3L89M

Human adenovirus type 21 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
126
structure length
126
Chain Sequence
CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Structure of adenovirus type 21 knob in complex with CD46 reveals key differences in receptor contacts among species B adenoviruses.
pubmed doi rcsb
source organism Human adenovirus 21
molecule tags Viral protein/protein binding
total genus 18
structure length 126
sequence length 126
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2009-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3l89M02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3l89M01
3ERBA 1OK1A 3GOVA 2RKYA 1OJYA 4WJG2 1TPMA 1G4GA 1OJWA 2EHFA 1H03P 2O39C 2G7IA 3L89M 1LY2A 4ONTD 2JRAA 3IX0A 1E88A 3NFPI 5HYUB 4AYDA 1OK2A 1OK9A 2A55A 2BZMA 1TPGA 1MD7A 3GXEA 4AYMA 2ERJA 3SW0X 4ZH1D 4B2RA 2KRIA 1TPNA 2JGXA 4C16A 1ELVA 2XRDA 2XRBA 1VVDA 4AYIA 5I0QB 1ZJKA 1O9AA 3MQLA 1GKNA 4K12A 2CKUA 1QGBA 1CKLA 3CALA 3EJHA 3OXUD 3O8EB 5HYPA 1HFIA 2XWBF 3INBC 2IZ3A 1MD8A 3RJ3D 1Q3XA 2V8EA 1UOTP 2EC3A 1H2QP 4KKDA 2JGWA 3OEDC 3KZJA 2MCZA 2UWNA 1HFHA 1G4FA 3TVJA 2YRAA 2RL0A 2IZ4A 1GHQB 2XWJI 1GKGA 1OK3A 1PPQA 4YNXA 3ZRZA 4B2SA 1U5MA 2CG7A 3KXVA 1OJVA 2B5ID 2CG6A 3T5OA 2W80A 4A5WB 4CSYA 4JHSA 4F4OC 3R62A 2RLPA 1SS2A 2MCYA 2LOJA 1QUBA 1FBRA 3OP8A 4J38B 5HZPB 1NWVA 1H2PP 4IGDA 5FO8C 1E5GA 4PZ5A 4LOSA 4DJZA 4FXGG 3ZD2A 3IU3I 1H04P 2RLQA 5JPMG 3ZD1A 2KMSA 1GPZA 2QY0A 4AYEA 4MUCA 1QO6A 2WIIC 1C1ZA 2RKZA 1E8BA 5HYTB 2YBYA 1HCCA 1SRZA 4LOTA 1VVCA 3M7PA 1Z92B 2W81A 2XQWC
chains in the Genus database with same CATH superfamily
3ERBA 1OK1A 3GOVA 2RKYA 1OJYA 4WJG2 1TPMA 1G4GA 1OJWA 2EHFA 3WSXA 1H03P 2O39C 3CI0J 2G7IA 3L89M 1LY2A 4PO7A 4ONTD 2JRAA 3IX0A 1E88A 3NFPI 3ZLEA 5HYUB 4BWCA 2Y8RA 4AYDA 1OK2A 1OK9A 2A55A 2BZMA 3FGRA 2Y8TA 1TPGA 1MD7A 3GXEA 2Y8SA 3NJAA 4AYMA 2ERJA 3SW0X 3WSYA 4N7EA 4ZH1D 4B2RA 2KRIA 1TPNA 2I2LA 2JGXA 4YIZA 4C16A 1ELVA 2XRDA 2XRBA 1VVDA 4AYIA 5I0QB 1ZJKA 1O9AA 3MQLA 1GKNA 4K12A 2CKUA 3F6KA 1QGBA 1CKLA 3CALA 3EJHA 3OXUD 3O8EB 5HYPA 3FGTA 1HFIA 2XWBF 3INBC 2IZ3A 1MD8A 3RJ3D 1Q3XA 2X2ZA 2V8EA 1UOTP 2EC3A 1H2QP 4KKDA 2JGWA 5DN5A 3OEDC 3KZJA 2MCZA 2UWNA 1RLHA 1HFHA 1G4FA 3TVJA 2YRAA 2RL0A 2IZ4A 1GHQB 2XWJI 1GKGA 1OK3A 1PPQA 4YNXA 3ZRZA 4B2SA 1U5MA 2CG7A 3KXVA 1OJVA 2B5ID 2CG6A 3T5OA 2W80A 4A5WB 4CSYA 4JHSA 4F4OC 3R62A 2RLPA 2ZYCA 1SS2A 2MCYA 2LOJA 1QUBA 1FBRA 3OP8A 4J38B 5HZPB 3ZLDA 1NWVA 1H2PP 4IGDA 5FO8C 1E5GA 4PZ5A 4LOSA 4APLA 4DJZA 4FXGG 3ZD2A 3IU3I 1H04P 2RLQA 5JPMG 3ZD1A 2KMSA 1GPZA 2QY0A 4AYEA 4MUCA 4MSLA 1QO6A 2WIIC 1C1ZA 2RKZA 1E8BA 3VWOA 2YBYA 1HCCA 5HYTB 3K3TA 1SRZA 4LOTA 1VVCA 3M7PA 5DN4A 1Z92B 2W81A 2XQWC
chains in the Genus database with same CATH topology
3ERBA 1OK1A 3GOVA 2RKYA 1OJYA 4WJG2 1TPMA 1G4GA 1OJWA 2EHFA 1H03P 2O39C 2G7IA 3L89M 1LY2A 4ONTD 2JRAA 3IX0A 1E88A 3NFPI 5HYUB 4AYDA 1OK2A 1OK9A 2A55A 2BZMA 1TPGA 1MD7A 3GXEA 4AYMA 2ERJA 3SW0X 4ZH1D 4B2RA 2KRIA 1TPNA 2JGXA 4C16A 1ELVA 2XRDA 2XRBA 1VVDA 4AYIA 5I0QB 1ZJKA 1O9AA 3MQLA 1GKNA 4K12A 2CKUA 1QGBA 1CKLA 3CALA 3EJHA 3OXUD 3O8EB 5HYPA 1HFIA 2XWBF 3INBC 2IZ3A 1MD8A 3RJ3D 1Q3XA 2V8EA 1UOTP 2EC3A 1H2QP 4KKDA 2JGWA 3OEDC 3KZJA 2MCZA 2UWNA 1HFHA 1G4FA 3TVJA 2YRAA 2RL0A 2IZ4A 1GHQB 2XWJI 1GKGA 1OK3A 1PPQA 4YNXA 3ZRZA 4B2SA 1U5MA 2CG7A 3KXVA 1OJVA 2B5ID 2CG6A 3T5OA 2W80A 4A5WB 4CSYA 4JHSA 4F4OC 3R62A 2RLPA 1SS2A 2MCYA 2LOJA 1QUBA 1FBRA 3OP8A 4J38B 5HZPB 1NWVA 1H2PP 4IGDA 5FO8C 1E5GA 4PZ5A 4LOSA 4DJZA 4FXGG 3ZD2A 3IU3I 1H04P 2RLQA 5JPMG 3ZD1A 2KMSA 1GPZA 2QY0A 4AYEA 4MUCA 1QO6A 2WIIC 1C1ZA 2RKZA 1E8BA 5HYTB 2YBYA 1HCCA 1SRZA 4LOTA 1VVCA 3M7PA 1Z92B 2W81A 2XQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERB A;  1OK1 A;  3GOV A;  2RKY A;  1OJY A;  4WJG 2;  1TPM A;  1G4G A;  1OJW A;  2EHF A;  1H03 P;  2O39 C;  2G7I A;  3L89 M;  1LY2 A;  4ONT D;  2JRA A;  3IX0 A;  1E88 A;  3NFP I;  5HYU B;  4AYD A;  1OK2 A;  1OK9 A;  2A55 A;  2BZM A;  1TPG A;  1MD7 A;  3GXE A;  4AYM A;  2ERJ A;  3SW0 X;  4ZH1 D;  4B2R A;  2KRI A;  1TPN A;  2JGX A;  4C16 A;  1ELV A;  2XRD A;  2XRB A;  1VVD A;  4AYI A;  5I0Q B;  1ZJK A;  1O9A A;  3MQL A;  1GKN A;  4K12 A;  2CKU A;  1QGB A;  1CKL A;  3CAL A;  3EJH A;  3OXU D;  3O8E B;  5HYP A;  1HFI A;  2XWB F;  3INB C;  2IZ3 A;  1MD8 A;  3RJ3 D;  1Q3X A;  2V8E A;  1UOT P;  2EC3 A;  1H2Q P;  4KKD A;  2JGW A;  3OED C;  3KZJ A;  2MCZ A;  2UWN A;  1HFH A;  1G4F A;  3TVJ A;  2YRA A;  2RL0 A;  2IZ4 A;  1GHQ B;  2XWJ I;  1GKG A;  1OK3 A;  1PPQ A;  4YNX A;  3ZRZ A;  4B2S A;  1U5M A;  2CG7 A;  3KXV A;  1OJV A;  2B5I D;  2CG6 A;  3T5O A;  2W80 A;  4A5W B;  4CSY A;  4JHS A;  4F4O C;  3R62 A;  2RLP A;  1SS2 A;  2MCY A;  2LOJ A;  1QUB A;  1FBR A;  3OP8 A;  4J38 B;  5HZP B;  1NWV A;  1H2P P;  4IGD A;  5FO8 C;  1E5G A;  4PZ5 A;  4LOS A;  4DJZ A;  4FXG G;  3ZD2 A;  3IU3 I;  1H04 P;  2RLQ A;  5JPM G;  3ZD1 A;  2KMS A;  1GPZ A;  2QY0 A;  4AYE A;  4MUC A;  1QO6 A;  2WII C;  1C1Z A;  2RKZ A;  1E8B A;  5HYT B;  2YBY A;  1HCC A;  1SRZ A;  4LOT A;  1VVC A;  3M7P A;  1Z92 B;  2W81 A;  2XQW C; 
#chains in the Genus database with same CATH topology
 3ERB A;  1OK1 A;  3GOV A;  2RKY A;  1OJY A;  4WJG 2;  1TPM A;  1G4G A;  1OJW A;  2EHF A;  3WSX A;  1H03 P;  2O39 C;  3CI0 J;  2G7I A;  3L89 M;  1LY2 A;  4PO7 A;  4ONT D;  2JRA A;  3IX0 A;  1E88 A;  3NFP I;  3ZLE A;  5HYU B;  4BWC A;  2Y8R A;  4AYD A;  1OK2 A;  1OK9 A;  2A55 A;  2BZM A;  3FGR A;  2Y8T A;  1TPG A;  1MD7 A;  3GXE A;  2Y8S A;  3NJA A;  4AYM A;  2ERJ A;  3SW0 X;  3WSY A;  4N7E A;  4ZH1 D;  4B2R A;  2KRI A;  1TPN A;  2I2L A;  2JGX A;  4YIZ A;  4C16 A;  1ELV A;  2XRD A;  2XRB A;  1VVD A;  4AYI A;  5I0Q B;  1ZJK A;  1O9A A;  3MQL A;  1GKN A;  4K12 A;  2CKU A;  3F6K A;  1QGB A;  1CKL A;  3CAL A;  3EJH A;  3OXU D;  3O8E B;  5HYP A;  3FGT A;  1HFI A;  2XWB F;  3INB C;  2IZ3 A;  1MD8 A;  3RJ3 D;  1Q3X A;  2X2Z A;  2V8E A;  1UOT P;  2EC3 A;  1H2Q P;  4KKD A;  2JGW A;  5DN5 A;  3OED C;  3KZJ A;  2MCZ A;  2UWN A;  1RLH A;  1HFH A;  1G4F A;  3TVJ A;  2YRA A;  2RL0 A;  2IZ4 A;  1GHQ B;  2XWJ I;  1GKG A;  1OK3 A;  1PPQ A;  4YNX A;  3ZRZ A;  4B2S A;  1U5M A;  2CG7 A;  3KXV A;  1OJV A;  2B5I D;  2CG6 A;  3T5O A;  2W80 A;  4A5W B;  4CSY A;  4JHS A;  4F4O C;  3R62 A;  2RLP A;  2ZYC A;  1SS2 A;  2MCY A;  2LOJ A;  1QUB A;  1FBR A;  3OP8 A;  4J38 B;  5HZP B;  3ZLD A;  1NWV A;  1H2P P;  4IGD A;  5FO8 C;  1E5G A;  4PZ5 A;  4LOS A;  4APL A;  4DJZ A;  4FXG G;  3ZD2 A;  3IU3 I;  1H04 P;  2RLQ A;  5JPM G;  3ZD1 A;  2KMS A;  1GPZ A;  2QY0 A;  4AYE A;  4MUC A;  4MSL A;  1QO6 A;  2WII C;  1C1Z A;  2RKZ A;  1E8B A;  3VWO A;  2YBY A;  1HCC A;  5HYT B;  3K3T A;  1SRZ A;  4LOT A;  1VVC A;  3M7P A;  5DN4 A;  1Z92 B;  2W81 A;  2XQW C; 
#chains in the Genus database with same CATH homology
 3ERB A;  1OK1 A;  3GOV A;  2RKY A;  1OJY A;  4WJG 2;  1TPM A;  1G4G A;  1OJW A;  2EHF A;  1H03 P;  2O39 C;  2G7I A;  3L89 M;  1LY2 A;  4ONT D;  2JRA A;  3IX0 A;  1E88 A;  3NFP I;  5HYU B;  4AYD A;  1OK2 A;  1OK9 A;  2A55 A;  2BZM A;  1TPG A;  1MD7 A;  3GXE A;  4AYM A;  2ERJ A;  3SW0 X;  4ZH1 D;  4B2R A;  2KRI A;  1TPN A;  2JGX A;  4C16 A;  1ELV A;  2XRD A;  2XRB A;  1VVD A;  4AYI A;  5I0Q B;  1ZJK A;  1O9A A;  3MQL A;  1GKN A;  4K12 A;  2CKU A;  1QGB A;  1CKL A;  3CAL A;  3EJH A;  3OXU D;  3O8E B;  5HYP A;  1HFI A;  2XWB F;  3INB C;  2IZ3 A;  1MD8 A;  3RJ3 D;  1Q3X A;  2V8E A;  1UOT P;  2EC3 A;  1H2Q P;  4KKD A;  2JGW A;  3OED C;  3KZJ A;  2MCZ A;  2UWN A;  1HFH A;  1G4F A;  3TVJ A;  2YRA A;  2RL0 A;  2IZ4 A;  1GHQ B;  2XWJ I;  1GKG A;  1OK3 A;  1PPQ A;  4YNX A;  3ZRZ A;  4B2S A;  1U5M A;  2CG7 A;  3KXV A;  1OJV A;  2B5I D;  2CG6 A;  3T5O A;  2W80 A;  4A5W B;  4CSY A;  4JHS A;  4F4O C;  3R62 A;  2RLP A;  1SS2 A;  2MCY A;  2LOJ A;  1QUB A;  1FBR A;  3OP8 A;  4J38 B;  5HZP B;  1NWV A;  1H2P P;  4IGD A;  5FO8 C;  1E5G A;  4PZ5 A;  4LOS A;  4DJZ A;  4FXG G;  3ZD2 A;  3IU3 I;  1H04 P;  2RLQ A;  5JPM G;  3ZD1 A;  2KMS A;  1GPZ A;  2QY0 A;  4AYE A;  4MUC A;  1QO6 A;  2WII C;  1C1Z A;  2RKZ A;  1E8B A;  5HYT B;  2YBY A;  1HCC A;  1SRZ A;  4LOT A;  1VVC A;  3M7P A;  1Z92 B;  2W81 A;  2XQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...