3L8JA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
b'XXXTTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 10
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8jA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8jA02
3W8HB 4XEFA 4EBJA 2JX0A 2PBEA 1QVXA 3C18A 2JPUA 2YWAA 3BRJA 4XEKA 2HSBA 1KTMA 4GEHB 3L8IA 1WWPA 3RQEA 1K04A 2L6HA 3GM3A 3K7DA 3AJMA 3RQFA 3U0CA 2Q00A 1ZZPA 1WTYA 2KK1A 1K40A 3RQGA 1UFBA 2LK4A 1OW6A 1JOGA 3TULA 3O10A 1WOLA 3W8IB 3GM1A 3L8JA 1KNYA 1V4AA 1OW8A 1OW7A 3JYYA 4R32A 4EBKA 4XEVA 3MFNA 3GM2A 1O3UA 2L6FA 3C8GD 4NQFA 3S9OA 3B71A 3U3FA 2L6GA 5F28E 1PV3A 1K05A 3C8GA 3C8GB 3JZ0A
chains in the Genus database with same CATH superfamily
1HMDA 4XLNF 2R05A 1XZQA 3RF3A 4WGZA 4J30B 5KYXB 4P9FA 3SXZA 2H8AA 3JYHA 2YLDA 1G4WR 4CS7A 4E17A 3ZDLA 2FAPB 2HZ8A 2RD9A 4YK5A 4MTFA 3M79A 1OW7A 3U2MA 5F5FA 5D92A 2NUTA 1TWGA 5B3SC 3ADDA 3RQEA 2IEXA 3QVZA 4LLEA 1JXZA 5L0JA 1MMGA 2MWQA 3EHMA 1PD0A 3G4ZA 3FDQA 1H7IA 5TJ5E 3HINA 5L0FA 1WWPA 2W45A 4PFOA 1OKKA 2F6QA 2KW3C 4JCHA 2KGOA 4G7ZF 2EPMX 3ECSA 2TMVP 4IZDA 3B71A 4MVUA 3FXHA 4CS9A 1HW2A 3DZAA 4O6NA 1JPJA 4XWJA 2EPLX 1OR2A 1OKKD 3DJNB 3CZ6A 2Y69C 1ZZPA 1D0YA 2P7VA 1KNYA 1LVKA 1ZHYA 1Z3IX 1VOMA 3CQZA 5JSLA 3LLKA 3QZCA 4U19A 4DXWA 4BG0A 2ZQRA 4JURI 2PX0A 4MVMA 2Q00A 3DAGA 1K40A 2VH3A 4FZWA 5B3IA 1V55C 1C03A 1TFOB 3K6BA 2R7UA 2EPNA 5CI9A 3B0PA 4NQFA 3DE8A 2Y3GA 2OKUA 3Q6NA 4K1OA 1K04A 1ZHTA 3HNJA 3SXKA 4E0HA 3EGXA 3OA1A 2Y3BA 3LEVA 4I44A 3CAXA 4PJLA 2XLEA 1ZHXA 5L3VA 1QVXA 1QPUA 3BRJA 3DM5A 1QQ3A 5BUOA 3F46A 5CI8A 1OCRC 3GM1A 5AC5A 4FJWD 3VM6A 3LS1A 5FCLA 3NYLA 4EBBA 5KYUB 3UMKA 1C17M 3AQBA 2HSBA 3DKAA 2XRHA 4PR9A 3NDBB 2JD3A 3DXJF 3ASOC 2P1AA 4KNWA 1FTSA 4CJGA 3EQLF 3TQOA 3W8HB 1U6HA 4QIIA 1CPQA 5JUAA 3N2ZB 2HV6A 3H65A 3L8IA 4J32B 2A68F 1YARO 2R7RA 3SXYA 3FAJA 3S29A 4WCZA 2LD6A 2OG2A 4I4ZA 1TWAA 1EKYA 3HLZA 1J8MF 1MJ3A 1ZVZA 1FAPB 1FMWA 2PF4E 2YVKA 1YYJA 3UMHA 5KYWB 3AGTA 3NMJA 4DRHB 4DVZA 2XLVA 4IB4A 1NZEA 3EGXB 2HSQA 2AWYA 1WGWA 2VCBA 2HFIA 4MS2A 1AVOB 2XM4A 1Z63A 3HKKA 2HMQA 1WATA 1VLTA 3SP1A 5HV9A 4JYLA 2A1DD 3M4CA 2Q9BA 4OLQA 3RYLA 4ELWA 2RSEB 3RVZA 3ADBA 1QSPA 5EK0A 3QTHA 3UNGC 3PMRA 2PP4A 5KYYB 3W4YA 3P5MA 4CS8C 3R0OA 1Q0KA 2A69F 4OG1A 5HSWA 4A4AA 3ZWIA 4JFCA 1M6TA 2B0JA 1OCOC 2GAQA 3PZKA 5JVEA 4U1AA 4QI0A 2HMZA 2W4MA 2IXMA 1W2WA 4XPWA 3NG1A 2H7BA 1RJNA 4ULVA 3KMIA 5JT4A 2DI3A 2MHRA 1OR3A 1VK5A 1HZDA 1RKEB 1UX5A 2GTRA 4ZLCA 3JRTA 3L8JA 2PBPA 3DE9A 5EGYA 2V26A 4FAPB 5JRAA 2BL2A 2L81A 2OJED 1Q51A 3EFOA 2F22A 4PJNA 1Y4CA 3JRMO 4JTCB 2DYSC 4PACA 3HNKA 1C02A 3EZIA 1XWJA 3US6A 3HTKC 3NKEA 1AUEA 4U5GA 1VYIA 3C63A 3EG9B 2LFDA 5KYNA 1UG7A 2PBEA 4C3BA 1YDIA 1I4ZA 4I1MA 1DUBA 4WGYA 5FZTA 2R7WA 1Z23A 1A7DA 2X51A 2XLOA 3C8GB 3I5PA 1IZMA 3KQFA 2Q9CA 1UX4A 4O6MA 2XLDA 3KPHA 4MI2A 1Q0FA 4C7OB 2WVNA 3KL4A 4CDAA 3K1HA 3M15A 5B1AC 1A41A 4PFPA 4B6IA 3DI5A 3O10A 2IBFA 4JCZA 3Q0GA 3F47A 3Q1TA 4MOUA 1R5ID 3AG3C 1ORYA 2Y3HA 2J9VA 2CW0F 3DD7A 1FFTC 3TLFA 3S27A 1WN0A 4AE4B 2NG1A 3TJ6A 4LLCA 3ZTZA 3B9QA 2ETSA 4JE9A 1U89A 2ZD9A 2IYLD 5KJPA 1FFHA 2ICWG 4FX5A 2QQ3A 3HRXA 2LFFA 3UGOA 4Q7CA 4MW8A 4K2NA 3A9CA 3ASNC 2FBMA 1NZYB 3RQGA 1UFBA 3X1OA 3AQCA 1MNDA 1E84A 3LS0A 4XPYA 3J06A 3S9OA 2YLGA 3ADCA 1GQAA 1MMNA 3WHNA 3JSZA 3MBGA 1JRAA 2L9JA 2PX3A 5L0HA 1RCPA 3JT1A 2ZQQA 2R03A 5COFA 2OU6A 1RMVA 1XZPA 3EJNA 4JIOA 5B1BC 1NSGB 3KYJA 4GEHA 3IPMO 3OWTA 4G7HF 1CGME 5JBXA 3AOUA 2NUPB 4BEMJ 1Q0GA 3GEIA 1RXQA 3GWLA 3N24A 1EQ1A 3SYNA 5DS6A 2NSFA 4MQ9F 4CIHA 2VB6A 4ONSA 3C18A 5DS5A 4YT8A 2ZPAA 4CS8A 2QY9A 1B68A 4F4BA 1EA8A 1FNTc 3W8IB 1LI7A 4IARA 3SNHA 3PCVA 3O4XE 3Q6MA 3WG7C 1ORJA 3QW0A 1BR4A 2XS1A 4UDVA 3H2UA 3GEEA 1Q0MA 1H6GA 3I4UA 1TKNA 4IGGA 4H4KC 4LACB 2HJ3A 3AG2C 1E85A 5A6BA 3T4RA 5COGA 2FGYA 2YHSA 2A0UA 4RDAA 2ZXRA 3ABKC 1GGQA 1HW1A 3Q7GA 5DVWA 2IXPA 1LS1A 3R9TA 1D1AA 5A6BD 1FR0A 1YJGA 3A4MA 2MYSA 3JYYA 4JEBA 3MFNA 2OCCC 4DOZA 3EH2A 5JP7A 3T8AA 4GEHB 2VCAA 4NNQA 3EZHA 1MMAA 4BJTA 3EH1A 2EILC 4A2NB 1V74B 4DBQA 2NUTB 3SZRA 2X0CA 1BZ4A 3K1IC 2XS8A 1G5ZA 4QDLA 4CX9A 4YWQA 3U0CA 2IXOA 3A4LA 1I5NA 4AK9A 1S05A 1LS4A 3MYFA 4BJ5C 4NY3A 4G78A 3PDMP 3C8ZA 4C3EA 1K05A 3RW0A 2WVQA 3B29A 2P6VA 5E33A 2JPUA 2QUPA 3AM1A 2Q7RA 2QTVA 2KYHA 3FAPB 1Y64B 4BJ6C 3C7JA 1DOVA 2G3VA 3T6BA 1V4AA 4MVQA 3CSKA 1EY3A 1G8XA 1ZW2A 1YLMA 4XEFA 4DRIB 1TWCA 3RQFA 1SR2A 3I5QA 1YVIA 2LSEA 3ABLC 3S90A 1EF8A 4NEKA 1N1CA 3JZ0A 1MQVA 2J9BA 4E0IA 3K66A 3T6JA 4U5DE 4OIRF 4HFKB 4JKVA 4U5CE 3GM2A 4RD9A 4J7YA 2YEVA 4OD5A 2R7SA 2VCCA 3W2WA 1HY5A 3A11A 1E2XA 3H81A 3UGPA 3VAYA 1JOGA 4BEJA 1OQCA 3V5YA 4EKWA 3AG4C 3T6GB 2L6GA 3S0XA 4E7ZA 2R7XA 2LCHA 2QNLA 1IW7F 1KTMA 1CGNA 1WOLA 1Z5ZA 4IRUA 2R9RB 5T3TA 4N06A 3FVYA 5JS5A 1PV3A 1RJ9A 1GS9A 1H9GA 1A7EA 2UZFA 1DOWA 2LQGA 4XTKA 2EIMC 4NC3A 1ZW3A 5L0DA 1DCIA 3TOMA 1TR2A 4Z9IA 3JSEO 2KNHA 3O39A 3ZG1A 3SXMA 1R4TA 2D4UA 2WZGA 3IQTA 4JOTA 2IM8A 2LIGA 3W2VA 4GYTA 1T5OA 3WODF 1T6UA 3ZTMA 1OCCC 3B0UX 3EHNA 3N0TA 2P63A 2WVOA 3NMKA 4LDQA 4EBKA 2EPOA 5EHHA 2JX0A 4N6HA 4KI2A 3T88A 2A6HF 5D91A 3K7DA 1CGOA 3M4BA 4Z9JA 5T3WA 4JJGA 3SLLA 4MVRA 1M2VA 5E3AA 4MTOA 4CBEA 1NFNA 2YZSA 3IHUA 4AL0A 3K33A 5F28E 2GWWA 5L0CA 2XXAA 2VX2A 2AWCA 3NYMA 3R2PA 5L0GA 4N4WA 4NTAA 1D1BA 1OW6A 3LJBA 3TOLA 2L7AA 1ZYRF 5A6AA 4ZU2A 1O3UA 2W9YA 3U3FA 3I47A 4U5FE 3RKOF 2A0BA 3NKDA 1HE9A 3NYJA 3LESA 3U8VA 4FESA 2YRFA 2FFHA 3V7OA 3GANA 3GEHA 3RIPA 3K1IA 3JTLO 4YL1A 4PJJA 1YYXA 1E83A 4BJ5A 5K0IA 4YT2A 4KC9A 4W8KA 4ER9A 1LKXA 1JR8A 4IZCA 4AX2A 1APCA 4BJ6A 5T1DB 2QLAA 1S7ZA 3O6XA 1RKCA 4EHPA 2WB7A 2G62A 4EMLA 3R9SA 3EGDA 1VTMP 3EFOB 2KJGA 4MNDA 4EBJA 1EI7A 4Z9HA 3KKBA 4WABA 2EINC 4KNPA 5KYXA 4P6IC 1NLXA 2QE9A 2B0HA 2NPUA 3IRBA 5A69A 1SF8A 2HS5A 4IWBA 3U8PA 4MTGA 3U2LA 3ZSUA 3U9JA 3C62A 3QK8A 4DBRA 2C03A 3MYBA 2XL4A 3V5ZA 4GQHA 4YL0A 4CDYA 5E2QA 3CEXA 3R7CA 3LLIA 2WL8A 1TWHA 3TJ5A 1V54C 3QMKA 4XQ1A 2YQYA 4U5EE 3LUTB 1NG1A 256BA 2PFDA 4U5BE 4JW1A 4J7TA 2J46A 3MX3A 4P9TA 2EIKC 4K0DA 4JTAB 5BQHA 4PJMA 1VB5A 4OIPF 4CIPA 1WTYA 1F1MA 2KC3A 5F5HA 3RVYA 1AEPA 2ZXPA 2OEXA 2OEVA 2YLIA 2PPYA 4XPXA 4YT4A 3ZQVA 2XL8A 5DLJA 1D0ZA 1ZHWA 3Q7LA 3TD7A 2Q4FA 4DRJB 1WZ8A 2J7PA 1QZXA 2EIJC 2OJQA 1Z6AA 4JC7A 4G0HA 1PCXA 3DJUB 4O6YA 2HUJA 2IOQA 2J7PD 2OOCA 4MW3A 2DGJA 4BJ1A 5L0IA 4Q4ZF 2XLHA 3LNMB 2R7TA 2Z15A 1MMDA 1LM3B 4K7BA 1M57C 2R7OA 2ZXWC 3TULA 2AVKA 4I42A 4Q5SF 3MOYA 2P61A 4EUKB 2BE5F 3E9VA 2E87A 5KYUA 2I8BA 1A0BA 4JVSA 4HEAJ 3RSIA 2J9UA 3ZVRA 1A7VA 1D0XA 4HE8D 2Y3DA 5IY5C 2Y39A 1JPNA 4KNVA 4HFFB 2L6FA 4YN0B 1QKRA 3LNRA 3W8HA 2BC5A 3RFYA 1LPEA 1G4US 4IAOA 3AJMA 3LAYA 2R25A 1JAFA 4ELXA 3EPVA 4ANJA 5COMA 2NSGA 3NMIA 3POVA 4DJ9A 4X0RA 3L34A 3LEOA 3FOPA 1YA7O 4K3WA 3S84A 2J45A 5KYWA 2IXNA 3E70C 3VYWA 1HMOA 4NCQA 3UMIA 5JLIA 2DUBA 2XM0A 4BPMA 1CPRA 1M56C 1ZHZA 4D4NA 2ASRA 4U9EA 1E86A 1LE2A 4LDKA 3GWNA 4PK4A 3FMSA 3MLGA 2KK1A 3HNLA 3UR3C 3S28A 5DQZA 5BQIA 2HKVA 3DWWA 4EWCA 4MVSA 4D4XA 1SZIA 2R7QA 4JJFA 5KYYA 4DVYP 3RH3A 3O55A 3FHDA 1PD1A 4E18A 2EJ5A 3FOOA 3GORA 5DS4A 1NU7D 1RJMA 4LDRA 2EPKX 2VC9A 1SMYF 2KSFA 3ITFA 3QXIA 3U3BA 2AU5A 3GM3A 1GM5A 1QLEC 2P0NA 3ZC4A 3G50A 2VASA 1I4YA 2DB4A 4OINF 2FW2A 3IQ6A 4CJOA 4LERA 1NBBA 3IQCA 1RKEA 4KBLA 3G4XA 2M4EA 1T9KA 1YZCA 3GODA 5C9GA 2W4BA 3DMDA 2CYDA 2GA0A 3ZIBA 1Y6DA 2J9WA 2Q3TA 2L6HA 3VRCA 1EF9A 4O79A 3ATPA 1BR1A 3U5SA 4CSAA 2WZFA 3EG9A 4ULWA 5DQTA 4C3DA 1T6IA 3V5XA 4OD4A 1Z7Qc 1M2OA 5A6JA 3IQ5A 4U18A 3WAQA 1D1CA 2YL3A 1BBHA 1BR2A 3OC7A 4JZAA 4JTDB 3QVYA 1LE4A 4WJ0A 1BDJB 3C8GA 3QW1A 1OCZC 1WASA 2A6EF 1JMWA 2Q9AA 4QI2A 1NFOA 4IAQA 2J8WA 4NTBA 4NTFA 4C7OA 3C8GD 1ST6A 2R7VA 1VLSA 2D5RB 4YJWA 2O9XA 5BQGA 4IZBA 4CS9C 1H9TA 1L3PA 4N6CA 2CNWA 1TFKB 4OIQF 4I1OB 5E3CA 1FMVA 3U9MA 2UUIA 3QXZA 1RJ9B 1ORSC 3G64A 4L6RA 2YWAA 2R02A 2XL6A 4XEKA 2YL1A 4I3MA 1NU9C 4AE4A 2XSEA 2CNWD 5CIVA 3M1CB 3TK0A 1Q0DA 4FZWC 2PNOA 1VMAA 2LP4A 2CGEA 3KYIA 3A4NA 3KH2A 5AGFA 3TRRA 2M64A 4JCSA 1NZYA 4QIJA 2LK4A 3ABMC 3DAFA 2DYRC 1OXKA 2ZXOA 1T01A 4CDVA 4ZLDA 5JBWA 1SYQA 1KU2A 4O7GA 2HJMA 3HNIA 4ELSA 3AGUA 3T89A 4W8PA 2V3CC 4OIOF 1UIYA 1LIHA 1L7CA 2UUHA 1ZU4A 1TQGA 4FWVA 1OW8A 1M2VB 5AC4A 4XEVA 4XLPF 4JRZA 4YL3A 2H7VC 2J0XA 2XLMA 1YAUO 2GFHA 1T6QA 2CCYA 3OEOA 3NRHA 2H7OA 2XXAB 3AG1C 4YT5A 4F47A 3L1MA 4RBNA 3X2QC 3SEOA 4EIYA 2NUPA 2KQ9A 1YA9A 2CDQA 3PHF2 2YL0A 4JEAA 3JCUQ 2VREA 1J8YF 1VYKA 3FDUA 2J0WA 1O5HA 2HV7A 3SWXA 4G7OF 3B0VC 2HW5A 4AL1A 1U0BB 2G3KA 4MVZA 3W8IA 1YZAA 2YL7A 4U5HA 4H54A 5GPGB 4MVOA 4I52A 4IJJA 2YKZA 1O87A 5A6KA 4U9DA 3L0IA 3DM9B 3H02A 1MNEA 2WZLA 1HE1A 4JWVA 4R32A 3BEHA 3IEEA 4E7SA 3H2VA 3VF0A 3ZQYA 4M63A 1ZU5A 2XLWA 2C04A 3T9OA 2AP3A 3Q0JA 1LI5A 2GDCA 1OXBA 3MYIA 2I15A 3EGDB 1Q52A 5L3QA 2OQMA 3HJCA 4CSAC
chains in the Genus database with same CATH topology
3W8HB 4XEFA 3L8IA 1UX4A 3RQFA 2Q00A 1K40A 3A4MA 1OW7A 3JYYA 3MFNA 4NQFA 3JZ0A 3ADDA 2YWAA 4XEKA 4GEHB 1UX5A 3RQEA 1K04A 2L6HA 4NNQA 2KK1A 3TULA 3O10A 3L8JA 2P63A 3GM2A 4EBKA 3A4NA 2JX0A 1QVXA 3C18A 3BRJA 1WWPA 3K7DA 3U0CA 3A4LA 1WTYA 2LK4A 1JOGA 3W8IB 3GM1A 3O4XE 4R32A 1RJMA 2L6FA 3B71A 2L6GA 1K05A 5F28E 3C8GA 4EBJA 3ADBA 2PBEA 2JPUA 3AM1A 2HSBA 3GM3A 3AJMA 1Y64B 1ZZPA 3RQGA 1UFBA 1KTMA 1OW6A 1WOLA 1KNYA 1V4AA 1OW8A 3IRBA 4XEVA 1O3UA 3S9OA 3C8GD 3U3FA 1PV3A 3C8GB 3ADCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8H B;  4XEF A;  4EBJ A;  2JX0 A;  2PBE A;  1QVX A;  3C18 A;  2JPU A;  2YWA A;  3BRJ A;  4XEK A;  2HSB A;  1KTM A;  4GEH B;  3L8I A;  1WWP A;  3RQE A;  1K04 A;  2L6H A;  3GM3 A;  3K7D A;  3AJM A;  3RQF A;  3U0C A;  2Q00 A;  1ZZP A;  1WTY A;  2KK1 A;  1K40 A;  3RQG A;  1UFB A;  2LK4 A;  1OW6 A;  1JOG A;  3TUL A;  3O10 A;  1WOL A;  3W8I B;  3GM1 A;  3L8J A;  1KNY A;  1V4A A;  1OW8 A;  1OW7 A;  3JYY A;  4R32 A;  4EBK A;  4XEV A;  3MFN A;  3GM2 A;  1O3U A;  2L6F A;  3C8G D;  4NQF A;  3S9O A;  3B71 A;  3U3F A;  2L6G A;  5F28 E;  1PV3 A;  1K05 A;  3C8G A;  3C8G B;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 1HMD A;  4XLN F;  2R05 A;  1XZQ A;  3RF3 A;  4WGZ A;  4J30 B;  5KYX B;  4P9F A;  3SXZ A;  2H8A A;  3JYH A;  2YLD A;  1G4W R;  4CS7 A;  4E17 A;  3ZDL A;  2FAP B;  2HZ8 A;  2RD9 A;  4YK5 A;  4MTF A;  3M79 A;  1OW7 A;  3U2M A;  5F5F A;  5D92 A;  2NUT A;  1TWG A;  5B3S C;  3ADD A;  3RQE A;  2IEX A;  3QVZ A;  4LLE A;  1JXZ A;  5L0J A;  1MMG A;  2MWQ A;  3EHM A;  1PD0 A;  3G4Z A;  3FDQ A;  1H7I A;  5TJ5 E;  3HIN A;  5L0F A;  1WWP A;  2W45 A;  4PFO A;  1OKK A;  2F6Q A;  2KW3 C;  4JCH A;  2KGO A;  4G7Z F;  2EPM X;  3ECS A;  2TMV P;  4IZD A;  3B71 A;  4MVU A;  3FXH A;  4CS9 A;  1HW2 A;  3DZA A;  4O6N A;  1JPJ A;  4XWJ A;  2EPL X;  1OR2 A;  1OKK D;  3DJN B;  3CZ6 A;  2Y69 C;  1ZZP A;  1D0Y A;  2P7V A;  1KNY A;  1LVK A;  1ZHY A;  1Z3I X;  1VOM A;  3CQZ A;  5JSL A;  3LLK A;  3QZC A;  4U19 A;  4DXW A;  4BG0 A;  2ZQR A;  4JUR I;  2PX0 A;  4MVM A;  2Q00 A;  3DAG A;  1K40 A;  2VH3 A;  4FZW A;  5B3I A;  1V55 C;  1C03 A;  1TFO B;  3K6B A;  2R7U A;  2EPN A;  5CI9 A;  3B0P A;  4NQF A;  3DE8 A;  2Y3G A;  2OKU A;  3Q6N A;  4K1O A;  1K04 A;  1ZHT A;  3HNJ A;  3SXK A;  4E0H A;  3EGX A;  3OA1 A;  2Y3B A;  3LEV A;  4I44 A;  3CAX A;  4PJL A;  2XLE A;  1ZHX A;  5L3V A;  1QVX A;  1QPU A;  3BRJ A;  3DM5 A;  1QQ3 A;  5BUO A;  3F46 A;  5CI8 A;  1OCR C;  3GM1 A;  5AC5 A;  4FJW D;  3VM6 A;  3LS1 A;  5FCL A;  3NYL A;  4EBB A;  5KYU B;  3UMK A;  1C17 M;  3AQB A;  2HSB A;  3DKA A;  2XRH A;  4PR9 A;  3NDB B;  2JD3 A;  3DXJ F;  3ASO C;  2P1A A;  4KNW A;  1FTS A;  4CJG A;  3EQL F;  3TQO A;  3W8H B;  1U6H A;  4QII A;  1CPQ A;  5JUA A;  3N2Z B;  2HV6 A;  3H65 A;  3L8I A;  4J32 B;  2A68 F;  1YAR O;  2R7R A;  3SXY A;  3FAJ A;  3S29 A;  4WCZ A;  2LD6 A;  2OG2 A;  4I4Z A;  1TWA A;  1EKY A;  3HLZ A;  1J8M F;  1MJ3 A;  1ZVZ A;  1FAP B;  1FMW A;  2PF4 E;  2YVK A;  1YYJ A;  3UMH A;  5KYW B;  3AGT A;  3NMJ A;  4DRH B;  4DVZ A;  2XLV A;  4IB4 A;  1NZE A;  3EGX B;  2HSQ A;  2AWY A;  1WGW A;  2VCB A;  2HFI A;  4MS2 A;  1AVO B;  2XM4 A;  1Z63 A;  3HKK A;  2HMQ A;  1WAT A;  1VLT A;  3SP1 A;  5HV9 A;  4JYL A;  2A1D D;  3M4C A;  2Q9B A;  4OLQ A;  3RYL A;  4ELW A;  2RSE B;  3RVZ A;  3ADB A;  1QSP A;  5EK0 A;  3QTH A;  3UNG C;  3PMR A;  2PP4 A;  5KYY B;  3W4Y A;  3P5M A;  4CS8 C;  3R0O A;  1Q0K A;  2A69 F;  4OG1 A;  5HSW A;  4A4A A;  3ZWI A;  4JFC A;  1M6T A;  2B0J A;  1OCO C;  2GAQ A;  3PZK A;  5JVE A;  4U1A A;  4QI0 A;  2HMZ A;  2W4M A;  2IXM A;  1W2W A;  4XPW A;  3NG1 A;  2H7B A;  1RJN A;  4ULV A;  3KMI A;  5JT4 A;  2DI3 A;  2MHR A;  1OR3 A;  1VK5 A;  1HZD A;  1RKE B;  1UX5 A;  2GTR A;  4ZLC A;  3JRT A;  3L8J A;  2PBP A;  3DE9 A;  5EGY A;  2V26 A;  4FAP B;  5JRA A;  2BL2 A;  2L81 A;  2OJE D;  1Q51 A;  3EFO A;  2F22 A;  4PJN A;  1Y4C A;  3JRM O;  4JTC B;  2DYS C;  4PAC A;  3HNK A;  1C02 A;  3EZI A;  1XWJ A;  3US6 A;  3HTK C;  3NKE A;  1AUE A;  4U5G A;  1VYI A;  3C63 A;  3EG9 B;  2LFD A;  5KYN A;  1UG7 A;  2PBE A;  4C3B A;  1YDI A;  1I4Z A;  4I1M A;  1DUB A;  4WGY A;  5FZT A;  2R7W A;  1Z23 A;  1A7D A;  2X51 A;  2XLO A;  3C8G B;  3I5P A;  1IZM A;  3KQF A;  2Q9C A;  1UX4 A;  4O6M A;  2XLD A;  3KPH A;  4MI2 A;  1Q0F A;  4C7O B;  2WVN A;  3KL4 A;  4CDA A;  3K1H A;  3M15 A;  5B1A C;  1A41 A;  4PFP A;  4B6I A;  3DI5 A;  3O10 A;  2IBF A;  4JCZ A;  3Q0G A;  3F47 A;  3Q1T A;  4MOU A;  1R5I D;  3AG3 C;  1ORY A;  2Y3H A;  2J9V A;  2CW0 F;  3DD7 A;  1FFT C;  3TLF A;  3S27 A;  1WN0 A;  4AE4 B;  2NG1 A;  3TJ6 A;  4LLC A;  3ZTZ A;  3B9Q A;  2ETS A;  4JE9 A;  1U89 A;  2ZD9 A;  2IYL D;  5KJP A;  1FFH A;  2ICW G;  4FX5 A;  2QQ3 A;  3HRX A;  2LFF A;  3UGO A;  4Q7C A;  4MW8 A;  4K2N A;  3A9C A;  3ASN C;  2FBM A;  1NZY B;  3RQG A;  1UFB A;  3X1O A;  3AQC A;  1MND A;  1E84 A;  3LS0 A;  4XPY A;  3J06 A;  3S9O A;  2YLG A;  3ADC A;  1GQA A;  1MMN A;  3WHN A;  3JSZ A;  3MBG A;  1JRA A;  2L9J A;  2PX3 A;  5L0H A;  1RCP A;  3JT1 A;  2ZQQ A;  2R03 A;  5COF A;  2OU6 A;  1RMV A;  1XZP A;  3EJN A;  4JIO A;  5B1B C;  1NSG B;  3KYJ A;  4GEH A;  3IPM O;  3OWT A;  4G7H F;  1CGM E;  5JBX A;  3AOU A;  2NUP B;  4BEM J;  1Q0G A;  3GEI A;  1RXQ A;  3GWL A;  3N24 A;  1EQ1 A;  3SYN A;  5DS6 A;  2NSF A;  4MQ9 F;  4CIH A;  2VB6 A;  4ONS A;  3C18 A;  5DS5 A;  4YT8 A;  2ZPA A;  4CS8 A;  2QY9 A;  1B68 A;  4F4B A;  1EA8 A;  1FNT c;  3W8I B;  1LI7 A;  4IAR A;  3SNH A;  3PCV A;  3O4X E;  3Q6M A;  3WG7 C;  1ORJ A;  3QW0 A;  1BR4 A;  2XS1 A;  4UDV A;  3H2U A;  3GEE A;  1Q0M A;  1H6G A;  3I4U A;  1TKN A;  4IGG A;  4H4K C;  4LAC B;  2HJ3 A;  3AG2 C;  1E85 A;  5A6B A;  3T4R A;  5COG A;  2FGY A;  2YHS A;  2A0U A;  4RDA A;  2ZXR A;  3ABK C;  1GGQ A;  1HW1 A;  3Q7G A;  5DVW A;  2IXP A;  1LS1 A;  3R9T A;  1D1A A;  5A6B D;  1FR0 A;  1YJG A;  3A4M A;  2MYS A;  3JYY A;  4JEB A;  3MFN A;  2OCC C;  4DOZ A;  3EH2 A;  5JP7 A;  3T8A A;  4GEH B;  2VCA A;  4NNQ A;  3EZH A;  1MMA A;  4BJT A;  3EH1 A;  2EIL C;  4A2N B;  1V74 B;  4DBQ A;  2NUT B;  3SZR A;  2X0C A;  1BZ4 A;  3K1I C;  2XS8 A;  1G5Z A;  4QDL A;  4CX9 A;  4YWQ A;  3U0C A;  2IXO A;  3A4L A;  1I5N A;  4AK9 A;  1S05 A;  1LS4 A;  3MYF A;  4BJ5 C;  4NY3 A;  4G78 A;  3PDM P;  3C8Z A;  4C3E A;  1K05 A;  3RW0 A;  2WVQ A;  3B29 A;  2P6V A;  5E33 A;  2JPU A;  2QUP A;  3AM1 A;  2Q7R A;  2QTV A;  2KYH A;  3FAP B;  1Y64 B;  4BJ6 C;  3C7J A;  1DOV A;  2G3V A;  3T6B A;  1V4A A;  4MVQ A;  3CSK A;  1EY3 A;  1G8X A;  1ZW2 A;  1YLM A;  4XEF A;  4DRI B;  1TWC A;  3RQF A;  1SR2 A;  3I5Q A;  1YVI A;  2LSE A;  3ABL C;  3S90 A;  1EF8 A;  4NEK A;  1N1C A;  3JZ0 A;  1MQV A;  2J9B A;  4E0I A;  3K66 A;  3T6J A;  4U5D E;  4OIR F;  4HFK B;  4JKV A;  4U5C E;  3GM2 A;  4RD9 A;  4J7Y A;  2YEV A;  4OD5 A;  2R7S A;  2VCC A;  3W2W A;  1HY5 A;  3A11 A;  1E2X A;  3H81 A;  3UGP A;  3VAY A;  1JOG A;  4BEJ A;  1OQC A;  3V5Y A;  4EKW A;  3AG4 C;  3T6G B;  2L6G A;  3S0X A;  4E7Z A;  2R7X A;  2LCH A;  2QNL A;  1IW7 F;  1KTM A;  1CGN A;  1WOL A;  1Z5Z A;  4IRU A;  2R9R B;  5T3T A;  4N06 A;  3FVY A;  5JS5 A;  1PV3 A;  1RJ9 A;  1GS9 A;  1H9G A;  1A7E A;  2UZF A;  1DOW A;  2LQG A;  4XTK A;  2EIM C;  4NC3 A;  1ZW3 A;  5L0D A;  1DCI A;  3TOM A;  1TR2 A;  4Z9I A;  3JSE O;  2KNH A;  3O39 A;  3ZG1 A;  3SXM A;  1R4T A;  2D4U A;  2WZG A;  3IQT A;  4JOT A;  2IM8 A;  2LIG A;  3W2V A;  4GYT A;  1T5O A;  3WOD F;  1T6U A;  3ZTM A;  1OCC C;  3B0U X;  3EHN A;  3N0T A;  2P63 A;  2WVO A;  3NMK A;  4LDQ A;  4EBK A;  2EPO A;  5EHH A;  2JX0 A;  4N6H A;  4KI2 A;  3T88 A;  2A6H F;  5D91 A;  3K7D A;  1CGO A;  3M4B A;  4Z9J A;  5T3W A;  4JJG A;  3SLL A;  4MVR A;  1M2V A;  5E3A A;  4MTO A;  4CBE A;  1NFN A;  2YZS A;  3IHU A;  4AL0 A;  3K33 A;  5F28 E;  2GWW A;  5L0C A;  2XXA A;  2VX2 A;  2AWC A;  3NYM A;  3R2P A;  5L0G A;  4N4W A;  4NTA A;  1D1B A;  1OW6 A;  3LJB A;  3TOL A;  2L7A A;  1ZYR F;  5A6A A;  4ZU2 A;  1O3U A;  2W9Y A;  3U3F A;  3I47 A;  4U5F E;  3RKO F;  2A0B A;  3NKD A;  1HE9 A;  3NYJ A;  3LES A;  3U8V A;  4FES A;  2YRF A;  2FFH A;  3V7O A;  3GAN A;  3GEH A;  3RIP A;  3K1I A;  3JTL O;  4YL1 A;  4PJJ A;  1YYX A;  1E83 A;  4BJ5 A;  5K0I A;  4YT2 A;  4KC9 A;  4W8K A;  4ER9 A;  1LKX A;  1JR8 A;  4IZC A;  4AX2 A;  1APC A;  4BJ6 A;  5T1D B;  2QLA A;  1S7Z A;  3O6X A;  1RKC A;  4EHP A;  2WB7 A;  2G62 A;  4EML A;  3R9S A;  3EGD A;  1VTM P;  3EFO B;  2KJG A;  4MND A;  4EBJ A;  1EI7 A;  4Z9H A;  3KKB A;  4WAB A;  2EIN C;  4KNP A;  5KYX A;  4P6I C;  1NLX A;  2QE9 A;  2B0H A;  2NPU A;  3IRB A;  5A69 A;  1SF8 A;  2HS5 A;  4IWB A;  3U8P A;  4MTG A;  3U2L A;  3ZSU A;  3U9J A;  3C62 A;  3QK8 A;  4DBR A;  2C03 A;  3MYB A;  2XL4 A;  3V5Z A;  4GQH A;  4YL0 A;  4CDY A;  5E2Q A;  3CEX A;  3R7C A;  3LLI A;  2WL8 A;  1TWH A;  3TJ5 A;  1V54 C;  3QMK A;  4XQ1 A;  2YQY A;  4U5E E;  3LUT B;  1NG1 A;  256B A;  2PFD A;  4U5B E;  4JW1 A;  4J7T A;  2J46 A;  3MX3 A;  4P9T A;  2EIK C;  4K0D A;  4JTA B;  5BQH A;  4PJM A;  1VB5 A;  4OIP F;  4CIP A;  1WTY A;  1F1M A;  2KC3 A;  5F5H A;  3RVY A;  1AEP A;  2ZXP A;  2OEX A;  2OEV A;  2YLI A;  2PPY A;  4XPX A;  4YT4 A;  3ZQV A;  2XL8 A;  5DLJ A;  1D0Z A;  1ZHW A;  3Q7L A;  3TD7 A;  2Q4F A;  4DRJ B;  1WZ8 A;  2J7P A;  1QZX A;  2EIJ C;  2OJQ A;  1Z6A A;  4JC7 A;  4G0H A;  1PCX A;  3DJU B;  4O6Y A;  2HUJ A;  2IOQ A;  2J7P D;  2OOC A;  4MW3 A;  2DGJ A;  4BJ1 A;  5L0I A;  4Q4Z F;  2XLH A;  3LNM B;  2R7T A;  2Z15 A;  1MMD A;  1LM3 B;  4K7B A;  1M57 C;  2R7O A;  2ZXW C;  3TUL A;  2AVK A;  4I42 A;  4Q5S F;  3MOY A;  2P61 A;  4EUK B;  2BE5 F;  3E9V A;  2E87 A;  5KYU A;  2I8B A;  1A0B A;  4JVS A;  4HEA J;  3RSI A;  2J9U A;  3ZVR A;  1A7V A;  1D0X A;  4HE8 D;  2Y3D A;  5IY5 C;  2Y39 A;  1JPN A;  4KNV A;  4HFF B;  2L6F A;  4YN0 B;  1QKR A;  3LNR A;  3W8H A;  2BC5 A;  3RFY A;  1LPE A;  1G4U S;  4IAO A;  3AJM A;  3LAY A;  2R25 A;  1JAF A;  4ELX A;  3EPV A;  4ANJ A;  5COM A;  2NSG A;  3NMI A;  3POV A;  4DJ9 A;  4X0R A;  3L34 A;  3LEO A;  3FOP A;  1YA7 O;  4K3W A;  3S84 A;  2J45 A;  5KYW A;  2IXN A;  3E70 C;  3VYW A;  1HMO A;  4NCQ A;  3UMI A;  5JLI A;  2DUB A;  2XM0 A;  4BPM A;  1CPR A;  1M56 C;  1ZHZ A;  4D4N A;  2ASR A;  4U9E A;  1E86 A;  1LE2 A;  4LDK A;  3GWN A;  4PK4 A;  3FMS A;  3MLG A;  2KK1 A;  3HNL A;  3UR3 C;  3S28 A;  5DQZ A;  5BQI A;  2HKV A;  3DWW A;  4EWC A;  4MVS A;  4D4X A;  1SZI A;  2R7Q A;  4JJF A;  5KYY A;  4DVY P;  3RH3 A;  3O55 A;  3FHD A;  1PD1 A;  4E18 A;  2EJ5 A;  3FOO A;  3GOR A;  5DS4 A;  1NU7 D;  1RJM A;  4LDR A;  2EPK X;  2VC9 A;  1SMY F;  2KSF A;  3ITF A;  3QXI A;  3U3B A;  2AU5 A;  3GM3 A;  1GM5 A;  1QLE C;  2P0N A;  3ZC4 A;  3G50 A;  2VAS A;  1I4Y A;  2DB4 A;  4OIN F;  2FW2 A;  3IQ6 A;  4CJO A;  4LER A;  1NBB A;  3IQC A;  1RKE A;  4KBL A;  3G4X A;  2M4E A;  1T9K A;  1YZC A;  3GOD A;  5C9G A;  2W4B A;  3DMD A;  2CYD A;  2GA0 A;  3ZIB A;  1Y6D A;  2J9W A;  2Q3T A;  2L6H A;  3VRC A;  1EF9 A;  4O79 A;  3ATP A;  1BR1 A;  3U5S A;  4CSA A;  2WZF A;  3EG9 A;  4ULW A;  5DQT A;  4C3D A;  1T6I A;  3V5X A;  4OD4 A;  1Z7Q c;  1M2O A;  5A6J A;  3IQ5 A;  4U18 A;  3WAQ A;  1D1C A;  2YL3 A;  1BBH A;  1BR2 A;  3OC7 A;  4JZA A;  4JTD B;  3QVY A;  1LE4 A;  4WJ0 A;  1BDJ B;  3C8G A;  3QW1 A;  1OCZ C;  1WAS A;  2A6E F;  1JMW A;  2Q9A A;  4QI2 A;  1NFO A;  4IAQ A;  2J8W A;  4NTB A;  4NTF A;  4C7O A;  3C8G D;  1ST6 A;  2R7V A;  1VLS A;  2D5R B;  4YJW A;  2O9X A;  5BQG A;  4IZB A;  4CS9 C;  1H9T A;  1L3P A;  4N6C A;  2CNW A;  1TFK B;  4OIQ F;  4I1O B;  5E3C A;  1FMV A;  3U9M A;  2UUI A;  3QXZ A;  1RJ9 B;  1ORS C;  3G64 A;  4L6R A;  2YWA A;  2R02 A;  2XL6 A;  4XEK A;  2YL1 A;  4I3M A;  1NU9 C;  4AE4 A;  2XSE A;  2CNW D;  5CIV A;  3M1C B;  3TK0 A;  1Q0D A;  4FZW C;  2PNO A;  1VMA A;  2LP4 A;  2CGE A;  3KYI A;  3A4N A;  3KH2 A;  5AGF A;  3TRR A;  2M64 A;  4JCS A;  1NZY A;  4QIJ A;  2LK4 A;  3ABM C;  3DAF A;  2DYR C;  1OXK A;  2ZXO A;  1T01 A;  4CDV A;  4ZLD A;  5JBW A;  1SYQ A;  1KU2 A;  4O7G A;  2HJM A;  3HNI A;  4ELS A;  3AGU A;  3T89 A;  4W8P A;  2V3C C;  4OIO F;  1UIY A;  1LIH A;  1L7C A;  2UUH A;  1ZU4 A;  1TQG A;  4FWV A;  1OW8 A;  1M2V B;  5AC4 A;  4XEV A;  4XLP F;  4JRZ A;  4YL3 A;  2H7V C;  2J0X A;  2XLM A;  1YAU O;  2GFH A;  1T6Q A;  2CCY A;  3OEO A;  3NRH A;  2H7O A;  2XXA B;  3AG1 C;  4YT5 A;  4F47 A;  3L1M A;  4RBN A;  3X2Q C;  3SEO A;  4EIY A;  2NUP A;  2KQ9 A;  1YA9 A;  2CDQ A;  3PHF 2;  2YL0 A;  4JEA A;  3JCU Q;  2VRE A;  1J8Y F;  1VYK A;  3FDU A;  2J0W A;  1O5H A;  2HV7 A;  3SWX A;  4G7O F;  3B0V C;  2HW5 A;  4AL1 A;  1U0B B;  2G3K A;  4MVZ A;  3W8I A;  1YZA A;  2YL7 A;  4U5H A;  4H54 A;  5GPG B;  4MVO A;  4I52 A;  4IJJ A;  2YKZ A;  1O87 A;  5A6K A;  4U9D A;  3L0I A;  3DM9 B;  3H02 A;  1MNE A;  2WZL A;  1HE1 A;  4JWV A;  4R32 A;  3BEH A;  3IEE A;  4E7S A;  3H2V A;  3VF0 A;  3ZQY A;  4M63 A;  1ZU5 A;  2XLW A;  2C04 A;  3T9O A;  2AP3 A;  3Q0J A;  1LI5 A;  2GDC A;  1OXB A;  3MYI A;  2I15 A;  3EGD B;  1Q52 A;  5L3Q A;  2OQM A;  3HJC A;  4CSA C; 
#chains in the Genus database with same CATH homology
 3W8H B;  4XEF A;  3L8I A;  1UX4 A;  3RQF A;  2Q00 A;  1K40 A;  3A4M A;  1OW7 A;  3JYY A;  3MFN A;  4NQF A;  3JZ0 A;  3ADD A;  2YWA A;  4XEK A;  4GEH B;  1UX5 A;  3RQE A;  1K04 A;  2L6H A;  4NNQ A;  2KK1 A;  3TUL A;  3O10 A;  3L8J A;  2P63 A;  3GM2 A;  4EBK A;  3A4N A;  2JX0 A;  1QVX A;  3C18 A;  3BRJ A;  1WWP A;  3K7D A;  3U0C A;  3A4L A;  1WTY A;  2LK4 A;  1JOG A;  3W8I B;  3GM1 A;  3O4X E;  4R32 A;  1RJM A;  2L6F A;  3B71 A;  2L6G A;  1K05 A;  5F28 E;  3C8G A;  4EBJ A;  3ADB A;  2PBE A;  2JPU A;  3AM1 A;  2HSB A;  3GM3 A;  3AJM A;  1Y64 B;  1ZZP A;  3RQG A;  1UFB A;  1KTM A;  1OW6 A;  1WOL A;  1KNY A;  1V4A A;  1OW8 A;  3IRB A;  4XEV A;  1O3U A;  3S9O A;  3C8G D;  3U3F A;  1PV3 A;  3C8G B;  3ADC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...