3L8JA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
XXXTTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8jA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8jA02
3GM3A 1KTMA 3BRJA 4NQFA 1WWPA 2L6FA 1K40A 4GEHB 3W8IB 1K05A 1V4AA 2HSBA 4EBJA 3C8GD 1OW7A 3L8JA 3JYYA 1QVXA 4EBKA 1KNYA 4R32A 3TULA 4XEKA 1OW8A 2Q00A 1UFBA 4XEVA 3S9OA 3C8GB 2YWAA 3GM2A 2KK1A 2JPUA 1K04A 2PBEA 3O10A 3W8HB 1ZZPA 1WOLA 3K7DA 3U3FA 3JZ0A 3C8GA 3C18A 2JX0A 3MFNA 1JOGA 3RQEA 5F28E 3GM1A 4XEFA 3B71A 3RQFA 2L6HA 3RQGA 3AJMA 1O3UA 1WTYA 1OW6A 2L6GA 2LK4A 3L8IA 1PV3A 3U0CA
chains in the Genus database with same CATH superfamily
2QE9A 3U9JA 1GQAA 5TJ5E 2LIGA 4DJ9A 5KYWB 2WB7A 4E0IA 4O6NA 2HJMA 4IGGA 3QXZA 4KNWA 4MVRA 3A4LA 1M56C 5L0FA 2GTRA 2C04A 1U6HA 1TFOB 3W8IB 2XM0A 2QNLA 4R32A 4MTOA 5L0JA 1RKEA 3QK8A 3B9QA 4WGZA 1YZCA 1D0XA 3W8HA 4OIQF 2DB4A 4CIHA 4JKVA 2HSQA 4B6IA 4DRIB 3TJ6A 3JRMO 3BEHA 1NG1A 1I5NA 4PJMA 1EI7A 1FTSA 1UG7A 2GFHA 3U8VA 2XXAA 4ELSA 4E18A 1DOVA 1ZHTA 1VYIA 2XLEA 1NFOA 2VB6A 3JT1A 3DKAA 4JZAA 4XQ1A 3HTKC 4DRJB 1QVXA 4PFPA 2A69F 2CCYA 2R03A 4JTAB 3JTLO 3ZWIA 4ZLDA 3H81A 3DM9B 1HE1A 1YLMA 5L3VA 2ZPAA 3MOYA 5C9GA 2AU5A 1UFBA 3W8HB 5T3TA 2NUTA 3EGDB 1T6IA 5JUAA 2HMZA 2OOCA 3WAQA 3PDMP 3UMHA 5E2QA 2DI3A 2XXAB 5BUOA 4JVSA 1O5HA 3FOPA 3LLIA 4K1OA 3Q1TA 3OEOA 4IJJA 5COFA 2Y3BA 4MVZA 4CDVA 2XRHA 5AC5A 2AWYA 4JW1A 1APCA 1QQ3A 2LCHA 1AUEA 2QLAA 2L81A 3IQTA 2W9YA 3POVA 2R7WA 4BJ5A 3O55A 1NZEA 5JBWA 2D5RB 2DUBA 1WOLA 2EILC 3CZ6A 3A11A 3W2WA 4JCHA 4I3MA 3S84A 4W8KA 4CS8C 1PD1A 1N1CA 3QZCA 3ADDA 1CGME 4XPYA 3ZC4A 1NSGB 2R7RA 2TMVP 1YA7O 3RQGA 5A69A 1Y64B 3P5MA 1BBHA 3NG1A 3VRCA 1R5ID 1VLSA 2H7BA 2H7VC 4IWBA 3L8JA 3FMSA 2PPYA 2AVKA 1TKNA 3LS1A 2IXMA 3CAXA 3WG7C 4HE8D 4YT4A 1UIYA 1Z3IX 2OQMA 1GGQA 3Q6NA 2W4BA 4N4WA 4GYTA 2A0BA 3I4UA 3T4RA 3U3FA 3ASOC 3DE8A 3US6A 4W8PA 1VK5A 1JPJA 3B0PA 4JURI 3PHF2 5DS6A 3BRJA 3KMIA 5KYUA 2Q9CA 3RFYA 4U5FE 3L1MA 2G62A 4E7SA 3H2UA 5E3AA 4NEKA 3AJMA 3TK0A 2EPOA 3ITFA 1V4AA 1JMWA 3GORA 3FAPB 4EBBA 2Q00A 3FDUA 2HW5A 2WVOA 1E85A 2PX0A 3O39A 3UMKA 4FX5A 4NTFA 3T89A 3VF0A 3KKBA 5L0GA 1T6UA 2Q3TA 4CSAC 2ASRA 4U5DE 3KYIA 2P0NA 2ZXRA 3TULA 4ER9A 3FOOA 5KYXA 3PMRA 2OEXA 3O6XA 3OC7A 3T6GB 4FZWC 1DCIA 4D4NA 2CNWA 3K1IC 2AP3A 3HJCA 4Q7CA 3DE9A 1F1MA 4P9TA 1Z23A 3GWNA 1S7ZA 3NMIA 1WZ8A 4U5BE 4CX9A 2L9JA 1H6GA 3QW1A 4P9FA 3I47A 3GM3A 1XZQA 5E33A 1CGNA 2MYSA 3LUTB 4U19A 3FHDA 3DMDA 3MYBA 5A6JA 4I52A 3HINA 4U9DA 2YLGA 1HW1A 3DAFA 1C02A 4I42A 2NUPA 4H54A 2J0XA 3TD7A 4PFOA 4JYLA 3IEEA 4PJJA 1JAFA 3JSEO 2H8AA 1WTYA 2LK4A 3R0OA 3ADCA 4AK9A 3QW0A 3E70C 3EHMA 4X0RA 3HNKA 4FWVA 2PF4E 2LQGA 5DVWA 1J8YF 5JSLA 2J8WA 3U3BA 3SXYA 3DXJF 4CS9A 2A1DD 2UUIA 2JX0A 3KPHA 1M57C 4YK5A 3ECSA 2J45A 3EZHA 2L6GA 2EPLX 4ANJA 3B0VC 2A6EF 4LDRA 1D1BA 3S29A 3EG9A 256BA 5B3IA 5L3QA 2HSBA 1FR0A 2RD9A 1Q0MA 2DYRC 2EPNA 2FAPB 1HMOA 2YZSA 4K2NA 1DUBA 2VCBA 1T01A 1NU9C 2ETSA 4MTFA 3RVZA 2NUPB 1H9TA 3R2PA 1SMYF 5D92A 4KBLA 3LJBA 3JSZA 1EY3A 3X1OA 2XM4A 4U1AA 2KK1A 3G4XA 3GM1A 1E84A 1U89A 4WJ0A 3HRXA 5L0CA 4O6MA 3J06A 1Q0GA 2OJED 3V5ZA 5A6AA 1ZHWA 4MVSA 3U2MA 4DVZA 3MBGA 2JD3A 2OCCC 3W8IA 4FJWD 4CS9C 3V5XA 4CDAA 1WGWA 3JZ0A 4JCZA 2IXPA 2Q4FA 1DOWA 4BPMA 3B71A 1OCOC 1JXZA 3K6BA 2G3KA 5B3SC 4JOTA 3NDBB 4YN0B 4JE9A 2IM8A 3ZVRA 4K0DA 4IAOA 4GEHA 1EA8A 4ULVA 2P61A 4AE4A 2JPUA 3G4ZA 1IZMA 3EH1A 4OIPF 4IZBA 1Z63A 2A0UA 2IBFA 2KW3C 2HS5A 4DXWA 2L6FA 3T6JA 3QTHA 4EWCA 4JWVA 3U8PA 4AX2A 2J7PA 2P1AA 3F47A 3RQEA 3UMIA 1VTMP 4J7YA 4A2NB 1G4US 1YA9A 2XLMA 2HJ3A 3UR3C 4EBKA 3HNIA 2FGYA 1VYKA 5EGYA 1Z6AA 4RBNA 2V3CC 2J46A 3SZRA 2YRFA 1MJ3A 4I1MA 3C8GA 2WVQA 4OINF 1H7IA 1J8MF 2YL1A 4O79A 1LE4A 4IRUA 3EGDA 3I5QA 4GEHB 4YT2A 1OW7A 3JYYA 1OXBA 4AE4B 4OLQA 4J7TA 1M2OA 4DBQA 1SZIA 3I5PA 2HZ8A 2R02A 1PV3A 4XLNF 2PFDA 4C3DA 5A6KA 1ZVZA 2ZXPA 4WABA 1Q0KA 1QSPA 3V7OA 1VB5A 1ZU5A 2IOQA 4I4ZA 4EIYA 5BQGA 1Q0DA 4ZU2A 4C7OA 1E83A 2XSEA 1K05A 4CS8A 2ZD9A 3IRBA 1E2XA 1IW7F 4EKWA 2Y69C 3DI5A 1ZW3A 3C8GB 1ZZPA 3K7DA 2XLOA 3SXKA 1YVIA 1NU7D 1YJGA 2A68F 2E87A 2IXNA 3N0TA 1XZPA 1U0BB 3U2LA 1BR1A 5D91A 1QPUA 2X0CA 1V55C 3IHUA 2BC5A 2Z15A 2Q9BA 3RQFA 4MS2A 3NKDA 3H02A 4LDQA 4GQHA 2Y3GA 1ZYRF 5JVEA 5CIVA 1L3PA 2X51A 3NYLA 3Q0GA 4YL0A 4IZCA 2KNHA 4C7OB 3LESA 2PBPA 3AQCA 3JYHA 4HEAJ 2EINC 1FAPB 4XPXA 1RJMA 4IZDA 2WZGA 1TQGA 3ZTMA 2J9BA 1G8XA 4XTKA 3TJ5A 3HNJA 1NFNA 4JCSA 1A7DA 5AGFA 3AOUA 3KYJA 1TFKB 5T1DB 3EJNA 3T9OA 4Z9JA 1LVKA 1ZU4A 3ABMC 1OXKA 4LACB 4JJFA 5EHHA 4JEAA 3LLKA 1A41A 3AG3C 1FFTC 4CSAA 2XL6A 2IYLD 3Q7LA 4HFFB 5L0HA 5L0DA 4NC3A 1RMVA 2HV6A 2GA0A 4U9EA 2ICWG 3SYNA 3OWTA 2L6HA 2R05A 2XLVA 4JJGA 5DS4A 1PCXA 4FZWA 4CDYA 5JBXA 1NZYA 4G7HF 2H7OA 3K1IA 4U5EE 1M6TA 2QQ3A 5DS5A 2PNOA 4RD9A 4XEFA 2OG2A 3DAGA 2R7VA 1O3UA 1Y6DA 4N6HA 4WGYA 3S27A 3G50A 3T6BA 5B1BC 1Z7Qc 2XLWA 4NCQA 3TQOA 1T6QA 1LS1A 2CNWD 1D0YA 1EF9A 3SNHA 1VMAA 1JPNA 4PR9A 5KYYB 2F22A 3Q6MA 3C8ZA 1EQ1A 5F5FA 4LLCA 4MW8A 2YLIA 3M1CB 2XL4A 4MVOA 3SEOA 2Y3HA 4IAQA 1FFHA 4U5CE 4JFCA 5FCLA 2KJGA 3PCVA 3M4BA 2HUJA 3L8IA 3GEIA 3X2QC 4NQFA 2P63A 1NZYB 1K40A 3W2VA 2F6QA 3U9MA 3HLZA 1R4TA 2VASA 2W45A 4QI0A 3RKOF 4YL1A 3ZG1A 1TWGA 1GS9A 1B68A 3JCUQ 2EIMC 1V74B 1LKXA 4YT8A 4C3EA 3OA1A 4YWQA 4MOUA 3AG4C 3EH2A 4U18A 4MNDA 1MMNA 3GANA 2EPMX 2EJ5A 1LE2A 3LEOA 2YL0A 2P7VA 3V5YA 1K04A 1ORSC 1Y4CA 1TWCA 4PK4A 2C03A 4WCZA 2UZFA 5A6BA 3ZIBA 2V26A 1OKKD 3FDQA 1OW8A 4H4KC 5B1AC 4ELWA 1AEPA 3FAJA 1TR2A 4DRHB 3ZSUA 2M4EA 4ELXA 2OJQA 3MYFA 3JRTA 5FZTA 4N06A 5JLIA 1TWAA 3LS0A 5T3WA 2R7QA 2WL8A 1ZHXA 3Q0JA 3GODA 1HW2A 5F28E 1OKKA 4FAPB 3HKKA 4LLEA 4PJLA 3ZQVA 2YEVA 3T8AA 4NNQA 1G5ZA 3MX3A 3SWXA 4KNVA 3SP1A 4JEBA 4K3WA 1I4ZA 3C18A 1LI7A 4I1OB 2IEXA 3H2VA 3F46A 1ST6A 1XWJA 4BEMJ 4ONSA 2KC3A 2R7UA 2PX3A 3NKEA 3Q7GA 3DWWA 5JP7A 2AWCA 4J30B 2HMQA 1V54C 2G3VA 2J7PD 3T88A 3O4XE 3EHNA 2YQYA 3L34A 2R7SA 1E86A 3QVZA 5E3CA 3RSIA 4OIOF 1YYXA 1CPQA 1Q52A 5DQTA 4JTDB 4YT5A 1MMAA 3C8GD 4JTCB 2NG1A 1I4YA 4K7BA 1ZHYA 2YWAA 4JRZA 3IPMO 1AVOB 4BG0A 1Z5ZA 4MVMA 4ULWA 3TOLA 3S28A 4HFKB 1UX4A 1JRAA 4MVUA 4EHPA 4KI2A 3PZKA 3TLFA 3E9VA 2Y39A 1YZAA 2PBEA 3IQCA 2ZXOA 5BQHA 4O6YA 1BZ4A 2EPKX 4KNPA 3C62A 2Y3DA 4IB4A 2KSFA 1S05A 4EBJA 3DM5A 2QTVA 3A9CA 4BJ6C 1A0BA 1BR2A 3NMKA 2QUPA 3EGXB 2DGJA 1QLEC 1WATA 1LM3B 2J0WA 3ZQYA 1C17M 4JC7A 4NTAA 1W2WA 1SF8A 3W4YA 2I8BA 3LEVA 2VX2A 1CGOA 3AGUA 3AGTA 3G64A 3N24A 1MMDA 2B0HA 1MNDA 3R7CA 3M4CA 3AQBA 4EMLA 3NYMA 4F47A 3U0CA 2A6HF 3FVYA 1RKEB 2FFHA 1QZXA 2XLDA 1YYJA 1MQVA 3B0UX 3K33A 4M63A 3VYWA 1WASA 3ABKC 4MQ9F 3ABLC 1G4WR 3SLLA 4N6CA 4OG1A 2XS8A 4CJOA 1D1CA 1GM5A 4XLPF 4G0HA 5KYNA 3EPVA 4AL1A 1QKRA 2LFDA 4UDVA 1D1AA 2MHRA 1O87A 3EZIA 1HY5A 1D0ZA 1NLXA 4D4XA 2EIJC 4A4AA 5COMA 3QXIA 4XEKA 2NPUA 4DVYP 2RSEB 2YL7A 1SR2A 1Q51A 4MI2A 2HKVA 3MLGA 4Q5SF 3RW0A 1UX5A 3R9SA 4O7GA 3AM1A 1SYQA 3EQLF 1M2VA 3C63A 4CJGA 1OQCA 2CW0F 4AL0A 2NUTB 1BDJB 1LIHA 3LAYA 3EFOA 1OR2A 1A7VA 4BJTA 3M15A 3DZAA 1T5OA 1OCCC 3RH3A 2DYSC 5KYYA 1Q0FA 2R7OA 1VOMA 1BR4A 3L0IA 3VM6A 3WHNA 5AC4A 4Q4ZF 2I15A 2OEVA 1YAUO 3A4NA 1HMDA 3NYJA 1RJNA 2R25A 2FBMA 1FNTc 1HE9A 2ZQRA 4CS7A 1WWPA 4BJ5C 2J9UA 1LPEA 2HFIA 2WZLA 1RCPA 2YKZA 3GM2A 5JT4A 2P6VA 4QIIA 1KU2A 1L7CA 1M2VB 1NBBA 2LP4A 3QMKA 2L7AA 1ZHZA 1KNYA 1C03A 3ADBA 3C7JA 1LS4A 3EFOB 4P6IC 1JOGA 3KQFA 3MYIA 4LERA 3TRRA 4F4BA 4G7OF 2PP4A 5CI9A 3AG1C 5COGA 5EK0A 3TOMA 2R7TA 2NSFA 4EUKB 2M64A 3ATPA 5BQIA 1OR3A 1FMWA 4IARA 4QDLA 2OKUA 3S9OA 3QVYA 4U5GA 4MTGA 3IQ6A 2LSEA 4Z9HA 2XS1A 2VH3A 4PACA 4DBRA 3GEEA 3HNLA 2B0JA 1CPRA 2EIKC 2VCAA 3NMJA 2ZXWC 2D4UA 4E7ZA 2W4MA 4Z9IA 4XEVA 1RJ9A 1OCZC 3ASNC 2VCCA 4J32B 1H9GA 4I44A 2XLHA 3KH2A 3MFNA 4MVQA 2UUHA 3U5SA 2KYHA 1OW6A 3DD7A 3SXZA 5KYUB 4XWJA 3N2ZB 2CYDA 3VAYA 2KGOA 4FESA 4ZLCA 2GWWA 2J9VA 2LFFA 4JIOA 4DOZA 5A6BD 1A7EA 1EF8A 3ZTZA 3WODF 5F5HA 5JS5A 3CSKA 5IY5C 3K1HA 4NY3A 1WN0A 3GWLA 5HV9A 4YJWA 2IXOA 3O10A 2BE5F 2BL2A 1MMGA 2YHSA 5JRAA 1KTMA 4OD4A 1YARO 2Q7RA 5KYXB 2YVKA 1RJ9B 3FXHA 4QIJA 4MW3A 5K0IA 2OU6A 1EKYA 4LDKA 5DQZA 2YL3A 5GPGB 5KJPA 3CQZA 3A4MA 2MWQA 2YLDA 2LD6A 1MNEA 3IQ5A 3KL4A 4KC9A 4G78A 4CBEA 4NTBA 4PJNA 1FMVA 4BJ1A 2GDCA 4C3BA 3DJNB 1YDIA 2FW2A 1T9KA 3M79A 2WVNA 2XL8A 3GEHA 2J9WA 2CGEA 4G7ZF 4QI2A 1RXQA 1VLTA 2R7XA 3CEXA 1OCRC 1RKCA 4E17A 2VC9A 2CDQA 4E0HA 4L6RA 5L0IA 2WZFA 3UGPA 3B29A 3NRHA 1ZW2A 2VREA 5KYWA 3RYLA 4U5HA 3UNGC 1JR8A 1ORJA 3AG2C 5HSWA 3LNRA 3DJUB 1PD0A 2Q9AA 3UGOA 3H65A 1LI5A 4OD5A 3RIPA 2O9XA 4BEJA 2GAQA 4YL3A 4CIPA 3RVYA 3SXMA 2HV7A 2KQ9A 3EG9B 4BJ6A 3K66A 1ORYA 2QY9A 3ZDLA 2ZQQA 5CI8A 1TWHA 3S0XA 3EGXA 3S90A 3LNMB 4OIRF 2R9RB 4XPWA 5DLJA 1HZDA 2NSGA 3RF3A 4RDAA 3R9TA
chains in the Genus database with same CATH topology
1WWPA 4EBJA 3L8JA 3TULA 1RJMA 1UFBA 3GM2A 2JPUA 1K04A 3W8HB 2JX0A 3A4LA 2L6GA 2L6FA 3W8IB 2HSBA 1K05A 3O4XE 3IRBA 1KNYA 4R32A 4XEKA 1OW8A 3ADBA 3C8GB 3O10A 1ZZPA 3U3FA 3K7DA 1JOGA 3RQEA 1UX5A 3L8IA 3AM1A 3GM3A 1KTMA 3BRJA 4NQFA 2P63A 1K40A 3C8GD 4EBKA 3S9OA 2YWAA 3A4MA 2KK1A 1WOLA 3C8GA 5F28E 3GM1A 3RQFA 2L6HA 3AJMA 1UX4A 3U0CA 4NNQA 4GEHB 1V4AA 3ADDA 1OW7A 3JYYA 1QVXA 2Q00A 4XEVA 2PBEA 3JZ0A 3A4NA 3C18A 3MFNA 4XEFA 3B71A 3RQGA 1O3UA 1Y64B 1OW6A 1WTYA 2LK4A 1PV3A 3ADCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM3 A;  1KTM A;  3BRJ A;  4NQF A;  1WWP A;  2L6F A;  1K40 A;  4GEH B;  3W8I B;  1K05 A;  1V4A A;  2HSB A;  4EBJ A;  3C8G D;  1OW7 A;  3L8J A;  3JYY A;  1QVX A;  4EBK A;  1KNY A;  4R32 A;  3TUL A;  4XEK A;  1OW8 A;  2Q00 A;  1UFB A;  4XEV A;  3S9O A;  3C8G B;  2YWA A;  3GM2 A;  2KK1 A;  2JPU A;  1K04 A;  2PBE A;  3O10 A;  3W8H B;  1ZZP A;  1WOL A;  3K7D A;  3U3F A;  3JZ0 A;  3C8G A;  3C18 A;  2JX0 A;  3MFN A;  1JOG A;  3RQE A;  5F28 E;  3GM1 A;  4XEF A;  3B71 A;  3RQF A;  2L6H A;  3RQG A;  3AJM A;  1O3U A;  1WTY A;  1OW6 A;  2L6G A;  2LK4 A;  3L8I A;  1PV3 A;  3U0C A; 
#chains in the Genus database with same CATH topology
 2QE9 A;  3U9J A;  1GQA A;  5TJ5 E;  2LIG A;  4DJ9 A;  5KYW B;  2WB7 A;  4E0I A;  4O6N A;  2HJM A;  4IGG A;  3QXZ A;  4KNW A;  4MVR A;  3A4L A;  1M56 C;  5L0F A;  2GTR A;  2C04 A;  1U6H A;  1TFO B;  3W8I B;  2XM0 A;  2QNL A;  4R32 A;  4MTO A;  5L0J A;  1RKE A;  3QK8 A;  3B9Q A;  4WGZ A;  1YZC A;  1D0X A;  3W8H A;  4OIQ F;  2DB4 A;  4CIH A;  4JKV A;  2HSQ A;  4B6I A;  4DRI B;  3TJ6 A;  3JRM O;  3BEH A;  1NG1 A;  1I5N A;  4PJM A;  1EI7 A;  1FTS A;  1UG7 A;  2GFH A;  3U8V A;  2XXA A;  4ELS A;  4E18 A;  1DOV A;  1ZHT A;  1VYI A;  2XLE A;  1NFO A;  2VB6 A;  3JT1 A;  3DKA A;  4JZA A;  4XQ1 A;  3HTK C;  4DRJ B;  1QVX A;  4PFP A;  2A69 F;  2CCY A;  2R03 A;  4JTA B;  3JTL O;  3ZWI A;  4ZLD A;  3H81 A;  3DM9 B;  1HE1 A;  1YLM A;  5L3V A;  2ZPA A;  3MOY A;  5C9G A;  2AU5 A;  1UFB A;  3W8H B;  5T3T A;  2NUT A;  3EGD B;  1T6I A;  5JUA A;  2HMZ A;  2OOC A;  3WAQ A;  3PDM P;  3UMH A;  5E2Q A;  2DI3 A;  2XXA B;  5BUO A;  4JVS A;  1O5H A;  3FOP A;  3LLI A;  4K1O A;  3Q1T A;  3OEO A;  4IJJ A;  5COF A;  2Y3B A;  4MVZ A;  4CDV A;  2XRH A;  5AC5 A;  2AWY A;  4JW1 A;  1APC A;  1QQ3 A;  2LCH A;  1AUE A;  2QLA A;  2L81 A;  3IQT A;  2W9Y A;  3POV A;  2R7W A;  4BJ5 A;  3O55 A;  1NZE A;  5JBW A;  2D5R B;  2DUB A;  1WOL A;  2EIL C;  3CZ6 A;  3A11 A;  3W2W A;  4JCH A;  4I3M A;  3S84 A;  4W8K A;  4CS8 C;  1PD1 A;  1N1C A;  3QZC A;  3ADD A;  1CGM E;  4XPY A;  3ZC4 A;  1NSG B;  2R7R A;  2TMV P;  1YA7 O;  3RQG A;  5A69 A;  1Y64 B;  3P5M A;  1BBH A;  3NG1 A;  3VRC A;  1R5I D;  1VLS A;  2H7B A;  2H7V C;  4IWB A;  3L8J A;  3FMS A;  2PPY A;  2AVK A;  1TKN A;  3LS1 A;  2IXM A;  3CAX A;  3WG7 C;  4HE8 D;  4YT4 A;  1UIY A;  1Z3I X;  2OQM A;  1GGQ A;  3Q6N A;  2W4B A;  4N4W A;  4GYT A;  2A0B A;  3I4U A;  3T4R A;  3U3F A;  3ASO C;  3DE8 A;  3US6 A;  4W8P A;  1VK5 A;  1JPJ A;  3B0P A;  4JUR I;  3PHF 2;  5DS6 A;  3BRJ A;  3KMI A;  5KYU A;  2Q9C A;  3RFY A;  4U5F E;  3L1M A;  2G62 A;  4E7S A;  3H2U A;  5E3A A;  4NEK A;  3AJM A;  3TK0 A;  2EPO A;  3ITF A;  1V4A A;  1JMW A;  3GOR A;  3FAP B;  4EBB A;  2Q00 A;  3FDU A;  2HW5 A;  2WVO A;  1E85 A;  2PX0 A;  3O39 A;  3UMK A;  4FX5 A;  4NTF A;  3T89 A;  3VF0 A;  3KKB A;  5L0G A;  1T6U A;  2Q3T A;  4CSA C;  2ASR A;  4U5D E;  3KYI A;  2P0N A;  2ZXR A;  3TUL A;  4ER9 A;  3FOO A;  5KYX A;  3PMR A;  2OEX A;  3O6X A;  3OC7 A;  3T6G B;  4FZW C;  1DCI A;  4D4N A;  2CNW A;  3K1I C;  2AP3 A;  3HJC A;  4Q7C A;  3DE9 A;  1F1M A;  4P9T A;  1Z23 A;  3GWN A;  1S7Z A;  3NMI A;  1WZ8 A;  4U5B E;  4CX9 A;  2L9J A;  1H6G A;  3QW1 A;  4P9F A;  3I47 A;  3GM3 A;  1XZQ A;  5E33 A;  1CGN A;  2MYS A;  3LUT B;  4U19 A;  3FHD A;  3DMD A;  3MYB A;  5A6J A;  4I52 A;  3HIN A;  4U9D A;  2YLG A;  1HW1 A;  3DAF A;  1C02 A;  4I42 A;  2NUP A;  4H54 A;  2J0X A;  3TD7 A;  4PFO A;  4JYL A;  3IEE A;  4PJJ A;  1JAF A;  3JSE O;  2H8A A;  1WTY A;  2LK4 A;  3R0O A;  3ADC A;  4AK9 A;  3QW0 A;  3E70 C;  3EHM A;  4X0R A;  3HNK A;  4FWV A;  2PF4 E;  2LQG A;  5DVW A;  1J8Y F;  5JSL A;  2J8W A;  3U3B A;  3SXY A;  3DXJ F;  4CS9 A;  2A1D D;  2UUI A;  2JX0 A;  3KPH A;  1M57 C;  4YK5 A;  3ECS A;  2J45 A;  3EZH A;  2L6G A;  2EPL X;  4ANJ A;  3B0V C;  2A6E F;  4LDR A;  1D1B A;  3S29 A;  3EG9 A;  256B A;  5B3I A;  5L3Q A;  2HSB A;  1FR0 A;  2RD9 A;  1Q0M A;  2DYR C;  2EPN A;  2FAP B;  1HMO A;  2YZS A;  4K2N A;  1DUB A;  2VCB A;  1T01 A;  1NU9 C;  2ETS A;  4MTF A;  3RVZ A;  2NUP B;  1H9T A;  3R2P A;  1SMY F;  5D92 A;  4KBL A;  3LJB A;  3JSZ A;  1EY3 A;  3X1O A;  2XM4 A;  4U1A A;  2KK1 A;  3G4X A;  3GM1 A;  1E84 A;  1U89 A;  4WJ0 A;  3HRX A;  5L0C A;  4O6M A;  3J06 A;  1Q0G A;  2OJE D;  3V5Z A;  5A6A A;  1ZHW A;  4MVS A;  3U2M A;  4DVZ A;  3MBG A;  2JD3 A;  2OCC C;  3W8I A;  4FJW D;  4CS9 C;  3V5X A;  4CDA A;  1WGW A;  3JZ0 A;  4JCZ A;  2IXP A;  2Q4F A;  1DOW A;  4BPM A;  3B71 A;  1OCO C;  1JXZ A;  3K6B A;  2G3K A;  5B3S C;  4JOT A;  3NDB B;  4YN0 B;  4JE9 A;  2IM8 A;  3ZVR A;  4K0D A;  4IAO A;  4GEH A;  1EA8 A;  4ULV A;  2P61 A;  4AE4 A;  2JPU A;  3G4Z A;  1IZM A;  3EH1 A;  4OIP F;  4IZB A;  1Z63 A;  2A0U A;  2IBF A;  2KW3 C;  2HS5 A;  4DXW A;  2L6F A;  3T6J A;  3QTH A;  4EWC A;  4JWV A;  3U8P A;  4AX2 A;  2J7P A;  2P1A A;  3F47 A;  3RQE A;  3UMI A;  1VTM P;  4J7Y A;  4A2N B;  1G4U S;  1YA9 A;  2XLM A;  2HJ3 A;  3UR3 C;  4EBK A;  3HNI A;  2FGY A;  1VYK A;  5EGY A;  1Z6A A;  4RBN A;  2V3C C;  2J46 A;  3SZR A;  2YRF A;  1MJ3 A;  4I1M A;  3C8G A;  2WVQ A;  4OIN F;  1H7I A;  1J8M F;  2YL1 A;  4O79 A;  1LE4 A;  4IRU A;  3EGD A;  3I5Q A;  4GEH B;  4YT2 A;  1OW7 A;  3JYY A;  1OXB A;  4AE4 B;  4OLQ A;  4J7T A;  1M2O A;  4DBQ A;  1SZI A;  3I5P A;  2HZ8 A;  2R02 A;  1PV3 A;  4XLN F;  2PFD A;  4C3D A;  5A6K A;  1ZVZ A;  2ZXP A;  4WAB A;  1Q0K A;  1QSP A;  3V7O A;  1VB5 A;  1ZU5 A;  2IOQ A;  4I4Z A;  4EIY A;  5BQG A;  1Q0D A;  4ZU2 A;  4C7O A;  1E83 A;  2XSE A;  1K05 A;  4CS8 A;  2ZD9 A;  3IRB A;  1E2X A;  1IW7 F;  4EKW A;  2Y69 C;  3DI5 A;  1ZW3 A;  3C8G B;  1ZZP A;  3K7D A;  2XLO A;  3SXK A;  1YVI A;  1NU7 D;  1YJG A;  2A68 F;  2E87 A;  2IXN A;  3N0T A;  1XZP A;  1U0B B;  3U2L A;  1BR1 A;  5D91 A;  1QPU A;  2X0C A;  1V55 C;  3IHU A;  2BC5 A;  2Z15 A;  2Q9B A;  3RQF A;  4MS2 A;  3NKD A;  3H02 A;  4LDQ A;  4GQH A;  2Y3G A;  1ZYR F;  5JVE A;  5CIV A;  1L3P A;  2X51 A;  3NYL A;  3Q0G A;  4YL0 A;  4IZC A;  2KNH A;  4C7O B;  3LES A;  2PBP A;  3AQC A;  3JYH A;  4HEA J;  2EIN C;  1FAP B;  4XPX A;  1RJM A;  4IZD A;  2WZG A;  1TQG A;  3ZTM A;  2J9B A;  1G8X A;  4XTK A;  3TJ5 A;  3HNJ A;  1NFN A;  4JCS A;  1A7D A;  5AGF A;  3AOU A;  3KYJ A;  1TFK B;  5T1D B;  3EJN A;  3T9O A;  4Z9J A;  1LVK A;  1ZU4 A;  3ABM C;  1OXK A;  4LAC B;  4JJF A;  5EHH A;  4JEA A;  3LLK A;  1A41 A;  3AG3 C;  1FFT C;  4CSA A;  2XL6 A;  2IYL D;  3Q7L A;  4HFF B;  5L0H A;  5L0D A;  4NC3 A;  1RMV A;  2HV6 A;  2GA0 A;  4U9E A;  2ICW G;  3SYN A;  3OWT A;  2L6H A;  2R05 A;  2XLV A;  4JJG A;  5DS4 A;  1PCX A;  4FZW A;  4CDY A;  5JBX A;  1NZY A;  4G7H F;  2H7O A;  3K1I A;  4U5E E;  1M6T A;  2QQ3 A;  5DS5 A;  2PNO A;  4RD9 A;  4XEF A;  2OG2 A;  3DAG A;  2R7V A;  1O3U A;  1Y6D A;  4N6H A;  4WGY A;  3S27 A;  3G50 A;  3T6B A;  5B1B C;  1Z7Q c;  2XLW A;  4NCQ A;  3TQO A;  1T6Q A;  1LS1 A;  2CNW D;  1D0Y A;  1EF9 A;  3SNH A;  1VMA A;  1JPN A;  4PR9 A;  5KYY B;  2F22 A;  3Q6M A;  3C8Z A;  1EQ1 A;  5F5F A;  4LLC A;  4MW8 A;  2YLI A;  3M1C B;  2XL4 A;  4MVO A;  3SEO A;  2Y3H A;  4IAQ A;  1FFH A;  4U5C E;  4JFC A;  5FCL A;  2KJG A;  3PCV A;  3M4B A;  2HUJ A;  3L8I A;  3GEI A;  3X2Q C;  4NQF A;  2P63 A;  1NZY B;  1K40 A;  3W2V A;  2F6Q A;  3U9M A;  3HLZ A;  1R4T A;  2VAS A;  2W45 A;  4QI0 A;  3RKO F;  4YL1 A;  3ZG1 A;  1TWG A;  1GS9 A;  1B68 A;  3JCU Q;  2EIM C;  1V74 B;  1LKX A;  4YT8 A;  4C3E A;  3OA1 A;  4YWQ A;  4MOU A;  3AG4 C;  3EH2 A;  4U18 A;  4MND A;  1MMN A;  3GAN A;  2EPM X;  2EJ5 A;  1LE2 A;  3LEO A;  2YL0 A;  2P7V A;  3V5Y A;  1K04 A;  1ORS C;  1Y4C A;  1TWC A;  4PK4 A;  2C03 A;  4WCZ A;  2UZF A;  5A6B A;  3ZIB A;  2V26 A;  1OKK D;  3FDQ A;  1OW8 A;  4H4K C;  5B1A C;  4ELW A;  1AEP A;  3FAJ A;  1TR2 A;  4DRH B;  3ZSU A;  2M4E A;  4ELX A;  2OJQ A;  3MYF A;  3JRT A;  5FZT A;  4N06 A;  5JLI A;  1TWA A;  3LS0 A;  5T3W A;  2R7Q A;  2WL8 A;  1ZHX A;  3Q0J A;  3GOD A;  1HW2 A;  5F28 E;  1OKK A;  4FAP B;  3HKK A;  4LLE A;  4PJL A;  3ZQV A;  2YEV A;  3T8A A;  4NNQ A;  1G5Z A;  3MX3 A;  3SWX A;  4KNV A;  3SP1 A;  4JEB A;  4K3W A;  1I4Z A;  3C18 A;  1LI7 A;  4I1O B;  2IEX A;  3H2V A;  3F46 A;  1ST6 A;  1XWJ A;  4BEM J;  4ONS A;  2KC3 A;  2R7U A;  2PX3 A;  3NKE A;  3Q7G A;  3DWW A;  5JP7 A;  2AWC A;  4J30 B;  2HMQ A;  1V54 C;  2G3V A;  2J7P D;  3T88 A;  3O4X E;  3EHN A;  2YQY A;  3L34 A;  2R7S A;  1E86 A;  3QVZ A;  5E3C A;  3RSI A;  4OIO F;  1YYX A;  1CPQ A;  1Q52 A;  5DQT A;  4JTD B;  4YT5 A;  1MMA A;  3C8G D;  4JTC B;  2NG1 A;  1I4Y A;  4K7B A;  1ZHY A;  2YWA A;  4JRZ A;  3IPM O;  1AVO B;  4BG0 A;  1Z5Z A;  4MVM A;  4ULW A;  3TOL A;  3S28 A;  4HFK B;  1UX4 A;  1JRA A;  4MVU A;  4EHP A;  4KI2 A;  3PZK A;  3TLF A;  3E9V A;  2Y39 A;  1YZA A;  2PBE A;  3IQC A;  2ZXO A;  5BQH A;  4O6Y A;  1BZ4 A;  2EPK X;  4KNP A;  3C62 A;  2Y3D A;  4IB4 A;  2KSF A;  1S05 A;  4EBJ A;  3DM5 A;  2QTV A;  3A9C A;  4BJ6 C;  1A0B A;  1BR2 A;  3NMK A;  2QUP A;  3EGX B;  2DGJ A;  1QLE C;  1WAT A;  1LM3 B;  2J0W A;  3ZQY A;  1C17 M;  4JC7 A;  4NTA A;  1W2W A;  1SF8 A;  3W4Y A;  2I8B A;  3LEV A;  2VX2 A;  1CGO A;  3AGU A;  3AGT A;  3G64 A;  3N24 A;  1MMD A;  2B0H A;  1MND A;  3R7C A;  3M4C A;  3AQB A;  4EML A;  3NYM A;  4F47 A;  3U0C A;  2A6H F;  3FVY A;  1RKE B;  2FFH A;  1QZX A;  2XLD A;  1YYJ A;  1MQV A;  3B0U X;  3K33 A;  4M63 A;  3VYW A;  1WAS A;  3ABK C;  4MQ9 F;  3ABL C;  1G4W R;  3SLL A;  4N6C A;  4OG1 A;  2XS8 A;  4CJO A;  1D1C A;  1GM5 A;  4XLP F;  4G0H A;  5KYN A;  3EPV A;  4AL1 A;  1QKR A;  2LFD A;  4UDV A;  1D1A A;  2MHR A;  1O87 A;  3EZI A;  1HY5 A;  1D0Z A;  1NLX A;  4D4X A;  2EIJ C;  4A4A A;  5COM A;  3QXI A;  4XEK A;  2NPU A;  4DVY P;  2RSE B;  2YL7 A;  1SR2 A;  1Q51 A;  4MI2 A;  2HKV A;  3MLG A;  4Q5S F;  3RW0 A;  1UX5 A;  3R9S A;  4O7G A;  3AM1 A;  1SYQ A;  3EQL F;  1M2V A;  3C63 A;  4CJG A;  1OQC A;  2CW0 F;  4AL0 A;  2NUT B;  1BDJ B;  1LIH A;  3LAY A;  3EFO A;  1OR2 A;  1A7V A;  4BJT A;  3M15 A;  3DZA A;  1T5O A;  1OCC C;  3RH3 A;  2DYS C;  5KYY A;  1Q0F A;  2R7O A;  1VOM A;  1BR4 A;  3L0I A;  3VM6 A;  3WHN A;  5AC4 A;  4Q4Z F;  2I15 A;  2OEV A;  1YAU O;  3A4N A;  1HMD A;  3NYJ A;  1RJN A;  2R25 A;  2FBM A;  1FNT c;  1HE9 A;  2ZQR A;  4CS7 A;  1WWP A;  4BJ5 C;  2J9U A;  1LPE A;  2HFI A;  2WZL A;  1RCP A;  2YKZ A;  3GM2 A;  5JT4 A;  2P6V A;  4QII A;  1KU2 A;  1L7C A;  1M2V B;  1NBB A;  2LP4 A;  3QMK A;  2L7A A;  1ZHZ A;  1KNY A;  1C03 A;  3ADB A;  3C7J A;  1LS4 A;  3EFO B;  4P6I C;  1JOG A;  3KQF A;  3MYI A;  4LER A;  3TRR A;  4F4B A;  4G7O F;  2PP4 A;  5CI9 A;  3AG1 C;  5COG A;  5EK0 A;  3TOM A;  2R7T A;  2NSF A;  4EUK B;  2M64 A;  3ATP A;  5BQI A;  1OR3 A;  1FMW A;  4IAR A;  4QDL A;  2OKU A;  3S9O A;  3QVY A;  4U5G A;  4MTG A;  3IQ6 A;  2LSE A;  4Z9H A;  2XS1 A;  2VH3 A;  4PAC A;  4DBR A;  3GEE A;  3HNL A;  2B0J A;  1CPR A;  2EIK C;  2VCA A;  3NMJ A;  2ZXW C;  2D4U A;  4E7Z A;  2W4M A;  4Z9I A;  4XEV A;  1RJ9 A;  1OCZ C;  3ASN C;  2VCC A;  4J32 B;  1H9G A;  4I44 A;  2XLH A;  3KH2 A;  3MFN A;  4MVQ A;  2UUH A;  3U5S A;  2KYH A;  1OW6 A;  3DD7 A;  3SXZ A;  5KYU B;  4XWJ A;  3N2Z B;  2CYD A;  3VAY A;  2KGO A;  4FES A;  4ZLC A;  2GWW A;  2J9V A;  2LFF A;  4JIO A;  4DOZ A;  5A6B D;  1A7E A;  1EF8 A;  3ZTZ A;  3WOD F;  5F5H A;  5JS5 A;  3CSK A;  5IY5 C;  3K1H A;  4NY3 A;  1WN0 A;  3GWL A;  5HV9 A;  4YJW A;  2IXO A;  3O10 A;  2BE5 F;  2BL2 A;  1MMG A;  2YHS A;  5JRA A;  1KTM A;  4OD4 A;  1YAR O;  2Q7R A;  5KYX B;  2YVK A;  1RJ9 B;  3FXH A;  4QIJ A;  4MW3 A;  5K0I A;  2OU6 A;  1EKY A;  4LDK A;  5DQZ A;  2YL3 A;  5GPG B;  5KJP A;  3CQZ A;  3A4M A;  2MWQ A;  2YLD A;  2LD6 A;  1MNE A;  3IQ5 A;  3KL4 A;  4KC9 A;  4G78 A;  4CBE A;  4NTB A;  4PJN A;  1FMV A;  4BJ1 A;  2GDC A;  4C3B A;  3DJN B;  1YDI A;  2FW2 A;  1T9K A;  3M79 A;  2WVN A;  2XL8 A;  3GEH A;  2J9W A;  2CGE A;  4G7Z F;  4QI2 A;  1RXQ A;  1VLT A;  2R7X A;  3CEX A;  1OCR C;  1RKC A;  4E17 A;  2VC9 A;  2CDQ A;  4E0H A;  4L6R A;  5L0I A;  2WZF A;  3UGP A;  3B29 A;  3NRH A;  1ZW2 A;  2VRE A;  5KYW A;  3RYL A;  4U5H A;  3UNG C;  1JR8 A;  1ORJ A;  3AG2 C;  5HSW A;  3LNR A;  3DJU B;  1PD0 A;  2Q9A A;  3UGO A;  3H65 A;  1LI5 A;  4OD5 A;  3RIP A;  2O9X A;  4BEJ A;  2GAQ A;  4YL3 A;  4CIP A;  3RVY A;  3SXM A;  2HV7 A;  2KQ9 A;  3EG9 B;  4BJ6 A;  3K66 A;  1ORY A;  2QY9 A;  3ZDL A;  2ZQQ A;  5CI8 A;  1TWH A;  3S0X A;  3EGX A;  3S90 A;  3LNM B;  4OIR F;  2R9R B;  4XPW A;  5DLJ A;  1HZD A;  2NSG A;  3RF3 A;  4RDA A;  3R9T A; 
#chains in the Genus database with same CATH homology
 1WWP A;  4EBJ A;  3L8J A;  3TUL A;  1RJM A;  1UFB A;  3GM2 A;  2JPU A;  1K04 A;  3W8H B;  2JX0 A;  3A4L A;  2L6G A;  2L6F A;  3W8I B;  2HSB A;  1K05 A;  3O4X E;  3IRB A;  1KNY A;  4R32 A;  4XEK A;  1OW8 A;  3ADB A;  3C8G B;  3O10 A;  1ZZP A;  3U3F A;  3K7D A;  1JOG A;  3RQE A;  1UX5 A;  3L8I A;  3AM1 A;  3GM3 A;  1KTM A;  3BRJ A;  4NQF A;  2P63 A;  1K40 A;  3C8G D;  4EBK A;  3S9O A;  2YWA A;  3A4M A;  2KK1 A;  1WOL A;  3C8G A;  5F28 E;  3GM1 A;  3RQF A;  2L6H A;  3AJM A;  1UX4 A;  3U0C A;  4NNQ A;  4GEH B;  1V4A A;  3ADD A;  1OW7 A;  3JYY A;  1QVX A;  2Q00 A;  4XEV A;  2PBE A;  3JZ0 A;  3A4N A;  3C18 A;  3MFN A;  4XEF A;  3B71 A;  3RQG A;  1O3U A;  1Y64 B;  1OW6 A;  1WTY A;  2LK4 A;  1PV3 A;  3ADC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...