3L89M

Human adenovirus type 21 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
126
structure length
126
Chain Sequence
b'CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Structure of adenovirus type 21 knob in complex with CD46 reveals key differences in receptor contacts among species B adenoviruses.
pubmed doi rcsb
source organism Human adenovirus 21
molecule tags Viral protein/protein binding
total genus 18
structure length 126
sequence length 126
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3l89M02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3l89M01
1E8BA 1CKLA 1OJWA 1TPNA 4F4OC 2RLPA 2UWNA 5HYPA 4CSYA 3NFPI 3ZD1A 1VVCA 2RLQA 1OK2A 4LOSA 1E88A 1UOTP 2QY0A 2EC3A 1OK1A 3MQLA 1Q3XA 1VVDA 2RKZA 2XRDA 2B5ID 1C1ZA 1H04P 2O39C 3L89M 4MUCA 5I0QB 1ZJKA 3TVJA 1MD8A 2EHFA 1OJYA 1TPGA 2BZMA 2XWJI 4LOTA 3R62A 3KXVA 4FXGG 3KZJA 1TPMA 3EJHA 1HCCA 4DJZA 2IZ3A 2YRAA 3O8EB 3SW0X 1HFIA 5FO8C 5HZPB 1GHQB 2G7IA 4J38B 1G4GA 4K12A 1H03P 2XRBA 3ZRZA 5HYTB 1PPQA 3IX0A 2RKYA 2KRIA 1OK9A 4AYDA 4A5WB 2CG6A 3INBC 4ZH1D 2CG7A 1U5MA 2CKUA 1SRZA 2JRAA 2V8EA 3ERBA 4B2SA 1Z92B 2XWBF 1GPZA 2LOJA 1GKNA 1QUBA 2JGXA 1G4FA 4PZ5A 1QGBA 1ELVA 1SS2A 3T5OA 4YNXA 4KKDA 2JGWA 3IU3I 4AYEA 4IGDA 2A55A 2W80A 4C16A 2IZ4A 3CALA 1H2PP 2WIIC 3GXEA 4ONTD 5HYUB 1OK3A 1NWVA 2RL0A 1O9AA 4WJG2 3OEDC 2YBYA 4JHSA 2KMSA 2MCZA 1E5GA 1GKGA 1LY2A 2MCYA 3OP8A 3ZD2A 1H2QP 1OJVA 1HFHA 4AYMA 1MD7A 4B2RA 3RJ3D 2W81A 5JPMG 1FBRA 4AYIA 3M7PA 1QO6A 2ERJA 2XQWC 3OXUD 3GOVA
chains in the Genus database with same CATH superfamily
1E8BA 1CKLA 1OJWA 1TPNA 4F4OC 2RLPA 2UWNA 1RLHA 5HYPA 4CSYA 3NFPI 3ZD1A 1VVCA 2RLQA 1OK2A 4LOSA 1E88A 1UOTP 2QY0A 3K3TA 2EC3A 2Y8SA 1OK1A 3MQLA 1Q3XA 1VVDA 2RKZA 2XRDA 2B5ID 3FGRA 1C1ZA 3CI0J 3FGTA 2ZYCA 1H04P 2O39C 3L89M 4MUCA 5I0QB 1ZJKA 3TVJA 1MD8A 5DN5A 2EHFA 1OJYA 1TPGA 2BZMA 2XWJI 4LOTA 3WSYA 3R62A 3KXVA 4FXGG 3KZJA 4YIZA 1TPMA 3EJHA 1HCCA 4DJZA 2IZ3A 2YRAA 3O8EB 3SW0X 1HFIA 5FO8C 4PO7A 5HZPB 1GHQB 2G7IA 4J38B 1G4GA 4K12A 1H03P 2XRBA 3ZRZA 2Y8RA 5HYTB 1PPQA 3IX0A 2RKYA 2KRIA 1OK9A 4AYDA 4A5WB 3WSXA 2CG6A 3INBC 3F6KA 2CG7A 4ZH1D 1U5MA 2CKUA 1SRZA 2JRAA 2V8EA 3ERBA 4B2SA 1Z92B 4BWCA 2XWBF 1GPZA 3ZLDA 2LOJA 1GKNA 1QUBA 2JGXA 1G4FA 4PZ5A 1QGBA 1ELVA 4MSLA 1SS2A 3T5OA 4YNXA 4KKDA 2JGWA 3IU3I 4AYEA 4IGDA 2A55A 2W80A 2Y8TA 4C16A 2IZ4A 3CALA 1H2PP 2WIIC 3GXEA 4ONTD 3ZLEA 3VWOA 1OK3A 5HYUB 1NWVA 2RL0A 1O9AA 4WJG2 3OEDC 2YBYA 4JHSA 2KMSA 2MCZA 1E5GA 1GKGA 1LY2A 2MCYA 3OP8A 3ZD2A 1H2QP 1OJVA 1HFHA 4AYMA 2I2LA 1MD7A 4B2RA 3RJ3D 2W81A 5JPMG 3NJAA 4APLA 1FBRA 4AYIA 3M7PA 5DN4A 2X2ZA 1QO6A 4N7EA 2ERJA 2XQWC 3OXUD 3GOVA
chains in the Genus database with same CATH topology
1E8BA 1CKLA 1OJWA 1TPNA 4F4OC 2RLPA 2UWNA 5HYPA 4CSYA 3NFPI 3ZD1A 1VVCA 2RLQA 1OK2A 4LOSA 1E88A 1UOTP 2QY0A 2EC3A 1OK1A 3MQLA 1Q3XA 1VVDA 2RKZA 2XRDA 2B5ID 1C1ZA 1H04P 2O39C 3L89M 4MUCA 5I0QB 1ZJKA 3TVJA 1MD8A 2EHFA 1OJYA 1TPGA 2BZMA 2XWJI 4LOTA 3R62A 3KXVA 4FXGG 3KZJA 1TPMA 3EJHA 1HCCA 4DJZA 2IZ3A 2YRAA 3O8EB 3SW0X 1HFIA 5FO8C 5HZPB 1GHQB 2G7IA 4J38B 1G4GA 4K12A 1H03P 2XRBA 3ZRZA 5HYTB 1PPQA 3IX0A 2RKYA 2KRIA 1OK9A 4AYDA 4A5WB 2CG6A 3INBC 4ZH1D 2CG7A 1U5MA 2CKUA 1SRZA 2JRAA 2V8EA 3ERBA 4B2SA 1Z92B 2XWBF 1GPZA 2LOJA 1GKNA 1QUBA 2JGXA 1G4FA 4PZ5A 1QGBA 1ELVA 1SS2A 3T5OA 4YNXA 4KKDA 2JGWA 3IU3I 4AYEA 4IGDA 2A55A 2W80A 4C16A 2IZ4A 3CALA 1H2PP 2WIIC 3GXEA 4ONTD 5HYUB 1OK3A 1NWVA 2RL0A 1O9AA 4WJG2 3OEDC 2YBYA 4JHSA 2KMSA 2MCZA 1E5GA 1GKGA 1LY2A 2MCYA 3OP8A 3ZD2A 1H2QP 1OJVA 1HFHA 4AYMA 1MD7A 4B2RA 3RJ3D 2W81A 5JPMG 1FBRA 4AYIA 3M7PA 1QO6A 2ERJA 2XQWC 3OXUD 3GOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8B A;  1CKL A;  1OJW A;  1TPN A;  4F4O C;  2RLP A;  2UWN A;  5HYP A;  4CSY A;  3NFP I;  3ZD1 A;  1VVC A;  2RLQ A;  1OK2 A;  4LOS A;  1E88 A;  1UOT P;  2QY0 A;  2EC3 A;  1OK1 A;  3MQL A;  1Q3X A;  1VVD A;  2RKZ A;  2XRD A;  2B5I D;  1C1Z A;  1H04 P;  2O39 C;  3L89 M;  4MUC A;  5I0Q B;  1ZJK A;  3TVJ A;  1MD8 A;  2EHF A;  1OJY A;  1TPG A;  2BZM A;  2XWJ I;  4LOT A;  3R62 A;  3KXV A;  4FXG G;  3KZJ A;  1TPM A;  3EJH A;  1HCC A;  4DJZ A;  2IZ3 A;  2YRA A;  3O8E B;  3SW0 X;  1HFI A;  5FO8 C;  5HZP B;  1GHQ B;  2G7I A;  4J38 B;  1G4G A;  4K12 A;  1H03 P;  2XRB A;  3ZRZ A;  5HYT B;  1PPQ A;  3IX0 A;  2RKY A;  2KRI A;  1OK9 A;  4AYD A;  4A5W B;  2CG6 A;  3INB C;  4ZH1 D;  2CG7 A;  1U5M A;  2CKU A;  1SRZ A;  2JRA A;  2V8E A;  3ERB A;  4B2S A;  1Z92 B;  2XWB F;  1GPZ A;  2LOJ A;  1GKN A;  1QUB A;  2JGX A;  1G4F A;  4PZ5 A;  1QGB A;  1ELV A;  1SS2 A;  3T5O A;  4YNX A;  4KKD A;  2JGW A;  3IU3 I;  4AYE A;  4IGD A;  2A55 A;  2W80 A;  4C16 A;  2IZ4 A;  3CAL A;  1H2P P;  2WII C;  3GXE A;  4ONT D;  5HYU B;  1OK3 A;  1NWV A;  2RL0 A;  1O9A A;  4WJG 2;  3OED C;  2YBY A;  4JHS A;  2KMS A;  2MCZ A;  1E5G A;  1GKG A;  1LY2 A;  2MCY A;  3OP8 A;  3ZD2 A;  1H2Q P;  1OJV A;  1HFH A;  4AYM A;  1MD7 A;  4B2R A;  3RJ3 D;  2W81 A;  5JPM G;  1FBR A;  4AYI A;  3M7P A;  1QO6 A;  2ERJ A;  2XQW C;  3OXU D;  3GOV A; 
#chains in the Genus database with same CATH topology
 1E8B A;  1CKL A;  1OJW A;  1TPN A;  4F4O C;  2RLP A;  2UWN A;  1RLH A;  5HYP A;  4CSY A;  3NFP I;  3ZD1 A;  1VVC A;  2RLQ A;  1OK2 A;  4LOS A;  1E88 A;  1UOT P;  2QY0 A;  3K3T A;  2EC3 A;  2Y8S A;  1OK1 A;  3MQL A;  1Q3X A;  1VVD A;  2RKZ A;  2XRD A;  2B5I D;  3FGR A;  1C1Z A;  3CI0 J;  3FGT A;  2ZYC A;  1H04 P;  2O39 C;  3L89 M;  4MUC A;  5I0Q B;  1ZJK A;  3TVJ A;  1MD8 A;  5DN5 A;  2EHF A;  1OJY A;  1TPG A;  2BZM A;  2XWJ I;  4LOT A;  3WSY A;  3R62 A;  3KXV A;  4FXG G;  3KZJ A;  4YIZ A;  1TPM A;  3EJH A;  1HCC A;  4DJZ A;  2IZ3 A;  2YRA A;  3O8E B;  3SW0 X;  1HFI A;  5FO8 C;  4PO7 A;  5HZP B;  1GHQ B;  2G7I A;  4J38 B;  1G4G A;  4K12 A;  1H03 P;  2XRB A;  3ZRZ A;  2Y8R A;  5HYT B;  1PPQ A;  3IX0 A;  2RKY A;  2KRI A;  1OK9 A;  4AYD A;  4A5W B;  3WSX A;  2CG6 A;  3INB C;  3F6K A;  2CG7 A;  4ZH1 D;  1U5M A;  2CKU A;  1SRZ A;  2JRA A;  2V8E A;  3ERB A;  4B2S A;  1Z92 B;  4BWC A;  2XWB F;  1GPZ A;  3ZLD A;  2LOJ A;  1GKN A;  1QUB A;  2JGX A;  1G4F A;  4PZ5 A;  1QGB A;  1ELV A;  4MSL A;  1SS2 A;  3T5O A;  4YNX A;  4KKD A;  2JGW A;  3IU3 I;  4AYE A;  4IGD A;  2A55 A;  2W80 A;  2Y8T A;  4C16 A;  2IZ4 A;  3CAL A;  1H2P P;  2WII C;  3GXE A;  4ONT D;  3ZLE A;  3VWO A;  1OK3 A;  5HYU B;  1NWV A;  2RL0 A;  1O9A A;  4WJG 2;  3OED C;  2YBY A;  4JHS A;  2KMS A;  2MCZ A;  1E5G A;  1GKG A;  1LY2 A;  2MCY A;  3OP8 A;  3ZD2 A;  1H2Q P;  1OJV A;  1HFH A;  4AYM A;  2I2L A;  1MD7 A;  4B2R A;  3RJ3 D;  2W81 A;  5JPM G;  3NJA A;  4APL A;  1FBR A;  4AYI A;  3M7P A;  5DN4 A;  2X2Z A;  1QO6 A;  4N7E A;  2ERJ A;  2XQW C;  3OXU D;  3GOV A; 
#chains in the Genus database with same CATH homology
 1E8B A;  1CKL A;  1OJW A;  1TPN A;  4F4O C;  2RLP A;  2UWN A;  5HYP A;  4CSY A;  3NFP I;  3ZD1 A;  1VVC A;  2RLQ A;  1OK2 A;  4LOS A;  1E88 A;  1UOT P;  2QY0 A;  2EC3 A;  1OK1 A;  3MQL A;  1Q3X A;  1VVD A;  2RKZ A;  2XRD A;  2B5I D;  1C1Z A;  1H04 P;  2O39 C;  3L89 M;  4MUC A;  5I0Q B;  1ZJK A;  3TVJ A;  1MD8 A;  2EHF A;  1OJY A;  1TPG A;  2BZM A;  2XWJ I;  4LOT A;  3R62 A;  3KXV A;  4FXG G;  3KZJ A;  1TPM A;  3EJH A;  1HCC A;  4DJZ A;  2IZ3 A;  2YRA A;  3O8E B;  3SW0 X;  1HFI A;  5FO8 C;  5HZP B;  1GHQ B;  2G7I A;  4J38 B;  1G4G A;  4K12 A;  1H03 P;  2XRB A;  3ZRZ A;  5HYT B;  1PPQ A;  3IX0 A;  2RKY A;  2KRI A;  1OK9 A;  4AYD A;  4A5W B;  2CG6 A;  3INB C;  4ZH1 D;  2CG7 A;  1U5M A;  2CKU A;  1SRZ A;  2JRA A;  2V8E A;  3ERB A;  4B2S A;  1Z92 B;  2XWB F;  1GPZ A;  2LOJ A;  1GKN A;  1QUB A;  2JGX A;  1G4F A;  4PZ5 A;  1QGB A;  1ELV A;  1SS2 A;  3T5O A;  4YNX A;  4KKD A;  2JGW A;  3IU3 I;  4AYE A;  4IGD A;  2A55 A;  2W80 A;  4C16 A;  2IZ4 A;  3CAL A;  1H2P P;  2WII C;  3GXE A;  4ONT D;  5HYU B;  1OK3 A;  1NWV A;  2RL0 A;  1O9A A;  4WJG 2;  3OED C;  2YBY A;  4JHS A;  2KMS A;  2MCZ A;  1E5G A;  1GKG A;  1LY2 A;  2MCY A;  3OP8 A;  3ZD2 A;  1H2Q P;  1OJV A;  1HFH A;  4AYM A;  1MD7 A;  4B2R A;  3RJ3 D;  2W81 A;  5JPM G;  1FBR A;  4AYI A;  3M7P A;  1QO6 A;  2ERJ A;  2XQW C;  3OXU D;  3GOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...