RA 1XTJA 2CVFA 4JL8A 3P1JA 4LJ7A 1JXMA 3GP8A 4GPTA 1Q3TA 2CCKA 3JVVA 5A0FA 5C46F 1BS1A 2FMXA 4HLQB 2P5SA 2Y8EA 2QPOA 2ZJAA 5HPYB 3QQ5A 2HV8A 3O8BA 4TTPA 2ZS8A 4X8MA 2V1UA 3E2IA 4YMWA 1J99A 4NE2A 2ZI6A 3F3YA 2AKAB 5FOXA 1W5SA 4OHWA 2O8EB 1EWRA 1P2SA 1TEVA 3WP1B 5JMTA 3IKJA 1K5GA 1YJ5A 2KE5A 2WWGA 1ZM9A 4V0KA 4ESHA 2I3BA 2ORVA 2ZRPA 2VRWA 4C2TA 5JBQA 1W0KD 3AKDA 1QVAA 3QXSA 4QKQA 4DEYA 2GRJA 1F6BA 1Z2CA 1U9IC 3K70D 3L0PA 4YMUA 1IOZA 5K8IA 2YOHA 4LHVA 1QF9A 1KI7A 1G8PA 5TVKA 3SU8A 4DWJA 2DYKA 1CKEA 3THWB 2OLJA 4JJKA 4OBEA 1A4RA 3EZ2A 3NIBA 5LD2C 4BFYA 1DBSA 4UJ5A 4PFSA 4JIMA 5G53C 2RGNA 2ONJA 2IYUA 3W6NA 2XTNA 2O8CA 5GVRA 2JLUA 1G64A 1E2PA 4JVLA 1T9HA 2GAOA 4Q66C 1BMFA 1VMAA 1W4RA 4NU0A 1WRBA 2HXSA 3GLFB 1R8QA 1JPJA 2J0UB 2JASA 2XNDD 2C98A 3GJ8A 4DLUA 3RWMB 4LBVA 3ADBA 1NBME 4BZQA 2LKDA 2W2TA 2WV9A 1P2UA 3VQTA 3FKSA 2H17A 3C14C 2Q3HA 1MRSA 4LJ6A 3HJNA 1U2RA 2BEKA 4DCUA 3K0AA 4JVNA 3IQWA 4DRZA 4IEEA 5FL7D 3V00A 3UANA 5KOYA 4L8GA 3MWJA 1G8HA 4XH9B 4D80A 2V1XA 4OQMA 1VG9B 2ZE5A 4I81A 1VIYA 3PV0A 1F2UB 2J9RA 1N6KA 2PH1A 2GEDA 3NHAA 2PCJA 3BJIC 2ZRNA 5AWFC 1YRBA 1VYTA 4PXAA 1RPZA 2OZEA 4TL9A 4QBGB 4YMVA 1J70A 3IPXA 3LAWA 1SHZA 1LS1A 1KMQA 3QKRB 1RE0A 5EUQB 3LDAA 4I1SA 4EIWA 1DE0A 4BGDA 2WSSD 3GJ0A 3CLVA 1G21E 3IPYA 1JAIA 1MR3F 3T1OA 5JJIA 1R0YA 4JL5A 2B7CA 3WP0A 3OIVA 2NO1A 4IDPA 5JJKA 4PC7A 1KO5A 4FMDF 5JS7A 3AVTA 1EK0A 2BJVA 3CRQA 1AK2A 2W2XA 1G7SA 1DAMA 1R0XA 4IDOA 1E2MA 2DB3A 1T0JB 4RZXA 1FNMA 2YWEA 4WXRA 4KXFB 1N0WA 3RS3A 5AJWA 1YR8A 3KUCA 1KHTA 4NCNA 3KFVA 1KMHA 2DWOA 4B2LA 4EAQA 5GVSA 4MGYR 2XB4A 2IYYA 3IEUA 3T34A 1ZC3A 1P73A 4ASUA 5SZIA 3GJ6A 2FSGA 4JLJA 2RGDA 5UKDA 1M34E 3Q8XB 3R9IA 5J4HA 3W8NA 3GLGB 5KSZA 4LCBA 2REBA 1JECA 1L2TA 3Q7QA 3R7WB 3LH5A 1E2LA 2FEOA 4DDWA 1JR3A 1E9EA 3PUYA 4C7OB 2XSZA 4JT4A 5CYPA 1RKBA 3DKPA 4GFDA 2HYIC 1QHSA 2CNWD 2QY9A 3KZ1E 3B6EA 2J3EA 1FFHA 3WNBA 2NPIA 5HZKA 3UG6A 2D7CA 5ELXA 4LHWA 2BMFA 2XAUA 3LX8A 2IYZA 1UDXA 2XITA 2ZSFA 1HE8B 3UMFA 4AKHA 3T1TA 4Z1MA 2ERXA 2FEMA 2HCJB 3QEOA 4RD2A 4TL8A 5JJLA 2WJYA 1XEFA 5AJYA 4MGKR 4DLSA 1OXUA 2WWXA 1XWIA 2ZQ5A 3RAPR 3OE7D 2BEJA 3S1AB 1DO0A 6Q21A 1CULC 2IHBA 1AKYA 1KNQA 3VHLB 4A6PA 4BLPA 4EPYA 1H8HA 1ZM7A 4PC6A 4FI3C 4N0DA 5KHOC 1NBMD 1G16A 1GAJA 3KJHA 3KFXA 5B64A 1F2UA 2QA5A 1TQDA 2BM1A 4ZIRA 3IHLA 3EA5A 1PVOA 2QBYB 3KKMA 5DE3A 3SN6A 2V7QD 4QNRA 2AKYA 1JB1A 1KSHA 2G9NA 2Z6VA 4Q4JB 3QF7A 1O3YA 1N6HA 1X8LA 4R2HA 2OSBA 2AHOA 4GBMA 3RNLA 1OFIA 2ODWA 1P2VA 3A1VA 3H4MA 1NY5A 1E1RA 1VDZA 3GLHB 1XX6A 3QXXA 4URZR 2X2FA 5FUXA 4ZDIA 4A8JC 1G291 1MT0A 2D2EA 4G5GA 4HB0A 5LB4A 2ZR7A 2NZ8A 4PAQA 2XJ4A 4LWZA 3TJZA 4DLVA 4BEBA 1R10A 2QAGC 4TTRA 1KI3A 4CT4B 3VFDA 1E9SA 3KKPA 3FKQA 3FMOB 4FMBB 4R71A 3MFYA 3SJCA 4F4IA 2RGEA 3SEAA 1KY3A 2DCUA 1KO8A 1SXJC 2BJWA 3RABA 5JI3E 3U6KA 1DEKA 4C0AC 2C9CA 1ZIPA 4V02A 2G88A 4GNKA 2LWIA 4PQFA 4W9MC 2JJ2A 3VR1A 2FWRA 3BGWA 2VP4A 4Q9IA 2YVUA 5IF9A 4B6EA 5JLJA 1MO5A 2ATVA 4NHOA 1U0JA 1GL9B 4KSCA 5EP4A 3QENA 1VIAA 3ZIAD 2XTZA 4F91B 4ZDWA 3I92A 5C1BA 1GKYA 3BFVA 2QAJA 5EZ6B 2RGCA 2WIAA 4B3CA 5DLQC 2GA8A 1NN3A 4LJ4A 3GJ7A 4MGIR 2DPXA 1HH4A 4KFSA 1KI8A 4JLOA 5DI9A 1XFAA 1TF7A 2ZUDA 4OJKA 4AWXA 3K0SA 2GAAA 3ETLA 3FHCB 2QORA 3QOFA 4V0ME 3C16C 5DYGA 4BLQA 3MCAA 1XNJA 3BXZA 4OYHA 1BKDR 4GOXA 4RD1A 5AK0A 4NYMR 4TLBA 1GRNA 4WXPA 2DHRA 3LXRA 2CXXA 2CJWA 2V55B 2GBLA 3JZAA 3GLHA 1G20E 3ZS9A 3B9QA 4LPKA 1G7TA 4HLDA 1E4YA 2FFHA 4RD4A 2AXNA 2B92A 5JHHB 4I1OA 4AC9A 2GF0A 2WZQA 3DDCA 3GCGA 3BERA 2V3CC 1N6PA 3NVAA 5SZJA 4DT1B 4A8JA 5K8TA 4KSBA 1G19A 3AV0B 5TARA 3RRNA 3BK7A 1EFUA 4FIDA 1VG1A 3IO3A 1OH7A 1OFUX 1KSGA 1KSJA 3NDBB 5C2JB 2HT1A 2R65A 1Q1ZA 4LYJA 2F43A 1QZXA 2CEAA 1QRAA 4F92B 3WYAA 5BW8A 2GETA 4MRNA 1SVKA 3EW9A 2CL0X 4PZYA 1W2GA 2P65A 3REGA 3TSZA 3PUWA 3CNLA 1G18A 1FW6A 3Q72A 3EPJA 3PUVA 4ACBA 2VEDA 4A36A 1GG2A 1FPMA 2GCOA 4OI0A 2RKOA 2ZM5A 4IXMA 3L0IB 2BWJA 3EIHA 1RVDA 5J4YA 4LBZA 4HAZA 3EX7C 2EFEB 1D2NA 1B0UA 221PA 3A4LA 5DN6A 2A3RA 2D74A 3TSWA 3VTKA 3TW8B 3CB4A 1ZINA 2ZRAA 1KYIA 3TGPA 2X19A 2ZJBA 3BH7A 5EE1A 5IHPA 4DUGA 2NO9A 2GVZC 4XSHA 3K0AB 1NY6A 4E5UA 3LXXA 4M1WA 3Q85A 5TB5A 4L4UA 1NSTA 2X2EA 1KMHB 1UBFA 2W58A 721PA 5LB2A 5CJ2A 4J0QA 4US1R 5FUVA 1AGRA 2ECKA 2J87A 3I5XA 5FTNA 2NQ2C 1NJGA 3IBYA 3B60A 2J0UA 1Z0FA 2O8FB 1TU3A 5FOWA 1W36C 3NBYC 3SNHA 5FPHA 1NKTA 1E2QA 2VTKA 1PLJA 3KX2A 2WKPA 2HDNB 2VQSA 4LJAA 4PC3A 5A4JA 1W44A 1PUJA 3I1FA 4PC1A 1G3QA 4BQSA 2MSEB 3TSOA 2ZRHA 3BIFA 4P31A 5FOTA 1ZU4A 4JJZA 4JMPA 4HAVA 2IUUA 2Q3MA 2D62A 4JBYA 1F5NA 4CEJA 5JS8A 2BDTA 2DY1A 2JATA 1XMIA 2D06A 3AUYA 2KI5A 1D9XA 5FTMA 1CJVC 4CEHB 4HLCA 1S9DA 4JVSB 2CE7A 1R5NA 4POAA 4YC7A 3QXHA 4MITA 1IY2A 4NYMQ 4A82A 4D4JA 3KKQA 4TTQA 2WWFA 1CJTC 3ZD7A 3K9LA 1CLUA 3C8UA 4ZO4A 3UKDA 4S35A 4Q7MB 4A2WA 5LBIA 3U7FB 4II7A 1BYUA 4LI0A 1XCPA 2ZAMA 4PZLA 2CHVA 3SI7A 4BZXA 2VP9A 3NKVA 1N6RA 4D4LA 1CJMA 4DDTA 3WRYC 2ZVPX 3T61A 2CLDX 3D6TB 3ECCA 4OQFA 4B48A 2IYTA 2KWIA 4OI1A 1IN6A 3QPWA 3SBDA 4KLNA 3GFOA 1E4VA 3UMSA 5LD2B 2FN4A 4Q4AA 4TYWA 2I4IA 1Z0KA 5BWMA 2C8VA 5EQTA 1UDWA 1S2MA 1FP7A 2YWFA 4Q03A 4CRWB 3R20A 3RSLA 2Q9CA 3EZFA 4KYIB 2A5GA 4N1AA 5BN4A 1E2NA 2ZYVX 3OE7A 5HE9A 5B58C 3EC1A 2BCJQ 2H7VA 3HPQA 2GK7A 2QG6A 3VR3A 3THYA 3WMEA 2GXUA 1QHXA 4KBGA 3SQXA 3AVXA 4Z1MD 1XDBA 1LVGA 1T8UA 5DSZA 5F2EA 1KJZA 3NEJA 1OYWA 1J90A 2YJTD 4B47A 4QHYA 1H65A 3H84A 5FTLA 4QC2A 4TL7A 1UAAA 2O0KA 3U44B 1OSNA 3LRPA 4YONB 2Z43A 2DWPA 3ASZA 2ZI4A 4DEXA 1WB9A 5C18A 2QT1A 1U99A 1XP8A 2CHQA 4US0R 1N3BA 4JL6A 4CGZA 1KSFX 2ZSAA 2G6BA 2XSZD 3PENA 3R8FA 1OYYA 2OLKA 2YOGA 1LS6A 4OK3A 1BIFA 2ZJZA 2VP2A 5IT5A 2V54A 1U8AA 4X8HA 2QMOA 1UF9A 5CK4A 2FOLA 4JLBA 5J4KA 2VA8A 4L16A 4X8LA 4HB3A 1K5DA 1COWD 3AVUA 3A4NA 1HT1E 2H5EA 1OB5A 1CEEA 3HP1A 4ASUD 4A0RA 4TYPA 1R6BX 1OHHA 1NIJA 5DI3B 2R6FA 3OAAA 4D2IA 3GLGA 1VYVA 2WBLC 4P0TA 2QTVB 1E2FA 4RFSB 3EZ7A 1NVUQ 1AZTA 1RJ9B 2PZFA 2XTMA 4QGFA 5AUPB 2UZIR 1SULA 2PX0A 1R5OA 1WQ1R 1XB2A 3AQ4A 3ADKA 2HLDA 5CYOA 1JXOA 1MO6A 1UFQA 1DAKA 1GUAA 5AJVB 5FBLB 4JSTA 4AKEA 2FF7A 1MH1A 1VHLA 2ODNA 3ZDQA 2QPTA 4C0KA 4PANA 1T3SA 1CP2A 1SVOA 3VX3A 4KV9A 5SZKB 4IW3B 2GHIA 3M4YA 2DFLA 4F7WA 3QY0A 2WWWA 4M9ZA 1XXHA 1U81A 1FUKA 1UBCA 2A5DA 4ZDJA 3FGNA 3E5HA 3K0CA 4PHFA 2WSSA 3KJEA 5FOVA 2NO0A 2W0MA 2GF9A 5H68A 4XSGA 4GI7A 3T5GA 1MABB 3D8BA 1HYQA 1KI6B 4NTZA 3C4JA 5KNBA 1OT3A 4M1MA 5B30A 2ZJYA 2CK3A 1I4LD 1N6IA 2JJ1D 1UEIA 5KPDA 3CIOA 4TLEA 2W2VA 2D7DA 2WKQA 4B71A 4KLZA 1XJQA 2H57A 3RS4A 2VF7A 4EJSB 1W4CA 2FFBA 1FQKA 3I8XA 3OEED 3QBVA 1EWQA 2F3TA 5AUOB 2OILA 1R7RA 4QBHA 1M8PA 3GLIE 5FL7A 1AKEA 2FFQA 4URUR 1T4GA 4NDZA 4C7OA 4K46A 4TMVA 2ZJ8A 1W49A 4P33A 3GJ5A 1YZTA 2AD5A 3CR7A 3B78A 1QHHA 2QI9C 4R98A 4TQUS 3TBKA 3ZJYA 4DB2A 1HUQA 3PG5A 1DTSA 4C30A 2XNDA 3PQCA 1WCV1 2ZRJA 1Q21A 1W4AA 4GZMA 1S9HA 4IVRA 4OI4A 3AB3A 5DISB 4M1OA 1XPOA 3I5YA 3JZMA 2D2FA 1DG3A 2GCNA 2H8KA 5EE0A 1CR2A 2PZGA 1P3JA 1S1MA 2FPLA 3U61B 1KI4A 3KQLA 1ZUNB 1MO3A 5JEDA 3GEIA 2C96A 3H86A 1CTQA 3LY5A 3R9XA 4PO1A 1XPRA 2FZ4A 4QJ4A 4CZ2A 3DL0A 2OUKA 3BE4A 3V4RA 4UNNA 1T0HB 3KXLA 1C9KA 3C15C 1UBEA 4MA4A 3LFUA 4JZKA 1SXJB 4MYTA 1KAGA 4B2IA 1ZUIA 3RWOA 3SYLA 2ZIAA 1XTQA 1EESA 2C78A 3ZVLA 1XTIA 4KAXA 5CM8B 3VKWA 1X1RA 2PX3A 4ARZA 1IJFA 1E9AA 3TH5A 3U44A 4BE7B 3TW4A 1XZPA 1TNDA 2AX4A 1FTNA 2LCFA 3RC3A 3BD9A 3KB2A 3THOA 1A1VA 4B43A 3DM9B 1FZQA 3R7WA 4MUBA 1E2HA 3O8CA 1KY2A 4TQAA 3AVVA 4A0GA 1T6NA 4G01B 5J5CA 4MDEA 5DNYB 2IXFA 2G0TA 3OEHA 4F4JA 1ZYUA 1XJ0A 2QQ0A 2BIFA 3CWQA 4OK6A 4A8JB 1P6XA 3L43A 1KK1A 4V03A 4HYYA 3ZH9B 3W90A 4QHSA 3W6PA 3UATA 1U8ZA 1J2JA 3GMTA 2J0VA 1KDTA 3TNFA 1R2QA 2W6ID 4LDJA 5CLQA 2AFIE 4DCSA 4NP6A 3GJ3A 2IWRA 4V0OA 3VKGA 4U5XA 1JAHA 2JLRA 4RFSA 1ODFA 1I2DA 3LA6A 2QZ4A 2HF9A 3TR0A 2ATXA 5EZ5A 5JRZA 3GLIA 4LHYA 5L8VA 2Q21A 2XX3A 1VECA 3VU9B 2WJJA 3CPJB 5HKKD 5JWOA 1YR6A 3A58B 1IXSB 4U02A 2ZI3A 2O5VA 2NOAA 1GWNA 2QUZA 2LKCA 1JQJC 1US8B 2FH5B 2RHMA 2MMGA 3MJHA 4M8NE 4WW0A 2AK3A 4QJ3A 5EXTA 1ZRHA 2VO1A 1IY1A 2IX3A 1G5TA 2BM0A 1JALA 1IXZA 2WM9B 2ZRIA 1Z0IA 2B8TA 3KB1A 1NL3A 4Q9JA 2ZITA 4QXAA 3AGQA 4GMDA 2O0HA 1KK2A 5H8WA 3NBZC 1M7GA 4DLXA 3FMIA 3M1IA 1YVDA 2IYSA 2DFNA 1Z6YA 3NBXX 1OXXK 5C4MA 2YC4C 3FFAA 5IRCD 3Q5EA 1G4UR 4PHTA 1Z2AA 1XPUA 4M9SA 1MKYA 2FDCA 1K6MA 5D3QA 5FOSA 4HUQA 1NF3A 4M1YA 1E2EA 2BOVA 2ZAOA 2KBEA 3M6AA 4XWKA 1KDRA 1CXZA 1M6NA 3A37A 3GLIB 1GITA 1GZSA 3AF4A 4BUJA 5JECA 1II8A 1P5ZB 2TMKA 3P4XA 3T12A 4OL0A 2XOKD 1T8TA 2OAP1 2VHJA 2GILA 3L0OA 3ZZTA 4UNRA 5IK2D 1S0UA 2RGBA 3PIRA 4FN5A 2A5JA 2Q0HA 3I61A 4EDHA 3Q5DA 3K53A 2ZRMA 3KQUA 4ZPXA 4C0QC 1EFTA 5KDDA 4AK9A 4G5SA 2WMOB 1SZPA 3LLMA 3LBNA 4LX0A 2XJ9A 5AUQA 3ZGXA 5L3QB 3RC8A 3H0KA 4O0MA 3LWNA 1DVRA 3K9HA 3WXMA 1YZUA 4AIIA 2Z5FA 2ZRKA 3AVYA 4GOKA 1LNZA 2GZAA 2J41A 4V0NA 2JDID 2Z83A 3NC0C 1NVWQ 4DC9A 2PCLA 1VHTA 2JDIA 1SVLA 2OFOA 1AQYA 521PA 3QKTA 1E0KA 3RS5A 3A1SA 4C9BA 1T5LA 3THWA 3CR8A 4JT2A 3I4LA 5L3SB 2IS1A 3LQQA 1TUEA 5KYKA 2BMJA 2WOJA 1TQ2A 5DYIA 2VH5R 1E9DA 2W0SA 4PO8A 4B6FA 1KO4A 1IAQA 1F3OA 1N0VC 2ZRGA 4RCYA 2A7QA 1VG0B 2IUSA 3THXA 1SXJA 5IK2A 2QTHA 1A2KC 3H2YA 1DAGA 4QBFA 3U7GA 3FHOA 3PEYA 1NVVR 2AWOA 4XOIA 2F3RA 4TLCA 4XD7D 5KNCA 4Z8YA 2E87A 2JGNA 1D2MA 3DVLA 3U4QB 4R7ZA 1ZNZA 2G3YA 3CH5A 3CZQA 2P6NA 1TUIA 1W0JD 3CONA 4B2PA 4F93B 3QSYA 4QGGA 1KZGB 1GRQA 3DEFA 3A1WA 3HU3A 1FQJA 4KU4A 1DOAA 2GTPA 4Q4AB 1OFHA 3P27A 3V4FA 4D81A 3TUIC 3CPEA 2AD1A 4IFEA 1KIMA 4JKYA 2KBFA 4FMCF 3MWKA 4YLGA 4MUAA 4Q1EA 1OXVA 2OCPA 4V0MA 1TTTA 5H1YA 1IY0A 1CJKC 4EPTA 1NG9A 3QXCA 3FMFA 4PAOA 1GKIA 2C77A 1XEWX 3M0EA 2C9YA 1M1YE 3UXMA 4OHVA 1RZ3A 1OV4A 4BEJA 4IVQA 3CUEF 3D7MA 1WF3A 1T91A 1X86B 5JSZA 3IDQA 1Q12A 1E2JA 1E32A 1OW3B 2F9MA 2OCYC 5E7IA 2R44A 5EJEA 4P32A 2EYUA 2ONKA 2WWIA 5JCPA 4MKIA 3K9NA 3NH6A 2C04A 5HZHA 1E2IA 2Q9AA 4AY2A 2UKDA 4UNSA 4NKRA 1XD9A 2YV5A 2AR7A 4A4DA 3AVOA 3KJIA 1IONA 5GJCA 3FTQA 2W6IA 4ZKEA 3RLFA 3SFVA 4O2LA 1WA5A 1X8JA 2NZJA 2A78A 3QNUA 2EFHB 2ZEJA 1ZNWA 1XD2A 1NNEA 1RRCA 2PJRA 2O8EA 1Z83A 1ZIOA 2FE4A 2WJGA 1A5TA 4I99A 3VX4A 4MRVA 2IS4A 2Z0MA 3VU9A 2QN6A 2ZROA 4B34A 4NYJQ 1Z07A 4JBWA 3L0SA 2ODBA 4NONA 4KVGA 4AD8A 2E1RA 4DKXA 1OIVA 2ORWA 1YRAA 1GTVA 2I1QA 3MWYW 2WWHA 4DT1A 3L8ZA 1BYIA 4PSKA 4TYYA 3W9YA 2WJVA 2F7SA 2HF8A 4PX9A 4YQFA 5EE3A 1G1MA 4YDHB 5DH9A 3AVWA 4DBLC 2BVNA 1GILA 1Q3HA 4GRAA 4WOPA 1QHHB 1VG8A 4NCJA 1QHGA 2XZLA 4DCVA 3QXJA 3ADCA 2IYLD 3CRMA 2CMKA 2YWGA 5CK5A 5FL3A 1KJWA 1R0ZA 2YWHA 1TEXA 4YXWA 3QF4A 1Z0DA 2R62A 1F60A 3H1TA 2WWYA 3AKEA 3EC2A 1JEDA 2ZI7A 5J47A 4I1UA 2ZANA 1D2EA 4PQYA 1VKJA 3U3JA 5KSPA 5L3RA 2WSMA 1XJCA 4A2PA 5EP3A 4DDVA 2GWHA 4TT3D 1Z6TA 3FPAA 3P4YA 3D3QA 1F2TA 5HTKA 2J0SA 2L0XA 2ZR0A 1E79A 1ZD8A 2QTFA 4HZIA 1XD8A 4H9GA 4GP7A 3FMPB 1T3LA 2OCBA 2OV2A 3R8CA 1FUUA 3SDZA 3AP3A 5FTKA 4MGZR 1AZSC 4M9XA 4M53A 4N3NA 2F6RA 1ESNA 3DM5A 4TZ0A 1VTKA 2J0QA 3EPKA 3DZDA 2GJKA 1GP2A 1Z6XA 4FCVA 2VYFA 3HWSA 4Q01A 2PEYA 2XZPA 1Q20A 2JIZA 4XTRA 3PUXA 5CM9C 5FBRB 2MSCB 4OKSA 1E69A 4NYIQ 5FR2A 4PPFA 1NVXQ 4LK2A 1LW7A 1ETUA 4EKDA 3I62A 1EFCA 3GLHE 2JJ8A 3TVDA 1N5IA 3GLFE 4TMZA 5E95A 4K81B 3WMFA 4U00A 3G0HA 3OEEA 1ZP6A 4MH0R 4DVGA 3BC1A 3ZVRA 4ZCMA 1BH2A 2NMVA 1HA3A 4V0LA 4DIDA 2ZETA 5TV2A 2FA9A 4OQLA 121PA 1U0LA 1FL9A 1ZNYA 2JJ1A 1OIXA 2CK3D 1E0AA 1G3IA 3RS2A 4Q7JB 3MLEA 1G41A 4Q9HA 3QVVA 1OH5A 4A0FA 2ZE6A 5L3VA 3HR8A 8OHMA 2AK2A 4OK5A 2NO6A 3K09A 4FMDB 2BKUA 4M22A 4RSGA 1NMZA 5BQ5A 4TLDA 1H8EA 4HAYA 2OM2A 1ZM4A 2I1VB 2AFHE 4IDHA 4QOSA 4RD3A 4ZDKA 5AJZA 5C4GB 4AKIA 1A82A 1W48A 4FXPA 3T5DA 2XXAB 2BHRA 5DN6D 3U7HB 1QDEA 5F3WB 1XRJA 3I3SR 3S1AA 4CEHA 1WP9A 2ZYTX 5EE5B 3U3OA 2DWQA 5JHGB 3KQKA 3G82C 5GADl 2HCBA 4HSEA 1ZVQA 3KDSE 4B75A 4CEJB 2QM7A 5BN3A 2HLDD 3I72A 4JYCA 4LBWA 4B3BA 1Z3IX 3UIEA 5L3SA 3EIEA 3BFXA 3EIQA 1NJFA 4YMTA 1CF4A 1Z47A 4B3GA 4LUCA 2XXAA 2DFTA 3QKRA 3OAAD 1XMSA 4IKEA 3QF4B 1WBDA 1FMLA 5ANRB 3CWZA 3SC3A 4E07A 3OF5A 3WNDA 2ZXUA 4PZZA 3RS7A 3ZVMA 4D0GA 2ZE8A 4XWOA 4HDQB 2IYWA 5BYKA 4W7SA 5J4VA 1G7CA 2J7KA 3BB4A 3QG1A 2FG5A 2ZUCA 4BPBA 1FP6A 1PJRA 1JPNA 1LV7A 4BLTA 4CYMA 1W7AA 1TX4B 5JI2E 3NBFA 1ZMXA 3CF6R 1X1SA 2YKGA 1DAHA 1R5BA 1AS0A 3PJRA 3MJRA 2IS2A 1CR0A 1PUIA 3TR5A 2J59A 1NMYA 1Z8FA 2QSYA 4TMKA 4Q4JA 4M0LA 5HCNA 2UZ3A 1G3UA 4US2R 4MKGA 1RFLA 4RZ2A 1S4QA 4UQOA 1XTSA 4OHZA 3GLGE 2O8CB 3ADDA 2CCJA 1QG4A 2VHUA 3BWDD 4B73A 2NGRA 3EPHA 1ZBDA 3GLFA 4BZPA 1GRRA 3MSXA 1QHIA 1KI9A 3CNOA 4OQXA 3K0FB 1GKUB 2PLFA 3CPHA 3W5JA 1ANKA 4KYUA 3O47A 1E3MA 3CH4B 2ODEA 2IEZA 1N6OA 4E03A 4DSTA 2H1LA 3PXGA 3EA0A 4PR0A 5KNDA 1DADA 5GJBA 4Q21A 3F5FA 1G6OA 4A15A 3TAHA 4ZKDA 4JLPA 1QHYA 3K70C 1GL6A 1NKSA 2G1JA 4AG5A 1GFIA 1UADA 2QE7D 3FFBA 5B2ZA 5FPTA 2JLWA 4RZ3A 1RYFA 2PJZA 1S96A 3K0EA 3QIAA 5FI0B 1Z6GA 3ZQJA 1X3SA 4URXR 1OPXA 2QMEA 3DOFA 3A4MA 4D25A 3AP2A 4A0HA 4LHXA 1Z08A 3THYB 2JJ2D 3W6OA 1AJEA 2HXYA 3LVRE 3RRZA 4P4TA 3QG5A 5BN5A 2C9OA 3CZPA 3KL4A 1W36D 1DG1G 5DHAA 5K8LA 1NN0A 3ZYCA 3QKUA 1UKZA 1S3SA 2J5XA 3QJYA 1OH6A 1KKLA 2RGXA 4Q4HB 1E9FA 1I4TD 1UM8A 1KAOA 3IUYA 2MSDB 2RGGA 2GJAA 1XTKA 2CJWB 3X1DA 4B35A 4CIDA 2ZTSA 4B3FX 4D0LB 4IFBA 4EQ6A 5F9FA 3QKSB 4MRPA 5EP1A 2YINC 3FB4A 3PFIA 4GSYA 2IF0A 3QUSA 1JJ7A 2IYRA 4DLWA 4HDOB 2QP3A 4S2EA 1L4UA 2HT6A 2P2LA 421PA 3WYFA 1Z0AA 3AUXA 4GL2A 4OHYA 1E1RD 4JSYA 1E9BA 2AL7A 4Q4HA 3FDIA 4LY6A 1T5IA 2EFGA 2IYQA 2FGJA 4NMMA 5J4LA 1TMKA 2G83A 4O25A 4LGMA 1YZQA 4Q1CA 3W5IA 4B3XA 1V5WA 5AR1A 4KJZA 4DLTA 5KDLA 2V7QA 1NRJB 1DAFA 3W3ZB 5CIWA 4AG6A 3KQHA 4EPWA 5TY0A 3K0CC 4BFWA 3LO5A 2H92A 2W83A 1M74A 4KITB 1AM4D 2RGNC 4BFXA 4CT5A 5CB8A 2XZOA 2WVJA 1YHNA 1H8HD 1DAEA 3MAAC 2OE2A 5TMPA 2GXAA 3PR1A 3SR0A 2IHYA 4AYWA 3BH6A 2JLXA 3TMKA 2X77A 4B44A 5BYJA 1WBBA 3EZ6A 5JWRA 1QHNA 1MABA 4IJMA 4DUGD 4HAWA 3ZQ6A 3EPLA 1TF5A 1U9IA 2GEUA 3ZZ0A 2YZ2A 4C0HA 1XF9A 4FW9A 3EAQA 1LF5A 1P62B 1AQUA 2NTYC 4BASA 1X6VA 4G1UC 4KI0A 3SS8A 2XEXA 4NBSA 2ZJ2A 2CNWA 1LF0A 5FTJA 1LTQA 1Z0JA 2OFXA 3HYTA 2CBZA 4URVR 2GK6A 3J81k 3U3RA 4RVCA 3VMFA 4HLUA 1C4OA 1SVMA 4CEIB 3PCRB 4HZUB 4NCKA 4YMSA 4NCHA 4IOJA 2RGAA 4OJQA 1Z06A 4LJ9A 3EZ9A 2RCNA 1ONBA 1BOFA 1NSFA 3IGFA 2O8DA 4BFTA 2WICA 5J40A 1OE0A 3CKLA 3GD7A 4C0SA 4FMCB 4JLAA 4KO8A 3DZ8A 2JA1A 3LW8A 1SHKA 5FOUA 5EXPA 1XXHE 1A2BA 1AS2A 2ZYWX 4DCTA 3EARA 5JCZA 2ZRDA 5EUMA 4NYJR 1JI0A 3QVUA 4PQRA 3SZRA 3TIFA 3X1ZA 1UKYA 2W00A 1P2TA 2F55A 4DHEA 3TVTA 3HPRA 1NI3A 4IDNA 4Q48A 3T06B 2JLZA 1G6HA 3GQBA 1Z29A 4EFLA 1R0WA 2IT1A 2FFAA 4D26A 4TMTA 2K5UA 5F9HA 2GNOA 4Y0VA 4Z51A 1ZUHA 3FHTA 2X8AA 4DXAA 2ANBA 4LJ5A 1Q44A 4B32A 1J8MF 4ITRC 1KK3A 4Q18A 1SKYB 2GZHA 5FBWB 4DLZA 5KUTA 2FV8A 4W5JA 1ESMA 3HR7A 1KZ7B 2F43B 2ZRCA 3ASYA 4DB4A 2WMNB 1C1YA 1KDPA 4FCTA 1ZCBA 1TQ6A 3LD9A 4M2LA 4IHQA 2FZLA 3P32A 2XGJA 3AM1A 3PVSA 3WHLA 1KI2A 1OIWA 2BBWA 3TQFA 1I2MA 4ABYA 1KDOA 2ZRLA 3BBPA 2JAQA 2ZE7A 1UJ2A 1N6LA 2GJSA 4BWYA 1NLYA 3BS4A 4TYQA 1GL7A 4L9SA 1Y63A 3Q3JB 1N25A 4CF7A 1L8QA 1W36B 2D3WA 3B1VA 2H18A 3C41J 3LX5A 3UMRA 4H1UA 3T15A 3QKSA 3K09C 3ZIAA 2WPDD 3AEZA 2RMKA 4GT1A 4JLDA 1GIAA 4M1TA 3WHKA 3IHWA 5M04A 1EXMA 4PPQA 1II8B 2BC9A 1EGAA 3VR5A 2CLCX 3B9PA 1CRQA 5DI3A 1YQTA 1E0JA 1KO7A 2G1KA 2QGNA 4TYNA 1MV5A 3W34A 1YKSA 5F98A 3GPLA 3BAFA 5HR5A 4G0NA 1QVRA 1E6CA 1V43A 2AWNA 2VSOA 3KTAA 4C4PA 3D31A 1KOFA 4UJ3A 3THXB 1FMJA 3AKYA 2ZU6A 2OCAA 2QROA 1GM5A 1Y3AA 2QP4A 3VHXA 1JBKA 4C0LA 2IF2A 3UWKA 1DELA 5DGXA 3SFZA 2B6HA 2OESA
chains in the Genus database with same CATH superfamily
1MRZA 3HJUA 3M6IA 4ALMA 1Z4KA 1I30A 2WD7B 3GJXC 2ERYA 5D01A 4A03A 1DUIA 3MJFA 1T2AA 2EBHX 2HU8A 2MSLA 3BX1A 2IS6A 2BUCA 3IBCA 1NIPA 2AXPA 1YC5A 3R40A 5CNKA 5B1DA 3RO7A 3ZHBA 4UTNA 1IUNA 1JU4A 1XXHB 2IE8A 1I1HA 3OFSA 3D2CA 3O73A 1SVWA 1ZISA 4G9GA 4K9DA 1M76A 4KQFA 2VBCA 4U6SA 4Q6WA 4BZWA 3I8SA 4JB3A 1RRFA 1TYEB 4OVKA 4MYDA 3PUKA 3SICE 3GA7A 1YB4A 3HUFA 1AUVA 3ZJTA 1KBOA 5BSMA 3ZXYA 5I7EA 1EGQA 4FHEA 2CE2X 3ODGA 3DE4X 4EUHA 1VKZA 4MEAA 2IL1A 4NHEA 3VUFA 3B2EA 3RBXA 3HB9A 1SCNE 4BO4A 1U9YA 3H2GA 5FFMA 4ZFNA 1J0DA 1FDUA 2YC2C 4UBKA 1K88A 3I9V1 4CKWB 4YQYA 3CX8A 1P60A 3UK1A 3NRCA 2M32A 3SJAA 1P61B 2P41A 1Q0TA 2A4KA 1XNQB 3FTFA 2X14A 3A2NA 1D09A 1JHXA 5IJ0B 3L06A 3ZWPA 1U5BB 2Y4OA 4JB8A 2RGUA 1Z5UA 3FKJA 2YZ7A 5DEIA 3LZCA 1CU1A 4MYCA 2GTHA 2XNJA 3T3GA 5EJFA 4BLRA 4DCNA 2ZIZA 4WD3A 2F1RA 1HRDA 2ZSJA 1SOVA 4HQNA 2C5BA 2QUHA 2L42A 4BKQA 1JR3D 2I7XA 2BTQA 3TDMA 4W5WA 4AKGA 3ZLBA 4E3ZA 2C2MA 2LIVA 4R3NA 4TTIA 3U7JA 4ARZB 4B76A 4WZAB 2PZAA 1AF4A 4YT2A 1KOJA 4PGGA 3TRFA 1BXRA 3ZNPA 4RGYA 1NLZA 5TC4A 5K6RA 4F9TA 2Y76A 5JSHA 1BSVA 5BN1A 1BA2A 3L41A 3CF0A 1P3DA 1JDSA 1VPLA 3CNNA 3G2HA 1G5PA 3ZPXA 1LJUA 4Q1DA 3WK8A 3MS4A 4GQAA 3O31A 4KQ6A 1YULA 2OHJA 2RKWA 3E1SA 3Q8KA 3DOJA 2WYWA 2B4AA 1J39A 1WIWA 4F2GA 3HN6A 1TPZA 3INGA 2GZDA 1THZA 4HQLA 3GHYA 1JX6A 2P11A 2YUIA 3V6MA 2P4EA 3N2GB 1FXUA 1M0SA 3ONWA 5E8RA 2BHNA 3S27A 4DA6A 4MJXA 4Z4IA 3BF8A 2PL3A 3VAAA 2F8SA 5IDQA 1YOVA 5D3MB 2QQ5A 3AFGA 4PFJA 4IXDA 3JY6A 2VJBA 5SZHB 4V3CA 1DKMA 3TLZA 3UAYA 1ZHFA 1QQAA 2IDMA 2VPWA 4LY9A 3TTWA 5JATA 5FDFA 1ULZA 2PE5A 1P1KA 1RR6A 1YONA 2QDKA 3L40A 2Z9BA 4YJ2F 3DOIA 3ZHXA 1H8ED 3RJTA 1G4AE 1L5WA 3UK7A 5FH9A 2RAUA 1QU3A 2ZJOA 2UYQA 3IT2A 3CZMA 4H7HA 5EY5B 1UKEA 5WRFA 5ITSA 3ZWXA 2P0EA 3W5UA 1NG1A 2DFPA 4H1WA 2VP5A 2HYDA 1KTVA 2RHRA 3ZK9A 4A2QA 3C7KA 1X1BA 4HB2A 4BRZA 5ALPA 1UZLA 2BKAA 2Y1DA 3K1AB 1OAOA 2QL6A 3LLUA 3U4QA 4TN1A 4J1SA 5CYGA 4S12A 4HVLA 1WDWB 1Y7TA 3Q3VA 2C5EA 1N8NA 3DV2A 3AF3A 1I2AA 1ZM3A 4MQLA 1KWKA 1MQ8B 4YO8A 1ECCA 2AH5A 3KYIB 4WVFA 1IQRA 2HQSA 2R66A 4WFIA 1Q0RA 4WZAE 4YJHA 16PKA 3V42A 2GBFA 1LRLA 3D8RA 2OORA 3F0TA 4KE7A 4XM2A 4YO7A 3PQDA 5C32A 5CITA 3DVQX 2C7OA 1ODIA 3E35A 2RGYA 2Y3IA 2YY5A 2Z2IA 1O0SA 4NENA 5ALNA 1IM2A 1C9DB 1UBKS 1WVMA 2VYNA 1HT3A 3E03A 3MT0A 2P8SA 2XNSA 1MG0A 2ZXEA 4MINA 4B0OA 3IIMA 1II9A 2X41A 3T8YA 2PSEA 4LV8B 2YJGA 4XPZA 2IYAA 4HPJB 2WE8A 1AS3A 3FPKA 3SYKA 4YRSA 2HREA 3FKSD 3UJ3X 2ZU0C 3MN1A 2Q41A 3BB1A 4QPDA 3IQXA 3WDSA 1RZVA 3UAWA 3PC6A 1IATA 4XIIA 1ZGJA 4NZ9A 1JHUA 1O58A 1R4AA 5HFAA 2C94A 4C4RA 2PKRA 4I2VA 2XRMA 3KPWA 4MWBA 4DUZB 2O0JA 5I9IA 4KIUA 3TTUA 3ZV7A 2A5YB 2WJAA 3DMRA 3CLSD 4XIYA 3EGDB 3MWLA 1E3LA 1RM3A 3G68A 2IU3A 5JCJA 4X93A 4GVXA 2OGWA 4FE3A 1T4CB 3TDKA 1QK4A 3TAXA 3TOZA 3DDHA 3NHMA 1FYWA 1G21B 2RGRA 4URWR 1DO2A 1NOIA 1DTWA 1ZH4A 2GS9A 1KI1A 3S68A 2W37A 3AF0A 4EFDA 1VKRA 4HZGA 1OB2A 1K92A 4YXWD 1RAHA 3FYTA 2P9GA 1LPBB 4TQ9A 2V6JA 1DT3A 4U7HA 3EODA 5JEEA 1Y3HA 1EJ2A 3KOYA 5INTA 2QE7A 1XIVA 3U56A 1QOPB 4PYLA 2HK9A 3TSCA 5JNSA 4LRXA 4ENTA 4KLCA 2Y99A 5I4KA 2GYYA 2H4ZA 3EDMA 3PNPA 4OHRA 2GVDC 1QVWA 3GAAA 3GRAA 5F78A 4O4HF 3F5SA 3AU8A 1LPMA 3DBHA 3A6GA 4DEVA 3B12A 5DHFA 1E9RA 1OWNA 4XRRA 1WX1A 2GEVA 2ILTA 3OWOA 3WNCA 2N1BA 2BZGA 2V4MA 2I7CA 1IWPB 3W5CA 3R7SA 2VHYA 1CUUA 5GM1A 1WMBA 1GRVA 3H3FA 1IHUA 3FSEA 1HGXA 3MTDA 4DCJA 2XKKA 2R751 4JI7B 2BKEA 3JAKB 1Y3FE 1JJIA 2BEUA 4IXNA 2A5FA 2ADOA 4OB7A 3ZS8A 4CUZA 1FBTA 4TXNA 1VYHA 2P67A 1LBSA 1LDYA 4G4IA 4BOYA 4CIYA 1XKLA 4EJ0A 3LXMA 1L7EA 3GU3A 4IBOA 5E7MA 2AFHB 4TVKA 4NOLA 3OOWA 4QQKA 5DM0A 2AS0A 4YJGB 4MUGA 1WLSA 1HE1C 3GO4A 3OU6A 2XZTA 4TS3A 1EFRA 2PK3A 3EUFA 2PIDA 1BE1A 4I1PA 1KGSA 1W5AA 2PEZA 1YI8A 4TMYA 5FBQB 3U4AA 4EPRA 3I6BA 4PLHA 2OQVA 3TO5A 3G9TA 2EX1A 2I66A 3K15A 5IUNC 2HNAA 2X7HA 3LWBA 3MZ0A 1U2GA 3LBHA 3RG2A 3DDUA 1Y9DA 5E7JA 5JPCA 2UUCB 1W1WA 4D0NA 1T3GA 3ZQ4A 2NSLA 4GXNA 3VNVA 4LQLA 3KG2A 1WXFA 2LPMA 3HADA 3OCXA 5KTRA 4JGBA 3DL7A 4BCCA 2L82A 2GO1A 1QNFA 4QL3A 1S3GA 1V37A 4JGIA 5F5LA 5H7XA 5CG1A 1SJ9A 3F90A 3SQWA 3L4KA 4G0XA 2EFDB 3JQPA 3N2IA 3TLGB 2YY7A 1E2KA 1JB9A 1MC8A 2AQIA 4O3MA 4L15A 4H31A 4A1FA 3ZHRA 2BAGA 2XB2A 5SYMA 2HCRA 4L5BA 2GN9A 4OGLA 4ESVA 1DRVA 3BBLA 3LQRA 5E3IA 2GI4A 1EWTA 1ZESA 3D02A 4MW5A 1FJ2A 2RJOA 3WV5A 3TKYA 3RANA 1J2UA 2QS9A 1JNXX 5EQJB 2YZGA 4H1VA 4WLFA 3KKEA 3NC4A 1L8AA 3WXBA 1Z0UA 2IKSA 4O2AF 3UOAB 5KSOA 4FOOA 1UXJA 4RTQA 1VB5A 2DFKB 4ITUA 1RFGE 2XCSB 3RH0A 2UUOA 5C8DA 1ZW1A 4PXYA 2BZ0A 4B6RA 3UWMA 1KI6A 4C7KA 2APJA 1XZQA 4F96A 1U90A 3RU2A 2JBAA 1EM8B 3G0GA 2BN4A 2BRUC 1QCYA 3RFTA 2A0UA 4CJXA 2PPLA 2W5UA 3HHEA 3L5OA 2BH9A 1Z63A 2CNBA 1JIVA 3B1YA 3N0TA 4GKKB 1DKUA 1Q7BA 3INNA 1G9SA 2J3KA 3E48A 2QTAA 5CFPA 2P2GA 2BUBA 3NP7A 3DMDA 1ZC4A 3VJKA 1JJVA 3DHYA 3FTCA 3A9UA 3UHAA 3U3MA 3HN2A 4NZZA 3PPVA 4K2HA 1CUVA 1ZJWA 4CV1A 4JP3A 4RPLA 1YKFA 3BRWA 2C95A 3A25A 3M2PA 3P9NA 2QRZA 1ECJA 3CZCA 4JR1A 4X8OA 5IVIA 3A9TA 4MRRA 1ELOA 4K8RB 4PO9A 2WFZA 3LYLA 2QVXX 5AHKA 2QJOA 2FPXA 2H2WA 1XAHA 1MEEA 2J46A 4FYIA 3K8YA 4KR7A 3D6VA 2ZXFA 2RDMA 2FPKA 4YXFA 3BUSA 3FUVA 3USES 3ON5A 1BAPA 2QD3A 3E70C 1U94A 5KPJA 2BEWA 4JS0A 3NDPA 1EFPA 1RKUA 1U65A 3U26A 2EKBA 1EX7A 3OG9A 4KX5A 4UNPA 2KMLA 1RYHA 3ROXA 1L7PA 2GJ8A 2PU5A 3TI9A 4B3DA 2IPMA 1E79D 2QMYA 3KVNA 2WD7A 4RMGA 4UVHA 3RSGA 5EC8A 4UDNA 3A1UA 2CVHA 1PJBA 1MOZA 4G5RA 1G8GA 5KWVA 1NR5A 5IKOA 4UEJA 2QN7A 1V35A 5I7VA 1GZ7A 2FGKA 2OQIA 3N76A 2Q8QA 5CLLA 3CVYA 3UWPA 3L79A 3ZEAA 2FQQA 3GGSA 4K88A 3SWWA 3K3PA 1O9GA 4QLOA 3C3BA 2DSNA 2I2DA 3K0FA 1P91A 1NJSA 4FOSA 2C0PA 2N3ZA 1TK9A 2Y0PA 1KARA 2ZS7A 4Q6BA 2E6UX 1VMEA 3R7BA 1SOWA 1T3ZA 3KQPA 3OMXA 3PB3A 4G5XA 3VYSB 1O6BA 3QLEA 4RUKA 1DIBA 3SEQA 2AZMA 5BMVB 1MBZA 3T3NA 3UWOA 4NC9A 4JI4B 1J49A 3CT4A 1P1HA 1SGWA 3V8EA 1QFYA 2BUAA 1Z39A 3QPVA 4IIDA 4ER7A 4EJSC 1NRXA 2J7PA 1AA9A 1SCUB 3K1AA 4FUQA 3KZXA 2A9FA 3DAPA 4EQ6B 1Q1EA 1DTWB 1N78A 1K6JA 1LBIA 4QG7A 1EUZA 4NI5A 3VPBA 4C1BA 2IFTA 2YYYA 1RI4A 4G5YA 4J49A 1YQEA 2CEKA 5MN5A 1KEUA 1X15A 3RVMA 3WL6A 4N82A 2FWIA 1C1XB 4AJNA 1JKXA 4W8GA 5EJMA 1IBMB 1K86A 1C0EA 1G8FA 3EWAA 3HU2A 1J7JA 4V3BA 5B5SA 2O14A 1DPFA 1XMQB 3ACBA 2AZTA 1RJ9A 1CZRA 1T24A 1Z25A 3HG7A 3AEKB 3KZKA 3QY9A 4FDTA 1HOXA 4PAGA 4ZOLB 2W6JA 4X7MA 1SK8A 3RI3A 2A94A 5JO0A 4URFA 4DYDA 3HCRA 1R74A 4OFBA 2NVWA 5F33A 2ROQA 3T1VA 3W5SA 3A3KA 4IM7A 2BGTA 2C5SA 2XZDA 5EL0A 1KDYA 2C4HA 1E89A 4RMIA 5H80A 3Q3HA 5C8YB 4M4SA 2BHTA 2A92A 1NMXA 2AOVA 3W2FA 4WFJA 1XD2B 3UT5B 3A04A 4DGQA 3QPUA 2R97A 1KQPA 5AD1A 3PL1A 3HACA 4Q7LA 4MHOA 1ITZA 5AH0A 2HIMA 2QD5A 5F3DA 5B36A 1WD7A 2V6IA 3UMYA 3EC7A 3SS7X 1KNXA 1E7RA 2ZIWB 1SQ0A 1S8FA 2AJ8A 3K2IA 1KRHA 3NEYA 3PGKA 1CB0A 2FUG6 6YASA 2QV7A 2X9GA 4GPEA 2ZSUA 3UJ6A 4LEIA 3TW6A 4JUBA 3EG5A 3F7NA 1SKQA 1SVSA 3I32A 1G7RA 1RIFA 4RDHA 3SXUB 4CLEA 2CLEB 3GX1A 3OCVA 3P9RA 2XOXA 4ZI3A 4TMFA 3TG2A 1UOQA 2QQEA 4MQ4A 4PAWA 1R8SA 4BB6A 4DJTA 4EEXA 1ADCA 1IN4A 2ZW9A 3H9JA 4CKXA 3W3AD 2V03A 1N33B 1KRWA 1Z5OA 3LBIA 1FRQA 2GESA 1X1QA 3DUFB 2N42A 4HSEA 3F47A 3NP9A 4MWTA 2OHVA 5K0EA 1X7DA 1PRYA 1Y80A 3DEZA 1E1NA 2P7IA 3BJRA 3EGDA 4TS9A 3FM9A 2C8LA 2WJIA 4HMOA 3CX6A 3DJYA 4ZVQA 4R8MA 4BVGA 4EYSA 1SKYE 1QCDA 5BPHA 2G5PA 5IM4F 1CB7A 4Q9LA 1NLUA 1Z17A 3NI2A 4JC5A 4NPHA 1TM2A 4C4XA 5GZ6A 4XD7A 5HQ3A 2RHLA 2WTAA 3FCSB 4NCIA 1OLOA 2K7ZA 2PWAA 2NN3C 4MQMA 4Q3EA 3WWZA 3JZDA 3K70B 1SMKA 4TROA 4BXOA 4AJ9A 4ENRA 3R74A 3NDJA 4YAJA 3HUDA 2FU5C 3WX0A 3UB3A 5C52B 4LC1A 3GDWA 1OWOA 2YXLA 2A6PA 3O4IA 1K1EA 4K8OA 3SC6A 4F4HA 2EFCB 4RJTA 2GDJA 2EWVA 3SHVA 1CQIB 1MC4A 1Q0SA 2VSQA 3REQB 1W30A 4XWYA 3IQFA 4F9EA 1GAQA 4EB6B 3ZOKA 1WHSB 4KGVA 1HQYE 3JWJA 3NUGA 1J8QA 1BMDA 2GYUA 4EW1A 1Y3IA 1AQJA 1UPAA 4HRXA 1K98A 3PTLA 3EVAA 3KQMA 3GRYA 4UEQA 2D6FA 4BQEA 4Y7DA 5LSAA 1IBCA 4KPUB 2V8OA 4PYQA 3UQYS 5IXYA 3DL4A 4ZO8A 5DKFA 4EFNA 5JDIC 2NO4A 4LBYA 4CVNA 4GYYA 1D4AA 3GR6A 3H97A 4R8VA 2FSFA 2W6NA 4PCVA 4LDNA 3WB2A 2WD8A 3T9CA 1MW8X 3REFA 4WOKA 3PLNA 4B17A 5C37A 2PMDA 1VL1A 4QBIA 4BNHA 2JAOA 1Y1TA 2OHFA 5CDFA 1FSZA 2O8NA 4L6CA 1K97A 4XPIA 4C6HA 5JD5A 2R1TB 2YOFA 1ID8A 2DH6A 5LC1A 1FQOA 2XOKA 2GZMA 1JLSA 3DPIA 4HEA1 2G09A 5BV2P 1HV8A 1MAWA 1W5FA 2Q6OA 3B5JA 3E7FA 3I2FA 1CUZA 1RQGA 3KTDA 4D3ZA 5AW7A 4L3WA 5HBGA 2QK4A 4IDDA 4Q37A 1GV1A 1C9NA 2F59A 1VBKA 2FJUA 5FPQA 4N0PA 1DDIA 5IJWA 1UPUA 1VCNA 4KNVA 5FO1A 5TNXA 2GPTA 5CDTA 4PO3X 3KKNA 2E5LB 3LO8A 2AMLA 3HXMA 4TLAA 4ZAFA 1I3CA 3GEHA 4QXPA 3TUJC 2QX8A 3BMOA 1DJQA 3RVLA 5ICEA 5G3ZA 4LGYA 4IX1A 5BYAA 1JEYA 3UW3A 3IALA 2XT9A 1VMIA 1EVKA 4A6XA 3R7LA 3UPUA 1UT5A 2PKQO 2WFLB 1T8YA 2VZEA 2WTXA 1L7AA 3RFUA 1J5XA 5FWXB 4IHAA 2WWRA 4JBLA 3TE6A 4FD2A 3ANLA 2W6ZA 3KOUA 2CVPA 2ZSEA 3SJBA 4TSFA 1Y1LA 4ARBA 1J8FA 2YWDA 4XGNA 2RHDA 2BGMA 5JH7A 4BRWA 4MCJA 3L8YA 2FQ1A 4HVCA 3FF1A 2NUAA 2ZTVA 1P45A 1PL7A 5D2CA 1M7HA 2GM3A 4WFKA 1XJWA 3VR2A 2NYRA 2HQOA 3PF8A 1C7JA 2B7BA 2ZI5A 2ZSBA 3UCEA 3B6KA 1YXMA 1VJDA 1QJ4A 5L45A 1YR7A 1PU2A 3FNEA 3OIUA 4Y9SA 4QXOA 1P5JA 1FOEB 1UXIA 3DOCA 3BOSA 1XMVA 3N0WA 2P62A 1YJAA 3ELUA 1U98A 1I01A 3ZE9A 3LOQA 5HK8A 3D6JA 5IDVA 4L5JA 3E7DA 3SE0A 4F2PA 3C8HA 3PE3A 1Z13A 4AROA 3OZUA 4XGKA 3G1UA 4R1SA 4P22A 1HQCA 1V26A 2UUPA 3DVAB 3L8GA 2QRQA 4WY2A 4DLRA 4U3JB 5JC8A 3GMIA 1TF2A 5CB6A 5L3QA 3U60B 1G4HA 1ONOA 3GCXA 3P97A 4GPD1 4RV5A 2EXXA 1VIDA 3LT2A 1UWLA 2B78A 3PHGA 2CVFA 2HHCA 3UUFA 3W7AA 4AKSA 4LJ7A 1JXMA 4KWIA 1PZMA 2TECE 4D5GA 4FXOA 3AIMA 1MLDA 3EA4A 5A0FA 2JAWA 1BS1A 2P5SA 4KV7A 3VR4D 2QPOA 8GPBA 1ZIYA 5HPYB 3AI3A 2AFIA 2ZS8A 3E2IA 4DIUA 4HNAB 3RBAA 1Y5RA 2JCBA 1J99A 4KQ2A 4BO7A 1HFJA 1K8ZB 1UBHS 5HRCA 2YW9A 2BGGA 2B36A 2AKAB 2CSUA 4OHWA 1Y7HA 3DEHA 5KQRA 3EZYA 2IZ5A 5AVVA 3JQRA 4B40A 5AM5A 5JANA 3B5IA 1P2SA 3HC7A 3WP1B 1LPPA 3NV9A 3LC2O 4HTFA 1ODKA 4FQ7A 5LA6B 2WQ7A 4CKYA 3JV7A 1CSEE 1DDGA 2ZRPA 4Z53A 5BRAA 2HK6A 2WMDA 1IZ9A 1OLUB 1WV0A 5ECDA 4DEYA 1WU8A 4MHTA 3BGIA 1F6BA 1FYVA 1U8XX 2PX8A 5E38A 5EIXA 4D3YA 3K70D 3QOYA 5JFTA 1Y7LA 3ZBTA 2NQ8A 2YOHA 1SCDA 1U6JA 3DWGA 4RDCA 4BLVA 4X1IB 3OZTA 3AM5A 2XKAA 2DXIA 1CKEA 4H6XA 1MB0A 2E4YA 3NQ41 2ZJFA 1ULSA 4OBEA 4NXMB 1GYRA 2E1PA 3NIBA 4I5FA 4PLYA 4F0JA 3Q8MA 2EBFX 3FGOA 3N8NA 4BFYA 1F7VA 2Q5JA 2WHQA 3K70C 5A9SA 1P7VA 2QE6A 1UPXA 5JMWA 4X62B 1CRPA 1C8LA 2IYUA 4KQCA 3S3TA 5TT0A 3W78A 4I6EA 1V1MA 1M1NB 2HL6A 1R0RE 1G64A 2FN9A 3SM9A 4X1YB 5BY2A 1Q6ZA 2OORC 2GAOA 3FPSA 4JVLA 4ENVA 1Q0PA 2HXSA 4L0QA 1X7YA 2QVCA 4RH3A 4BNLA 4BNDA 5EJ9A 5FWYA 1NI5A 2C98A 1S8AA 3AB8A 4Z4GA 4HP8A 1LDNA 2XDYA 2W2TA 2H3EA 3D0OA 3ILSA 2WV9A 3CX4A 3LDHA 1P2UA 2MHCA 3HJGA 1ZY2A 2BR4A 1O5OA 2ZYIA 3PA8A 5LYYA 3S2YA 3UJPA 3ZBPA 4D6YA 2E4UA 3RUHA 4KR6A 3NHUA 1BXGA 1UEXC 2BEKA 3K0AA 3ZHUA 4D9EA 4YAEA 4OJYA 4FHGA 3GK3A 4K9KA 1D1SA 2FZVA 2HWYA 4XZ3A 1LA2A 3MWJA 1U0OC 3B5EA 3V1NA 2D00A 4WN9A 1JLLB 3NT5A 4OQMA 2OKCA 2OOKA 4GM1A 1T43A 2ZE5A 3OFJA 4I81A 4FFRA 4IH1A 4O4LA 2OHXA 3Q3EA 5TPWA 2ZAIA 1AGXA 2JFUA 4DJAA 1BWSA 5CFRA 5DNUA 5ADHA 1XDDA 2XVAA 4DV2B 2AJLI 2PKWA 4C4TA 3IAM6 2OCIA 4PXAA 1VYTA 3PJEA 4MICA 5DCWA 5DNVA 4RSRA 2KW5A 1B00A 2G9RA 5A9SB 1V8OA 1NHGA 1ZKMA 4YMVA 1IXYA 2B9VA 3IPXA 5CLIA 1A9SA 1KMQA 1LS1A 1NVKA 3H2BA 3IKMB 3NGMA 5EUQB 3LDAA 4LMRA 1V4BA 4HFRA 1DE0A 2XKBA 1GGNA 1OBFO 1IZYA 3GJ0A 3I9JA 2HQBA 3EHDA 3K16A 4MVJH 2D0IA 3JYOA 1G21E 5CVVA 3SP1A 2HEGA 4YP1A 1MR3F 2OP1A 4S1WA 4Y2PA 3OA2A 5PGMA 3UH0A 1CEQA 3AOEA 3C3CA 3EGIA 3GRUA 4IS3A 5FB3A 1ZIXA 3VPGA 2B4QA 3HDQA 5JJIA 4J7UA 4OUKX 2D2IA 4PR3A 4J0HA 3WP0A 1LZKA 2VJKA 3BA1A 2LVBA 2NO1A 1PK8A 2VAPA 3ESXA 3HFGA 3IJEB 1DBQA 3RJZA 4FTWA 3HVHA 1KO5A 5B2EA 4OBWA 3ZV4A 2BTEA 3TTVA 5MF6A 1KC3A 4KN9S 1ZMRA 4KXWA 2EJWA 4WK0B 3VO1A 1G7SA 1UMCA 1E2MA 3H8WA 4RZXA 2NU8B 4KQMA 2YWEA 4MVJD 1N0WA 1GUYA 3RS3A 4NR0A 3TQQA 5AJWA 1YR8A 3KUCA 1KHTA 1POWA 3RBZA 5KTOA 3SVTA 1YGPA 3OD1A 4NCNA 1FX1A 2EF0A 4TXHA 3KFVA 3RODA 4B2LA 5J43A 1KAQA 3A6JA 1TKAA 3O75A 3HI6A 5DM2A 5FBKA 1JH8A 2WP0A 4U39A 4M83A 3T34A 3E2MA 3G02A 1PFGA 3ADOA 3PRJA 1QR6A 1SKBA 2RD2A 4RKYA 3GJ6A 1MW9X 4JEUA 3N2ZB 4AQDA 4H0CA 1UAGA 4YAFA 3T5MA 4DPMA 2HA7A 5IAOA 2DH5A 2PLNA 3EQ6A 4XFJA 5DN9A 1KYWA 1PJSA 1VP9A 2O3RA 5DDIP 4FDMA 1USKA 1P2DA 1X1TA 2ZJ4A 3L0BA 4LCBA 2XGMA 5ALXA 1DEOA 4KMMA 2JA2A 2NXWA 3V3TA 3MT7A 4GE0A 4L7VA 4JLUA 4EDFA 4DDWA 2DJ5A 4EVQA 4NBNA 3B2NA 2R7MA 2PWPA 5D5PA 1UAYA 1NF8A 1QHSA 4JVOA 4BKRA 1DAOA 4YAWA 3KZ1E 4GP9A 2J3EA 1FFHA 2ZWIA 2NPIA 4JUCA 3QFHA 4PYMA 5HZKA 3IRVA 3W4IA 1JS1X 1SC6A 1MENA 2CY0A 2IYZA 3G88A 2CLMB 4TOIA 3RLIA 4ND8B 1JMVA 7MHTA 1HE8B 3CVOA 5I7HA 4AKHA 2E2WA 3IQEA 2GAJA 4NLLA 4X85A 4CFSA 4Z1OA 2VH1A 4Z1MA 2ERXA 5LXTA 2PH5A 4NV0A 2Q2VA 4OKNA 3OA0A 2Z3WA 3OQIB 4PZEA 3AG6A 2ILVA 1XEFA 3MINA 2R48A 1G20A 4KPUA 2RBEA 4MGKR 5AJYA 2FPWA 2G4CA 5EWJA 2OPHA 4DOMA 2WWXA 3FZQA 4G8DA 3VHXB 3RAPR 1NAIA 1SEPA 3I6MA 1I1OA 2BEJA 1I5RA 2PQMA 4EUEA 4FX2A 4KBYA 3KB8A 1QZZA 3DC7A 4HNQA 1O95D 4BLPA 4E21A 1ZJ5A 2WIFA 2YXEA 4PC6A 5EJEA 4ZI5A 2HFKA 1L5GB 2PGAA 4D3XA 1NBMD 1O97C 3A31A 4LNHA 5F77A 4CLRB 4PZCA 3GQBB 3KJHA 5B64A 2NT4A 4X66B 1F2UA 3DTTA 3HA2A 3QFFA 1MMFB 3NTQA 1KQGA 1AXEA 2D1RA 1DO8A 4GM0A 5CUQA 5EJ6A 1PVOA 1VSBA 1D1QA 4HL6A 3TLYA 4H7FA 5M2QA 2QBYB 2XUAA 4MROA 3ZDBA 2DF8A 2BFAA 2GUGA 2J48A 4IG9A 1E18A 4XWGA 1KSHA 3D7RA 4Q4JB 1NQXA 4J43A 3UC5A 1EG2A 3ZWMA 1WPXA 3GUZA 4OUDA 1N6HA 2I76A 1MX5A 2R7AA 1SA0B 5T4BA 3W4KA 1FYFA 4R2HA 1ZH0A 3F96A 5KQGA 1L4LA 2HRDA 4WLOA 1OTXA 2IIPA 2ODWA 3EMDA 3A1VA 4WJZA 4CV3A 3ND7A 3GLHB 3EZNA 4MJLA 4CFZA 3PNMA 3O1LA 4URZR 5FUXA 3L1JA 1YZ3A 4A8JC 1AQLA 1TVEA 1FRVA 1PAUA 1V7ZA 3H9BA 2CDBA 4LE1A 4X60A 3ZDYB 5EIHA 3MVEA 1KFKB 1VLHA 2HA3A 3BRCA 3QW4B 4WNCA 5CEEA 4BEBA 1XZGA 2QAGC 3B3JA 1KI3A 1KYZA 5G0WA 1GA1A 4L5CA 4RF4A 2I91A 5MFZA 1E9SA 2CNNA 4R71A 1S3FA 3OCYA 3RUEA 4F4IA 1KHHA 2DCUA 1KO8A 2JKZA 4KWHA 1SXJC 2BJWA 1C9YA 1V6SA 1X39A 4O4JA 4FZ5A 4GXTA 2QXUA 4ZU6X 5ADWA 2Q1SA 2O54A 2PZMA 2QRLA 3SIXA 4JEHA 1M2VA 1ZIPA 4YJ3A 4XYLA 1YJBA 4IUYA 4IZHA 2JJ2A 3VR1A 1YF3A 1PDOA 4KDEA 4MUIA 5TGZA 4ECAA 5LZ5A 4B6EA 1N2IA 1RZUA 1GN8A 4YJ3B 4C5BA 1M9NA 2JH8A 2VPXA 2I78A 2B4KA 3AUFA 4PX3A 3ORYA 4YPVA 2BCEA 1VIAA 1DC6A 1CUJA 2N75A 2OV3A 4IAOA 1NSYA 4N18A 4OKIA 3SC4A 1QIJA 4EITA 4F91B 1H2AS 4LZPA 3I92A 3ISTA 4ZDWA 1C3OA 1GRCA 1FFSA 2YN0A 3DAGA 5AKIA 1J33A 2PQ0A 3RU9A 2VDOB 4Y6SA 1PWHA 1TAUA 4GYWA 1B0PA 2DPXA 3X3HA 3F1LA 4IIBA 4ZYVA 1NZDA 5FAKA 4AUEA 3ZWDA 1L3BA 3ZWKA 3FHCB 2Q5FA 3ETLA 3QOFA 5H9VA 3C3EA 4DV4B 1GG8A 3FNHA 3MWEB 4G09A 4BLQA 2C29D 2VT3A 1XNJA 2DT5A 1DHTA 4GOXA 4HN4B 2XD4A 4OYHA 3QVOA 1R0KA 5AK0A 2P3OA 3B7WA 4WXPA 1JAXA 1YBMA 5EPEA 1JFTA 3AEKA 3E8MA 3GLHA 5AXDA 1NXOA 2GBIA 1LU9A 2Z3VA 3WK6A 1VJGA 2BFEA 2ZWMA 3B9QA 3ECSA 4HLDA 1BDHA 3IKVA 2HV9A 4RD4A 2AV6A 3U4CA 3AG5A 2B92A 3HSYA 3L6UA 4KMOA 4I1OA 4AC9A 1EBUA 2WZQA 3GCGA 4BKPA 3O8OA 3PNBA 1ZVJA 3EGXB 3N0VA 5SZJA 4DT1B 5K8TA 4HYQA 4MUYA 1MA3A 4QUDA 1C0IA 2B69A 3BMXA 4EAAA 3DVSX 1G19A 2QGFA 2Y1KA 3P2MA 2NUPA 2XYGA 1G8JA 3AV0B 3DF7A 5CX1B 4CCYB 3KQQA 3RRNA 5FYDA 3SIRA 3GNLA 2P1ZA 3AEQB 3VAZA 2P4SA 1R9JA 3IO3A 1PL0A 1OFUX 1GT6A 3NM6B 3VKFA 1T15A 5K8CA 4F3YA 1Q1ZA 3DBLB 3SHTA 5K0FA 2F43A 2BSXA 1MTOA 2PXCA 4EG3A 2F4NA 4F92B 3RIGA 3MUOA 1XRLA 3GLUA 3K9WA 5HF5A 3LT0A 5CXUA 3MEQA 2WEKA 1W2GA 4BMNA 3TSZA 4CM6A 1LC3A 3NYIA 4ZZIA 1VRWA 3EXFB 3Q72A 1A7UA 3G2IA 5IFLA 1FW6A 4ACBA 2L2QA 5HKOA 2VEDA 4DPLA 4MVJA 1GG2A 1WZ2A 1CEXA 4C7XA 4JYMA 2RKOA 1Q7EA 5F7XA 1EFVA 2NSYA 2DQKA 2J5BA 3D7LA 3UAOA 3T94A 2WTBA 2DR2A 4EHKA 1TZJA 4EY8A 5AVRA 1JE0A 4EY6A 3EY4A 3EX7C 2W2OA 5DN6A 2P78A 1DG9A 1C7QA 3PR3A 2A3RA 3UH1A 2CUTA 3CZAA 2AKEA 1K2WA 4L6IA 2VAWA 2I3AA 3CB4A 1ZINA 2XV1A 1N2GA 3CT6A 7AT1A 2H0QA 2QJWA 3H1AA 3TGPA 1CJCA 4DIFA 1JA1A 5EE1A 4YI5A 2YJZA 4FUTA 1RRVA 4RHYA 5ERYA 4WSOA 1BQEA 3K0AB 4AXXA 1QZUA 1ICEA 2IVFA 2VJMB 3ESDA 3Q85A 4M1WA 5TB5A 4BHTA 4HNUA 2X2EA 1B14A 4Q12A 4UBMA 3OZAA 1F0KA 1GZ6A 2WYUA 1G60A 3HYCA 5B3LA 3VR0A 1U1FA 3I5XA 5FTNA 3JQ8A 3VH3A 2NQ2C 4RDXA 5JTTA 3IBYA 3HCOA 1T8SA 3NOVA 1OFGA 1RWOA 3K6JA 2YJ6A 4IMPA 4Y1RA 2OA0A 3WL8A 5EZQA 4RZSA 1UL1X 2J4CA 2F17A 3SNHA 4Q4DA 4IDCA 5F7OA 1RAFA 5FPHA 4AAYA 4LXYA 4L1KA 1XI2A 2HDNB 1VA4A 4ZI7F 5K4HA 4LJAA 2C5FA 2EDCA 1D7AA 2WILA 2H63A 4K03A 3DZKA 3I1FA 1FDWA 4BQSA 3U48A 2MSEB 4GO1A 4Y1GA 1NJ8A 4FYWA 4P31A 5EHNA 1IOVA 2QYTA 5FOTA 4ZVNA 3BTSA 3N0RA 3H4TA 3QEKA 4DRXA 1G5HA 3R44A 1WSWA 4JBYA 3ZIDA 3R1IA 2BDTA 4J9VA 5AVJA 3H5OA 4OLAA 5I47A 2H1IA 1CJVC 4QX6A 5LP6C 4U7FA 1LVHA 4JVSB 2CE7A 1R5NA 1JG2A 3BGVA 4POAA 4YC7A 5FO0A 4A73A 3ZCRA 4R6WA 1IY2A 2YHBA 4I0WB 4GXRA 4HX5A 1AKTA 3TLMA 2F1OA 1RPNA 1UMDB 2HBZA 2YXBA 3CUUA 3H5VA 1EQ2A 3OZEA 3U7FB 2PUBA 4Q7MB 3INYA 5LBIA 4HEHA 4LI0A 1EUDB 3PC2A 4A2CA 3SI7A 3NKVA 1WD5A 2O05A 1W1IA 4BX8A 4LF5B 4BIMA 1JG3A 1G8MA 3MMXA 2ZVPX 3V3KA 4G07A 6CHYA 3ECCA 3QWBA 2IYTA 1QCCA 5IJXA 3QPWA 3TX6A 4KLNA 4BTLA 1S7CA 1GR1A 4EVRA 3IB3A 2BFCA 4BBAA 3WGZA 4TYWA 1KIAA 1J9GA 3VZRA 2FPIB 5DW0A 3SLRA 2O6HA 4MS4A 1UDCA 1E1YA 1W6UA 2OHGA 4JEMA 4QICA 5AW5A 4CGYA 2GZ1A 2WWTA 5IT4A 3OJCA 1S2MA 2RONA 1FP7A 2V7PA 3F2IA 3R20A 4UFOA 1R6DA 4HTAA 3DQQA 4IFIA 3AONB 4K6CA 4KYIB 5TQ2B 1E3IA 4BS9A 4CG2A 2GERA 5B58C 2J3HA 5CD1A 3HPQA 1R8XA 1VL6A 2QG6A 1XZIA 4CHTA 4ZXPA 3P9QA 2B83A 4MIYA 5DBGA 2ZATA 2R7LA 4P3NA 4KUGA 2HDOA 3WWYA 3I6ZA 5I7WA 4NXNB 2NZXA 1XDBA 5THQA 1P7YA 1H2YA 5F2EA 1MIHA 2WUVA 1J90A 2YJTD 3H84A 5L7YA 3H05A 1AMOA 4TL7A 3BDIA 4HS4A 2XH8A 4XW2A 4NG4A 5DWDA 3CW8X 2Z43A 3G7NA 3ASZA 2BL4A 4NPCA 5C18A 5A5DA 4B9EA 4B80A 5PNTA 1GVHA 3PJDA 2E0IA 1T5TA 2CHQA 4LWOA 2YUTA 1V7PC 4JL6A 4O4IB 4P4GA 2ZSAA 1HMPA 1W9MA 2WP8J 1NUTA 3EDYA 5AOCA 2XSZD 3PENA 2ZB3A 4ZT6A 2OLKA 4EEZA 2YOGA 5IT5A 2FEPA 2ZJZA 1YH3A 4MEBA 3WMRA 4ZAXA 2QMOA 2FOLA 2BEWB 3RJ9A 2VA8A 2YJ4A 3L8DA 5J4KA 3CLTC 4E30A 2P2NA 4BIIA 2B9EA 3HJRA 3CE9A 1BNCA 3A4NA 3ZY4A 1Y8AA 2X42A 4ZOLA 1QF6A 2B0JA 5IW8A 4UM7A 1HG0A 5DCUA 1CIVA 3MTGA 2WYIA 4TYPA 3Q98A 1HM5A 3VR2D 4A0RA 2CV0A 2O8VA 3QOXA 4D2IA 1RLTA