3L8EA

Crystal structure of apo form of d,d-heptose 1.7-bisphosphate phosphatase from e. coli
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
185
structure length
185
Chain Sequence
b'KSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 63
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l8eA00
3OCUA 2YMMA 3NAMA 1ZOLA 3BA6A 5AIAA 1S8OA 3PGLA 2EATA 3N1UA 5AW3A 3ZX5A 4J03A 4Y3UA 2WF9A 3DNPA 4OCZA 3EF0A 1RLTA 4MUMA 5AW8A 3WK5A 2P11A 4BX0A 2FUEA 1SU4A 2G06A 5AVXA 3ZVNA 3QU5A 3L8FA 3QUCA 1S2OA 5ALIA 1Z4KA 3L8EA 2QYHA 4NWIA 5AKZA 1L8OA 1N9KA 5AESA 4QQFA 3SLRA 1FEZA 5IT4A 2FUCA 3W5DA 3ESQA 2YFYA 2G1AA 4KYTA 5ALEA 3L8GA 4H1WA 5ALUA 1T9ZA 4HYTA 1IWOA 3L7YA 5AW0A 2IOFK 4XOUA 4AS3A 3AR7A 3UMGA 2I6XA 3EF1A 3WK6A 1XPJA 4NAVA 5AI4A 3ZUPA 3OTQA 3A1CA 3ZW7A 4EX7A 3UM9A 3S6JA 4BX2A 1QQ5A 5AK4A 1VJ5A 4RESA 1RC8A 4YCNA 4FYPA 1Z4PX 2PQ0A 4AP9A 4YGYA 2YJ3A 1VFPA 2NO5A 5AVUA 1U2TA 2PR7A 4EELA 4FFDA 3DV9A 4QJBA 2GMWA 2HSZA 4G63A 3MN1A 5ALSA 3SMVA 2HHLA 3R4CA 4GIBA 2WF7A 4HGNA 5ALRA 1Z88A 3MC1A 1Z4OA 3U7HB 1U2SA 3QXGA 1WPGA 5AW5A 2I54A 4UATA 3W5CA 2NYVA 4XQ0A 2R8YA 1WVIA 2JARA 2O9JA 3FZQA 3KD3A 3HYCA 2AH5A 4KNWA 4CF4A 1YJ5A 4YH1A 5AW6A 3AR9A 2JAOA 3U19A 4KX5A 5ALOA 1LTQA 3U13A 5AKJA 4OFZA 1CR6A 1PW5A 4PNHA 4AS2A 1Y8AA 3N8GA 4B6JA 5AVRA 2WHEA 3I6BA 5ALQA 3B9BA 3PDWA 5AM5A 4BX3A 2FPXA 3EPRA 3E81A 2WM8A 1WR8A 3M1YA 2FPWA 2MSNA 5IT0A 5AW7A 3PCTA 5ALDA 5AM4A 2OM6A 2HF7A 4CF3A 5JJBA 5AVQA 1ZRMA 4UW9A 2CFTA 4GXTA 1TJ3A 3QU4A 3AR3A 1RKQA 1Z5UA 5ALKA 1YDFA 3E84A 2FPSA 5AI5A 3R9KA 2C9MA 2R8XA 2D2VA 5IS2A 1WZCA 1YMQA 2G07A 5AI0A 3RF6A 3QYPA 4EEKA 2YJ6A 1RMTA 5ALNA 3I1YA 1ZS9A 3ET5A 2RARA 4Y2QA 3SKXA 2IYEA 1RLOA 4IG4A 4F72A 1RQNA 4BEVA 5AW1A 4DW8A 2YY6A 3A3YA 4L57A 2YJ4A 3FVVA 3ZWKA 3WKDA 2OA0A 3MMZA 4EZEA 2ZG6A 2HX1A 4XPZA 4Y2XA 4Y2YA 1Z4JA 1RMQA 1NRWA 4FE3A 2X4DA 1N8NA 2I7DA 1KYTA 3M9LA 1SWVA 1ZD2P 5ALFA 3ONNA 2JAWA 3TLMA 1X42A 2C88A 3WKCA 5AI9A 2MU1A 3QUQA 3U7FB 3IJ5A 2YN4A 4Y2VA 2I34A 3NALA 4G9BA 2JAUA 5AKLA 1YS9A 2AGVA 2P27A 2BY4A 3QU7A 3IRUA 3QLEA 4YIKA 5ALZA 3W5AA 2B82A 3ZVLA 4DCCA 2G80A 5AVTA 1SWWA 2BDEA 4BNDB 4BEWA 3UMCA 2AUTA 5AM3A 2YJ5A 4BKMA 3L1VA 3J7TA 4KNVA 2CN1A 3B8EA 3QUTA 2OYCA 1T5TA 4UAUA 5AKYA 3L0BA 5AW9A 3WGUA 5AM2A 1QH9A 3D6JA 5AKEA 4UMVA 5AKGA 4E88A 1NF2A 5ALHA 2IOHA 4BNDA 1CQZA 5ALLA 2GFHA 3SF0A 1Z4NA 3QNMA 4F71A 1JUDA 3P96A 3GYGA 3F9RA 5AK3A 1QYIA 3I28A 1L7NA 2I55A 2G08A 2YMLA 2ZBGA 5A3QA 4L6CA 1RLMA 3EWIA 5AM0A 3L0CA 3WK8A 1O08A 4YCMA 1U02A 4CNQA 4CE6A 4HGOA 5AK5A 1LVHA 3SKYA 3R09A 4L6AA 2YBDA 4NABA 2YMQA 4UM7A 3WK7A 3ED5A 3ET4A 2HI0A 1F5SA 5ALJA 3SHQA 2P69A 3ESRA 5ALPA 4YCLA 4UAVA 4BBJA 4RETA 4HGRA 4BYGA 3FM9A 4NFLA 5A3RA 3N07A 2PKEA 4ZEVA 2W11A 1ZD3A 2WF8A 3CZ4A 3U7EB 1RKUA 4HAIA 2ZXEA 3OCYA 4HGQA 3ZI4A 4EX6A 2WF6A 4UMEA 2B8JA 2ZBEA 1RKVA 1YV9A 3AR2A 4Y2RA 2JGAA 3WK9A 3FPSA 2O2XA 4JDPA 5ALWA 1EK1A 2ZBDA 2FPRA 3OCXA 3VAYA 1ZJJA 3OCWA 4DWOA 1O03A 3NIWA 2WFAA 3OCZA 1J8DA 1ZRNA 2RB5A 3NRJA 1Z4MA 4C4SA 1XP5A 2CFRA 4UU0A 5AKHA 3N28A 1K1EA 2GHTA 2C4NA 3OPXA 1RMYA 4UMDA 2R8ZA 4MWOA 3E58A 3AR8A 2R8EA 3A1DA 3NANA 2G09A 2GHQA 3ZWDA 4C4TA 3KDPA 4Y2TA 5AKIA 5AK6A 1L7MA 4JB3A 3I76A 3RFUA 3KZXA 3QX7A 1L8LA 2B1RA 2Q4RA 4KX3A 5ALVA 2I33A 4UM5A 3L8HA 1ZD5A 1MH9A 2ZBFA 4EENA 4OD0A 2B8EA 3QUBA 1T5SA 3WK4A 3CNHA 1RPZA 4CF5A 3WGVA 2FI1A 3ZX4A 2RBKA 1XVIA 5ALYA 5E0OA 5AVZA 1Q92A 2OBBA 5A3SA 4ZEXA 3KC2A 4C4RA 1L6RA 4KN8A 2C8KA 2Q5EA 1Q91A 2EAUA 5FP0A 1TJ5A 3WKAA 1Z5GA 2C8LA 2W4MA 2GO7A 2G0AA 3HLTA 5AKKA 5AW4A 1YNSA 4UU1A 5AICA 3SD7A 2HDOA 1AQ6A 2B1QA 4Y2SA 5AIBA 2W43A 3AR6A 3E8MA 1NNLA 2ODAA 3B9RA 3U26A 5AVSA 4UASA 3MPOA 2BDUA 3QU2A 1TE2A 3AR5A 3A1EA 2HF2A 2RAVA 3L5KA 5AM1A 2Q4TA 5ALGA 5AVVA 2HOQA 3NASA 3L0YA 1RDFA 1TJ4A 1EK2A 1U7OA 3QU9A 1VJRA 5AHXA 3N5KA 3NUQA 5AKXA 5AVWA 2AMYA 1RQLA 1Z4LA 3WKEA 3U7GA 4I9GA 3KOOA 4O8CA 1Z4QA 1U7PA 5AI8A 2FEAA 1J97A 3OCVA 2FDRA 4HGPA 2B30A 4I9FA 3FPBA 3IB6A 4Y2UA 5AI6A 2IA5A 5ALMA 2P9JA 3QGMA 3W5BA 2DQSA 3L1UA 2CFSA 1L7PA 2FPUA 5AVYA 2WF5A 4NV0A 2B0CA 2VKQA 3FGOA 5ALXA 2HCFA 2IOFA 4Y2PA 3BWVA 1L7OA 4IFTA 2NO4A 3ZTYA 4J2TA 3ZU6A 3K1ZA 4YIHA 4ZEWA 4UMFA 2HO4A 4XE5A 2YMPA 4UARA 5AW2A 4DFDA 5T41A 2QLTA 3PGVA 2EARA 4OHFA 3ZVMA 3UMBA 3WKBA 2HEGA 1RRCA 5ALTA 2ZOSA 3ZTWA 3DAOA 3AR4A 1TA0A 3DDHA 1Z4IA 1QQ6A 4Y2JA 1QQ7A 1ZD4A 3KBBA
chains in the Genus database with same CATH superfamily
2BHTA 2O59A 3O8BA 5EMJA 3KCQA 3FWZA 3ASYA 3NG1A 5CB4F 1E1LA 3JAKB 4J1QA 1YR9A 1OZAA 5LA6F 1E6UA 4R7TA 5B58T 4PZZA 4KRGA 2BKUA 1BVYF 1D7OA 1VHTA 2HU5A 3E4CA 1RLTA 1L4FA 5F7ZA 2IW1A 3VYWA 3WYEA 4PXYA 5EIWA 4NJEA 1IHXA 1SU4A 1B23P 4H3VA 1GL9B 3DE7X 2Y93A 3UATA 1MTOA 4YYEA 1PD1A 4QUKA 2DPGA 2EJVA 3R76A 3C45A 1EUDA 5K4AA 2DE0X 3WYDA 5C5EA 1E3SA 1RYNA 3RANA 4D4GA 2VO1A 4EUEA 5AESA 4AG5A 3NV9A 4C3ZA 1U1GA 2PHZA 2XYGA 4N49A 5AH0A 4R2HA 5GPBA 4KUHA 4F92B 3C3CA 4BOYA 1JAZA 1NWCA 1U8EA 2J7PA 3QELA 4HMQA 4WA7A 4YRIA 5EJEA 1ZK2A 3N6RA 2JFZA 3G89A 4L8VA 2RKWA 5A3VA 3QFTA 2JVJA 5LBIA 3C70A 3BMOB 1MO6A 5ER6A 4Z49A 3QQPA 4DPMA 4E2YA 1R9GA 1QP4A 1F5NA 4DY4A 5CVTA 1PUIA 1XZHA 1T2CA 3LM8A 3G49A 4J49A 5K0ZA 3S1AA 1IHPA 3A1CA 3KR1A 4Z0NA 3JRXA 2B9VA 3GGOA 4UTNA 2QL5A 1CRWG 5BSUA 2DP4E 1WJGA 3CZ5A 1YTUA 1NC1A 3UF0A 3SQNA 2O8CB 5ETJA 1AXGA 5I8ZA 4QLBA 3HN7A 4ZI7B 1VFPA 1CQPA 2FXIA 2PRJA 2NUTB 2WU1A 4BMZA 1C7QA 3QVMA 4YRQA 1N9GA 2NM0A 2C4HA 3WZLA 5JV5A 2VJBA 3BN3A 1LLFA 5BV0A 2XV1A 3ZE0B 1O94D 1P2GA 4LHXA 4O1IA 4UTPA 3DBLA 3NRCA 3HKDA 4GIBA 3B3AA 3MXOA 4ZRMA 5EMHA 1PWZA 3VZCA 2F17A 1E2BA 3IPLA 4QDJA 4A8JA 1JA0A 2AJ8A 2QRNA 2RSLA 2A14A 4DPLA 5L51A 2NZWA 2J6HA 3DFKA 3I5AA 3NZEA 4PX3A 3RRMA 3U3OA 3A2NA 4L4YA 4XDHA 4A92A 5LZ2A 2MSLA 2P9EA 3RGWS 1E1QA 3QFHA 4GBED 5BRJA 5DLQC 2H0QA 3IAXA 4Y67A 4YI3A 3USES 5ADVA 3DOIA 4HWRA 2WIDA 2XTAA 3CKLA 5K4GA 1OIXA 4MRMB 1NBWB 4TMKA 2RHMA 5AW6A 4GX0A 3PEFA 3GPBA 4UDOA 4WBXC 1JQBA 2P1RA 3MWGA 5AJTA 3WJAA 2A1TS 4BN5A 1DWQA 4I1PA 3MD0A 4D8YA 3Q4GA 1JV2B 4KE6A 5EFZA 2P9TA 2IX9A 1YZUA 2Q6OA 1THGA 3LKDA 3FWPA 3M0EA 3H87A 3D0OA 3U5TA 1E5XA 4R0NA 3KELA 4QLAA 4XWTA 1KO5A 1V39A 3GMIA 1ZK3A 1I9GA 3ISJA 1Z5VA 2WIBA 1BYIA 1US8A 3S2EA 1VCNA 3K9WA 4AG3A 1J1ZA 5DW0A 3CEPB 2CYCA 2DKNA 4KTTE 4MV0A 3JQPA 5K0FA 1IBCA 3EY9A 4YJ2B 1H2FA 1ZXBA 2C7VA 1DC4A 2OM6A 1R15A 2OFXA 4JUDX 3D81A 1Y9JA 1GKUB 1QV6A 3ELBA 1L3BA 4UHJA 4OB8A 2FPPA 1U9IA 1WZEA 4MWGA 3DBIA 3SJZA 1Z5UA 4RENA 3E5RA 4LYJA 2OLEA 2CZCA 2QYTA 3H2ZA 3V00A 5IF9A 2OAQ1 3RKRA 3NDRA 4XRGA 3ZLJA 1T2NA 3FUWA 3HO8A 3R5SA 1R88A 5DWDA 3D7NA 4FMBB 3NEPX 3PLRA 3X2FA 2BEKA 1QLHA 5LOVF 1M2NA 3IUNA 4EG0A 3BZWA 1DAOA 1U63A 4RYLA 4UM9B 2PXAA 3D02A 1L5YA 3VKWA 2VSXA 3U37A 3B52X 3AH8A 5JJIA 1TPYA 2QENA 2VDWA 1HNZB 2WHPB 3HA2A 5KJ1A 4DV2B 2J87A 3UWDA 3ELUA 1KC3A 4R1MA 2PXHA 4N9QA 3IX7A 2CF5A 3A9TA 3ER8A 3NIGB 1JALA 2CNLA 1OX4B 2Y2UA 4WLVA 1NI4B 1GARA 3I3OA 2L2QA 3OOJA 2IBMA 5DBEX 3HM2A 1IY8A 5JAMA 3DJFA 4Z53A 3EGEA 4YECA 3LL7A 3D8RA 3LUBA 2Q1XA 2QTMA 3ACBA 1EP9A 4DZTA 4BNLA 1VE1A 1P44A 2VWQA 5FPTA 1D6NA 3TW4A 1NM5C 2ADFA 1CSEE 3BPSA 10MHA 3EFBA 3BQNB 1YJQA 4Y9SA 3RYTC 2NSLA 5TPZD 3EZNA 7ABPA 1N8NA 3LKVA 4RLSA 1Z0DA 2EF1A 3TRHA 5BRAA 5IUNC 1KYTA 2V6BA 2HAEA 4Z4GA 1XDSA 2JHCA 3AESA 2X1VA 4M1KA 1NYLA 3SEFA 1NATA 3QBVA 1JIQA 1HE2A 1ZZEA 3AF0A 3A7EA 3GN2A 3TE6A 3OIUA 1D1QA 3C85A 4PC1A 2E2WA 4B40A 1N2OA 2FZ4A 1D8TA 4JLPA 2DR3A 4ZTUB 3KTOA 2XMCA 4YRFA 1O54A 4W9RA 3AM3A 4WW0A 3HKCA 2VJMA 4P8RA 1S1CA 4ZT4A 4IZIA 4EGQA 1NU6A 1D8AA 4LQCA 4RZIA 3VV3A 1USUA 2GYYA 2Q3JA 1P1FA 1DX9A 2W2QA 1CZKA 2DEUA 1QCZA 3RH0A 1W36D 4V24A 5DM0A 5B3KA 5KREA 1JFVA 3HJNA 1F48A 1PN3A 1J22A 2OD7A 3PU6A 2OYCA 4UTOA 3W5HA 2HWWA 1M76A 2HRZA 3WGUA 1BIFA 3MGBA 5GGXA 1NDQA 2YASA 2DC1A 2GCIA 2Z2ZA 1VLQA 3PHCA 1RRMA 4E88A 1HYGA 1QIMA 1YIOA 3C4QA 4PIMA 2WI8A 4ZA2A 4DDWA 2B2CA 3JYOA 4TRJA 4UBIA 4ENPA 3F8WA 3H3FA 4HBGA 2UU9B 2C42A 1UMDA 1VE6A 3VDNB 3TE7A 1Q17A 2Q1SA 5DHSA 2BJVA 2NACA 3I8XA 4KWTA 1TLTA 2AFHA 2PBLA 1UIRA 2I5PO 4YUXA 4CV2A 2ORVA 1RXEA 2PX5A 3Q0TA 4MIEA 2ZBGA 5CEJA 2ZDGA 4MO2A 3R7BA 1PJ2A 1ZNZA 3DZHA 3M1LA 1ESEA 4HDSB 4OHRA 1CETA 4KQMA 4QBKA 4ZIRA 1UBUS 3ZJ5A 1E1CA 1L4KA 2IUTA 4UVDA 4EQZA 3SXJA 1BJTA 4LDZA 1I5EA 1R0RE 2G7ZA 1EVLA 1XKTA 1CEXA 3QE0A 2IYXA 2VT3A 1QDEA 3PK0A 7YASA 2XB2A 1Y3IA 3MOSA 4KZPA 3V4PB 3WYBA 1ID8A 2W98A 4R1QA 1JBEA 1QJ4A 4HN9A 1UBOS 5FYQA 3KD2A 1RVV1 2LVBA 1MPXA 3LGAA 2H5LA 4RMIA 4U7TB 4FHGA 4Q9HA 3UW1A 2FR8A 1BQ3A 2I29A 3AM4A 4KMRA 4FKMA 4Q4CA 3AEQA 4YB8A 1YIDA 1DJNA 2VP6A 1UP6A 5HTOA 1A2BA 3GVPA 2W11A 4GL2A 3A6EA 4QM6A 1DBRA 1QRDA 3DZBA 1XMXA 4YJFB 4R16A 2AVDA 3E61A 2RHBA 4N4AA 2H18A 1GYPA 2IDMA 5A0TA 4P5DA 4FPXA 2GDJA 1JG3A 1P7WA 3DKPA 5M04A 2OCXA 3BK7A 1WVMA 1QHNA 1U1IA 2DSTA 4V2UA 4IJKA 4Q4DA 4W1QA 4F6LA 4LXXA 3AR2A 1OFGA 1LNQA 5F1OA 3SHWA 4AYWA 1MB2A 3RCBA 2OAGA 2C77A 4NJMA 2F67A 5IZCC 2HQ1A 3KHUA 3M5CA 1AN0A 4CDGA 5CCEA 4MV8A 4HZUB 3ZBTA 4PLGA 3A9CA 2VPPA 3OCXA 1GZVA 1SD5A 4D46A 2C92A 4DEXA 1Z6XA 4Y2GA 2BGKA 1Y1QA 2XUFA 2Z2XA 2QTZA 2XD4A 4F0JA 4IMRA 3DBVO 4AO7A 4BFSA 1T3ZA 1A4UA 2IDKA 3VU3A 2YIMA 4P7KA 2NMVA 1EWTA 2R8EA 4YMHA 2GESA 2XKKA 5B1IA 3TXYA 3IAM1 4B3CA 4K6KA 4UD2A 3S55A 5HQJA 2A94A 2P2YA 3D8HA 4PYNA 2XNDD 1H2WA 4ESVA 4CZ2A 4I7EA 4W5WA 2Q99A 3V8RA 1BWPA 2WAMA 4GE3A 4FGJA 4NU0A 4FONA 4BLVA 2D2XA 2JAHA 5HFAA 2AR9A 2O2SA 4PG6A 2HWYA 1CZLA 3HDJA 3NWBA 2RI0A 1K3UB 2Y1LA 3Q7QA 4TL8A 5COQA 3TAHA 5HUHA 4NOLA 2QTAA 1Q1GA 1I4DD 4GR5A 1IK4A 3MJRA 4X0EA 3RT7A 3SYMA 2XCTB 4ETIA 2FRXA 4ME6A 1T3TA 2GRJA 4PTYA 3UQZA 5HRUA 2Q6IA 1V4VA 2E5WA 3EZ2A 3IEPA 5DU2A 1NX6A 3HP4A 1F4VA 2M6RA 4U2EA 4LWPA 2XCLA 3GZNA 4JP1A 4OI2A 3AVOA 4XW2A 2LP4Y 3H9GA 5EY5B 4NEHB 2YWRA 5A3SA 4KJZA 3WLSA 5FULA 1O5IA 2R8BA 4V0KA 1GM5A 4E13A 5LCXA 4Q9LA 1ZWKA 1WSWA 3PB3A 3OFJA 4EI7A 4NBUA 2GJ4A 4JYPA 4E4RA 2FQXA 1MC1A 3B5IA 4O4LF 5F76A 3AVXA 1J2JA 2P2ZA 5DOZA 3FPAA 2W83A 1O0CA 2NP7A 3FF1A 5JVDF 5J3JA 4MA5A 4RPCA 1YJCA 4BLOA 1P7VA 4N82A 3QJ5A 4PO1A 2HJVA 5E2IA 5B3LA 5E1MA 1KORA 2EV9A 4D0RA 1Y7IA 3N2NA 1M34B 3QI7A 1G98A 3ICWA 4NESA 1OILA 2GYVA 3MEQA 4C2BA 4Q34A 2D3TA 1NG1A 3NTOA 5EN4A 3V97A 1R8JA 1XU9A 5K5EA 3TOSA 4DNOA 2JEYA 1E3TA 4IMPA 1ULAA 3DL2A 2C9OA 4ZYZA 3PLAE 1WQ4A 4HEA1 3RABA 2P2CA 1KI3A 3CRW1 3O8OB 4GI5A 1N5DA 3OOWA 4MDFA 1F2DA 3DW1X 3LC1O 2Q5LA 5IBQA 3QPAA 4PTZA 5C31A 4LYAA 3RBVA 5JQGA 3J81A 1ZH6A 5ELMA 5F52A 1KEUA 2BBWA 4JYAB 1Q3TA 1RDFA 5DCYA 1AMUA 1TM5E 1C7FA 1GSOA 2QUZA 2VCHA 3TSAA 3ZNPA 4YRMA 5BQ3A 3W5UA 2F3PA 4W5NA 3UPTA 1XK6A 4IRXA 4WKBA 4M1YA 1MT3A 5BSWA 3WXMA 2OC9A 2HK7A 4YCJA 1FY2A 5IAEA 2Q27A 4HWPA 1E4EA 4I9NA 1OAAA 1BNCA 1T24A 4IEFB 1Y0BA 1CJKC 4YX9A 2BFPA 2OG2A 1C4OA 1K4KA 4Q3AA 3VNRA 2NV2B 5EPEA 2YIDA 4HATA 1UBNA 4JASB 1QVWA 2J5QA 4L78A 5EXEA 4H0CA 1OJ7A 3AV3A 3JQAD 2FFJA 4R1TA 3IB6A 4KL8S 1VZ2A 2FEPA 3QMVA 4K6GA 4BO6A 1W9HA 4IDNA 4LF9B 3P9ZA 2BM0A 2C1EA 2HUPA 3TCXB 1JWAB 3O6VA 1T10A 4TWZA 3VRHA 1LBHA 4ZANA 4NV0A 3WYAA 3Q11A 2QMOA 1U5AA 4OU5A 5F23A 1L4EA 4OGKA 1SPXA 1SCDA 1TCAA 2YUTA 1X7WA 3PXAA 1XD9A 5DYTA 1N33B 3I61A 4KQ6A 3IEMA 2VPQA 5TE9A 1CUZA 4F4UA 2F8TA 1Z45A 2JFFA 4NE2A 1UANA 4ESHA 4L4XA 5E6SA 5JSZA 3P26A 3CF0A 1AURA 1XDUA 3UB2A 1PIWA 1GU0A 3BX1A 4HNSA 5BR1A 1FP4B 4LISA 5B36A 2CNDA 3O2JA 4X6UA 4ZT6A 1VXOA 3T1VA 1A9TA 4GKKB 3RSOA 4OLJA 3W5IA 5TS3A 5JNTA 1A8UA 2EU8A 3GRFA 3A1FA 4IDOA 4MS1A 2OGWA 3UHJA 4Z3KA 1U90A 1PCXA 4I4TF 1S3SA 3MGKA 2QU8A 4YR7A 3C4JA 2Q29A 4X63A 2IELA 2QGNA 3WKBA 5F4ZA 4CKXA 2HEGA 1NVAA 3Q3EA 2ZOSA 5ALTA 2RGUA 3AXTA 1E5QA 4NG4A 3TTYA 4EY6A 4Q7QA 4ZHQF 3GH1A 4RK7A 4A7PA 4O4HF 4A8PA 2WK1A 5EJGA 2W2PA 4I9HA 1T8TA 2FF7A 4XGKA 4BECA 3BICA 4R05A 4AJPA 2C58A 3RSFA 1DUVG 1QQ6A 3QRWA 3U0BA 3X44A 5CVVA 1Z17A 4AU1A 4IQ8A 5J5AA 4AICA 1IJBA 2VUIB 4RA9A 5HX7A 4RTMA 3ESDA 3FSEA 1W0CA 3HVKA 2NX2A 1GU1A 3MBOA 5A9SB 4CTNA 3Q40A 3D2CA 4KMOA 4DS3A 1VBKA 3RTCA 2PZLA 2CHQA 2QUKA 3BTSA 3GARA 5HNKA 1NQUA 2JCBA 3NT4A 1Z6YA 3DZDA 5I6DA 4P38A 4RVUA 4RVHA 2ISQA 3ESBA 5CT9A 5AW8A 1E64A 1B0PA 1U7ZA 2H2GA 4KWCA 5C2JB 3DMFA 5ECGC 3SVZA 1DEKA 5K0BA 4QO7A 5FOQA 1SB9A 1II8A 3DEAA 5HILA 4EB3A 2B3TA 2AT1A 2DM6A 2XHEA 2ZYIA 4BL5A 2ODWA 3QBDA 2VXBA 3TBFA 1DO2A 1IG3A 1DARA 2OWDA 3W5DA 5BSRA 2M1ZA 3AJ9A 1VMIA 1YB6A 2GD1O 3VX4A 4R1OA 4I2VA 3A1SA 2OXCA 4NPAA 1SC1A 2W2KB 4HLUA 4RAQA 3RS9A 4AO8A 4S1WA 1U80A 1VDZA 5IMBA 5JBNA 1E32A 2LIVA 4N3BA 2Q8PA 3A9RA 2WD8A 2RGGA 3KL2A 2Q3DA 3LUGA 4W99A 2XT9A 4CLOB 3EMBA 4DV7B 2QE7D 4RNCA 1XPJA 1QF7A 5ISMA 4JIMA 4RCZA 3KIPA 4N3AA 2M98A 2YKGA 4OKSA 3U3DA 2NO9A 3AOEA 1DIOB 1QQ5A 1EKXA 3MJ4A 4JVLA 5AK4A 1P60A 3A32A 4YCNA 1QFXA 2HTFA 1LPBB 1G21E 2R66A 2UXDB 3HO6A 1UMBA 2L19A 2WOJA 1Q7GA 3GEDA 2NO5A 1IB6A 1WW8A 1L5GB 1Q1QA 4FHEA 5E8RA 1W34A 1IRXA 1G38A 2GK7A 3A0RB 4EO9A 4NZYA 4X84A 3H1PA 3E7PA 1KHHA 5HIAA 1LQUA 4WJLA 1V8BA 1RKBA 2VNJA 4DV5B 2I91A 5BVHA 3G0BA 3U7QA 1U2SA 3IL2A 1NR7A 3C7AA 2OMEA 3AI7A 2IDZA 2XB9A 4LSZA 4E5SA 2QG9A 1Q20A 5CBPA 5KZMB 3E3OA 4J4HA 3RSGA 5CDFE 2X8BA 3R74A 3UJCA 4OUDB 4RSRA 2FW9A 1GTSA 2R5WA 3WNBA 3UMSA 5CXUA 3R5FA 5K09A 4TYYA 4OHCA 3U3MA 3N6VA 4YQFA 2JBHA 2VBGA 3G6KA 5I51A 2SNIE 5DIZA 1G19A 3P9NA 1A72A 3OJCA 4QEZA 5A5DA 2O5EA 4CU2A 3JRWA 2NWQA 2ZJ4A 4ZMBA 2YZGA 1JDJA 3CPHA 4KX5A 3G82C 1PEDA 3GK3A 4EFLA 1DC5A 5BWLA 1XHEA 2HJWA 3LQKA 1KAMA 4WXHA 4X85A 3RW9A 1PU2A 1GQQA 1DIHA 1BZYA 3LT5A 5JBIA 2A67A 1CP3A 4G4SP 3FPKA 1GPH1 3PEUA 5C7LO 3I6IA 4PF1A 5L8VA 1KWKA 2OO3A 5IM4F 1AU9A 1SXHA 3DWIA 3E81A 3NJ8A 2QG6A 4LOLA 4KMMA 2C9BA 5JNWA 5DE3A 1G5HA 5IT0A 1LSUA 2VXCA 1XPUA 3Q3GE 1DC6A 4KU4A 5T3YA 4YBRA 2VSNA 1XFDA 4CF3A 4J2OA 3ZI7A 4JR2A 1ZHFA 1I0ZA 1YJXA 3ZKWB 2CHVA 2HDHA 2C4TA 4FYHA 1N9ZA 1PSWA 3H2YA 4D9MA 1R18A 1Z68A 2XDQA 1YR7A 3L01A 2PLFA 3CUVA 2HT6A 1CUXA 1DP4A 4IFBA 4YDRA 1W49A 1R8YA 3B1WA 3TQHA 1PTKA 4I0WB 1N5JA 4Q6BA 5BQXA 3CRZA 4X7MA 4MITA 2PRIA 4FI3F 4CT5A 1VMAA 1GGVA 4M0FA 3GOQA 4FCVA 1PHPA 3RF6A 1TQHA 1VG9B 2AD5A 4KIWA 1M2WA 4RHCA 3AI2A 1ZS9A 2R9VA 2X13A 3PF9A 3QYJA 4IJMA 4JQZA 3CLRD 4QJ5A 3TK1A 4A4DA 4RD6A 1VYTA 2Q0XA 4DE5A 1P39A 2UVDA 3N3AC 4N39A 2ONKA 3UAWA 1FDIA 1MJGM 2IYEA 3H11A 3T7KA 4JUCA 3OICA 3IE0A 1YS6A 1NJGA 2I4LA 4LX8A 4TYNA 3AY6A 4BQQA 1AG9A 4NV1A 3L7IA 4M7RA 5CM9C 4DW8A 2VTEA 3IBFA 4Y1GA 4AWBA 3PUJA 3KFVA 3OM9A 2A1UB 3BMXA 4AZ3B 3LO5A 2VT6A 4DLTA 3RSLA 4F4IA 3SS8A 2O6HA 1CW2B 5KOJB 1CHNA 1Z29A 2NUBA 3GLVA 5CR9A 1MW9X 2PV7A 2MSCB 3UW3A 3ZXIA 4Y2YA 1WCV1 1IQRA 1G291 1LZKA 1HLGA 2QV0A 2XX3A 4YQEA 3RREA 1U31A 1JG4A 3IBSA 1EB9A 3S40A 3AF6A 4AS1A 1PR0A 3TEJA 5JWRA 5AT1A 1WPXA 2QTHA 3PFWO 5EKDA 2VAWA 3VKGA 4B45A 2CXRA 3PPIA 4EX6A 1U8CB 4E30A 1WMDA 4WACA 3JASB 2FEKA 2J4CA 4JU9A 3B20A 3OZUA 3PCXA 4PLFA 4RNDB 2J9GA 3T9CA 1PJRA 1PEYA 3OQIB 3FZEA 4QTTB 3TZQA 1YS1X 1VHWA 2GEJA 2IYQA 1L5HB 4R83A 4YAIA 2AGVA 3HGQA 3F7MA 1SGWA 2GRAA 3H19A 1ML4A 3C15C 3HEMA 1Z7EA 3JZDA 3NHLA 3QVTA 4FU0A 5A03A 2XGJA 3PEEA 4NP6A 3RJ5A 1GUFA 2Q1WA 1Y6JA 5CITA 1OLOA 5C18A 2XB6A 3D8NA 4AXBA 3GAMA 3DLHA 2WFLB 1TEXA 2FEXA 2GJ8A 1ETHA 1M0SA 4B76A 1P1IA 1QYXA 3B8EA 4X7PA 1T25A 2WIKA 4MW1A 1NF8A 3QKSB 4EHHA 1ZCFA 3IP6A 1KKUA 3N86A 1HDRA 2AQ8A 2YW2A 4P92A 2QRZA 4C7MA 5AM2A 4EG3A 3OQJA 4KQEA 1O2DA 3D6JA 4FYMA 1IZZA 1XALA 1KMCA 2YXLA 4D0SA 1B42A 5LYJA 4A73A 2YWEA 1D2NA 4YFYA 1G21B 2MWMA 3A36A 1U8FO 2A58A 4LJ8A 3SDSA 3L4JA 3C1UA 3FNQA 3DMTC 6LDHA 1PYGA 3QY0A 5I48A 1A9OA 4A2PA 5KEIA 4MAMA 3RIGA 4XH9B 3ROEA 2WHXA 3ZWNA 1C9KA 1SZCA 2XYPA 3CB4A 3FFBA 3OHSX 1ILWA 1CHDA 1F9EA 1ZIOA 2EP5A 1YSCA 2I2CA 1U0GA 4GKVA 4ZT5A 2X9NA 2G08A 3LNTA 3WICA 1A4XA 4MI3A 5KKCA 4A6XA 3TTWA 1H2BA 1N3LA 1RZ3A 2XNHA 2XIJA 5D85A 2ZE5A 4RV5A 5DW3A 4TLLB 3GPLA 1U2DC 1W88A 5NULA 4PLWA 2VHQA 4XFJA 3SYNA 5GM2A 1WU7A 2GKSA 2ZJ3A 1P5FA 2H4JA 2ZRNA 4GZMA 4RPJA 4A6PA 3HJTA 4ER6A 3O38A 2JGFA 3NYWA 3CPSA 4MKIA 4AQDA 1AB5A 1UMCA 3DXFA 2JIRA 2IY7A 2NO7A 3C3BA 5IBRA 5CB4A 5LA6A 3ZK7A 2GAJA 2BM1A 2O0MA 3SSNA 3ESRA 3FMVA 4ALMA 2ZJ0A 2VJDA 4HEA6 4RKRA 1G5QA 4EB6B 2I2XB 5BMVB 4BYGA 5HSGA 3WTCA 1HEUA 1UKYA 1T4DA 2G1JA 2IXAA 3O4JA 4TXMA 4YA6A 3UMRA 5JCOC 1A8IA 3WWPA 4JMLA 3TKYA 3DE0X 2XWQA 4CI0B 2IZ0A 1OCEA 2VQ6A 3DFFA 4YC7A 2ZUDA 3V4FA 1FPQA 5FTLA 2IQ5A 3EVCA 1GL3A 1G8SA 3KHKA 4PC2A 3GLQA 3A1WA 4XUDA 2ZJ6A 3D7RA 4XPIB 3RRFA 3UTDA 4DV1B 1Y5RA 2ARKA 5P21A 5DBHX 1QVAA 2X1HA 1HL7A 4CT4B 1MO5A 1SO8A 1L5NA 3TGPA 3WLMA 1UPUA 3DBHA 3BXFA 5LD2B 4Z4FA 1GGFA 3I4FA 4LQ4A 2VG8A 3B1FA 3X1YA 4C4OA 5C8YF 1A71A 4ALNA 2RGXA 3O3OB 3LT0A 4KFSA 4W6ZA 3OU2A 4ZOCA 3M4NA 2V7QD 1ZGHA 3VAYA 2OY0A 1DG3A 4DWOA 2OHHA 1YNOA 2R62A 4FJ0A 3FY4A 1BN6A 1JAIA 5EESA 2H4ZA 2HQRA 3U3XA 1MJNA 4G86A 2CJXA 4GI3A 4JUFA 4XLZA 5A9TA 2X1MA 4TXNA 1TJNA 2AJTA 3RS5A 4D9EA 4K6FA 1EI9A 1EWKA 1M6HA 4NIMA 3PQ5A 4ZVLA 3L4KA 3E58A 3O93A 4ALLA 3VKVA 1JHXA 1UWCA 2RBGA 3QBTA 2OK8A 3INYA 4NBLA 5CJJA 2G09A 5EIBD 1KZHA 3R41A 2I0FA 3CN9A 1TW2A 3BD9A 4YUVA 3VR2A 1Z9BA 1EDOA 4X1IB 3KDPA 4L9RA 4UDYX 3QTTA 5A1JA 1L7MA 1HE8B 4B6SA 2ZROA 3I76A 1VI6A 5BYAA 1N2CE 1E1MA 1WCWA 3A1NA 4IYRA 1YT5A 5T7BA 2CNOA 3PRJA 1CB7A 3SY8A 3O9MA 1WMAA 1ZD5A 2BSAA 5JS6A 4BZQA 1V2GA 4DHWA 1JW9B 2PRKA 3F90A 2WD7A 4L5CA 3RPEA 3N7AA 2B8EA 1NRXA 3SVLA 2YY7A 4NX2A 1OI7A 1RPZA 1ZVVA 3ASVA 4CLHA 3KVRA 4OA5A 2PMBA 5KYXA 1ZW1A 1Q92A 1WETA 1GY8A 4F2WA 3NBAA 5L6MB 3NTRA 4CCYB 4FFBB 3LYHA 4O59O 1T3SA 4C4AA 3ZXSA 1MGOA 1FYFA 4FDVA 2W4MA 2XD9A 2D7DA 8MHTA 4A82A 1YNSA 1A1SA 2AOVA 2WM9B 3GJRA 3JQ8A 3GDOA 3MBIA 2ZR8A 2NZ8A 3ZDXB 2B1QA 1TADA 1I4TD 2FRDC 3EXG1 4PFQA 5GV7A 1WABA 1FNSA 2B78A 3C8HA 3DE4X 4XWAA 5FWYA 2ODAA 1YJBA 4LXYA 1V7CA 5L7WA 5AXDA 3QM1A 1J33A 1ENYA 2P30A 2PUHA 2F55A 2PGNA 2YYSA 1LBIA 3BSYA 4EITA 4PBTA 5IKXA 3KHTA 4ENSA 1GAJA 1YDEA 3D1JA 2OHXA 3KZNA 4TSKA 3ZQKA 4ZO7A 4EVIA 5J47A 5K6TA 5GADl 3T7SA 4L4UA 4TLBA 4JXJA 4PHFA 2O06A 1CUUA 5SYNA 1XYGA 2QBYB 1WWKA 2HT1A 2CJFA 2GN0A 4LJ4A 1VG1A 2VDKB 4Z2AA 4H0NA 3TECE 2W6ID 2WKRA 3FNHA 4NK4A 3HJUA 2AVNA 4K9DA 1U7WA 1UM9B 1KMHA 1XKXA 4Q4HB 4DJEC 1I2AA 1H22A 3KTAB 3NOVA 5LOVA 5IM5A 3AU8A 2PGAA 3ZDBA 1PWXA 1C7JA 1KO4A 4OQLA 3QWAA 3N5KA 4DARA 3THYA 5DMXA 3MJEA 3AZQA 3AF3A 2WWVD 3T3GA 5DSTA 4WBNB 3ZU2A 5I7HA 4XFKA 4D43A 4DJ5X 4BGDA 1LDNA 1JECA 3AHGA 1SY7A 4R2WA 4IIBA 2HF8A 4S35A 4NEQA 4ZTBA 2PBZA 5H1YA 1Y98A 1CDZA 2ZUBA 1Z0KA 3M6XA 4DMRA 1G55A 4MWBA 1YA6A 4GUDA 2X8LA 3QFSA 3WWDA 1QCYA 1VI2A 1LU9A 4G25A 2ZAMA 1JJIA 2Q6LA 3L8YA 2JW5A 2P4QA 4B0PA 2J9ZB 5K3FA 2VH5R 4BMVA 3A2KA 3PNPA 1N92A 3WYGA 4CM8B 4F3NA 3GZ4A 3T9BA 3WS7A 3GEEA 4ND2A 4QC2A 4XDZA 2ERCA 5EHXA 1TQDA 4C7XA 1I5OA 3KFXA 4UMFA 2HO4A 4HVTA 2PUGA 4JLVA 1FFYA 4QODA 1R0BA 2QHXA 3G2LA 1QORA 4BO2A 2GZDA 2FW6A 1XXHE 3EUWA 3HCEA 3UNXA 3TG2A 5KKAA 1OXBB 1Z3CA 2IKQA 2W6JA 5B6PA 1I80A 2IP1A 3MTQA 2BEWA 2BFWA 1MJHA 1KEWA 4N3CA 4Y98A 4YO7A 5TPWB 2AXNA 4TSRA 1PYOA 3SN6A 1RE1A 2R84A 5CIWA 5J4VA 1U2ZA 4ODIA 2QR3A 1ZH2A 2ZUSA 3CZRA 1QFJA 3DB2A 3OTIA 1HQDA 3P9QA 2QN6A 5IAAA 4YJDA 4L8FA 1T6YA 2V55B 4QUGA 4MS4B 1KAEA 1KBOA 2IYNA 2V97A 3RAEC 1QQ7A 1G5FA 5LZ5A 2W58A 1X1BA 4HN2A 1QTNA 5IWAB 5F5XA 5IVKA 1NLZA 1FDTA 3DE6X 4L5JA 1R16A 4UTXA 2WSBA 2L0XA 4KVAA 5BNFA 2ON6A 4J03A 4C07A 3S0JA 3B1XA 1J00A 3UJ7A 3ZOZA 5LR6A 1EVEA 3ODGA 4IIEA 2JIDA 5DWVA 2WKPA 2DFVA 3WIDA 2PQ6A 1BQ4A 5BN5B 2RC5A 5LUAA 3B6IA 3DCNA 4DV0B 2QVZX 5B55A 3GD5A 5CX1A 1MVLA 1XLVA 4IIYA 5AVXA 1KGDA 3DEJA 1UJ6A 1VIYA 2QLNA 3QU5A 1LLDA 3FNEA 4DEYA 3UK7A 3EGVA 1FDWA 4X3PA 4B3TB 3GUCA 2ZKIA 1CS0A 2FEMA 4KIGA 5IT4A 2Q3BA 4WZZA 2CV0A 3AIOA 1OXKB 5JE8A 4II7A 3HXTA 1ES9A 1WV0A 2XTMA 2VPXA 1TO2E 4WK6A 1YBVA 1TT5A 3TR0A 3UK6A 2X9VA 4FN4A 1T4GA 1E7YA 1LLQA 1XBTA 3BIWA 3KJFA 3MIIA 4JLOA 4EGAA 2WQ7A 2VN8A 4MXDA 4MZDA 4PVDA 1AK2A 2OHIA 4M38A 3TDNA 3WMFA 3GVHA 4YUAA 3PQ7A 4XOUA 4BMPB 4GI2A 4AS3A 5CLQA 3H9JA 1G5PA 3D4IA 4LBWA 4AF7A 4OB7A 3EF1A 4PRKA 3RIXA 3RASA 5LU9A 3HMKA 4L3OA 3ACCA 3L0DA 3CW9A 4IGFA 3E9MA 1ZI6A 2QZPA 4B47A 1MC8A 2HLDD 4I08A 4P4TA 4U5XA 4DG5A 1V8PA 3UM9A 4EF6A 2CT8A 1RXIA 4R8KA 2DGDA 1J6UA 4HI0E 1XTPA 3C3JA 3EZ7A 4XAQA 4FYPA 4AMUA 4RO0A 4DOMA 2IGBA 2WOOA 2YJ3A 3HABA 5IVDA 3BZBA 1KFJB 1P62B 5PGMA 3A4YA 3BJIC 3IEUA 3ZXYA 2DQKA 3WE7A 3T1HB 1DPFA 3ZJUA 4ND8B 4BDSA 5CDYA 3I5XA 4NLLA 1DXOA 2IC5A 1HG1A 1RYZA 3D2LA 2WG0A 3EPKA 1RTKA 1BCSB 2J48A 2PU5A 3TZKA 5EHQA 4F9GA 2HHLA 1XB2A 1F2UB 1RE0A 4EI8A 3R6GA 1FSPA 1H2AS 4A5OA 2ROQA 2PUCA 5A05A 1SXJD 3C3XA 2AS0A 4FEEA 1B3RA 4MVYA 3GCDA 3B3GA 2PM8A 1FTQA 3B13B 3DXXA 3EODA 2O3RA 1VKHA 3HKBB 1H0KA 3H9UA 4ILKA 2XGSA 1YR3A 5A9RA 3T9FA 2BI8A 4AB1A 2VHUA 5K8LA 4UVGA 5B58C 3E9CA 2OUKA 4JBNA 2X41A 3GRRA 1XKQA 5ICFA 1Q74A 4Q0MA 3GUVA 5CFZA 2H06A 2Q50A 1XZFA 2Z04A 4JB2A 4MYUA 5ULLA 3RT1A 4D96A 2VK2A 4JEHA 3OC6A 1RAAA 5G2OA 3WSTA 1CF4A 5HIJA 4WZBE 3K7EA 4D9HA 3U13A 821PA 5BV8A 4ARSA 3KJQA 1Z5NA 4BX8A 4X9XA 4YY3B 3FB1A 1P5RA 4HRXA 1JZTA 5FV7A 3F74A 3WB9A 2EZ4A 4BQIA 3IQEA 4FZJA 1HWYA 1I51A 4X91A 1KJQA 2C2WA 1GTG1 2NU8A 3TLCA 1KF0A 1JVSA 1EFVB 4G1FA 4CCWA 4D7AA 1QE5A 4DLNA 2O8VA 3PCTA 3K6SA 3H3JA 3RVLA 4ENVA 3NR2A 3LX4A 3VZQA 1M0EA 4IJWA 3DMNA 5AVQA 5JUWA 2C9CA 2IE0A 3BGSA 4WT7A 1R4NA 1ZRMA 3I6MA 4LSGA 1EFPB 2W2MA 4RZ2A 2PS1A 1GWNA 1QOPB 1YHYA 2AOTA 2LCIA 5A7FA 3ZWVA 2WAXA 3CRRA 2VDJA 4KDFA 4RZSA 5EINA 3ZWAA 1OH8A 3EVTA 5ECYA 2VA8A 3TZBA 3DOEA 4O4LA 1P75A 1YOVB 1DDIA 2PSSA 3FWNA 2QMEA 4D9JA 4HWKA 3QLTA 2GHRA 2M9MA 1M5RA 5JVDA 1G4AE 1XXHB 1R0YA 4XQEA 2VUSA 1P3Y1 2O3TA 2D59A 4RZHA 4ZZ0A 2IYTA 3WGJA 2EL7A 1RMTA 4F4HA 1IAVA 5D00A 4ZYUA 1LK7A 5K8VA 1DKQA 3AEZA 3G9XA 3PZBA 2FWPA 5ER9A 5TEVA 2HJRA 1JGTA 3UAYA 2WUEA 4Y2QA 4J0EA 2AQIA 1RLOA 3VNBA 1YR2A 2Y9PB 2G82A 2NZXA 3CUYA 4LE2A 2J3LA 4W5TA 2BE7A 4Y1RA 1KO1A 4FCTA 4MWTA 4ARZB 1O8CA 2K2QB 3WBFA 2EJWA 3LW7A 4BLQA 1VSVA 1KIFA 2X86A 3LUFA 3KEFA 5DX8A 1SC4A 4ASUD 1DCTA 4RXUA 4YDSA 5FR2A 3ELYA 2IHNA 1QO7A 2CHGA 3PXEA 4WZAA 4FYWA 1LFDB 3FDJA 2ZRJA 4FE3A 3OZXA 4QTYA 1V0JA 1E2IA 1GKYA 1QNLA 2CE7A 2ISCA 3MTBA 3DUFA 1CERA 1JZQA 3PGMA 1SK9A 1ISMA 1SWVA 4BV2A 2FWBA 2YH2A 1HYEA 3IUPA 3NOQA 4HX2A 3TLMA 4NPCA 5E6RA 3LA8A 5M3BA 3OU7A 3RFFA 1V1JA 3VR4H 3KRTA 5ITWA 1EZ1A 4CG3A 2QVYX 3U4MA 1UWLA 2I34A 1E7RA 3OPMA 3NBYC 1VG0B 1L5ZA 1O94A 2BY4A 1C7RA 2JH8A 1QLWA 1ZGZA 1KJ8A 2DX7A 4YIKA 1B0ZA 5AXBA 1UZLA 1O9GA 2IYYA 2WABA 3LT1A 5E3HA 4FNOA 3ZJYA 4L0DA 1QAMA 5ADHA 1WX1A 2C5SA 2OHJA 3N75A 4UPVA 4XSGA 4I1VA 4AECA 3NTVA 4B3IA 5AVTA 2YICA 4CUJA 4BEWA 5B53A 4BTEA 3GRKA 4V0OA 2B8NA 1NLMA 1SOAA 4BKMA 2JJQA 3JQ6A 1Y7LA 2VHXA 5FPPA 1NOIA 4KNVA 4JI1B 4OI4A 1KEEB 5DTRA 4L72A 4EYGA 3C3MA 3F7NA 1T5TA 3VTZA 3I9LA 1OX6A 1R8XA 1SHZA 5CVDA 1WMBA 3GQBB 3MWLA 3KZ1E 2HEIA 4KR3A 4PFJA 3PIDA 4O1HA 3QPDA 2XVAA 2XRMA 2C2GA 3F5MA 1KL7A 1IM8A 5K03A 1G0NA 4QOHA 3SCZA 3ZK9A 3HQ4O 2E7ZA 1U8UA 4K0KB 3H2KA 2G77B 2Q9AA 4UNNA 4I4TA 2ZSFA 2P5YA 1BTOA 1N0HA 4JJIA 1WCXA 2DRIA 2IHVA 4N12A 1N2IA 2JHGA 4CCAA 4WERA 2H54A 4C76A 2Q8QA 1AQNA 1SQ6A 1XVAA 2G71A 1R1DA 2VS1A 3GDWA 4BQRA 4ENTA 1LF5A 4ZHQA 1NBME 4F4JA 5A3QA 3I04M 2JLCA 5JAUA 3PUIA 4IPTA 4O4HA 3WGOA 5EIXA 4AUMA 1IY1A 3AKCA 3N7TA 2PD6A 1O6BA 4FMDF 1Y8QB 4TX1A 1QH8A 2WZBA 3O8DA 4RGVA 3IHLA 3ABSB 2AX4A 1KPGA 3OPVA 1G2PA 1K6EA 5K01A 4BNJA 5A3JA 1GEEA 1FJGB 4NOJA 1AT1A 4FILA 2IS6A 3KV1A 4YWJA 4FWTA 1KAOA 3OY7A 3VKUA 3HXQA 1T9BA 1JT2A 1IY9A 2XTZA 1GP2A 4F5YA 3BRQA 3OE1A 4PPYA 3PJRA 4J1TA 3SHQA 3KYBA 2O0KA 1WDWB 2ZJ7A 5JR3A 3EH1A 2HMSA 1EK5A 3VOSA 2XKAA 1X1RA 1Y4UA 2JF0A 3ZV6A 4HDOB 4LUCA 5JRZA 2JLBA 1E1NA 1U8YA 3C3AA 2C5GA 5I45A 2P3OA 4WZBB 1MHPA 1JKJB 1EJ0A 2WT8A 3D6HA 5DK6A 3SOZA 1YCFA 4EDHA 5CFQA 1T26A 3AP3A 2CBXA 3QLUA 2EZTA 4H7HA 5EZQA 4HT3B 1BFDA 1K8XB 5KWEA 3QEBZ 4OO3A 1EBUA 1L4LA 1LGYA 3SSAA 4E1AA 4WUVA 1ZRHA 2C82A 1CY7A 4BFVA 4LJAA 2P91A 4R3WA 2GPTA 3HJFA 4QPPA 1GQ2A 1KP3A 2HIAA 5CJPA 3QF4A 4QKQA 4OI0A 3UVEA 5KYWB 3JTEA 1LZLA 4BV8A 2O2XA 2FPGB 4JDPA 2X5XA 2M6KA 3ELWA 4PC7A 2OHFA 4Y7DA 3AO0B 3F1LA 4OH7A 5IYZF 1C1HA 5DN6D 3AETA 3AVUA 4QLOA 2VK8A 1C0LA 2QVBA 2KLBA 3OCWA 1H2EA 3EPPA 3PT5A 1YB7A 5TPZA 3W6PA 3I8OA 2RJOA 3AY7A 4FWIB 3ZE7A 1FFDA 4XIJA 4UDXX 4IV5A 5JMTA 1IM2A 1SBQA 3FMPB 5EUBA 3RUPA 4DCTA 2VZLA 2JGLA 3H16A 4GLBA 1XNQB 1RMYA 5H68A 4MGIR 4UMDA 5IH7A 1RNLA 1JR3E 1N3BA 3GFRA 1UBHS 3MJFA 5EJMA 1XCJA 2F1KA 2C7GA 2OZPA 3AB3A 4F93B 1ODSA 1LVGA 1XRNA 1T36B 3X43A 2WMNB 2B98A 1KY3A 2ZK7A 4WFJA 2O50A 5LP6F 4L16A 3BSFA 3HLYA 3SX4A 1V7QA 1GCGA 3OQVA 3PUVA 4R1PA 1QF6A 1QFMA 3TQCA 3S1SA 1LF0A 1C4KA 1ZOOA 2ZZKA 2GD6A 3EC7A 1L7BA 2YYYA 1GGMA 1OREA 1OZHA 4Y1EA 5CH3A 3AP1A 3X3HA 4XWGA 1ZD1A 4OAOA 4QEDA 3WBJA 5HE8A 1E2MA 4EENA 3OP1A 3O1JC 5CYFA 5T8KC 5LMZA 3UXYA 2C5BA 3D2AA 5DN9A 3CNHA 4LJ5A 1JIVA 1Q57A 2A1TR 2H51A 2JIMA 4NU6A 4RGBA 1AQJA 1MPTA 3TJZA 4MV7A 1PD0A 3KTDA 3ZW9A 5ITZB 4F6CA 4JQSA 1EH5A 2CKDA 2AK3A 3OFVA 2C8KA 1ZGJA 3IO3A 4HRYA 1YQGA 4GWKA 4IOLA 2Q41A 3FYUA 2JZNA 5H80A 3U48A 1W94A 1TJ5A 2VRNA 4JOCA 1WUHS 3ETHA 5GIOE 2EC5A 1ISSA 3OPYB 4GPAA 5AUPB 1KK3A 4P53A 1LFAA 4V1CI 2WQ6A 5G0TA 4CMCA 3B5EA 1F51E 4AMBA 4ZOBA 5D7NA 3VDMA 1FFGA 2J6CA 1OYYA 5BSEA 2BV3A 1DQZA 1RYHA 3VR6H 1E20A 4LGYA 5IM4A 1E4VA 4LZAA 1UBCA 2P6MA 2Z6VA 3G7UA 2HU7A 4OXKA 5LUBA 2W90A 5KJ6A 4ETWA 2CMDA 1TCUA 4M46A 1WEHA 4JSYA 4QICA 4OH1A 5EUQB 3QX9A 4AFNA 5FI5A 3OTWA 3AR5A 4BO7A 4NE9A 3CRQA 3DPSA 2JAPA 3C16C 4N6GA 1MOZA 1K8YB 3ZY5A 3DXZA 5EP2A 3DFMA 4GLOA 1KBZA 3PNLA 2IYLD 1GUAA 2XYHA 4I81A 2YOHA 1PNVA 4LS3A 1W87A 1P61B 2I9PA 2O1XA 3PSAA 4G5GA 3KUUA 1XZGA 2H1WA 2P5SA 1TYDE 1JSLA 4FDLA 4B44A 1XMSA 2FFQA 2ZRDA 3DBOB 3QMPA 1L1FA 5JDIA 5KTMA 1EK2A 3KEMA 1UZUA 3JQRA 4ARUA 2DUJA 5T4FA 1I3CA 3R6LA 2X2FA 2EP8A 2GCOA 2IUEA 5BSVA 1LX6A 4RABA 3UHOA 2KLHA 1ORRA 3O4IA 4GVPA 1IHYA 2GZ2A 3QPWA 5AVWA 3CRMA 2Q45A 4RULA 3E3LA 3U7GA 4J3NA 3LHSA 4KXLA 2KYRA 2FZLA 3IT2A 3IERA 3I4LA 3ND9A 2EKZA 3FCYA 4B6EA 4BLSA 2BCEA 4LHWA 1JKXA 2ICAA 4UZFA 2PTHA 1M2VA 2ZE8A 1LK5A 4KBGA 4M4SA 2DUUA 5CFOA 2P9JA 4MUHA 3OTGA 3RHTA 2EQ5A 2DQSA 3FVWA 4LKRA 1OVMA 1GRRA 4BCCA 3H17A 2FPUA 1VYUA 2F43B 1OA1A 2QWXA 2XUHA 5K4HA 1RYYA 1JH9A 3I42A 4PGMA 2XODA 3SX2A 1CUWA 2XBLA 2SHKA 3E7WA 1G66A 1NUUA 5EQFA 2IGTA 2F62A 4ND3A 2BI4A 5JPDA 4N6NA 3LJKA 1XZBA 3P0HA 4RX1A 3A1VA 1FX1A 2J1LA 3UA3A 2G6BA 4EHKA 3I73A 1XEAA 4BVEA 3BB3A 3SJUA 3BL5A 3O4FA 5EMNA 2FZEA 2W93A 1M6YA 2JAXA 1HDYA 2XNDA 2A6PA 2A0UA 1D2CA 5U9CA 4B2LA 3BMNB 2HL6A 1N36B 1SELA 2OXIA 3V4LA 1RYEA 4F6RA 5AW2A 1EUCA 1GAXA 2GDZA 1HR0B 5H59A 4BC0A 3B9QA 1W4ZA 4ONEA 3ROZA 5ICEA 3IMEA 1BCRB 5H8WA 1T3LA 4URZR 3CX7A 3UMBA 1OWOA 1PZHA 1R4MA 2BUCA 3C8UA 3OUTA 4PQYA 4WIAA 1ECFA 3RV3A 4C4XA 4E22A 1OXUA 1UBGA 1F7UA 1VHJA 4P3OA 3ML1A 2ZSJA 3DDHA 3RADC 1EPUA 3AZPA 4IHJF 1K75A 1HRDA 2XXJA 3HL4A 4E2ZA 4XCQA 1D0IA 3ENZA 2DH6A 2HA7A 4S2UA 4UHEA 5LIPA 2A4KA 2XCSB 2IDJA 1CPYA 1VKJA 1VL2A 1EUDB 2WIGA 3S2FA 1HETA 3I05A 3IB3A 3L1JA 4G0XA 4TXHA 1ZCBA 4ZDJA 1J49A 3FYTA 1CZRA 1MUUA 1NQTA 3M6MD 4NZZA 4RJJA 4XYGA 5I9IA 2QD4A 1LPSA 1LD3A 2H92A 4BMNA 2XMSA 3QELB 4GRDA 1Z63A 3DNPA 1PR6A 3K96A 4W8OA 3A4TA 1UMKA 3H6HA 3O94A 4Q15A 3RYFB 4MYHA 3C5WP 3O4HA 5DYYA 1NJ5A 5H70A 1QIEA 3VHLB 5EMLA 4YJHA 4KPEC 3K0BA 1JFSA 1PQUA 2LPMA 2Q2QA 2XQVA 2OBMA 4GP9A 2ORWA 4IFIA 1F8GA 1RD4A 5GTDA 1CZUA 5IAOA 3OA0A 3QUCA 2FPIA 1EFHA 4R8LA 3L8EA 1HLDA 2ZB2A 1OZGA 4S1VA 2Y8EA 3KYCA 3NKVA 2V7UA 4I5FA 1W0KD 4K26A 4M0LA 4O5OA 1YVDA 3NVAA 2FUCA 3WDLA 2BMVA 1A98A 2JHPA 2ZBUA 2I8LA 5C8DA 1QU3A 1ZU5A 2PWAA 5T3UA 1U98A 2G1AA 1SN7A 4FDAA 5EQJB 3EBPA 2ZANA 4WNAB 4H1WA 3BCHA 4RY9A 2O3QA 2V3WA 4UOQA 1FRVA 4HB0A 1E66A 2Y1FA 2W6MA 3JALA 2OV8A 1G3RA 2ZIVB 3ZDAA 2BUAA 1N9GB 2AFHE 4LPSA 4MUXA 3W2HA 3OO0A 1D1TA 3OHPA 2ZIEA 3WK6A 2VHZA 1WQ1R 2QRPA 3KALA 1SZPA 1W96A 3CB2A 4QPJC 5HOQA 3OTQA 1V41E 3DBLB 2B99A 2IS1A 2VHJA 3RKUA 3LPNA 3MRXA 3TX2A 2PUVA 1GPAA 2IZ5A 3MS4A 4JBWA 1XMPA 4V0MA 2C7BA 4NY1A 4Q3NA 4ZVTA 5EYPB 4CL0A 4DDTA 4QAQA 3OZTA 1S2MA 3JQAA 2FSVA 3HYLA 1E94E 4AULA 3QWIA 4FX5A 4DANA 4MZXA 5FX2A 2FPKA 1JT9A 3KT0A 4KLRA 4FFDA 2PLNA 5EWJA 4KPFC 2HR1A 3MJDA 1U3TA 2FA9A 3LQYA 1N32B 4FGUA 2QDKA 1WXFA 3OOHA 1VBNA 2VHYA 1STOA 2QMZA 5TVKA 3TRJA 4KFRA 4KE7A 3GPDG 4HGNA 2N9UA 4J0IA 4EPRA 1NLFA 5DHPA 1KY4A 4EZEA 3ZHZA 1UC8A 2Y1OA 1XRLA 1MJGA 1JVNA 1X7ZB 1E4OA 2C99A 2IVZA 2B0JA 3EMVA 3MAAC 4I5EA 4M6WB 4TWJA 4ZREA 1U81A 1KARA 3KJIA 3ROFA 5BN1A 4P7BA 2G9VA 4RTLA 2J30A 4FHCA 3PTZA 5F51A 1WVIA 4BCBA 5HDBB 2C5AA 1E2JA 1YJAA 4OU4A 4RPLA 4F3TA 4TM7A 2QSZA 2UZIR 3FPJA 4QNNA 4ZZ2A 1THMA 4KH1A 2IEIA 5AJZA 3KD3A 1KDPA 3SSOA 5BV7A 2XUJA 4UNIA 4KOAA 1GRVA 1YRLA 5HF8A 2Z57A 5LNK1 2C03A 1FP1D 1RWBA 4UHBA 1GGJA 4BFLA 5FCDA 2VH2A 1EX7A 1RQRA 4MEBA 1L5SA 5EHIA 3WMWA 1CUBA 1XRMA 1NRJB 3H9QA 2IT1A 4MGEA 3CUKA 4O25A 2YWGA 1Y8AA 1ZMRA 1MIOA 2WHEA 3I6BA 3K70C 3T1NA 1HNXB 3K70B 3VM6A 2GGSA 4PSAA 1VHQA 5FHQA 2TMDA 2POCA 3MLEA 2JATA 3LHIA 1SXGA 2IYVA 3WWCA 4KLNA 2C95A 3FPLA 5HGXA 3IAFA 1KIAA 2B4YA 2BL4A 4HGZA 4YRJA 4Q4AB 4Y0VA 5LZ9A 1SUIA 3Q8KA 4LXIA 3L7JA 2AXQA 3L3BA 1CG6A 3IELA 1FYDA 5HGJA 3UV3A 3AHEA 4M8SA 5CPBA 5A0FA 3ZZ1A 3ZWCA 1J5XA 4CKYA 3EIXA 5LQRA 3P20A 3JQ7A 5CFNA 1QU2A 1ZSVA 2ZYTX 1B76A 3PD1A 1P74A 3OT4A 2WTXA 4RACA 2CV1A 5K6AA 1Q3KA 4JVSB 4GF5A 4PAWA 3Q0IA 5ALNA 2H1IA 3I09A 4OYLA 1JB9A 4LY6A 1HLPA 2GFIA 3FMFA 1C29B 2BEJA 3CINA 2YL2A 4JYMA 1D5CA 1G16A 3EVAA 3NNDA 1U4SA 1FDVA 5K3OA 1W2GA 1XWIA 2O7QA 3GNQA 3CMMA 4BV3A 1RQNA 5FXMA 3DXYA 4U7FA 3GLIE 4Y6QA 5CD9A 3NAZA 4KKVA 2QE7A 3PGA1 4RHXA 3CKKA 2KWIA 3AZOA 3VYSB 4P22A 3E6AA 3DR3A 4PNPA 1DTWA 4KXQA 2MSWA 3WXBA 2ZI9A 3AWDA 4Y2XA 3OP4A 4EPWA 5ES4B 3HKCB 4OG2A 4ILEA 1I0LA 3VR4D 3AONB 3SGLA 2GPJA 1NULA 5L40A 3MM4A 4L3VA 1YZYA 2JL1A 3I9FA 5HQ3A 2CMGA 4NYJR 3DSRA 5BNTA 1S3FA 4KMSA 4LI0A 4M8IA 2REXB 2IYRA 2C2YA 2CDAA 3FSRA 2FE1A 5BSFA 2VF4X 3D3QA 4RMHA 3HFRA 5IUJC 2QX8A 4HS4A 4LFBB 2A9JA 2X7HA 3U7FB 4EGFA 5BNWA 5K0GA 1SVWA 5AKLA 1VJTA 4DLAA 4CTKA 2WM2A 5DYNA 1KI4A 1Y3DE 2I7TA 3SP1A 4N8EA 1J2RA 5CGQB 3ICCA 3KPVA 5GJVC 3UA4A 4DDMA 4DY6A 1SC3A 4YP0A 2XOXA 3ADKA 2PYZA 2II6A 3QK7A 1EM8A 1X7HA 2FB9A 3EYWA 4FSDA 3D4BA 3V7FA 2PJUA 1P2UA 1UMDB 1A9XA 2X6QA 4BC1A 1GNSA 4O1MA 2QT9A 2OYRA 3HU5A 2WBLC 1UFRA 1TAQA 3TS1A 5LC1A 2AOUA 5L4NA 2RCYA 2OP1A 1P9LA 4OFXA 4PSDA 4U7WA 1J09A 4TSFD 2BFOA 4IZ6A 5AKYA 5KHOC 2IYFA 2WMOB 3HTXA 3H0KA 1MF7A 121PA 2OGTA 3OETA 5AKEA 3GVIA 4JA0A 1XWWA 3FVRA 4K9OA 4G97A 3RQSA 4ZIRB 1HT3A 1EUQA 2JRLA 2NADA 1E3EA 1NF3A 3GJXC 3ID6C 3B12A 3GXOA 1AK1A 2P9BA 4DXHA 1ABBA 1X8XA 4F06A 1M8PA 3C3PA 5EKXA 4PAQA 3IKMB 5K2MA 2Z9CA 4WLNA 2XB4A 2WB2A 3ROGA 2WTEA 4CPDA 4JJAA 2OZKA 4EY3A 4G0YA 2H63A 4F4FA 5FBHA 4RTKA 3F9RA 5LQKA 5AK3A 3P9XA 3IBGA 3DWEX 5F12A 1XTVA 1VJCA 4ACBA 2YMLA 3BD7A 1UDAA 2CK3A 5AM0A 2VK4A 5DHQA 4AZSA 4BQSA 3BUSA 4ABYA 5HUJA 1WAMA 4FFVA 1LC0A 1N2ZA 5EGNA 4RXMA 4JGBA 2JFVA 1XX6A 4TLMB 1XG5A 4RU1A 2IS2A 5FR1A 1L7RA 1ZRSA 3R09A 1EWVA 1NVUQ 1FVXA 5G1OA 1SCQA 2H7VA 2EYQA 2ODBA 2X0JA 4NBWA 2NU7B 2J07A 4J75A 4EG7A 5K0SA 3ED5A 2GEDA 3A3PA 1JYSA 2IW3A 4IXWA 5ALJA 2P0AA 1CQIA 4DLPA 1NW4A 2IXBA 4BZPA 1RWWA 3HDHA 2HRQA 2X8JA 5B4TA 2REQA 4EJ2A 3ECCA 3KR0A 4UUQA 3SKVA 1B41A 2VAMA 5DBOA 2L18A 5KYYB 5FI0B 1FVHA 5H3HA 1XT6A 2H1VA 1GKLA 1QB8A 4JFAA 4Y0AA 3BWCA 5E9WA 1H9BA 3ZHUA 2JI7A 4DUPA 4Z1MD 5FV4A 3VTKA 4R84A 4EAAA 2WF8A 4GWGA 1SU8A 3FR7A 1KDZA 5KC8A 3DQZA 4ZQFA 2VTBA 3OJEA 5D51S 4TTAA 1JHUA 5HIIA 2Q62A 3JSAA 2OQIA 2WF6A 1S6YA 2J4DA 3HXKA 2IZ1A 2GCEA 3UJHA 6GPBA 1RKVA 1YFLA 3TZEA 1BOOA 3TLEA 3QSGA 3C97A 5CH5A 2YWFA 1K7FB 3TUJC 3V4SA 1N5RA 3KBOA 5KU7A 1JLMA 5EWMA 5GOZA 5JS8A 2HSGA 2C7QA 1KHTA 2AXEA 1DIGA 3L9XA 1GITA 3ASZA 3GAZA 1P2FA 3U9LA 3NRJA 1Z4MA 2XZPA 2C7OA 2IYUA 2O0HA 3DT8A 3EFHA 3S5UA 4OTZA 1G8FA 1TUBA 3C6ZA 3WRYC 3KQKA 3HNOA 1GZ7A 1RXCA 2PZMA 4AJ1A 1V96A 3GJ7A 2X3UA 3STTA 3SR4A 5CDTA 2J09A 4DB4A 2BJHA 4RK0A 3IEXA 2R0QC 4F38A 2JH9A 2OB2A 3I9V6 3UK2A 4NE7A 1WL8A 1AQYA 2G1KA 1E9RA 4BVHA 2FWAA 2M1XA 2PUDA 4K6MA 1ZJ5A 4WKNA 4YLEA 3KLPX 3G79A 3R7SA 1HE3A 1RWPA 4A26A 1DCFA 2GTHA 4KXNA 3G2HA 4LRQA 4OJYA 3QJGA 3TVYA 3I32A 1PDVA 3LRXA 3TYXA 3GW8A 4MQFA 1P1BA 2P9GA 2YINC 3IT1A 1WHSA 4UCWA 2J08A 2WY2D 3VJKA 4KN6A 1YGYA 3WADA 4UHHA 3KQNA 3VDRA 1XQYA 1FJHA 2A5YB 2FN4A 5B4VA 2Q4BA 4G26A 5DNYB 4C43A 4G8CA 2CFIA 1ORWA 1YE5A 4MW0A 4QG3A 1RZRD 4PHCA 3OT5A 4YPFA 5FAXA 3MXTA 3WYNA 2NSDA 1E2HA 5TQVA 3SOPA 2EFHB 1KH2A 3ROQA 4C4RA 5FUXA 1L6RA 1PR3A 5KNBH 4O3MA 3F67A 3EZLA 1SG9A 1B93A 1V45E 3K0CC 2NZ2A 4G5HA 1Q5PA 2FW1A 2Y1CA 4NYJQ 1AM4D 4AJEA 1MEEA 1DMSA 2HK8A 4HHEA 1LY1A 1OIVA 1WBDA 2OB1A 3QF7A 1XDWA 3KOYA 4D99A 4W63A 1A9ZA 3N0XA 3VR6D 3VDQA 4HPWA 5ESRA 3Q1LA 5EVCA 3GBVA 3SXUA 1Y5LA 4U7GA 1CNMA 1VG8A 2IIPA 3FOCA 3MMPA 4XGNA 4LXTA 4RA6A 2P2SA 3H5AA 1TIKA 3ZD9A 4E46A 3KZKA 3B1ZA 2NAFA 3D43A 1V95A 3MZ0A 1G6HA 1NNLA 1YQXA 3HCPA 3NKFA 3PL5A 3PXXA 4LCJA 3ANTA 4U2CA 3SQMA 3UT5A 2O8BB 5AVSA 3R3VA 1HBJA 3CZCA 3EMDA 1KZ7B 2WJ4A 1N3IA 3BRSA 4N3GA 4JL6A 1V47A 2GBLA 4W1PA 5K8JB 2DCMA 1E4EB 4DJAA 2HF2A 3R5XA 2GK4A 2H9AA 1AZTA 2OORC 5AM1A 1VL0A 2Q4TA 3HZZA 1C3XA 1P5HA 1MX3A 1R74A 3GRUA 4GPTA 3O0TA 1E0JA 1OLXA 2C0CA 4RCVA 5D01A 1DFIA 4D97A 5D84A 1ZM3A 3ZV3A 1PT6A 5FDFA 2OENG 3DHVA 1M2JA 2WYOA 4CNBA 1P17A 3TNLA 3TTTA 4B71A 4E5YA 5A5FA 1O57A 5E3IA 4AC9A 7GPBA 5BOSA 4O2AB 1MRZA 2PFSA 1SPBS 3D3JA 3VU0A 4XUGB 1K98A 2GEVA 5H7XA 5J4KA 4LY0A 2R65A 3LL4A 5J2UF 1GXSA 5CJ2A 4YRZA 3QOFA 2JGKA 4X1YA 3PQ2A 4ZVVA 1VPVA 1Z22A 2XIQA 4M9CA 2GM9A 1B3BA 4OQNA 5G0WA 4Y7CA 1WP9A 1MOSA 1X9GA 1YZHA 3OCVA 1N1GA 2B30A 2D0DA 3CF4A 3FPBA 5CH8A 4ARAA 4C0QC 3FOBA 1O9HA 3BIJA 2V7QA 1GG8A 1U5BA 1W8DA 2A8YA 2AZTA 4F5EA 1FNMA 1DQRA 1YA8A 2HN9A 3EGDA 3ND7A 3REOA 2J3HA 4KE9A 3RVPA 3ZU3A 5KWIA 4D0GA 3BXOA 3QV1A 4XVUA 3K71B 2WRZA 4LZLA 5DNCA 2LKDA 2VKQA 4RD3A 3UC5A 4D92A 2BGUA 3UICA 2WR8A 3GWZA 6ADHA 1QIIA 3MTEA 3ORRA 4IP0A 4KXVA 5GGYA 1MO3A 2RHWA 1PJ4A 4KO2S 4ECAA 2Z1DA 4J2TA 4HYYA 4UEQA 2CDCA 2PRZA 2PWPA 3MS7A 4QIHA 4M36A 3MJSA 4YIHA 2ZRMA 1IWPB 4ZQBA 2QMQA 1DDGA 1OWPA 1V8OA 3TW8A 1DEHA 2F9MA 2I71A 4DA4A 1DZIA 1MAVA 2ZT7A 5IEBA 3UUWA 4RA9B 5T41A 3BWDD 5CB8A 4E12A 1YB4A 2BRUA 4XIYA 1XA0A 2EARA 2DKFA 2GBFA 3A70A 4ND1A 4YASA 4IKPA 4K88A 5JH7F 3OZWA 1W85A 4G0PA 2NP6A 1MAWA 4FMPA 4O2BF 4D4MA 1P77A 3BE5A 3ME5A 5K0NA 4FSHA 1RYFA 2B7LA 4HP8A 1M2OA 3NAQA 2FWJA 3CGGA 4WY5A 3PE6A 3QY9A 2C54A 3CSDA 3KDSE 3Q8LA 4C7JA 2VWHA 2QLFA 1MV5A 2OO7A 4RBNA 2D1TA 3H4VA 2ETXA 5CHEA 1BDMA 3RFCA 3TEFA 2I76A 4DMHA 1II8B 3FVTA 3GYBA 4GR4A 2HXSA 5JARA 2CL7X 4EYQA 2F1IA 4AY4A 1X1EA 4MVJG 2I1WA 2ECPA 4TXJA 5I7VA 4PE5B 5A4JA 1T9GS 2HM7A 3O26A 1CY6A 2EWVA 2Y92A 1A7UA 1EAYA 1JJ7A 3N1UA 5IVIA 3KFLA 3LFUA 4BFCA 4JYZA 2OHVA 3LUDA 5KMGA 1T8WA 4MUMA 3AJRA 4BO9A 2IP2A 4ESOA 2AUNA 1LEHA 2WV9A 1BN7A 2ZKLA 4ZHSA 5A06A 3MHPA 4Q03A 4EABA 1RLIA 3GRPA 2IIVA 1XLTC 2DZDA 1FLAA 1B8NA 1CUCA 2EBWA 1L7DA 1USIA 1K86A 5J23A 5LQDA 4OJQA 5I7FA 3EDQA 2DTDA 2PS0A 2BE9A 4LOKA 2IK8A 2X0DA 4G4SO 1J4AA 1UMBB 3WO1A 5AJXA 4AKIA 1T9ZA 2ZPTX 1D07A 3M6FA 3MAJA 4PGAA 4QHSA 4B84A 4ZRDA 4CDMA 2V8BA 4NU5A 1WW3A 1L9KA 1EINA 5EWLA 4S3MA 1KOFA 1OXSC 2GTIA 2W6IA 3RVOA 3B2QA 5KNLA 4D3ZA 4IW3B 2I6XA 3CCFA 3CMCO 5F7XA 2ID7A 3EK2A 3WHLA 3PEYA 1E4YA 1RRPA 4RZ3A 5BNIA 2KMLA 2EW1A 4U0KA 3PFKA 4KO4S 1PK9A 2CXPA 2ZUUA 3GX1A 4F1WA 4B2YA 5BVHB 4BU0A 2QQ5A 4DIDA 1M1YA 2HCJB 2M2IA 2O1WA 5BY2A 3KSAC 3JVVA 2R00A 2EG5A 3HP1A 4HRVA 1ML3A 3LWNA 3NHZA 5BW5A 3LV8A 1D4OA 5CBPB 5JAOA 1YUNA 1GYQA 3ZY4A 3QTLA 4ID3A 5INTA 5DJ5A 1YQTA 4D57A 3QYFA 3SK0A 2ONCA 2FMUA 4JJ6A 5CCXA 2ZJAA 3I5YA 3DV9A 4OP1A 1HRKA 2FGKA 4BX9A 2E21A 3IV6A 1WA5A 1MXFA 4MQEB 1LPOA 4RGQA 2ONZA 3E9NA 5DCUA 4G0UA 5EPUA 2VCYA 4C4PA 4CMEA 3A6FA 5IYZA 3DL7A 2W2NA 1Z88A 1K5HA 5SY4A 1GTZA 1WUJS 2YWXA 2PYIA 4LHSA 4Z1OA 2CNNA 2C2KA 3GMSA 3L7MA 1IFXA 2RAFA 1H85A 4MV1A 2O8NA 1KYQA 3IA7A 2O9JA 2O8FA 3QVKA 1XJ0A 2QRLA 4G1MB 4WX2B 1NUTA 3HUEA 2XWJI 1LSSA 3VPDA 4Y2HA 4FFOA 3PUHA 1USKA 4LVCA 3I9MA 2C9YA 1YS4A 2HMUA 4TTIA 5BOVA 4B4DA 4DIFA 3THXA 4CF4A 4ZEOA 1T8YA 2ZRIA 2YVAA 4ABTA 2YY5A 4AWAA 5I4CA 3TN7A 2UYCA 3BWYA 3K92A 4K03A 1JEQA 1KPHA 1O95A 3LWDA 2HLHA 3OZGA 4LXGA 5L3RA 2B1IA 3FTEA 5DASA 5ALOA 5AOCA 3ONEA 2BEVA 4DCUA 1OKKA 3M2TA 5LP6A 4L22A 1M33A 1M54A 4RF5A 4RH1A 2DULA 1V48A 1BU8A 4AG6A 2RK6A 2PANA 2ZR9A 1CKEA 2VXYA 4FHZA 4CR8A 5BSHA 1RT9A 4DLZA 3KXDA 1A5BB 1JH8A 4ZDWA 1SHJA 4TTJA 2Y1GA 2HSWA 2JD0A 3QXJA 4YRNA 1E5DA 1HDCA 2HXYA 1UFOA 4MAAA 1AKWA 5E9AA 5LM3A 1MFZA 1XRPA 5CB0A 4N47A 5JJBA 3EXFA 3GRAA 3RLIA 2R8OA 1I3KA 3H75A 2X77A 1P3JA 1CX9B 4M76B 3ZE8A 3QIAA 3WA7A 4ZU1X 1UKVY 3AR3A 2JGEA 3HACA 3GLHA 5JY6A 4JBGA 3TIIA 4A2CA 4U63A 4YFVA 3RYFA 3PC8A 1TZ2A 4H3HB 5LXTB 2OO5C 2CJPA 1SVUA 3K9CA 2Z2IA 1Q1EA 1QJCA 1JJFA 1O97C 2J45A 3F6CA 3H1GA 5BVGA 5CT5A 5IAKA 3WLIA 2A7QA 1NHWA 1I01A 4ZAXA 3M6VA 2FV8A 4F9EA 2Z3WA 1IHOA 1R50A 4OBBA 1JTFA 4ZMRA 1G2OA 1XRSB 1CE8A 1MENA 2OCGA 4HUQA 2H1RA 3CSSA 3VOTA 3LI2A 4CM1A 1KYWA 1BYUA 3W8FA 1B4DA 1YAJA 2RARA 3AFNA 3FVQA 1JDZA 3O91A 4I4CA 4CQNA 1CVIA 2I4NA 2P1DA 1U28C 3ST7A 5IG2A 4DNPA 1KS9A 4X8HA 5AW1A 1LS1A 2G4LA 3I04A 4G4GA 1CLUA 1D1PA 1E3WA 1P0MA 2P68A 2Q6KA 2RHOA 4L57A 1AUOA 1KJNA 1Y3FE 2BLNA 5T57A 5THQA 3HBJA 3HYSA 3SNHA 2GNAA 4LMAA 4ZC8A 4HVAA 2C8VA 2GBIA 2OCKA 3DE5X 4F3KA 4ZQHA 3PHJA 2CLEB 5KX5A 5EZYF 2HA5A 4K3UA 1CJBA 4L95C 2XXAB 1U65A 1CUJA 3T15A 2WD9A 3EWSA 1TAHA 3LSYA 3RTDA 4DCJA 2QLMA 3CWCA 3T4UA 1T6NA 1VXRA 3CT4A 1OROA 1YRHA 3DLIA 4I55B 3V8MA 4ZEMA 5K8UA 2XMDA 2RC6A 2UUBB 3C5CA 1XXLA 3O1IC 3CNLA 1E7SA 1PVOA 4YRPA 1ULSA 4RY0A 4PZLA 3UAVA 1LJLA 3AINA 3MNFA 3K0FA 4TWAA 1NMXA 3KYJB 5KSWB 1CNFA 1I7LA 2Z0MA 4KHZA 2MT9A 3KU1A 4KYVA 4RDCA 5AJWA 2V3CC 2JFWA 3KQQA 1JSCA 3CX6A 1WCIA 1IM5A 4BE9A 5DM1A 1JYEA 3V1KA 4QDTA 1SXJA 3LUPA 1W75A 3GOHA 3MT7A 3URMA 3FWKA 1HE1C 4UM9D 5LYJB 3W5VA 4OA8A 2LTAA 1KP2A 2FWRA 1AD2A 2R00C 1QB7A 3JQFC 3K0AA 3ZHXA 2ES4A 4C5AA 3TPCA 2HA0A 4O08A 3VR3A 5EP4A 4HWGA 3QKRA 4CKZA 3ZNNA 4H7PA 5LP1A 3OZRA 2O0LA 1EM6A 4TKVA 3RFVA 1Y6QA 3T8YA 2QB5A 3LVQE 2EFYA 2NT3A 3QWFA 3WIEA 4GKJB 4UMVA 3NHAA 4F1KA 5H9WA 4N48A 3OUZA 4N0DA 1M2EA 1TB4A 1WF3A 3K15A 3W8EA 1E9DA 4PS1A 3FSJX 3PTLA 2ZUEA 4URUR 1W2HA 2GFHA 3MTIA 4H6XA 1J9GA 3ZCTA 1Z25A 1HL3A 2ZB4A 4AMZA 1JLLB 2DR0A 2LDBA 2YV4A 2HK9A 3MCAA 4KYUA 1Z0FA 2HU8A 2IWRA 2ZXUA 2AR0A 5JHHB 5LA6B 1H4TA 1DKPA 2C5HA 1QANA 2I55A 2MYNA 1ZVKA 1Q6ZA 2NTNA 4C7OA 1S3IA 1KQOA 3QWBA 4GSLA 2KE5A 2P35A 1FDSA 2JDID 2QJTA 4IHJA 5SY6A 2QQ0A 2Z4TA 4TN5A 3PBKA 4L4ZA 4KVFA 3VZRA 4JY7A 1MVNA 2QRJA 1ZUNA 3VI4B 2Q2NA 3DCYA 1NF9A 1VCOA 5C3MA 3Q41A 2OXRA 1CY8A 3A14A 4BZWA 5LP6C 2XF2A 3DZIA 2AFIA 1PEKE 3DULA 5BYJA 3T7IA 2ZE7A 1BGXT 1PQ4A 1U4NA 2VJQA 4UM7A 2CNKA 1E9SA 1QOZA 1FX0A 3RVSA 5DM70 3S7ZA 1C0IA 2VYVD 4Q1VA 1TJPB 2G5TA 4Q05A 3V4VB 3OCCA 4M9XA 3FN4A 2XKJE 3PG5A 1QR2A 4DG9A 2Y76A 5H4HA 2BP7A 1XJ5A 4YR9A 3G2MA 4ANFA 4W4TA 3FTNA 2XT6A 4WXEA 4YCDA 4REQA 2YVLA 4CODB 2YW9A 3R0IA 2K4MA 2HADA 3KYDB 3FKQA 4JX9A 4RYDA 3H9BA 4FT4A 1OC2A 4GQAA 4ND7A 5LLSA 3SMQA 3CLHA 4PWZA 2VPWA 4LYDA 4GYWA 2H6EA 4W5RA 2DHEA 4ZVSA 1SU6A 1DC8A 3F5FA 4L75A 3B6MA 2YV1A 5IARA 2WZCA 2BFAA 4CG0A 2PN1A 1T5LA 3C3EA 2B37A 4NDAA 4WTOA 5FOSA 5A2GA 3NWPA 1PJLA 1JFFA 1EK0A 2J0EA 1VYHA 4GBJA 4ASUA 2UZAA 2XSZA 2RHJA 2BCJQ 2IF2A 2ZTSA 3QEJA 3STUA 2COUA 4DQKA 2X9GA 3PXDA 1G8KA 3F46A 4Q1EA 4MJXA 3RROA 1DT3A 2PUAA 3ZIAD 3OCZA 4EYKA 5KJFA 3A4VA 3FMGA 4OXIA 2TS1A 3FFTA 2ILTA 1GR0A 5FTWA 3UGQA 1XP5A 4BQNA 4DIMA 5AKHA 1UPTA 2JGDA 1CEEA 1CRQA 3EB9A 4AMYA 4IIJB 3IOYA 1NC3A 2YV2A 4M87A 1KTVA 5JQWA 1E1RA 3ZHVA 1JQJC 2P8JA 2R6GA 1R64A 4GBMA 3FYDA 1X7YA 2IYSA 2WD7B 2XE8A 4II3A 4R54A 3A9SA 2PEZA 3CNNA 2YZ7A 2E48A 4D4LA 3LUCA 3E27A 1QOQB 2BBSA 3G7NA 3LQFA 5KYXB 1MBZA 3NBZC 3R77A 3FZYA 2OCPA 3JZFA 1E2LA 2D2EA 1RACA 2OESA 3FA2A 4U6SA 2WPNA 2P6UA 3JQ9C 1X80A 4C1NA 4D5GA 4DUYB 2GKGA 2QRVA 2D5CA 1TFRA 3VI3B 3ETCA 1E6LA 1RJWA 3RRZA 2I33A 2WQZA 5BV2P 1M8KA 4UM5A 3UG6A 5MHTA 2JGIA 4RJIA 1V3VA 2E49A 5JXIA 3KUCA 5KNBD 3KSDO 2PMWB 1OXVA 5ENVA 1GJRA 4JWTA 1XJWA 2H2IA 3T12A 2PGJA 4BMOB 3G5MA 1TM1E 1Z34A 3DG9A 5FWYB 1VE3A 4BBZA 1FL9A 4DBLC 4HZIA 3U3ZA 4AM8A 2WZDA 4RUKA 5HCIA 3R9XB 1FP6A 1UOOA 5G40A 4QYSA 1NXVA 4DC9A 4KAAA 2WA1A 5DNAA 2B8WA 3LBNA 3QBEA 4RH0A 2BUBA 4OQQA 3NBKA 4UAJA 1H2YA 1V6SA 2OD2A 2V1XA 1QG0A 3O8RA 1Z2DA 2GO1A 3Q5GA 2Y0BA 2HSJA 2C20A 4JBIA 4H18A 5JASA 3GLKA 1ZDMA 2XVXA 3EJ6A 2OYSA 4CM4A 4EPTA 1YZTA 1RHMA 1SCUA 4W5JA 3Q10A 3LQQA 1OIWA 1R7RA 4YO8A 4BJ5A 3E8MA 1EP3B 4L2IA 4J16A 4LI3X 3LF2A 3KQOA 3UUEA 3OQMA 1W6UA 5LOVB 2BDUA 3EA4A 4G5QA 4DREA 1IZ0A 3L4BC 2QN3A 3JWGA 4MR9A 1AS2A 1EFRD 3F49S 3JD0A 5GONB 3GFVA 3MMNA 4FMCB 2BD0A 2EP7A 4FYXA 4WNCA 1B26A 1N1MA 4QYXA 4WK2B 1UDBA 4IDAA 1KAGA 3E9ZA 3KSBC 4UVIA 3RWMB 4W6QA 3AVVA 2PX0A 4K9SA 2NG1A 2WJVA 2ZWMA 2PQ2A 3TOXA 2BM8A 5JZMA 3EX7C 3EFOA 4FP9A 3CIOA 4JVMA 1HZZC 1PJ8A 2HH9A 4HQFA 1YE8A 5B3JC 1K89A 2RHDA 3G02A 4CFSA 3QE2A 4V1CA 3QU9A 1U8