3L8EA

Crystal structure of apo form of d,d-heptose 1.7-bisphosphate phosphatase from e. coli
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
185
structure length
185
Chain Sequence
KSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
pubmed doi rcsb
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
molecule tags Hydrolase
source organism Escherichia coli
total genus 63
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l8eA00
2FUEA 3ZX5A 3TLMA 4MUMA 2YMQA 3WKCA 4NV0A 5ALIA 3ZI4A 1RKQA 2ZBDA 5AI8A 3DDHA 4BNDB 2X4DA 3CZ4A 1VJRA 1F5SA 4EENA 2G0AA 1RKUA 2NO5A 2OBBA 4YCLA 3U7GA 1Z4KA 1T9ZA 3FGOA 1SU4A 4UAUA 4XE5A 4OCZA 2R8YA 3AR9A 2JAUA 1VJ5A 3AR4A 3WK7A 4Y3UA 2B8EA 3FM9A 3E8MA 2RARA 3QLEA 5A3RA 1SWVA 5IS2A 2I54A 2CFTA 1U7OA 2FUCA 2YY6A 3NAMA 3U7HB 2HCFA 5ALWA 5E0OA 3SF0A 2HI0A 2IOHA 2NO4A 5AKLA 1L8LA 2C8KA 1N8NA 3BWVA 4BYGA 3N07A 1RC8A 3QX7A 3NANA 3ET5A 2WHEA 4QJBA 5AW2A 3DNPA 5AI9A 5AKXA 2G07A 3M1YA 4CE6A 2YJ3A 4MWOA 2OM6A 1KYTA 2P9JA 3PDWA 1QQ6A 4H1WA 3NASA 4BX3A 2RAVA 3L0YA 5ALXA 1QQ7A 3MN1A 2IOFK 4HGNA 1Z5GA 3QYPA 1EK2A 1U2TA 1XVIA 3EF1A 5AW8A 5AKHA 3W5BA 2YFYA 5AM0A 1RQLA 4KNVA 2AGVA 1ZRNA 3N28A 3OCYA 2I34A 3N1UA 3L8GA 4KX5A 5ALUA 2FPUA 3WK4A 5ALEA 4EX6A 4NFLA 2FPSA 2HEGA 2BY4A 3NALA 4J03A 4J2TA 3I76A 3FZQA 1RLMA 3ZWDA 1Z4JA 4JDPA 5ALDA 1NRWA 5AVWA 1TA0A 4BNDA 2HSZA 3P96A 3S6JA 3A1EA 2W11A 1ZOLA 4YCMA 3U7EB 5AESA 1U7PA 1ZJJA 2O9JA 1T5SA 5AKKA 5AVSA 5AIAA 4DW8A 4I9GA 4HGQA 4Y2SA 3OTQA 1S2OA 4KYTA 4KNWA 4ZEXA 1MH9A 4NABA 2WF8A 1Z4OA 5ALRA 3SMVA 3W5AA 2YN4A 2WF9A 3KDPA 4DCCA 2EAUA 4EEKA 5AKGA 5ALPA 3KOOA 4HGPA 1ZS9A 3KD3A 3ED5A 1SWWA 3HLTA 2HDOA 5AM2A 1RMTA 1Z4QA 5AVQA 2B1RA 3QU5A 5AVZA 1ZD4A 5AK4A 3ZU6A 3FPBA 4BKMA 2HF7A 3QUTA 4BEVA 3U13A 4OHFA 4UMDA 3U7FB 5ALTA 2MU1A 2RB5A 1Z4LA 2HHLA 3RF6A 4F71A 2ODAA 4Y2VA 5AM3A 3L1VA 2FPWA 5AW3A 1WVIA 2B0CA 3N5KA 5ALJA 5AW9A 4UMEA 4UAVA 4BX0A 2C88A 3PGVA 3QUQA 4B6JA 2HO4A 3I6BA 4ZEVA 3W5DA 1ZRMA 4I9FA 3B8EA 1J8DA 4UATA 2QYHA 2FEAA 3QUCA 4HGOA 4L57A 2IYEA 2OA0A 2ZXEA 2FPXA 2G1AA 4ZEWA 3SKYA 4Y2PA 5A3SA 3QU9A 1YJ5A 4NWIA 3BA6A 4HGRA 2WM8A 2Q4RA 3NRJA 3QU2A 4E88A 2C9MA 1TE2A 5AW0A 3I1YA 1N9KA 3HYCA 1NF2A 3QU4A 2ZG6A 2HF2A 2PQ0A 1L8OA 1RDFA 2CFSA 2R8EA 4Y2RA 3ZVLA 4RETA 5AI0A 4CNQA 3NIWA 1L7NA 1CR6A 3L5KA 3WKEA 3ESRA 5IT0A 3AR3A 2G80A 4L6CA 1Z5UA 2WFAA 2FI1A 4C4SA 2HOQA 4UARA 4CF5A 4Y2JA 5AK6A 2PR7A 2ZBFA 4YCNA 4YIKA 5AW6A 2GFHA 1XPJA 4UASA 5ALVA 2NYVA 3WK5A 3UMCA 3U19A 2FPRA 4EX7A 2YJ4A 2IOFA 1QYIA 3MPOA 3ONNA 2W4MA 1TJ3A 2G09A 1LVHA 3ZTYA 2ZBGA 4UM7A 1YV9A 5AI4A 3NUQA 3SKXA 2Q5EA 1ZD3A 1TJ5A 4FYPA 1Q92A 3AR2A 4UU0A 5AVXA 4O8CA 1Z4MA 5AICA 2WF6A 5AK3A 2D2VA 3CNHA 4HAIA 1WR8A 3WK8A 3ZX4A 2P27A 2IA5A 1S8OA 4IG4A 3IB6A 4UM5A 3K1ZA 4Y2QA 5ALNA 3MMZA 2R8XA 2P11A 1LTQA 3L8FA 2GHQA 1RLTA 3FPSA 4FE3A 2I55A 4EELA 2Q4TA 4AS2A 5ALQA 3EWIA 4XOUA 1Z4PX 3E81A 3KBBA 1U02A 3OCZA 3WK6A 3MC1A 3IRUA 5AKEA 2B82A 4IFTA 3E58A 1EK1A 3ZVNA 2JGAA 5ALYA 2BDEA 5ALZA 2DQSA 1L7OA 2YBDA 3R9KA 2CFRA 1XP5A 2YJ5A 1X42A 3IJ5A 2YJ6A 2WF5A 3VAYA 2C8LA 4BX2A 3AR7A 5JJBA 1WPGA 1QH9A 4UMFA 1RLOA 1TJ4A 3L0CA 5AVRA 5AW1A 2HX1A 1RKVA 2ZOSA 5AVTA 1VFPA 4Y2UA 1RMYA 3SD7A 2YMMA 1Z4NA 3QGMA 3ZTWA 1Q91A 1YS9A 2AH5A 4OFZA 3M9LA 2O2XA 4GIBA 3AR6A 2JAWA 3SLRA 3QU7A 3B9RA 4FFDA 1RRCA 3R09A 3UMGA 1RQNA 3L8EA 3ZUPA 2CN1A 3B9BA 4L6AA 4C4TA 3DAOA 2FDRA 4YH1A 2B30A 2QLTA 2VKQA 5AVUA 5ALKA 4CF4A 3ZVMA 3A1CA 1YDFA 2JARA 1Y8AA 1WZCA 3PCTA 3I28A 4RESA 5ALFA 3WGVA 3L7YA 5AM1A 5AIBA 3ET4A 4Y2TA 2P69A 4XPZA 4UW9A 4NAVA 4G63A 2G08A 3A3YA 4Y2XA 5T41A 2RBKA 1O03A 2GO7A 3OPXA 1Z4IA 2JAOA 1RPZA 3W5CA 2YMPA 1K1EA 4YGYA 5AK5A 3QUBA 5AI6A 1CQZA 5ALMA 3WKBA 2ZBEA 3N8GA 2W43A 5AM5A 4BBJA 3UM9A 2R8ZA 5AHXA 5AKIA 4CF3A 2EARA 3WGUA 3ZW7A 4KX3A 4EZEA 2EATA 3D6JA 1ZD2P 2B8JA 2G06A 5AI5A 3EPRA 1JUDA 3PGLA 4UU1A 5AKJA 2PKEA 5FP0A 3ZWKA 5ALLA 3OCVA 4F72A 2AUTA 3L1UA 3OCUA 3J7TA 1QQ5A 1IWOA 3GYGA 4GXTA 4BEWA 2MSNA 2GHTA 5A3QA 3L0BA 4DFDA 5AKYA 1AQ6A 3F9RA 3QXGA 3UMBA 2I33A 5ALGA 3L8HA 5ALSA 1FEZA 4XQ0A 3R4CA 4QQFA 1YMQA 3WK9A 5AVVA 4JB3A 3EF0A 4HYTA 3U26A 2I6XA 3SHQA 4C4RA 3RFUA 3OCWA 2OYCA 1RMQA 2WF7A 1NNLA 3A1DA 3WKDA 5AM4A 3WKAA 4AS3A 2YMLA 1PW5A 5ALOA 3DV9A 1Z88A 4G9BA 3ESQA 5AW5A 4DWOA 1T5TA 2C4NA 1ZD5A 3AR5A 1L7PA 5AVYA 3AR8A 4PNHA 2B1QA 3E84A 4AP9A 5ALHA 4UMVA 2GMWA 2I7DA 4KN8A 1YNSA 1U2SA 4OD0A 1L7MA 3OCXA 2AMYA 3QNMA 2BDUA 1O08A 3KZXA 3KC2A 5AW7A 4Y2YA 5IT4A 3FVVA 5AKZA 1J97A 4YIHA 1L6RA 5AW4A
chains in the Genus database with same CATH superfamily
4JU8A 5BWBA 5J2UA 1Z39A 4QGAA 2V54A 4MUMA 2JLUA 4LVNA 1R0ZA 3QFFA 1KJNA 4PG4A 5F1OA 1AMNA 2ODPA 4YJ2F 4Z99A 1EG2A 4OYHA 3T7AA 3KSUA 4Y1GA 4PPQA 1F1BA 3UWKA 3WI7A 2Q2WA 1ZNZA 3DEJA 1KGSA 2GWHA 3IALA 1VJRA 5AUQA 4HSEA 1Z2PX 2LBPA 3FSGD 4FFRA 4M1TA 1ZEMA 3DEYX 4AAYA 4ES6A 4JI0B 3K0BA 3CR8A 1W2HA 4HPXB 2VK8A 4XIYA 5FTMA 1ORTA 1PDOA 3OA0A 1E63A 1G6KA 1BAPA 3HB7A 1AJEA 3DOCA 3SYTA 3PIDA 4S0ZA 3ZJVA 1N75A 1Z2NX 2VWHA 2I7TA 4B3JA 2VPTA 4YQFA 4PPGA 1FBTA 1I14A 1U8AA 1X7YA 2RKWA 3AHHA 3B5EA 1CERA 1Y1PA 2ZWPA 4RTSA 1SWVA 1MLDA 2OHFA 3QWIA 5EXEA 2Y1FA 3AUFA 4X20A 4BGUA 3U61B 1NDUA 5G1OA 2XODA 4J8PA 5B4UA 4F96A 2F9FA 3I53A 1OLSB 4POAA 4KFCA 3ZHSA 3SF0A 1C3VA 1AZSC 3SI7A 3EJWA 1EB9A 4AG5A 3MVEA 2G83A 2V03A 3TPZA 2FPPB 3C74A 4AN0A 4CVNA 4EVIA 1RC8A 1FX0A 5KYGA 3HJFA 1K3UB 2IE8A 3M9WA 1VIVA 2Y1LA 1KDZA 2JD0A 5KNBA 1XBTA 3F2IA 1DDOA 2OXFA 3QUAA 4FOPA 4LJAA 3VX3A 4H1WA 1LK0A 2B7LA 3HBLA 2HT1A 3FNFA 5CUQA 4JQSA 4RZ2A 1G9XA 3H5RA 3KJQA 1Z5PA 3PTLA 5ICFA 1A5AB 1ODTC 4RMNA 3HZOA 1EWVA 1G21E 5DB4A 1ZH8A 3VZBA 4F97A 1QGUA 4NHEA 2W93A 3SX2A 1YZGA 1JPUA 1Z0SA 1ZCJA 2FSVA 3RH0A 2Q5HA 2QTCA 2BBWA 3LW7A 5TNXA 4XVUA 4OB8A 3SNKA 1ZEJA 1YFZA 4WOPA 1P1BA 5IDYA 2PIDA 1E94E 4GYWA 1JEJA 2LCFA 4BRUA 2V9PA 3OLXA 1ZM4A 5U4XA 2NZYA 5IBPA 2YV1A 2BY4A 4QYXA 3UC5A 1F20A 3TJZA 3VX4A 3DUFA 4PCLA 2OFPA 4O4IA 4REMA 1H8ED 3A31A 4U5XA 1ORIA 2RHJA 1SZJG 3GUHA 3RSOA 3VJKA 4Z0TA 3ZWDA 1UPUA 1JAIA 4F8JA 1RLJA 2P7HA 2XSZD 4Q48A 1CB7A 2XUFA 3KUDA 1GU0A 2BW0A 5THQA 4BNDA 5HKBA 2LCIA 4IMPA 2CMFA 1GFSA 4MO2A 3U7JA 3F8SA 4RM3A 4C7MA 3WFZA 2WC1A 5E38A 4TYWA 3I1IA 1MV8A 3GHYA 3EY4A 1K5DA 4ZXFA 1VMDA 2O9JA 3IVAA 3QFHA 5EN4A 1JN0A 2OSBA 4B4KA 4DRZA 5B2EA 5M29A 4DV4B 4TQ9A 3T5MA 2P91A 4ARBA 4E3WA 4EBBA 1CDDA 1R50A 2SICE 4I55A 1PG0A 1SVWA 2C4KA 3QF4A 4TS9A 4RGQA 1SPBS 5SYNA 4EVRA 1P9LA 5T4HA 2V6BA 3DHVA 4I19A 4E94A 2B0JA 5CYOA 3TPFA 1EUYA 3HP7A 3HWX1 2XWBF 2XGSA 3DTNA 3NTOA 4D8VA 4DCCA 4XCQA 5L3RA 3HVUA 1Y9DA 2CLEB 2ZRHA 1YQDA 3R7NA 5ENVA 2YJTD 3MZ0A 1SWWA 1MPXA 4ZMSA 4X3CA 1RHRA 4I66A 1EFUA 3GFQA 3NI2A 5EWLB 5D1NA 1WSBA 5K8IA 2YWDA 4AUEA 1T6XA 1CRPA 1HDOA 4I5DA 3ZJ4A 3NVDA 4GP7A 1OOEA 2JGIA 5TPZA 2YVQA 2VDKB 3KOZA 4U9UA 1LZKA 1WW8A 2WT9A 3U7FB 1NN0A 4KW7A 3ND9A 4IO1A 1WDTA 3C85A 4AG6A 4C2BA 5JNWA 3ICWA 1GLGA 3RF6A 3V2GA 1B8UA 2QTGA 4MV5A 4U1RA 3FUUA 5CLQA 1AO3A 1QZZA 3QTBA 2Z43A 3IDOA 3PHHA 1C0PA 1HFWA 1I2CA 4WSOA 1BHO1 3CRW1 3FCUB 4BMDA 2B0CA 1NFQA 3H4MA 3UFXB 4P5DA 1LA2A 1NMZA 2ZI3A 2ACWA 4CQMA 1QQAA 3G9UA 1EB8A 2X13A 4RKEA 3G2LA 4WKPA 4ZO9A 3PVCA 3W5DA 3MGGA 4RVOA 3HV2A 1YFKA 4YRKA 4Z4IA 3E4DA 3N2ZB 1IATA 1GKUB 4CPDA 2P2LA 3IPRA 3BMNB 1M8PA 2AJCA 3CX3A 3RSZA 4TKZA 3DFZA 1L4NA 2GYUA 1JX6A 3QLUC 2BR5A 4IFEA 2X4LA 1JEOA 4PVDA 4P3PA 2V5AA 3GIWA 3TX2A 1HLPA 1DUIA 2J6HA 3LAWA 3IAAA 1EP3B 3NUGA 3EYAA 2IGTA 1VMKA 2IPNA 4NJEB 4NU8X 1JI0A 3QFCA 1XMIA 4LXXA 2P9FA 1PYOA 2CXHA 3B1FA 1GKKA 2PU7A 4MYCA 3J7AC 1K75A 1U7TA 2RHWA 2ZJZA 2Z3ZA 3AJDA 2OFOA 1QH8A 3N76A 1NZDA 2BI8A 3OZAA 1LBHA 2BE7A 3LQKA 4HVAA 5GONB 1DZ3A 3SGLA 4D02A 4DJDC 3UJAA 1Z6XA 4F8EA 3R7WA 4YXFA 2GM4A 1E5XA 5JBQA 1S2MA 4H7PA 1RFGE 4IBOA 1ULAA 1RQPA 1C7EA 4AP5A 4NBRA 2R8PA 4XTRA 3D6VA 3SIPA 2X9QA 2G80A 1GTZA 4J2HA 4C6HA 1F2UB 2O05A 4EKIA 2YJGA 4N5MA 3T4UA 2BH9A 2BRUA 4EKGA 4JDUA 1Y6ZA 5SZJA 2ZBFA 4D80A 4YCNA 1IXRC 2Z8ZA 3H9CA 1MX5A 4BO0A 3T5PA 1R88A 3OJEA 4IDBA 3FYSA 1LQTA 3I72A 3ILXA 5KSPA 1YRLA 1YB2A 3JAWB 4M1KA 1SKYB 1C9MA 1XTTA 2W8BB 4DLZA 2IEDA 3KHKA 3UMCA 5JNRA 4AKGA 3DGEC 4D8XA 1P1RA 2H7CA 1KS2A 2YWRA 3N74A 2R6CA 5HKAA 2ERXA 2O2SA 1SUEA 5DNEA 2R2GA 2XITA 3MPOA 1SELA 1QAOA 1FFDA 1V8PA 2QVZX 1OZAA 2XH8A 2DUMA 4FT4A 3H65A 5FO0A 2ZJ2A 2ZYRA 4NS1A 4QULA 2ZZNA 3B20A 5EE5B 1VPDA 1YO6A 2ZBGA 4HMPA 2C2MA 3BIJA 4C6TB 1PJZA 4BNFA 2XVYA 1R6VA 1TECE 1TJ5A 4ANFA 3S5JA 3GN1A 4JBXA 5D85A 1ULZA 4ENRA 5FD8A 4UU0A 2J31A 1GCOA 4GU5A 2HBYA 5FOXA 3R7WB 3BZBA 4PZZA 4ZGBA 3VSCA 1YJAA 2A9KA 3ORFA 3ZGOA 4A6PA 1RACA 4WCDA 4Y98A 1PFGA 3GFSA 1OKKA 2FZ4A 3HBNA 1V4NA 2RK3A 1CHDA 1GPUA 1W73A 1XTPA 3HXPA 4H59A 4EKYA 3TD2A 5BR1A 1E4YA 1SKQA 1S2LA 1UT8A 1VA4A 1VIDA 1YCHA 1EUDA 2FPIA 4MWBA 2H1OA 1NVVR 4NXMB 1PNRA 2FFAA 3ULKA 4EARA 2J1LA 1JG6A 4N6GA 2VXBA 1B3BA 2GPYA 4OLFA 4PGFA 1TIPA 5DM1A 3F49S 3FWKA 4JB0A 3FD8A 4E21A 1A4XA 4LBYA 4V0KA 2NM0A 2AYXA 2FPKA 3OH8A 3HGTA 5K3FB 2V4ZA 3A3KA 4YT5A 3S2SA 2BM0A 4UJ3A 2X4GA 4CTNA 2HIAA 3INYA 4DSUA 5JZ9A 2G9QA 1M33A 1YJXA 2J5KA 3E7DA 4X97A 3VYVA 2XQVA 3GK3A 3JRWA 2Y68A 3QWAA 3VRHA 1VM6A 2PD6A 4FX5A 3BQ9A 3IJ5A 1WV1A 1IEQA 3WA6A 3B1JA 3KYDA 1JTFA 4C04A 2GJSA 1XDGA 1PIWA 1XU4A 4G25A 1FJ2A 1LC0A 1SULA 4IIGA 2VJMA 3O8RA 5JJBA 1WPGA 3MJSA 3VR6A 3L0CA 4F4FA 5KQMA 1QAQA 3OQNA 1VE3A 3B12A 2YOGA 3HU1A 5IUNC 2EEZA 3W2TA 1R16A 3BX1A 3HSSA 2YHIA 3TZLA 3VU9B 5BNIA 5DLDA 2FSFA 3OWXA 4AF7A 1TIBA 2YMMA 3L8MA 3T94A 2BHRA 2WB4A 4FHDA 4QARA 1XLTA 3M9LA 3TPCA 5G0TA 3Q8WA 1I6MA 1UPTA 1EUDB 1OGJA 2FPIB 3CF4A 4GIBA 3SJAA 1JGTA 5B4TA 3M6IA 1BD4A 1UCFA 1KYXA 2VOEA 1OAOC 1JBQA 1SB8A 2JGLA 2P5SA 2X9LA 3IJRA 4ZHQA 5LNK6 4DV2B 1SQFA 2IHYA 1E2NA 3THYA 3U3MA 1MB9A 5JMTA 1TNDA 3CR3C 2UYYA 1RQNA 1Y3DE 4KBYA 3B9BA 3TYXA 1UBRS 4DSNA 5A9RA 3DAOA 1SQSA 1SXIA 2O3RA 1GKIA 4YH1A 2XUJA 3WDSA 4D0GA 1CS0B 2QRNA 2AYYA 3S1SA 3TNYA 3VC1A 2CUZA 2X5XA 5AVUA 2JCSA 5L40A 5EESA 4NPCA 1NOKA 3MMXA 3VR2D 1UT5A 1W4BA 3PICA 5ALFA 1YB4A 1OT3A 2IYAA 1SN7A 3OE4A 3D0RA 1A9OA 2D0PB 4FR5A 3SC4A 3U16A 1T9KA 2AS0A 1M34E 1PTKA 1XTRA 3ZBTA 2JIZA 1VRCA 3ASVA 2ZZMA 4G0MA 1UC8A 2BGIA 2IYOA 3QW2A 5T64A 4Z9FA 2IHBA 2VK4A 4YP5A 3W3AH 3BK1A 1FQKA 3WZLA 1WU8A 3A3YA 3IBGA 4KFUA 1A3CA 3L46A 3U0VA 4DTCA 1P6XA 3CLSC 4B4DA 1U6JA 1E2UA 1JHRA 1S7GA 2AI3A 4ITRC 1E2MA 1CY6A 4PGGA 4U6SA 3GJTA 4N47A 4F4DA 2QX6A 3SYMA 1RAGA 4ZALA 4IINA 3KE9A 3I39X 3M2TA 5KQSA 1UEXC 3ANLA 2ZBEA 2BBSA 1UR5A 3DKVA 1K9SA 2WP8J 3HE3A 5LWHA 1U0RA 2B6HA 4PWZA 2R8ZA 1N2CB 3CNLA 1YU6A 4HAYA 1Y1RA 4XSHA 5AKIA 4LFCB 4ALKA 4ZHQB 3IT1A 2GVZC 2EARA 1L1EA 1RXYA 2CFCA 2DC1A 3NOQA 4KODA 1KEZA 2FSIA 2PNFA 4DDWA 5A2GA 5MFZA 2ZRCA 5AI5A 2F8MA 4UAGA 4PLPA 2D2XA 2WWWA 2YYZA 3IAFA 3QP9A 2XZOA 2HLPA 4YP1A 4IV0A 4Z8YA 3WGNA 4R83A 1YKFA 2GASA 1RRVA 5JCJD 4G3XA 4GI7A 2IZ5A 1ZSYA 2YL2A 5JCOC 2RKOA 5FPYA 2WU1A 1W1WA 3OQPA 1SVLA 3K9FC 4UZEA 4CKCB 4U0JA 4F0JA 5B3KA 1T1GA 4OO3A 1Z0ZA 3L7IA 3VR0A 1RD4A 1JAYA 4BAUA 1YB7A 5DXAA 1DAPA 3HGQA 1QQ5A 3TNLA 4DREA 3U7QB 2NNWB 2ZJ6A 5U9CA 4BEWA 4I1UA 2Y0DA 5FH9A 1DJMA 4FYXA 4PGMA 2C5BA 2M32A 1BGXT 1N2OA 2P41A 6CHYA 1UFVA 2JD1A 1E3EA 3CNEA 2CDAA 3UPUA 3HDGA 3CBQA 1BDJA 1M10A 4IEIA 2Q7OE 4LDNA 5HQ3B 3AHFA 3SC6A 4F2WA 5JVDA 1M76A 2OCIA 4JT9A 4LDPA 5NULA 1C4XA 1PEKE 4YJ3F 1A9TA 1B0ZA 1L5QA 2AG0A 3FSGA 3EQZA 3OP4A 4U7DA 1QRDA 4J0KA 2Q1XA 5LQJA 1QTNA 4BNWA 1OJLA 4C7OB 4E2FA 4P58A 4PWYA 1HG1A 1T9HA 1CDZA 1SG0A 4ND1A 2A1IA 4TQUS 1JI3A 1TD1A 1QKJA 2KBFA 2JGFA 3DF7A 3PKZA 4KXWA 1T5BA 4P2GA 4LCBA 4OI0A 4ZWNA 3TJRA 2GPWA 1ZIPA 1X14A 2WIJA 3DMNA 4EA7A 4TKVA 3NTLA 4RL4A 1P33A 1EWTA 3OQ1A 3Q8KA 5F77A 3OJ0A 4PNHA 1R66A 3T12A 2OWEA 1R37A 2OESA 3BT7A 1SIUA 2H2IA 1O6FA 4CDNA 4K0RA 1U1DA 2QUHA 4MLPA 1U2PA 1QO0D 2ASEA 4A1OA 1E1KA 5EE0A 5AHRA 2BDUA 4DY6A 5IANA 1XDUA 2V59A 4EHJA 4MKFA 2GM3A 2ZB4A 4Y2YA 4B8ZA 1UKYA 3KZMA 1K8ZB 3F3YA 1BHJA 4Q7JB 3TE7A 4BY9E 5IT4A 4IEEA 3DZCA 1J07A 4PANA 1WM1A 4KPUA 1E5DA 3CS3A 4TMTA 2Q4OA 1SHKA 2IBSA 5JLJA 1EUZA 3M34A 5GAJA 1SBCA 5K0EA 3C7TA 4GI3A 4LQCA 4MWCA 2BFDB 1I2AA 2NVUA 4BFSA 2QU8A 5DRYA 1YFLA 2GZSA 3KLOA 3GJYA 4R9SA 2QR3A 1TJNA 1JG7A 2BGKA 1PR6A 2RJNA 2WWRA 1RYEA 4YCLA 1AKVA 2PAAA 4GVLA 4ALNA 4ZTZB 3T0IA 2VJBA 4C5AA 4NONA 1XXHA 3HUEA 4B5KA 3PYXA 1O5IA 3NYRA 4FHCA 3W06A 4AK9A 1KEEB 3MUFA 3AGPA 1VQ1A 3I2IA 3LY8A 4TKVB 2JJ2D 3ZKWB 1E77A 2NZ8A 3P52A 5I8PA 3QLEA 1PEDA 1TD9A 4TMKA 2YC2C 2GBPA 4WLEA 1JRLA 3C5EA 4V0ME 5H70A 4LV5B 3SX4A 1RYHA 1E9VA 1U7OA 4G09A 3REOA 3SEFA 3U3ZA 1XNHA 3OIGA 2AKEA 2GETA 5TVGA 4ZIRA 1GR1A 1DNPA 1H8EA 1PNVA 4MWSA 3LY7A 1N8NA 2MYPA 3WY9A 1RTTA 1SUPA 4X8LA 2XSZA 4V0SA 4QUIA 3B3GA 2I8CA 4QM7A 4BFTA 1FU7A 1VA5A 1TA9A 2WD9A 2Y2UA 1Y8CA 3JWPA 4TM7A 4WFJA 1LNQA 2WUGA 1AMOA 2GF9A 5H4HA 1P1HA 3U39A 1TC2A 2QV0A 1GNTA 4OIFA 2HJ9A 4GR5A 4WY2A 3PRHA 3DDNA 4KN6A 2QX7A 2PL9A 4BFLA 2NVUB 1CR2A 2FSVC 2FMTA 1KMNA 1X7DA 5BXQC 2KE5A 1S6YA 4CF7A 1XZLA 1XYGA 4UREA 1YRWA 4MVJG 2D62A 1M2FA 2WUEA 3KOYA 2QVBA 4FGLA 3VOBA 3G9XA 5IJWA 4URUR 1BN6A 4P83A 1OASA 3CEPB 3PFFA 3ZG6A 1W2WB 1B0UA 1EBFA 3BXGA 4TLLB 1VSQA 5HDBB 1A2KC 3EN0A 3QKSB 4JL8A 2JHGA 2GDZA 4Q24A 1L6IA 4KNVA 2WIKA 5EPEA 2A1TS 4BVEA 2HADA 4YP6A 1ZGCA 4KREA 4XVRA 3LYLA 2TMYA 1PD0A 5H9VA 1EAYA 4AURA 2HD4A 3HN7A 5K0TA 3L8GA 2EQ5A 2PU5A 5ALUA 4BL5A 2P6UA 2Q2QA 4I08A 3KKEA 2D1FA 5LDGA 4MSUA 4X54A 1KKUA 2ADFA 2H1WA 5I7RA 4IMRA 4BWVA 4MDFA 2FPSA 4MO9A 2VJYA 5H0IA 3GGCA 2QLJA 3EAFA 3VSAA 2JBAA 3TGPA 1PWHA 2PLWA 2RHRA 1RYDA 5E4JA 3ZW8A 4JXJA 3CZQA 3AW9A 3LVRE 2XAUA 2ZUCA 3LK6A 5FWXB 3HP1A 2XF8A 4QVGA 5F7JA 1HQKA 2M1ZA 3DO6A 4B85A 1CX9B 4HWGA 4RY9A 4EYQA 1WB4A 4PYJA 4WZAA 5BSVA 3QSYA 3RGGA 2QI9C 2X5KO 3MRTA 1NVEA 4NYIQ 4OUDB 2VNIA 4X9XA 5IVDA 1M3SA 1QIIA 1T2DA 4B1FA 3GZ4A 3PGXA 4LSMA 1WHSA 4Q9HA 2V9ZA 1QDUA 3WLSA 3PEFA 1NX9A 4PAQA 3O8QB 1L9XA 1PD1A 4CDMA 4Z53A 2CNKA 2PL3A 4QEZA 2DXIA 1EGQA 4KKXB 2J9ZB 4J0QA 1JIUA 3JPYA 2ZXUA 5ANRB 1Z74A 1T8PA 2BJHA 2PMWB 2VXCA 2FNAA 1H9AA 2VQEB 5H8WA 5JXIA 1N2HA 1L4HA 3G0BA 1OGYA 4BO9A 3KEGA 3LC2O 2VHXA 5CH8A 2VZ8A 3KOOA 1IQPA 1A9SA 3OURA 2V7QA 4HGPA 4UC0A 3VPXA 2RSLA 4AM8A 1ZS9A 2FEPA 3DBLB 3LWNA 2VT2A 3M1LA 4CTKA 2B8WA 1W85A 2NXCA 3RS0A 3WXBA 3EX7C 2C4TA 1ZLXA 1KHTA 2PWBA 4MRRA 4ZPJA 1NQTA 1V7ZA 3NOOA 3PFIA 1Z6TA 3QPWA 1C7ZA 4IFIA 3R0VA 2O0LA 3NDRA 1F9EA 4UQOA 4DRXA 5TQJA 2HQBA 4F3NA 2JBAB 3E7PA 5IU6A 4WI1A 2ZRMA 3IIEA 4A4DA 2F1IA 2AG5A 4FLMA 1ZONA 3Q0EA 2WKSA 4Z54A 4MVXA 4KLZA 4AKTA 5KVQA 5ALTA 2JLAA 3ETNA 3N8IA 4BATA 5JAZA 3BXHA 1YUNA 2ZFUA 3PKIA 3UKOA 4TLEA 2AX3A 3I2GA 2ZRLA 4NHOA 1EFCA 1G4HA 3L8ZA 3OJOA 1K7SN 3C7DB 4ZVMA 1QQBA 4LYEA 4FGKA 4M9SA 1WVIA 5T6BA 4UBMA 4GLBA 1ZXBA 5LNK1 2IZ1A 4DCTA 1NQUA 4H16A 2FA9A 5AD1A 2XRZA 1NN3A 2P6MA 2R60A 3E3NA 3PHBE 4L0DA 1DI0A 5F4BA 4B33A 1FFCA 1RRKA 3EMBA 2IYZA 1VRVA 2IDJA 3H6GA 2PGLA 1NTRA 4KLCA 7ADHA 1I6KA 5DLQC 4W8HA 2FX3A 4HB2A 1ULUA 1NG9A 1ULHA 2D0DA 4EI8A 3PI7A 1W34A 1CD5A 1BRTA 2QQ0A 2ADOA 2X6TA 4GDFA 2GZAA 1P18A 3VR5D 3QE3A 4Q1BA 4D97A 4N3NA 1W85B 1WUTA 1SA0A 2GILA 3AHJA 3QMMA 1T3GA 5FWAA 4B3XA 3OEYA 1F06A 4LVCA 4DDHA 4ALLA 4GZ5A 3RANA 2YC4C 1AHPA 5HWSA 2WB2A 4FW9A 1XJQA 3FBTA 4NPAA 2Z2KA 3FFTA 3QIVA 3QU4A 5LSAA 1JXAA 1L8OA 3EPPA 2G63A 3FNRA 3S28A 3E70C 1PR2A 1S96A 4P31A 4AXBA 4E5KA 3E35A 1AGPA 1YDEA 1S7CA 5A3VA 3FETA 3O1JC 4BO2A 4BQIA 2NVWA 1F1JA 1JIKA 3HL4A 2H0RA 4ZDJA 1ZAYA 2VP5A 5JFGA 3RBAA 3L5KA 1QR2A 3LQ1A 1Z5UA 1ZK1A 2BCEA 2ZAIA 1ZESA 3AC0A 2H4ZA 2VF2A 1D07A 1TTPB 2HMSA 3GDFA 3HCRA 2I4LA 4HJRA 1KJIA 1QFSA 4DCGA 3FNEA 1ZW6A 3L0PA 1MQ8B 1YUBA 1B26A 1GARA 1NHWA 1OC4A 2D2IA 2ZKLA 3V8QA 4MR8A 1FXWA 3E8XA 3MPUA 3ND6A 3M5PA 3QV1A 3K70D 3X1XA 1A9XA 5A06A 1O7JA 5DISB 4REQA 3E9EA 1P81A 4K03A 5GZ6A 4TLBA 1N78A 4M98A 3VO2A 3WK5A 1P44A 4AZTA 3L6RA 2G5GX 2NO1A 3JD1A 2CZGA 4NCHA 4YJGB 3WNDA 4A2QA 2YWEA 1TOAA 2YHUA 3ETHA 3CVOA 3NRBA 1UBFA 2R4TA 1NUQA 3W8DA 3H0CA 4H9GA 3WJ2A 4ABTA 2IEIA 1EDOA 1SIOA 4UOEA 2W4MA 3E1GA 2C97A 5CR9A 4G85A 4PYIA 3MJFA 4LV6A 2H7XA 2HU2A 3QMWA 1WS6A 2IELA 4FOOA 1KJWA 3I01M 4RD0A 3DLPX 5FR1A 4FM9A 1X1CA 1AZLA 2I6UA 2KS6A 3ND8A 4FYPA 4D7AA 1VJ0A 2HWWA 5C8XA 3N9IA 5A0VA 1KOGA 4MINA 1A76A 2VYVA 3OZFA 5CX1A 2J32A 1Z4MA 2F3SA 5LMZA 1ZX1A 5I7UA 4Y0VA 3IO5A 5EHNA 1NE7A 1V0JA 2B4RO 3QEOA 4EB0A 1HF3A 4DWJA 1C7JA 2NAPA 1AXEA 3FPKA 3HRIA 3SFTA 4EUNA 3K09A 1LX7A 1S2NA 1BXRB 1K6EA 5JRZA 3F5SA 4CU5A 3TI9A 3GWGA 3H2HA 3RVBA 1QTRA 1SRRA 1WXDA 3L0IB 4IM7A 4FLFA 5LLSA 1XMVA 2V1XA 4MR8B 1OROA 2Q4TA 3GJ5A 2E37A 3QEMA 4EELA 3U4DA 4F4JA 4R1NA 3RJZA 1Y1SA 1DFIA 4BKRA 3JQPA 5K3OA 1UIMA 2VBGA 3FCXA 1RWXA 4PO1A 1ULSA 4GICA 4QPPA 4JELA 3TXAA 4HB3A 5FHQA 4LX0A 3OX3A 3TOVA 1W5SA 5AXCA 1JKJA 1YULA 2XXJA 1IXSB 2X0KA 3VR2A 2BDEA 2Q5LA 2AV6A 3ILVA 3SVTA 1P0FA 2BDTA 4RMIA 2JAXA 3JAKB 4KI0A 1D1TA 4XM2A 1QDLB 2I67A 1VZ2A 3R9KA 4RVGA 4WD3A 1ND5A 1OUMA 2AZMA 2F3PA 4FFBB 4MLCA 4AYWA 1V1JA 4PC1A 2NQ8A 2H1FA 4PYKA 2FFBA 2F17A 4F91B 1Y8ZA 3JWHA 3WIBA 1XPUA 2QT9A 1Z34A 4M8LA 3KP1A 5EWJB 4PLFA 2QQ5A 1M2JA 3A04A 4B6GA 2O59A 3RFFA 2ZYHA 3MWKA 1V2HE 2DCUA 2DSNA 2M2IA 3BD7A 5EJ5A 1U3VA 1L5RA 2I7XA 3MM4A 3FE2A 4LXQA 4JVNA 3QE2A 3H1TA 3QVVA 5FBLB 4O4JA 3R76A 5HE8A 3R5FA 1KH3A 4ZKEA 1Z5WA 3NEYA 3GA5A 2CCKA 2BHLA 3CN9A 1Q3HA 3TQIA 3NVKI 5E2AA 1B2LA 1KC3A 4IJKA 1TCUA 4Z86A 4Q7LA 1KEUA 4RHCA 5EZ5A 3OQIB 2QZSA 1N5OX 2VDNB 1YAHA 3HPQA 3W9BA 1ESNA 5JATA 2IHNA 1QM5A 2HB6A 2BC9A 3EVFA 3T4PA 5IYZA 1EHYA 3QEMB 1MC5A 2Q6LA 3T1QA 1QHIA 5A5DA 4UM9D 4EF5A 1NBAA 2EG9A 3GQBA 1AUVA 2PT9A 2JGKA 1JQJC 3OMXA 4L4XA 4UHKA 4FXPA 2I1WA 1DRVA 2GBGA 2FDRA 2VYQA 2HLDA 5IEJA 1A5TA 4R40A 5CEJA 1EWKA 3H7AA 1T3SA 3OBBA 3B7GA 2P5YA 4D2IA 3QEJA 1B8VA 3H8WA 1TAHA 3PCTA 2Z08A 3R3ZA 5F21A 4TROA 1IXKA 5C81A 2UAGA 3D5TA 2VT6A 1YAJA 4UE2A 3ET4A 3QSGA 4QJ5A 4BNLA 3PXBA 4MWZA 1JQ3A 1EESA 1RAAA 5IVHA 2AW5A 1EZZA 2ZCUA 3SVLA 4Y2GA 2HA2A 1L5HB 4NAVA 3RC8A 3ESCA 3LK7A 2L69A 2XEDA 1KXJA 2PM8A 5C7LO 1R64A 3TI7A 1YZNA 5I9SA 3BMCA 3SHTA 3ZDDA 1IJBA 4R01A 1ZINA 3RYFB 2NN3C 1W88B 3D3NA 3P4UA 4M0FA 1H23A 4NG4A 4L8GA 3V1KA 4C4XA 5BYAA 3Q2IA 1H0HA 2YMPA 4FD3A 5EZ6B 3NBZC 1ODFA 4Z3OA 3KHUA 2VYCA 3LWZA 2PZJA 3IRVA 1GRRA 1RBQA 5L3ZA 3GP8A 2SHKA 4TWAA 1E9AA 1KDYA 1P7CA 1YDMA 1P4GA 2AG1A 2W43A 1OFHA 4LY0A 4PGHA 4PG5A 2C0QA 1EFPB 4M1MA 1JDVA 4HBGA 4W1RA 3T9BA 5KNLA 4B3TB 4EG5A 2ZRAA 1SC3A 1HDXA 2AOUB 2GS9A 2OOKA 4TZTA 3RABA 4RNDB 3IGFA 1IFXA 5AHWA 1QK5A 4XWGA 3TSAA 3FFWA 3Q7QA 1PG2A 1YI0A 2IFTA 5G02A 2H7YA 4R8MA 1BCSA 4DS3A 5I7OA 3ABQB 2PMEA 2YWGA 3SDBA 2I7VA 2FPGA 4OHKA 3PGLA 3RWMB 1G0OA 3CJQA 1MAVA 1X7ZA 3IEXA 3SDSA 3ZK7A 1L3IA 4IXTA 1UWVA 3FPJA 3I64A 1VL8A 3UYLA 1AKNA 4GGOA 1MO6A 3TMAA 1JB1A 2A1TR 2PKWA 1NU8A 3R6LA 1T0IA 2CLFB 4JB8A 4HAXA 3KJXA 2W6CX 1ZBQA 2QRUA 2A9QA 4ND8A 3OCUA 3TIGA 2ZYTX 3WZ2A 3TIIA 3HU2A 1FNDA 2FZWA 1NBIA 2GI4A 4W9NA 4B3SB 1X38A 3AOEC 1LRJA 3ENQA 3FLMA 4YRCA 3ZCRA 2LE0A 4E70A 3KQKA 1KH2A 1YI1A 1OYWA 3F9RA 3KX2A 4PC6A 5ALGA 2YV3A 1OBFO 2G6BA 4QQFA 4BP1A 1NG1A 2A0WA 5KWJA 4ILKA 1RZRD 1J8VA 1RAEA 3P2MA 3HY6A 4YRJA 5HX7A 4JP1A 6REQB 3AL2A 3R0QA 5J2TF 5BSMA 3AOGA 5F1YA 4BV8A 5GIPE 2B4AA 5J5AA 3ZC3A 1OX6A 3LD9A 5GM2A 3X1YA 1RXVA 2V6JA 3U4QA 1AKRA 4BO7A 4MAAA 3LPMA 2XUAA 2JJ2A 2X8BA 1UBNA 5A5GA 5C0OE 3LPAA 4LJRA 2VZ0A 1NGSA 1ZGJA 3N7UA 4TSKA 1XAHA 4IDCA 3O2QB 4MVWA 1F9AA 1MT0A 1A50B 3IT2A 4PHGA 1KZ6A 1Z5VA 1EK5A 1DAFA 1Y7TA 1O5OA 1Z0FA 2CY0A 2W6NA 1WUIS 3AIIA 3CCFA 4UKDA 3R9IA 4R1LA 4BO8A 5BUSA 3PHIA 1QLHA 2R0QC 3OCXA 5EEGA 1SPXA 3KLMX 4FMPA 3PXEA 4B79A 4K8OA 4YCDA 2HV9A 3HBMA 3EH2A 4RCYA 3UA4A 5JSHA 1VI6A 4M9XA 3CPSA 3K2BA 3PQ4A 4OA5A 4I8XA 4CM4B 2P3QA 5BQ3A 3L1HA 3NT4A 2E87A 4RF5A 1W5FA 3IOYA 4YIHA 1T26A 4F4IA 3RT7A 2JLZA 1CJKC 2G1PA 5HCUA 3PBKA 3TL3A 3TEFA 1NTOA 5TGDA 2BTQA 2ZIXA 2OGWA 1CRWG 5IC6A 2CXSA 1FUKA 2FWMX 5AVOA 3ZV4A 2ATXA 1PJ8A 2YQ4A 3EAGA 1FS4A 1NI4A 4L9WA 4B2LA 5CVVA 4FNOA 4RKYA 2NUAA 3EEOA 2ZYAA 5DF1A 4L07A 4S3MA 4IFBA 3GOQA 2GAOA 4LQDA 5L53A 4LZLA 1V8BA 1SU4A 3H1EA 1TZ2A 4IIVA 2NPOA 2A5LA 4II3A 3RIHA 3U44B 3FMIA 1QP0A 2ODEA 4BAZA 2XTAA 2ZU0C 3EW7A 1YVPA 3KDAA 3FJOA 3JARA 4GYKA 1I8TA 3OPYB 3EHEA 2NAFA 4Q6BA 4ZEMA 3IB3A 4HAUA 4DLRA 2VYFA 3H4IA 4G8BA 1FFYA 1XF9A 1HV8A 4MV8A 1QE5A 2XDAA 2XOXA 3IAHA 4ROTA 1SUDA 2L19A 2QB5A 3JD4A 1FY2A 2IV7A 3UPDA 3G85A 4UNIA 1Q1AA 1NY5A 2O7QA 1Z16A 4MRSA 3R5HA 4IDDA 1M1YE 4P84A 2R1UA 4M36A 2R25B 5EUQB 5IDQA 4IIDA 5A4JA 3HKDB 8MHTA 1ML4A 3TSZA 2GBCA 3UHOA 2EBFX 1SHLA 2AQ8A 1JFRA 4BE9A 4GLLA 1GQOA 4V0LA 5LFAA 2NU8A 5DGIA 4CMCA 1JIJA 3LBFA 4QA9A 2GH1A 3LQQA 5AI9A 2REXB 4HXFB 5HMMA 2BTQB 2ZIXB 2ZPAA 4A27A 1KEWA 2OM6A 1ZR4A 1VLLA 1WEKA 1ORWA 3F4LA 2JG3A 2VP0A 2GZ3A 1OLXA 3DE3X 5ARCA 3TOXA 2O6LA 4AG3A 5C8YB 3VVCA 4L85A 2AUNA 3CTPA 1AXRA 3DBRB 4ZK6A 3S27A 1MU0A 3GJ8A 2JIQA 5LPNA 1AUQA 1T0UA 1QNLA 1IHPA 1ZK0A 2ID4A 4G37A 3TG2A 4TSRA 1BVUA 3MF4A 1XCPA 4N0EA 5T8KC 5AW8A 5C32A 3HJRA 4GF5A 3DYIA 1FZQA 3JARB 1P17A 1CEQA 1HZZA 1OIVA 2YQ5A 1IPFA 5FT9A 5GQSA 2HUNA 5A6VA 1Z0IA 1ZK3A 2ZP1A 3LQRA 5EUCA 5B1YA 1KI6B 3QXXA 3SAJA 1MPTA 3ZWYA 1WLYA 2R6ZA 5E4FA 1KO5A 3H2YA 5LZ9A 3PRJA 5FPQA 2PWPA 4M9QA 2EBWA 1G0NA 1MB3A 4K8RB 3QOWA 4IF4A 4G2TA 1DUVG 3RE1A 1FNSA 1BC5A 4A0FA 2J87A 2OZEA 3J81k 4LRYA 1OA0A 1IHYA 2VHCA 2VPZA 3MB5A 1YF3A 1LPPA 1G18A 1POWA 4RWEA 2OXTA 1Z4JA 5J1SB 1RW4A 2PH7A 1GTMA 2X77A 4EA6A 1YZLA 4OP3A 2HMUA 1H9CA 1A8QA 4U8GA 1V5WA 1DO0A 1PQWA 1DMSA 1ZIDA 3DAGA 4RSRA 3PDUA 3RVQA 3T1VA 2BFMA 3R3VA 3EZ7A 5EIEA 5K0FA 3E05A 3G5LA 3HDTA 1OLXB 1QV7A 3JRNA 3KB6A 4UUQA 5FHRA 5JMPA 2ZQ5A 3DHYA 3INTA 3U7EB 1B0PA 3UB3A 1T5SA 5EY5B 4JI3B 1U3DA 4B40A 4DW8A 3KV3O 2VQSA 3OX4A 4CR6A 3WLMA 1X7HA 4I81A 2HFJA 1YI8A 4IIJF 4M4SA 4IDGA 4YAEA 5GMOA 4DLBA 2P1DA 2WTAA 3OY2A 3R3XA 5HKKD 3GLHA 3OFJA 5FL7D 3IPCA 2UXDB 4HSGA 1M83A 4Z7OB 3E53A 1G4AE 4L5IA 1D0IA 4MNTA 1ELOA 1N1EA 3VR5A 4MWGA 4YJKA 1OH5A 4JEMA 4K88A 2VF4X 1YQ9A 3C8HA 4KXLA 5L6MB 4XD7D 1TUEA 3H0EA 3GLFE 1ARZA 4NENA 1UPXA 1ECJA 5C52B 5FTLA 1H6CA 1L7DA 1R12A 2CD9A 2JC3A 3FI0A 4GX2A 4HX9A 3KAPA 3QU5A 4OXXA 1ZIOA 5EFZA 1S89A 3RUIA 3WMFA 1C9DB 3SLKA 1H66A 4OGWA 1JQAA 1N5LA 3M1IA 1CRZA 2AI1A 2ZWIA 4KJXA 4P4SA 4BEVA 2GZHA 3JASB 4GR9A 3UJPA 2NZWA 3H2KA 5EEHA 3TLXA 3K6JA 2HTFA 1L8AA 4W1PA 6AT1A 3T41A 3TLEA 4NEHB 3I12A 4KO4S 5DHAA 4DDUA 2JZNA 4Q21A 1G20B 4ITVA 2JFNA 1G3MA 1PDWA 1JHPA 4MIEA 2FEMA 1P1FA 3QW4B 4KEAA 4Y2VA 3NGXA 4JQCA 2HSDA 4EY6A 1L4UA 4DBLE 3I45A 1R6DA 2B35A 2ZI7A 1P91A 3D7KA 4M37A 1VSBA 1Z68A 4B31A 2F3RA 1NXVA 5ALJA 4R9UC 2RC6A 1DB3A 3PLRA 1T2AA 3G5AA 2HO4A 2ORVA 3QTLA 3W5IA 3IKLA 3KQUA 3LQ4A 5K51A 4FWIB 3AP3A 3B9PA 1RCTE 3B8EA 1JDJA 3Q87B 4DBZA 1YZFA 4K9PA 4CM7A 3F2VA 3QY0A 4M55A 2FJ0A 3GZTB 1VYTA 4L57A 3UJNA 4N49A 3ZNNA 1V4VA 2FPXA 5LR6A 3OZWA 4TOIA 3ZY5A 4NENB 4BVHA 1WVGA 1C9EA 4JA2A 2ZB2A 3MT8A 3DFIA 5AHOA 1U2EA 1Z3IX 4XFJA 3REGA 2V74B 4B6QA 4G5QA 3O7MA 4RVNA 2IIBA 1MJ5A 3NFRA 2VTBA 1Z38A 2WVAA 3LWDA 3L7CA 3SR4A 2JLWA 4F5EA 3KCNA 3ZBPA 4ZOQI 4L50A 5GY7A 2DQKA 5K8UA 2C2HA 3M4NA 3AI7A 1GG2A 3UGQA 2QG6A 2GD2A 2Y3IA 5J4YA 3BVPA 4XUGB 4LRQA 4O2BA 1L4LA 4R8KA 1GGEA 3SQXA 1NI3A 5HOEA 1BJRE 3KPYA 4XZ3A 4LRWA 1LK7A 4QAJA 4ZV4A 1A5BB 2ZJ8A 2WJVA 3PXXA 3TBKA 1EUCA 2Z09A 4PX5A 1GPDG 2X8WA 3AF1A 3IEKA 4R3UC 2ZE5A 3TR5A 5DH9A 3DR5A 3R77A 3WQQA 1QVZA 4YHHB 3TQTA 3FAZA 1P5FA 2BGJA 3AJAA 1TVMA 3HEAA 3K73O 4Y8VA 1ZVKA 2G0NA 3JR3A 3NZEA 1WXIA 4XH9B 4X44A 4YC7A 4Z1MA 1VPEA 2RE8A 2F4VB 5LZ7A 3RJMA 1TRKA 1URPA 4RAOA 1E3TA 1R4ZA 4PYLA 1DKLA 4Q00A 4QFDA 2MSCB 1N3BA 2C4UA 4KXUA 1JDPA 2QD3A 3L6DA 5EJ9A 1PK8A 3L1KA 5K7SA 3CSDA 1WOYA 3AU8A 1CKEA 3EY9A 1B8NA 1W87A 2HXYA 2ZRNA 3A11A 4N0PA 4OA8A 4BFUA 4BZWA 2HPHA 3RRYA 4C7VA 4G9GA 3TKYA 4PRZA 3B48A 1E6EA 1Q3TA 4FYWA 4RULA 5K8JB 4UBOA 1JBKA 5JQGF 1IBMB 3LCCA 4G1UC 1DKQA 1LFAA 4ZI5A 3LGAA 4G86A 2XZLA 2C4HA 1CDEA 3RFTA 1ZCAA 1FRZA 2A7XA 2C96A 1JDZA 1Q1BA 2FUG6 1DLIA 2Q5FA 3FY4A 4S04A 2GKSA 2GN2A 3H0KA 3GRKA 1GZ5A 4GPD1 1LNSA 3K09C 1Q50A 3AR2A 3F7MA 4OKNA 4U7PB 4AO7A 2WWIA 1DOHA 4ZO6A 4EWLA 1FFBA 1MJNA 1Z6GA 1YS7A 2O4UX 2D1YA 4MQMA 1WJGA 4OEHA 3DAPA 3TZKA 4WKCA 4RSHA 1FFGA 1AY0A 1DHRA 1B14A 1PTJA 4JEHA 2OHHA 1B73A 4LKOA 1SK9A 2Q21A 1EUCB 2VHZA 1NBEA 5U1PA 4CUKA 2ODBA 3NTRA 3KJEA 2C3UA 2D0IA 4YPOA 3MBKA 2C61A 4KR0A 1K7EB 4U39A 4MVJH 3DWGA 2J7PD 3FN4A 2QL6A 2MTBA 3N86A 3V3KA 4DJ5X 2GARA 3KBBA 1RZUA 3Q40A 1U0EA 1LTKA 3PDJA 4CIBA 4BGDA 1JG1A 2LP4Y 1TT7A 3IRUA 1QS0A 4PZEA 4RGBA 1XCGB 4WDRA 5GVRA 3ZPXA 5JSUA 2GNAA 5LU9A 4M0PA 1FYWA 1SO8A 3DZKA 3NKLA 2CDBA 4UUAA 4W5OA 4DGQA 1P6QA 4Q3CA 5K5EA 3P5BA 4X00A 1UZMA 3E23A 2O1XA 3U31A 4DC9A 1ECFA 3AZPA 5HJ5A 1W49A 1I01A 4QJ4A 3I1JA 3EXG2 5I5GA 5E8RA 1UC4B 2OCDA 2RONA 3A28A 5BV0A 3KR0A 4PXYA 3T7KA 3CR7A 4B34A 1F8UA 2JHPA 4L8VA 2A33A 3W4IA 3HUDA 5HP4A 5AVRA 3ICQB 5K4HA 5KPDA 4NLLA 1KK0A 4ZT6A 4DJTA 5JO0A 2GJ9A 4ZVQA 1MEJA 1JQEA 5LD2B 3SD7A 3PQ7A 4LBZA 5K0NA 3AERA 3R8XA 4LF7B 4MPPA 3RUDA 1Z6ZA 1YJBA 2GFQA 4Q19A 2G9RA 2I0FA 1ZD1A 2ZIEA 1UAGA 3ELUA 3EWNA 4HLUA 4L9AA 1QMPA 1ICEA 4ZKDA 1M0TA 2E7ZA 2Q1SA 1HDCA 2JAWA 2QQEA 4Q66C 2A9RA 2OQRA 3G0DA 3NIDB 4MP6A 4U0KA 4OLAA 3C41J 2PT5A 1BXZA 4GMXA 3EOBI 1AUOA 5ULLA 4K46A 2OK8A 3CGGA 3KL2A 4M8KA 3RB8A 3LSTA 5ICSA 3KZNA 4HDKB 3HJGA 4C4TA 4QQKA 5EPOA 3GJXC 3Q9LA 5JBIA 5E1OA 5BSKA 1YS6A 1E8DA 4AMUA 4BRZA 4Z3DA 4OYLA 1I1HA 1GQSA 4FOTA 4WWHA 4BVGA 3ZDRA 1PVOA 2YBEA 3EGXB 2O5VA 2WJ6A 1ZOSA 2BI7A 2JARA 3IEVA 4YALA 4RY0A 3TCNA 4FD2A 5AIBA 4DCSA 2CCJA 2BFFB 2RIRA 4KVZA 4QDTA 4S0XA 3ZNQA 4B4WA 2DHQA 5KWEA 4TQAA 3RC7A 3ZY6A 3EXHA 2X9VA 4XPZA 2WZQA 4HUQA 4QUJA 5A4FS 2BV3A 4LK3A 5AYVA 1W36D 4I50F 2JFGA 3R7BA 2NP7A 4HZIA 1Z8HA 2WAYA 3C45A 2ISCA 1P5JA 2DH5A 2ET6A 3KKMA 3NO4A 1D4FA 2C5HA 3ND5A 1Z37A 1R74A 3OC0A 5CM9C 2YWFA 4LC0A 3FWNA 4MQFA 2NU7A 1RZRA 2XLCA 3ZTWA 2C94A 3GP3A 2O3UA 1K1EA 1OMOA 1RJEA 1Z29A 3IAUA 3A1SA 4KP7A 4GWKA 3F5QA 4QPJC 3G9ZA 1HT1E 1SOMA 2H57A 4F7WA 3OT4A 1KI8A 3JQDA 4KFSA 4WA8A 5CYGA 5K6TA 2FQYA 1O8CA 4EG4A 4OMDA 1NDHA 4H6WA 1DQZA 4F4UA 2AOWA 8LDHA 4P1ZA 1Q6ZA 4FEEA 3NIGB 4C3VA 3ROMA 2WA2A 1L5VA 4MA5A 2ZTUA 3ZW7A 2C2BA 2YWXA 4HN2A 4FMCF 4EZEA 1IY9A 3D6JA 4CI0B 1HEIA 5TJHA 4BB6A 2GF0A 2MSLA 3GEBA 3Q85A 1PJBA 2D0OB 3DBIA 3M6UA 5EKXA 4D92A 2YOFA 4AJ1A 1XZJA 4NF2A 4OJTA 4WERA 3LT1A 1FNMA 3CH7A 1VL5A 2EP5A 2CXQA 2PKEA 5MF6A 2OP0A 1IUNA 1GUBA 1ID1A 2PGXA 3NOXA 2I4RA 5CLHA 3IODA 1Z0AA 4DY4A 4ZK2A 4UHCA 3JVEA 1Z35A 3L1UA 4RA9B 3TB6A 4HUQB 3WNZA 4YRMA 1YHNA 5FLXA 8ATCA 3TOCA 2O8FB 1IJEA 4UBNA 1P0MA 4FSDA 4D4IA 1WEHA 1NNI1 2GLUA 2ZSUA 4K2HA 1R8SA 4X5OA 4DVGA 5D84A 4A1FA 1XCMA 4C20A 1U0NA 3NXKA 2QLFA 3WV4A 1XALA 3FHLA 2O5EA 2W0SA 4QTYA 4MQFB 3BXXA 1EBBA 3FCYA 3V32A 4YV1A 4FEYA 5ALSA 5CB4F 4DANA 4GOOD 2I6GA 5IKXA 4JJAA 3PNYA 3CX4A 1ZKMA 3AUSA 2PZAA 2WHYA 4KXMA 4NAUA 1XZAA 4B80A 4MGEA 2DERA 2FG5A 3MLEA 1IB6A 1JHUA 4BQNA 1Y9AA 4W6QA 4B7CA 2BGTA 3QRWA 3LIIA 4I8IA 3THWA 2PKQP 4COOA 4BZZA 4A6EA 1E1RA 1J99A 3ESQA 3RR2A 1Q1EA 1MHPA 4MYUA 4C01A 4D74A 4IUDS 4PVCA 5ADHA 1O97D 3GLGA 2D00A 2ZDHA 4ZOEA 4U7HA 3SU8A 1ZGHA 3ZWNA 1Y6FA 1WB9A 3VI3B 2A94A 5TMEA 1ZHOA 2I7DA 2B7BA 2ZR8A 5FCDA 1PV1A 3NBMA 4YJ2A 1IEVA 4GECA 1SKAA 2AEMA 1EM6A 1D2HA 2VCHA 4EW1A 4EY3A 4JQOA 4BKPA 1LBSA 1YRHA 3HLYA 1VL1A 4RH1A 2WJGA 2ZSJA 1KVQA 1NQXA 3I9JA 3I6MA 1QKKA 2A0KA 3C0KA 3GRPA 3BE4A 2ZVQX 4ZQFA 1FZTA 4TMFA 4F6RA 3EIFA 1PR4A 2ASVA 2JFVA 3JQGA 4X63A 5JQWA 2DB3A 3I9FA 4YP7A 1R0SA 2GAJA 4PTLA 2B2NA 3WKCA 4S1OA 2G6TA 4L22A 3P97A 3BEOA 1E5LA 1S3IA 2ACEA 3F7NA 4TLMB 3EQ7A 4LYAA 4NCKA 3AY7A 4FE4A 4U7TB 4R54A 1G16A 2XNHA 5KJCA 4BN0A 4MRMA 4BN4A 3I04M 3PCXA 1EXDA 3K35A 3WOVA 2ZYUX 3RTCA 2ABWA 4Z2YA 1E3IA 2WBLC 4MH0R 5LB4A 4EFMA 2OZVA 5FFFA 2O14A 4LNAA 5D2CA 2ST1A 2HCRA 1E6UA 3KELA 3N3AC 6Q21A 4B3FX 4CQJA 3K9CA 3AR4A 3UOAB 3IQWA 4JLOA 4PNPA 3DH0A 4R1SA 3IHLA 3IQGX 3KYIB 2R7AA 1WXXA 1T3TA 2XE8A 3SFVA 3WLPA 3WAJA 3FGNA 2O0KA 3C3PA 2I54A 4R6XA 2IKQA 1FS6A 1XQ9A 2FUCA 2HSJA 1QIKA 2Z2XA 4K1LA 4IDPA 3GYBA 4YMLA 2KYRA 4I1IA 3L7BA 1QGDA 3A05A 4Z7QB 1FIUA 3PPXA 4C29A 2VS1A 3QPBA 3HVJA 5F1KA 1QRSA 1DGQA 3MRVA 2C7GA 1LD3A 1O94D 5E9JA 3BD8A 5BRJA 1DJLA 3QX7A 1ZDMA 3X1ZA 3NANA 2OAQ1 1PVVA 1QPGA 2A30A 2DT8A 4J7CA 4WTOA 4F6RB 4U9IS 1FC0A 2WE8A 3ANYB 4FN4A 4GSLA 3EWAA 2OV8A 2PXCA 2FLWA 2JVIA 3F78A 1RE0A 1SOAA 2FP4A 4A7PA 1XZDA 4AZ3B 4D3DA 2C84A 1L5KA 2XCTB 3GUYA 4JYZA 4BKUA 3NASA 3L2OB 3FOCA 5B3JA 2B2CA 3IUPA 2ZJ5A 3KFXA 4MRMB 4NMMA 4HVLA 3TR6A 1QQ7A 1SIBE 2G04A 2I3ZA 3MN1A 4OJMX 3BN3A 4IDEA 4RHXA 3I2JA 1SQ6A 3WYFA 3KJFA 5HKKA 1GSOA 3KVVA 5FL7A 1J7JA 1JWBB 5KNCA 4JYMA 1NW6A 4KC0A 4ALJA 1UBKS 1ZH4A 1IYZA 4M1EA 2OGZA 1QV9A 4X8MA 4AROA 3DZFA 2UUCB 4D4JA 1D03A 1D6NA 4XD7A 1QUEA 2GWRA 3KPJA 4E2YA 2AGVA 3FHCB 4JLKA 4KRGA 3NG1A 5ICMA 4P86A 1ZM2A 3UWSA 1MP0A 3C6YA 2W2MA 3FNHA 3HACA 1XF1A 3EVNA 3O9VA 4KX5A 4N8EA 3VC2A 3ZGYA 4CLXA 5JNSA 1OFUX 1NQOA 3GJ4A 1HE2A 3C98A 5ALEA 5KJEA 1OXUA 2VCEA 2FUG1 3S0JA 3SKVA 1YKSA 3ANXA 5HRAA 2L2QA 2JH8A 3S44A 4AVYA 2O6HA 1U8UA 1ZL2A 1S2IA 1DDGA 1IQ0A 5HS4A 3MWGA 4C06A 4YO8A 2RFLA 1DG9A 5EJAA 4L73A 1T2VA 1Y6QA 1XFAA 3ZHVA 4EW3A 1GPNA 2H1VA 1ZRSA 2A9PA 1GUFA 1U2DA 2DWUA 3WLNA 2HNKA 4P38A 1MHTA 4J6FA 4ED9A 1UINA 5H7XA 3F6BX 4CT5A 4PR0A 1ZOLA 4Q9JA 3EASA 1U7PA 3P9YA 1T9GS 2FTKE 1F4PA 3DDOA 4MRAA 1SUFA 2VDRB 4PR3A 2HQOA 2JFWA 4J1QA 5AVSA 3EOZA 1OH7A 4R2KA 3ZH2A 1SBZA 1DT3A 1PZMA 1ZNQO 3HYLA 4G5HA 3UT6A 5IG2A 5CX4A 5A6SB 4P35A 3RU7A 4TYPA 2PX4A 3HXOA 1QC5A 2P6NA 2P62A 2XWSA 3L40A 3RU9A 4MWTA 4LSGA 1EXVA 4H17A 3KSMA 4ARSA 3BIOA 3H2GA 3KFVA 1RC0A 4KIWA 2H9IA 3GH1A 1U2RA 2MHCA 2WKWA 3FOWA 3OOSA 2E4AA 4MA4A 2XKKA 3RVSA 1A4UA 1VE5A 4X64B 3ZEAA 2OC4A 3AVTA 4HYYA 3HU5A 3ED5A 1GP2A 3OZBA 1EM8A 2EL7A 3AUTA 3FPLA 4I5IA 3L02A 5COAA 1MJGM 4V39A 3A9RA 1Q0PA 5KWIA 1D09A 2CLCX 3KPVA 4BDSA 1LZLA 2MCFA 3FPBA 5IJ0B 1VL2A 4K28A 1TF5A 2EJWA 4GMFA 4ZVNA 1HBJA 1PUJA 2C9ZA 4TV8F 3A1VA 4R71A 5LJLA 1G291 1B00A 3HZZA 2OMKA 4MYHA 2XOKD 2N1MA 3RC2A 1NULA 2CL7X 5I9LA 2OHIA 2QN9A 1QIJA 1SBTA 2ONZA 2WPDD 3K9WA 3QLVA 1GPBA 4ALMA 5JXJA 1NQ5A 1Y4UA 1J9GA 2CLLB 4UHBA 3THOA 3RS9A 4YAUA 1RCUA 3ICOA 3L1VA 4MROA 3R3WA 4DG8A 1YBMA 2GRUA 3PUYA 5FA6A 4LUCA 2FU5C 5FBVB 2JASA 2XUQA 4UMEA 4W5WA 4ZI7B 3A4YA 2CL5A 2C88A 2HJWA 3EXAA 3OE7D 4HQKA 3DOIA 4ND4A 5A4IS 2ZYVX 3L6CA 3N2NA 2X0RA 4WW0A 1N57A 1PWXA 2FCRA 1V3UA 3D8TA 4FI3C 4I9HA 4F38A 8OHMA 4CDRA 4E1BA 1Y48E 1ZU5A 4FR2A 4C5CA 1DIHA 5IM5A 1Z3CA 1NLUA 4ZAFA 1P4RA 2BMJA 4LRSB 4C0XA 4CM5A 1U81A 1FRQA 1WUYA 2MOKA 3ANSA 1P9RA 3QKWA 4JUIA 1X8XA 3ZJ5A 2G77B 1KYWA 1VKNA 4KO1S 4WASA 5H81A 3HWWA 4BE7B 1N36B 1EM8B 2CWDA 2RGNA 3NJ4A 4GBED 1BEUB 3CSSA 5TLSA 1IU9A 4WESA 2Q3CA 4MGIR 1NASA 2Z1DA 1QF6A 3BG5A 2QW1A 3WLIA 3LDGA 4EUFA 3IAXA 1E3WB 3A6JA 4I9NA 3O8OA 4GX0A 2QVLA 4Y2RA 1EVYA 4Q1VA 1JQKA 1H1DA 1J4AA 1ZUNA 3LYAA 5CPFA 4YASA 4EJ0A 5JZSA 4YN3A 3O8DA 1ORHA 1P80A 4LE0A 4Q9AA 4P7BA 3D43A 3H75A 1QHYA 3COWA 4QNRA 4WA7A 1NM5C 2CNDA 4LBWA 3ZU5A 4DN6A 3OZCA 3LPLA 3OCCA 1PGJA 2P4QA 1NVAA 2JH9A 4K40A 4O4HF 3TE6A 1A9QA 1XDZA 3ISJA 2C9CA 2IHTA 3IOMA 3OLVA 4LAFA 3ZZ1A 4C7KA 5C1PA 1PS9A 1Z47A 3QHAA 5AVKA 3RVLA 3CRNA 2IVFA 3KV1A 4AICA 1ORVA 1BHSA 3AJEA 2IWHA 3Q88A 3MT9A 2J7PA 1I7NA 3EH1A 3FCEA 4DCNA 4YUXA 4H7EA 4KWIA 3T5BA 2B36A 5AW6A 3ABIA 3SSMA 5SZIA 2YTZA 1UBUS 1XCOA 3KVYA 3HI4A 1CSEE 2P4HX 2PWAA 3WYGA 3PP8A 3W05A 2PGJA 2JLXA 1QPBA 3KJIA 2YCLA 3VAZA 2QLBA 4UZFA 3MB8A 4P98A 5A02A 2PA0A 4XEHA 2B1GA 1HX7A 1E9EA 3FLBA 4I4TF 9ABPA 2AR0A 2C3MA 5DI3B 1A4IA 1YL7A 2ZROA 3GNQA 3ZZMA 1OH8A 2D2FA 1KSGA 3IVXA 1MRZA 3H9QA 4CCSA 5LD2C 4BQEA 4LE1A 1W5EA 1OV4A 1PRYA 2QW8A 1N9ZA 3BTVA 3FBGA 4QXMA 1PKEA 2DUUA 3SXUA 3V1NA 4ZZIA 5F35A 4EJFA 3C3DA 1KYVA 1XCBA 4I1YA 3KG2A 4TYMA 4TVBA 3UUEA 1PTJC 2IIQA 3R23A 1ZUNB 4YWJA 4UD2A 3BXZA 5KTMA 3VU8A 2N42A 3QVKA 4O29A 3E03A 1OW3B 3PF8A 4CCAA 3C8UA 3CEAA 4XJSA 4BQQA 3I0MA 2VDWA 1H2BA 1Y3CE 4IZIA 4NI5A 1NUSA 2FZCA 3LX8A 3P0IA 1I24A 2ZTMA 5ALNA 2JFPA 2OGSA 4FFMA 2C7VA 3MMZA 5FBKA 4Q16A 4TM8A 3TTTA 4XQEA 4L72A 1F3LA 4EPXA 2I55A 3QPUA 4AS2A 2OV4A 2G17A 4QXQA 2QP3A 1UC9A 3AESB 1QHFA 1OVGA 4CKWB 2V5VA 4Q9LA 2O2DA 2OGTA 5CT8A 3CISA 2BFEA 1EK1A 3W9YA 3D3JA 1XXHE 4C07A 2BGLA 2B3TA 2QG4A 4Q4JA 5F2EA 3I04A 4HP8A 3IULA 3MLBA 4YJDA 3ZVKA 3SE0A 1WMFA 4KDRA 3IQDB 4D4HA 2ROQA 3DZGA 1JFLA 3HLKA 1S01A 3S2YA 1OWOA 1WUKS 3B7PA 4N0MA 4PC7A 1SCJA 2QMOA 2G3YA 2HFKA 4DLUA 1TZMA 2QNBA 2XYPA 3OZTA 5KSOA 4A2PA 2OVFA 2PGNA 4RGVA 4BX2A 3DULA 4B46A 1T5OA 3JW8A 5CXSA 1QH9A 2AMVA 2PA3A 3E6AA 1LGYA 3MCAA 2RAFA 2EKPA 1XD2A 3RLIA 4WCVA 3I2KA 3EDQA 5JSZB 2ZITA 1H05A 5B3LA 5A62A 4KH0A 5LP1A 2UZ1A 4Q02A 2VDWB 5DBHX 5BP7A 4F4CA 2J3KA 1C1DA 2PXXA 1G3IA 3AEYA 1KO4A 3NHBA 4OFZA 1H0RA 4LXHA 2I9KA 4ODIA 4CMEA 2EJVA 3SQOA 3EPKA 4MP3A 3QU7A 3WV5A 1TC1A 3EYWA 1TM1E 3MD9A 4H3SA 1WMSA 7ABPA 3AJ9A 4PINA 2WTEA 4CG0A 4U7WA 3ELWA 4G1CA 2WHPA 2GOYA 3AMVA 1BXGB 1X8LA 4NARA 4PSVA 4RD4A 4NFYA 4YMVA 1RRCA 3IUQA 3L8EA 3CPEA 2YW2A 4Y6QA 3K4QA 3L7DA 4Q5IA 3SHWA 1LDMA 1THGA 2VKQA 3EXHC 3LX4A 3MWLA 5J2UF 4ZRDA 4JXZA 1EPUA 1YE8A 5F64A 2WTMA 1GAEO 5DOZA 3WGVA 3SZGA 2I80A 1W36B 1ZMTA 4RJ2A 2C5FA 2OCPA 1FSGA 1MOZA 3RUPA 1O4WA 2AFIB 1X9HA 2IYXA 4G5SA 2FUNB 3BYZA 2VHEA 2BZ0A 1MR3F 2YFQA 4QECA 2UZ3A 5DBGA 3SJCA 4YCCA 2O0MA 4DIKA 3F96A 1NXSA 4ND5A 4W82A 5EVJA 3S99A 5T41A 3NTUA 5JS2A 1V8DA 2BSXA 3RJTA 4FPXA 4RLHA 4Q9KA 3DSRA 1QSGA 1X1EA 2YDXA 1ZCFA 5F9HA 1PFQA 1QBKC 1VL6A 2IY7A 2J0VA 3FPGA 4LDQA 4QDUA 3SLGA 1VLZA 5JMWA 4KIFA 1QTIA 4HYQA 3S8EA 2XCUA 5KINB 3B3AA 3DQPA 5AM5A 1I0ZA 4BBJA 4DLYA 4DEXA 2BELA 4WZAE 4YRNA 2WHPB 1J20A 3EQ8A 3UJ9A 3D4IA 3HCEA 1TEZA 3OJWA 3LI2A 3DEHA 2QRQA 1FQWA 1MX1A 2BHSA 4ECAA 3DE1X 3LCUA 1OZ0A 1APBA 1GL9B 2WVHA 4ONEA 5CVJA 3OZRA 2X86A 1E9DA 1H6BA 2BEWA 3FTQA 3GQVA 3PEEA 4DNQA 3JVDA 3ADKA 5KOJA 1YK1A 2FW8A 2UVQA 1IY2A 2GDJA 4OB6A 4YDQA 3A37A 2AUMA 4S1TA 5AKJA 3ROZA 5JCXA 1YS2X 3TQQA 4BO1A 3C1AA 1A2OA 1LDNA 2CJXA 3TQSA 5BOSA 3DVRX 4F6LA 3UJ7A 3HM9A 4YTEA 1UK6A 3NFYA 4JI5B 3TIFA 1A5SB 2Z1NA 4HDSA 4BE4A 3CWCA 3MJDA 4LHZA 2UYOA 4IYJA 1IWOA 2JATA 2PZ8A 2QTVA 2ZUBA 3RIMA 4GXTA 3V7YA 1N32B 1BOOA 3HCAA 1T9DA 1NSTA 2BFAA 4OMUA 3BK2A 5LQDA 1QK3A 4YAWA 1IBLB 2XDQB 3VC3A 2HLNA 3GPDG 1G8MA 4GPTA 2AQKA 3TLYA 3ZCXA 3QXGA 5CDGA 1NF3A 2QVCA 1O6ZA 3ZD9A 4OGKA 2C7OA 2IY9A 4Q93A 3JQFA 1NXTA 4NYJQ 3MQ2A 1IOLA 4JB3A 3PUHA 3Q7RA 3A9VA 4HQRA 4WXYB 3U26A 1VYUA 3KXIA 3DQZA 5C7OO 1MB0A 3CY6A 1A9ZA 1T9GR 3SK0A 3ZHYA 1DMRA 2RK6A 1UKZA 2ZT7A 4XA8A 2WUDA 1SNYA 2V55B 3LT2A 2IYWA 2OHXA 1JL3A 3GJRA 3MJTA 4MUIA 4TUYF 5FTNA 3NPMA 1A2BA 4OHOA 1O54A 4OHZA 2JS7A 3M5CA 3H5AA 1XEXA 2XKAA 2BEWB 4HDRB 4QG7A 5KOJB 3ONEA 5DYGA 1QYVA 3IKVA 3VOTA 1L8QA 1VTKA 3GDGA 4B7UA 4F45A 1H6DA 1KZ1A 2QM0A 3ZE8A 4PZLA 1VG1A 2Q6KA 4CKBA 1LDYA 2YY5A 5H1YA 2XA9A 4CMBA 4KXFB 1JEYB 4MYTA 1M2GA 5B7NA 3V1MA 1N1GA 3NXSA 4UTOA 4KQHA 2MT9A 4YJ3B 1O94A 4UEWA 5DP1A 3GVCA 3KZXA 4UTXA 3U5TA 3TCKA 1A1SA 1HQCA 2WMDA 1FDOA 3ITDA 4TZ6A 2QTVB 1LVUA 2IDKA 2LRHA 1GTJ1 3A6ZA 3ILSA 1L6RA 4IO0A 4I99A 4IVQA 4PG8A 2EBUA 3RM3A 4LYHA 4CEIB 1P75A 1V9SA 2HXSA 4XRGA 5JSQA 3BRQA 2A5GA 4DC0A 3O2NA 4PLCA 4E5NA 4MKZA 3AHCA 5F7ZA 4FJ1A 1QHXA 1WCWA 4ZHSA 5AJVB 4CCYA 2ZBDA 3ZCQA 3AVWA 3R8CA 1G63A 3AUYA 5CW1A 4YBZA 2HQSA 4BNGA 3RUHA 3BZWA 2G0AA 2OBBA 4BNTA 2O1SA 2CSXA 4PM4A 1TM3E 3C1OA 2ATVA 2XB6A 3EMKA 4W9RA 3HMKA 5CK5A 1PT9A 2X1LA 4KLRA 2CE7A 4YUYA 3OLYA 2VDMB 1DC5A 4I0WB 5K1ZA 3L4BA 1E8NA 3USZA 1P0CA 1V1RA 2FSGA 1TW2A 3B3JA 1XEXB 4FCVA 2MMGA 3UMVA 3VDXA 1E6MA 4P32A 2H5JA 5LXTB 1IONA 1ZSVA 3LHDA 3C5CA 3GLVA 1GA1A 2ODNA 3AXTA 5KKAA 3V1LA 2WD7A 1YCGA 1EINA 4ZVTA 4DEVA 3DT9A 1MC8A 3MMSA 4IJQA 5TR9A 3SR0A 2HCFA 2VHQA 4RDCA 1FUIA 2V3CC 3CLKA 3K1AA 4L74A 4DA8A 5HM8A 5AKLA 1T8SA 4ID3A 4FGUA 5FXMA 4U2BA 1JP7A 1VJDA 3FOBA 2EKDA 1ADFA 4QU0A 1EMDA 2E4YA 4NU6A 4IGIA 2AF4C 3WSVA 5J63A 4NQZA 4XI9A 2D5BA 3FTFA 1D7OA 5B3JC 3BWCA 3USES 1ISHA 5AW2A 3ZR4B 3DNPA 5FUMA 4NPHA 4OGLA 5AXAA 4URFA 3ZH9B 1OBVA 3D4LA 1T0PA 3H9UA 4PBSA 4LDRA 2EF1A 2W6QA 4S2EA 5BRAA 4UEJA 1GD1O 1FDTA 1Q1NA 2OCYC 3HCPA 1M6EX 4Q15A 2C2KA 1QQ6A 4YVFA 2XUZA 1C50A 1E2GA 4LJ8A 2B34A 3WGQA 5LQUA 2H2FA 1BFKA 4OSOA 4EB6B 4KZPA 1N6IA 2IS1A 3G23A 4HGNA 1NYTA 1Z5GA 1KEKA 2C04A 3DUWA 2OY0A 4IHQA 1FK8A 4WGGA 3BGDA 4EVQA 3O2SB 3TTYA 4KLAA 4Y6LA 2FRDA 2YFYA 1QWOA 1U7ZA 2BBTA 2MMCA 2R1TA 1GQQA 1D2AA 4D43A 1QP7A 2HIGA 3KAJA 1Z2AA 1KJYA 2GBFA 3OCYA 4OFXA 4JJ4A 3GC6A 1DQYA 1VLQA 1Q95A 3RS5A 4H7IA 3VSDA 1HYHA 2WD7B 5C4IA 4DMCA 1SK8A 4OXRA 3M33A 5EMKA 4BJ3A 3BDVA 1GOTA 2ZYSA 3DCYA 3K1AB 4ZJPA 4J03A 2RBGA 1RLUA 1GGFA 3QELA 4JASB 5FI1B 1YR2A 2ZTSA 3WMWA 5KX5B 1KAGA 4DV5B 3Q8MA 5IX8A 2YZMA 3RBXA 3RG2A 2XOKA 1NUAA 3JALA 4J94A 4JL5A 3GNSA 4R68A 1MTOA 1E9BA 2YNMC 3KYCA 4RWZA 3NBUA 2NYRA 1P4JA 2JGNA 3MYRA 4J0IA 2PN1A 4CWAA 5JADA 1GDDA 3UXHA 1A8SA 1C3OB 1GZDA 1JF8A 1Y9ZA 3JQAB 1NY6A 1W44A 3CKLA 4MUFA 2EL9A 4H3VA 5TS2A 4BFWA 4YCMA 3OE7A 4M8SA 4ZVRA 3LKDA 2Q7XA 4PG7A 1EK6A 5TMPA 4WE3A 1LBQA 2YRFA 2OHOA 2Q8PA 7REQB 1HURA 1O5TA 1U5CA 3LO8A 4OI4A 2H4WA 2QVXX 1FW6A 3PPWA 5DN6A 2ETVA 4RA6A 1PGPA 5CLIA 4NABA 4RPCA 3PG5A 3WBKA 3DPSA 2AE1A 1XQ1A 3KVRA 4CZ2A 2RB4A 1E5TA 2PSEA 3O4RA 5K20A 2EU8A 1NLFA 3GLTA 5DBFA 1YTLA 1V8FA 4IKOA 5ALPA 3P9PA 1NDQA 2EGHA 2R8BA 3B3QA 4J7XA 3I2HA 3K5WA 1QZTA 3K92A 4ZC1A 1DXHA 1KMQA 2HDOA 1QF7A 4FDMA 3O9ZA 4NZPA 3VPGA 4DOMA 5AVQA 5KKNB 3RS7A 1DZIA 1X3SA 3E9NA 2EFJA 1OU0A 1PSZA 1UK7A 3HQ4O 2GNPA 1M74A 3RUAA 1KSJA 4MVJF 4OQNA 4DA6A 2KBEA 2N75A 1VGRA 1QP8A 5FAKA 1OHHD 1IG0A 2ZYWX 3AFOA 3JALB 3WGGA 1ADYA 4Z49A 3OIWA 2IY8A 4ESVA 1F8YA 3VDNB 3T4EA 4LGCA 4ZCSA 1VGQA 5I01A 4EUSA 1BE0A 2WICA 1QGAA 1OU4A 1E0AA 2PUHA 4MRPA 5DT2A 3DB1A 3DWEX 3O4JA 1EFVA 2J4CA 1XD8A 2YXDA 5TGZA 1A1VA 2ZRQA 4BLQA 2QIOA 5AJUA 5K8CA 3QJ5A 2JGDA 3V34A 2W4IA 3FYDA 3OD5A 1G21B 1T6NA 2G70A 5EVCA 5IMBA 4AMZA 4D82A 3PGVA 1DEHA 1YVUA 2HCBA 2AWNA 4ZAZA 2C0CA 2QRVA 2WV9A 5LMCA 1XNQB 3TK1A 4AB1A 2WKPA 1N0IA 4F5WA 1D2GA 2DPLA 4HRYA 2QENA 4ER7A 1L4GA 2VRBA 4F60A 2VZLA 2PT6A 1OREA 4HGOA 1ADJA 3LG2A 2NV6A 3LLVA 3UENA 4TZ0A 3EVGA 2GRJA 3C6KA 4UDNA 4DQVA 4Z3KA 3NHZA 3NEJA 1OPXA 4UHEA 4ZQEA 5DEIA 2G1AA 2HZBA 4XEUA 2NIPA 3M82A 2NOAA 2VTKA 4CMIA 5EOVA 2EG5A 5FEMA 3UGTA 1TTQB 3C1UA 4K3VA 3UXYA 1NLZA 4E46A 2GCIA 2EYQA 2VWQA 5E2BA 4Q4CA 2P9CA 3EIXA 1I7PA 4R3WA 3K96A 2DBZA 3CUYA 1N2EA 2IS4A 5GZ3A 2DH6A 3HYCA 3R3UA 1AURA 4ADSG 4QTUB 4CV1A 1FPQA 1NMEA 2H65A 2PQ0A 3BMOA 4IRUB 2CFSA 1E9SA 4RY8A 3T8YA 4BWFB 4IR7A 4F5ZA 3FSEA 2QZPA 1PSWA 2J4DA 2QX8A 3PL5A 3ILHA 4J4HA 3WRYC 5IBQA 4BTLA 1JXMA 1XWIA 3NS7A 2HA4A 4HAWA 3WB1A 2I22A 3ZWAA 4Q47A 4IHAA 2H4YA 3ESRA 3F1KA 1C14A 1M75A 3MNFA 1SOVA 2XVZA 3JQ7A 3TW8B 2I62A 3OOYA 4BMPB 1JFTA 1X7WA 2VWGA 1F60A 4RSMA 1FLVA 5ED0A 2QRVB 5AK6A 4B3HA 2XV1A 3QE4A 4JFAA 4JXKA 1G8FA 1QUFA 4YIKA 3L0OA 1NFFA 3O21A 3KR2A 4LZAA 4RANA 4ISBA 1KO7A 3VTAA 3IBYA 2BF4A 2FVYA 2VYND 3RYIA 2GCOB 3TGLA 1PVDA 4MIYA 2GAAA 3A9TA 1BDIA 1DC6A 1ORDA 3GFVA 2AVDA 2YJ4A 1T4CB 3KFLA 4K3UA 4MV0A 3BXFA 3DL0A 3HN6A 3NDPA 2E5FA 3PQ8A 4FGJA 2YQZA 3PWTA 1PO7A 4I36A 5HCIA 2ZSEA 3ONNA 4OM8A 3BGOS 2PIAA 3AEQA 2G09A 5JW6A 4C2TA 2L18A 4NOJA 2ZZKA 5COQA 1C30A 3D7NA 2PLAA 3PNKA 4FW8A 2P4EA 3E15A 1TM5E 3G5UA 1KAEA 2AN5A 5HF9A 1KP3A 2RHBA 2ATEA 3GEHA 4OKIA 5CHEA 5K0ZA 5L3SA 4LISA 3RIEA 4AKSA 3ST7A 4CM3A 3T0FA 1AQUA 2O8EA 1KPGA 1KWGA 1Q0QA 3KO8A 3SPXA 2WYHA 3TWOA 3RUCA 1XUOA 1XWFA 3D9QX 3JZIA 3A4NA 2PRYA 1DC7A 1J9EA 2FVXA 4IQ8A 1ZGAA 1ETHA 2VSOA 1HMPA 1XX6A 1S8OA 4BJ5A 4PO8A 2R85A 3TFWA 4NEGA 1OFTA 3K1ZA 4RPJA 4DCJA 4NECA 5B7QA 2C3PA 2XD9A 3QA9A 3T9AA 1XN1A 3KQYA 3PV0A 5M5BA 1GDTA 4B82A 4RTNA 621PA 1X1BA 4YRTA 4LQLA 1FTYA 1O87A 1USUA 2V6IA 4LWZA 5CU7A 2GXSA 1E2QA 2VTVA 2NZJA 1KO8A 3DVAA 4HVTA 4PC2A 2I2FA 4YLGA 3WK6A 4QG3A 4Q3KA 2B82A 5CVDA 4BIMA 3FZEA 1P2UA 1VBKA 5DNDA 4E22A 1W36C 2Q6VA 3N2GB 2PSJA 4ICIA 2DP4E 4RMHA 3C3CA 5ALZA 2IRWA 4KN9S 3ENNA 4DXHA 3H8SA 3TH5A 2XBUA 5A9SA 3BMQB 4KV7A 1XP5A 4QVKA 1ND6A 4TTVA 821PA 1CEYA 3WYBA 2WPNA 1NR7A 4XW2A 1P73A 1UBGA 2AKAB 2W90A 3C24A 4D0LB 1X87A 4FYVA 4QELA 2C8LA 3B6JA 3G79A 5T3UA 3U4IA 3MS7A 2FK8A 4ZI2A 2P3OA 4QZVA 2IU3A 5LKAA 1SC9A 1P45A 2Q3LA 1H1LB 2IU6A 4UMFA 1NW3A 4YP9A 3G88A 1O6BA 2HX1A 4JC0A 5J5VA 4EA8A 5L3SB 4KAXA 4DT1A 2POCA 2PPLA 3UV6A 4E2WA 2HJVA 5IAKA 2YH2A 5BMOA 3AEXA 1KA9H 1JVNA 1QHHA 3CLRC 2PR2A 2W98A 3EGDB 4QRDA 1Q22A 3E5HA 3H86A 3UF0A 5BWNA 3VO8A 3QHPA 2H11A 3TLZA 3PUXA 2YS6A 5GZ1A 5LL6P 3ADBA 1RLIA 2ZVDA 1E1YA 5FBRB 3RW9A 5JAQA 3AR6A 3H1AA 3NDIA 4JMPA 3QWHA 2W83A 4M9CA 3LY5A 5CCBA 1PWZA 3H4VA 1PGNA 2YVLA 4GZLA 1XMOB 2P68A 3ITKA 1S9DA 2PUBA 4UPDA 2E55A 1G7RA 1T91A 1WU7A 4QQRA 1KEPA 1S2DA 1T24A 4JGIA 2X0DA 4RPKA 3DVAB 1EXMA 4NC9A 2O4CA 1E89A 4ZCQA 3MMPA 1CF4A 1CIVA 3DFFA 5DSTA 5K09A 5EIXA 1OX4A 4MX8A 4PQGA 4WXPA 3ENVA 1KVSA 3QX3A 1RFLA 2VP3A 4B3GA 2HR1A 4URYR 1RHJA 3SG0A 1XTZA 1XP8A 1E9CA 4OLHA 3I28A 4RSGA 4IGAA 2ZUVA 4NZZA 2QHXA 4R2JA 3FOZA 2WJ3A 1BS2A 4EHFA 1IJFA 1DHTA 2X4IA 1DC8A </