3L8JA

Crystal structure of ccm3, a cerebral cavernous malformation protein critical for vascular integrity
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
200
structure length
200
Chain Sequence
XXXTTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CCM3, a cerebral cavernous malformation protein critical for vascular integrity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Programmed cell death protein 10
total genus 75
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2009-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.70 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3l8jA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3l8jA02
3C8GB 1WOLA 2LK4A 2PBEA 3GM3A 3U3FA 4GEHB 3GM2A 3O10A 3RQGA 3W8HB 3U0CA 3C18A 1K40A 3BRJA 3K7DA 1V4AA 3B71A 1O3UA 3JYYA 2L6FA 3GM1A 2Q00A 1KNYA 3JZ0A 2JX0A 1OW8A 3RQEA 4XEFA 4XEVA 1UFBA 1K04A 3W8IB 2L6HA 1JOGA 3L8IA 3C8GD 3L8JA 4EBKA 3S9OA 3MFNA 2KK1A 4NQFA 3C8GA 3RQFA 4R32A 1OW6A 2L6GA 4EBJA 2YWAA 1K05A 5F28E 2HSBA 1WTYA 1QVXA 4XEKA 1OW7A 1WWPA 2JPUA 3TULA 1KTMA 1ZZPA 1PV3A 3AJMA
chains in the Genus database with same CATH superfamily
1WOLA 2F6QA 3RW0A 3NG1A 3K1IA 4OIRF 2NUPB 4ZU2A 5A6AA 1JRAA 2Q9BA 2J7PA 3LS1A 3N2ZB 3TQOA 2KGOA 1GM5A 1RCPA 4JOTA 2UZFA 3B9QA 1D1BA 1NZYB 3RQEA 2NUTB 3UR3C 5EGYA 2HJ3A 3IRBA 3GEEA 3JSZA 5B1AC 3L8JA 2W4MA 1LS1A 4MTFA 4F4BA 1ZU5A 2KK1A 4IGGA 3I47A 4JFCA 1LI5A 1ZHTA 3W8IA 4P9FA 3VYWA 3LJBA 1M57C 2LFFA 1OCRC 3H2VA 2IXOA 2Y69C 1EY3A 3S27A 4C3DA 1C17M 1ST6A 1VYKA 1WTYA 4U9EA 3NYJA 3RFYA 3U9MA 3RH3A 1T5OA 1YDIA 1Q0KA 2XLMA 1G4WR 4BEJA 3J06A 2GWWA 3LAYA 3HNLA 1QZXA 3KH2A 1M2VA 4G7ZF 2DUBA 2BE5F 1QQ3A 3JYHA 1VK5A 4DRJB 3U0CA 1LM3B 1AUEA 2HV7A 4PACA 2HW5A 3H02A 1HE9A 2FBMA 2VC9A 4MS2A 3GM1A 4PK4A 3JZ0A 1KNYA 4B6IA 4MW8A 4D4XA 5L0DA 5L0HA 2OEXA 2ZXRA 2PNOA 2EIJC 1A7DA 3AGUA 1PD1A 3RVZA 3US6A 1Q0GA 2OG2A 1JOGA 1ORJA 3L8IA 1WGWA 2GA0A 4NNQA 4XTKA 3FXHA 3T88A 4LDRA 5IY5C 4NTAA 3TOLA 5AC5A 3EGXB 3Q0GA 3SXYA 5F28E 4CIPA 1XZPA 2IXPA 4G0HA 2AVKA 1QVXA 5F5HA 5K0IA 1EQ1A 4Q5SF 1I4YA 1Y4CA 2XRHA 5T1DB 3ZQYA 2ZXOA 4YL1A 3ZC4A 3TULA 3PDMP 1DOVA 1VLSA 2R9RB 3EHNA 2EJ5A 1MQVA 3K66A 1Q0DA 2KYHA 3V7OA 4CDAA 3EHMA 1YA9A 1H9TA 2JD3A 1QKRA 2W45A 2W9YA 3C8ZA 1Q52A 3SWXA 1Q51A 4CDYA 2A6EF 2Q3TA 2WVOA 2H7VC 4FZWA 3M79A 5BQHA 2VX2A 3RIPA 2VH3A 3NDBB 4K7BA 2J7PD 3C62A 3QTHA 4XEFA 3MLGA 3F47A 1EF8A 3SYNA 2TMVP 4K2NA 2H7OA 5JSLA 4EBKA 1WN0A 1HW1A 3C8GA 4KBLA 3FVYA 3UMHA 4E17A 2O9XA 1Z63A 1RJ9B 1ORYA 3CQZA 2ASRA 4FX5A 4HEAJ 1BR2A 1T01A 4J30B 3W2VA 2MYSA 1MJ3A 1R4TA 1BR4A 4CDVA 3LLKA 1E2XA 1WATA 1WWPA 2XS1A 2KW3C 3L0IA 4I42A 1H9GA 5KYXB 1ZZPA 4JKVA 3UMIA 1OKKD 2VCCA 3GM3A 3CZ6A 1TFKB 3EZIA 1FFTC 4N4WA 1RMVA 2MHRA 2Q9AA 5T3TA 3WAQA 4IRUA 4FZWC 2P7VA 3UMKA 3E9VA 1O5HA 4QIJA 1NLXA 2LP4A 1SF8A 2Y3GA 5BQGA 3B29A 3KPHA 1E85A 1BDJB 1E83A 4CJGA 4IAOA 2XLDA 2EPNA 3I4UA 3TOMA 3KL4A 1RJ9A 1Z5ZA 4AK9A 3FMSA 4MVOA 4N6CA 4U18A 1LS4A 3DE8A 4I1MA 3JCUQ 4O6YA 2B0HA 2A1DD 1FNTc 1Q0MA 4RD9A 2NSGA 2QUPA 4U9DA 4PJJA 3H2UA 4RBNA 3FDQA 1VMAA 1UX4A 3IPMO 4XPYA 4DVZA 3NMJA 3SLLA 2J46A 2QTVA 4XPWA 1A7EA 3TD7A 3ADCA 3A4MA 1SYQA 2G3KA 3T89A 4H54A 3KKBA 4JRZA 4EUKB 3W2WA 3K7DA 4QDLA 5KYWA 1V4AA 3SP1A 2G3VA 3B71A 4MVMA 4F47A 1LE2A 2UUHA 1I4ZA 3NRHA 5BUOA 2IYLD 2LFDA 1J8MF 2Y3BA 5JLIA 1H7IA 4Z9JA 1F1MA 1TWHA 2Y3DA 3LNRA 2HMQA 4KI2A 1FFHA 5COFA 1HY5A 4CJOA 3HINA 4BG0A 3O39A 4MOUA 2A69F 4MQ9F 2NSFA 5COGA 2A68F 3O4XE 4EWCA 4P9TA 1FTSA 1CGNA 1TR2A 2DGJA 2LD6A 2XM4A 4KNWA 2ZQRA 5JP7A 3U9JA 4YL0A 1OXBA 1U6HA 1DCIA 1AEPA 2H8AA 2Y39A 2OCCC 1SMYF 1OW7A 2PFDA 3JRMO 2XSEA 2LCHA 4JEBA 1Z23A 4JTCB 2PX3A 4RDAA 2M4EA 3FOOA 3QXZA 3I5QA 3ZIBA 1IW7F 2R7QA 3PZKA 3H65A 1OKKA 1LIHA 3O10A 2D5RB 3AQCA 1A0BA 1YYJA 2EPOA 1ORSC 2ZD9A 2KSFA 2X51A 3JT1A 4MTGA 4XWJA 3ZDLA 1HE1A 1EKYA 1RKCA 1TQGA 2J9WA 2HMZA 2JX0A 2YQYA 3M15A 5JRAA 2CNWD 2XL8A 4M63A 3ZTMA 4N06A 4OD5A 3AG2C 3NYLA 3V5XA 5DQZA 3AG4C 1CPRA 3ZG1A 1T9KA 2RSEB 4IJJA 4DRHB 5JVEA 1TWAA 2VB6A 3Q6MA 3ECSA 1OR2A 3GEHA 1VB5A 3L34A 4R32A 1MMAA 3EFOA 2CDQA 2AP3A 2OOCA 3JRTA 5DQTA 2IEXA 3POVA 4Z9IA 2XLEA 4KC9A 3TJ6A 2QLAA 4MVRA 4CSAC 2XL4A 4ANJA 4MVZA 4U5HA 5CI8A 3F46A 1GS9A 3NKEA 4X0RA 3RSIA 2PP4A 1KTMA 1PV3A 4FESA 5A6KA 3Q7LA 4OD4A 2J0XA 3W4YA 5JT4A 2CGEA 4U5EE 3W8HA 2OKUA 4CS8C 4DXWA 2ZQQA 4OIQF 3JYYA 3QK8A 3LNMB 1FMWA 1A41A 3OA1A 4CS7A 2YEVA 1KU2A 1YLMA 3V5YA 4JZAA 5KYXA 1QLEC 2YRFA 1XWJA 3S29A 1Z7Qc 3C8GD 4MNDA 3S28A 4MI2A 2YKZA 4CS9A 4E0IA 1V54C 2WVQA 2J9VA 2YLDA 4E0HA 1Q0FA 1D0XA 2R25A 4U5BE 3AOUA 4YN0B 1APCA 5KYNA 1MNEA 2R7VA 2R05A 2YWAA 1D1CA 4BJ6A 1JXZA 4JTDB 3QZCA 1A7VA 1E84A 5T3WA 2QNLA 5KYWB 3MOYA 3T9OA 3KMIA 1MMDA 1V55C 3VM6A 1VYIA 3Q6NA 4JIOA 1J8YF 1U0BB 4OLQA 3B0VC 3S90A 2EPMX 3LLIA 3M4CA 4W8PA 5L3VA 1OCZC 4O6NA 3DI5A 4JCHA 2NUPA 4FAPB 1ZHYA 2Q00A 1Y64B 3DE9A 4NCQA 4PJMA 3GODA 3MYBA 2FW2A 4C3EA 3O55A 3QVYA 1C03A 4IARA 3ABKC 1EF9A 2CNWA 1O87A 2FFHA 5DS5A 1TFOB 3MFNA 4YT4A 3HLZA 1S7ZA 5HSWA 4QI2A 2FAPB 5L0IA 1DOWA 3RKOF 1NG1A 1YA7O 3GORA 1BZ4A 1R5ID 3WHNA 4XEKA 2R7TA 2YL3A 4KNVA 2OU6A 2R7XA 5KYUA 1ZHXA 1RKEA 3EG9B 3QMKA 3K33A 4JCZA 5DVWA 3SNHA 1RXQA 3MX3A 4WJ0A 3T6GB 4GEHB 2P1AA 3FDUA 3O6XA 4JE9A 1UIYA 1NZYA 1LVKA 3OC7A 1K40A 5AGFA 3VF0A 1ZYRF 1G4US 5B1BC 5KYYA 1IZMA 2MWQA 4GEHA 3TJ5A 2XXAB 4WGZA 2I8BA 2LIGA 2YLIA 2J9BA 2YZSA 3X2QC 5DLJA 4QIIA 3DM9B 3W8IB 2L6HA 4MVSA 1RJNA 2PPYA 2VASA 3ABLC 2AU5A 1T6QA 4BJ1A 4OINF 1TWCA 2A0UA 4XPXA 3SXKA 3G64A 2XXAA 2EILC 3IEEA 4IAQA 2DB4A 2I15A 1JPNA 4I44A 4D4NA 1L3PA 2CW0F 3N0TA 1U89A 1K05A 2HKVA 2L81A 2XLWA 3EGXA 3L1MA 4LLCA 4CBEA 3DWWA 4YWQA 5DS4A 5L3QA 2GDCA 1GQAA 1M2VB 2Y3HA 4DBQA 4G7OF 1RKEB 2YHSA 4HE8D 2L7AA 4GYTA 1M2OA 2HJMA 4YK5A 1LI7A 2IBFA 1PCXA 1ZHZA 2Q7RA 1QPUA 1JAFA 2YL7A 3DJNB 3T6BA 1LE4A 4I1OB 3MYFA 3EH2A 3EGDA 3UGOA 3QW1A 3NMKA 2H7BA 4PJLA 3JSEO 1ZVZA 2YL0A 2A0BA 4FWVA 5FCLA 1BR1A 3EGDB 3H81A 1T6UA 2YVKA 3RVYA 1NFNA 1K04A 2A6HF 3DMDA 4LDQA 4PJNA 3BEHA 5C9GA 2R7OA 3CEXA 3FHDA 3NYMA 4WABA 3ZTZA 2XLVA 3ZWIA 3RQFA 3DZAA 4DVYP 1OW6A 4HFKB 3U2LA 2XLHA 1NU7D 4EBJA 4CSAA 3A11A 3RF3A 2V26A 4MTOA 4I4ZA 3TRRA 2P63A 3N24A 3OEOA 3R2PA 3R7CA 4NTBA 1FR0A 2HUJA 2DYSC 5A6BD 2QE9A 1YZCA 3U2MA 4ZLDA 4EBBA 1NSGB 4P6IC 3SXZA 2IXNA 2PBEA 2XS8A 1OXKA 2XL6A 3T4RA 4E7SA 3Q0JA 4H4KC 3C7JA 4BJ5C 1HMDA 2R7SA 3U5SA 2UUIA 2DYRC 2EINC 2IM8A 2YLGA 3HTKC 3JTLO 3K1HA 1O3UA 2CCYA 5E2QA 3WG7C 1NU9C 1Z3IX 3ASNC 4A4AA 2VCAA 1VOMA 5FZTA 1LKXA 4IZDA 3LEVA 4LERA 1UFBA 4XEVA 3P5MA 5KJPA 4DOZA 3PHF2 2L9JA 2Z15A 4U1AA 2WZFA 5E3CA 3S9OA 3V5ZA 5DS6A 3AG3C 3EG9A 2OQMA 4ELWA 3TK0A 4EKWA 256BA 2BC5A 2NG1A 3PMRA 3UNGC 1YARO 4MVQA 2HSBA 1L7CA 4KNPA 1EI7A 4O79A 2XLOA 3EZHA 2R02A 4U5CE 2NPUA 3DKAA 3T8AA 3VAYA 4K1OA 4ER9A 5KYYB 2ZXWC 3ASOC 1OR3A 3C18A 4LACB 5COMA 4IB4A 4IZCA 3ZQVA 2NUTA 1UX5A 1JMWA 2B0JA 4MVUA 2J45A 2KQ9A 3GANA 3GM2A 3SZRA 4AE4B 1N1CA 4O7GA 4BPMA 4DRIB 2HFIA 5B3SC 4PFOA 5AC4A 2R7UA 4U5DE 3ADDA 2E87A 4JJGA 4GQHA 3X1OA 5BQIA 1ZW3A 2J0WA 1OW8A 2R7WA 2QY9A 2ZXPA 4EHPA 1DUBA 3CAXA 4QI0A 5E33A 1GGQA 3EPVA 2VCBA 1I5NA 3FAPB 1S05A 1MMNA 2XM0A 2HS5A 4BJ6C 1YJGA 2WZGA 5L0FA 3NKDA 4WGYA 5F5FA 3E70C 2KNHA 2OJQA 3DM5A 4E18A 3DJUB 3C63A 2KJGA 3RYLA 3B0PA 1HW2A 3Q7GA 4WCZA 4JTAB 2LQGA 3AJMA 4C3BA 4E7ZA 5A6BA 3UGPA 4C7OB 1QSPA 4PFPA 1NZEA 3RQGA 3I5PA 3GWLA 4J7YA 4MW3A 2EPKX 3LEOA 2GTRA 4ELSA 2RD9A 3ZVRA 2AWYA 1OCCC 3OWTA 3SEOA 2R7RA 1G5ZA 3TLFA 3A4NA 3R0OA 4ELXA 2C04A 2GAQA 1NFOA 3KYIA 4XQ1A 1YAUO 3S0XA 5CI9A 3PCVA 5KYUB 4NC3A 2FGYA 3DD7A 4NQFA 4ONSA 4ZLCA 4CIHA 3ZSUA 1T6IA 2P61A 3HNKA 3QXIA 2CYDA 2IXMA 2M64A 4JC7A 3EJNA 3K1IC 1FAPB 3G50A 3QW0A 4IWBA 5A6JA 4YT2A 2P0NA 1BBHA 3U3BA 1H6GA 1W2WA 2ICWG 4C7OA 1ZU4A 3U3FA 3HNIA 3AG1C 4XLPF 3M4BA 5JUAA 4I3MA 4JJFA 1TKNA 4YT5A 4OG1A 1G8XA 1MNDA 2HZ8A 4FJWD 3GEIA 5E3AA 5L0JA 4IZBA 1JPJA 3U8VA 3A4LA 3R9TA 2W4BA 3ATPA 3IHUA 4PR9A 2ETSA 1Y6DA 1D0YA 4U5FE 4AL0A 2KC3A 1SZIA 3EFOB 3GWNA 1SR2A 3DAFA 5L0CA 4YT8A 1UG7A 4K0DA 2Q4FA 4EMLA 3AM1A 4G7HF 1HMOA 1MMGA 4NEKA 2L6GA 2LSEA 4OIOF 1LPEA 3R9SA 2ZPAA 2DI3A 1PD0A 3QVZA 3NMIA 5EK0A 1EA8A 2WL8A 2G62A 4K3WA 5CIVA 3MBGA 2JPUA 1YZAA 4ULVA 3Q1TA 3IQTA 3IQCA 1CPQA 4I52A 3C8GB 4ULWA 2Q9CA 4AX2A 3IQ6A 3MYIA 1Z6AA 2HSQA 1OQCA 4BEMJ 1D1AA 1FMVA 2J9UA 3BRJA 4L6RA 5L0GA 3S84A 3HRXA 2D4UA 3KYJA 1TWGA 3LS0A 5HV9A 4AL1A 1OCOC 2WVNA 1M6TA 4Q7CA 5D92A 4J32B 2WZLA 2IOQA 3SXMA 3G4XA 5EHHA 2P6VA 1B68A 2R03A 3CSKA 3IQ5A 2EIMC 4NY3A 1CGME 4BJTA 4A2NB 2J8WA 4UDVA 3ABMC 3HKKA 4JWVA 1ZHWA 5D91A 3ADBA 3K6BA 2HV6A 2EPLX 2EIKC 3VRCA 3LUTB 4NTFA 3DAGA 2GFHA 5TJ5E 4YJWA 2PF4E 2OJED 3FAJA 2PBPA 4YL3A 4BJ5A 1D0ZA 4HFFB 3LESA 3WODF 2LK4A 4Z9HA 4CS9C 3EQLF 2F22A 4LLEA 5JBWA 1CGOA 2VREA 1WZ8A 1ZW2A 3W8HB 3G4ZA 4LDKA 4N6HA 3DXJF 3AQBA 2WB7A 1M56C 3ITFA 4CS8A 4OIPF 1VLTA 2L6FA 1JR8A 1WASA 2BL2A 4G78A 2X0CA 4J7TA 4CX9A 1HZDA 1E86A 1YYXA 2PX0A 1V74B 1YVIA 2C03A 2AWCA 3EH1A 3HNJA 4JW1A 4JEAA 4U5GA 4DJ9A 4DBRA 3M1CB 1NBBA 4EIYA 1RJMA 1C02A 3KQFA 2YL1A 3AGTA 4W8KA 4AE4A 5JBXA 4JYLA 4XLNF 5A69A 2V3CC 3FOPA 4Q4ZF 3A9CA 5JS5A 1AVOB 3B0UX 2QQ3A 3HJCA 4O6MA 3T6JA 5B3IA 1VTMP 2OEVA 4JURI 3U8PA 4JVSA 5GPGB 4U19A 1XZQA 4JCSA
chains in the Genus database with same CATH topology
3C8GB 1WOLA 2LK4A 2PBEA 3GM3A 1UX5A 4GEHB 3ADCA 3U3FA 3A4MA 3GM2A 3O10A 3RQGA 3W8HB 3U0CA 3C18A 1K40A 3BRJA 3K7DA 1V4AA 3B71A 1O3UA 3JYYA 3ADDA 2L6FA 2Q00A 1KNYA 1Y64B 3A4LA 3GM1A 3JZ0A 2JX0A 1OW8A 3RQEA 4XEFA 4XEVA 3A4NA 1UFBA 1K04A 3W8IB 2L6HA 1JOGA 3L8IA 3IRBA 3C8GD 3L8JA 4NNQA 4EBKA 3S9OA 3MFNA 1RJMA 2KK1A 4NQFA 3C8GA 3RQFA 3O4XE 3AM1A 4R32A 1OW6A 2L6GA 4EBJA 2YWAA 3ADBA 1K05A 5F28E 2HSBA 2P63A 1WTYA 1QVXA 4XEKA 1OW7A 1WWPA 1UX4A 2JPUA 3TULA 1KTMA 1ZZPA 1PV3A 3AJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  1WOL A;  2LK4 A;  2PBE A;  3GM3 A;  3U3F A;  4GEH B;  3GM2 A;  3O10 A;  3RQG A;  3W8H B;  3U0C A;  3C18 A;  1K40 A;  3BRJ A;  3K7D A;  1V4A A;  3B71 A;  1O3U A;  3JYY A;  2L6F A;  3GM1 A;  2Q00 A;  1KNY A;  3JZ0 A;  2JX0 A;  1OW8 A;  3RQE A;  4XEF A;  4XEV A;  1UFB A;  1K04 A;  3W8I B;  2L6H A;  1JOG A;  3L8I A;  3C8G D;  3L8J A;  4EBK A;  3S9O A;  3MFN A;  2KK1 A;  4NQF A;  3C8G A;  3RQF A;  4R32 A;  1OW6 A;  2L6G A;  4EBJ A;  2YWA A;  1K05 A;  5F28 E;  2HSB A;  1WTY A;  1QVX A;  4XEK A;  1OW7 A;  1WWP A;  2JPU A;  3TUL A;  1KTM A;  1ZZP A;  1PV3 A;  3AJM A; 
#chains in the Genus database with same CATH topology
 1WOL A;  2F6Q A;  3RW0 A;  3NG1 A;  3K1I A;  4OIR F;  2NUP B;  4ZU2 A;  5A6A A;  1JRA A;  2Q9B A;  2J7P A;  3LS1 A;  3N2Z B;  3TQO A;  2KGO A;  1GM5 A;  1RCP A;  4JOT A;  2UZF A;  3B9Q A;  1D1B A;  1NZY B;  3RQE A;  2NUT B;  3UR3 C;  5EGY A;  2HJ3 A;  3IRB A;  3GEE A;  3JSZ A;  5B1A C;  3L8J A;  2W4M A;  1LS1 A;  4MTF A;  4F4B A;  1ZU5 A;  2KK1 A;  4IGG A;  3I47 A;  4JFC A;  1LI5 A;  1ZHT A;  3W8I A;  4P9F A;  3VYW A;  3LJB A;  1M57 C;  2LFF A;  1OCR C;  3H2V A;  2IXO A;  2Y69 C;  1EY3 A;  3S27 A;  4C3D A;  1C17 M;  1ST6 A;  1VYK A;  1WTY A;  4U9E A;  3NYJ A;  3RFY A;  3U9M A;  3RH3 A;  1T5O A;  1YDI A;  1Q0K A;  2XLM A;  1G4W R;  4BEJ A;  3J06 A;  2GWW A;  3LAY A;  3HNL A;  1QZX A;  3KH2 A;  1M2V A;  4G7Z F;  2DUB A;  2BE5 F;  1QQ3 A;  3JYH A;  1VK5 A;  4DRJ B;  3U0C A;  1LM3 B;  1AUE A;  2HV7 A;  4PAC A;  2HW5 A;  3H02 A;  1HE9 A;  2FBM A;  2VC9 A;  4MS2 A;  3GM1 A;  4PK4 A;  3JZ0 A;  1KNY A;  4B6I A;  4MW8 A;  4D4X A;  5L0D A;  5L0H A;  2OEX A;  2ZXR A;  2PNO A;  2EIJ C;  1A7D A;  3AGU A;  1PD1 A;  3RVZ A;  3US6 A;  1Q0G A;  2OG2 A;  1JOG A;  1ORJ A;  3L8I A;  1WGW A;  2GA0 A;  4NNQ A;  4XTK A;  3FXH A;  3T88 A;  4LDR A;  5IY5 C;  4NTA A;  3TOL A;  5AC5 A;  3EGX B;  3Q0G A;  3SXY A;  5F28 E;  4CIP A;  1XZP A;  2IXP A;  4G0H A;  2AVK A;  1QVX A;  5F5H A;  5K0I A;  1EQ1 A;  4Q5S F;  1I4Y A;  1Y4C A;  2XRH A;  5T1D B;  3ZQY A;  2ZXO A;  4YL1 A;  3ZC4 A;  3TUL A;  3PDM P;  1DOV A;  1VLS A;  2R9R B;  3EHN A;  2EJ5 A;  1MQV A;  3K66 A;  1Q0D A;  2KYH A;  3V7O A;  4CDA A;  3EHM A;  1YA9 A;  1H9T A;  2JD3 A;  1QKR A;  2W45 A;  2W9Y A;  3C8Z A;  1Q52 A;  3SWX A;  1Q51 A;  4CDY A;  2A6E F;  2Q3T A;  2WVO A;  2H7V C;  4FZW A;  3M79 A;  5BQH A;  2VX2 A;  3RIP A;  2VH3 A;  3NDB B;  4K7B A;  2J7P D;  3C62 A;  3QTH A;  4XEF A;  3MLG A;  3F47 A;  1EF8 A;  3SYN A;  2TMV P;  4K2N A;  2H7O A;  5JSL A;  4EBK A;  1WN0 A;  1HW1 A;  3C8G A;  4KBL A;  3FVY A;  3UMH A;  4E17 A;  2O9X A;  1Z63 A;  1RJ9 B;  1ORY A;  3CQZ A;  2ASR A;  4FX5 A;  4HEA J;  1BR2 A;  1T01 A;  4J30 B;  3W2V A;  2MYS A;  1MJ3 A;  1R4T A;  1BR4 A;  4CDV A;  3LLK A;  1E2X A;  1WAT A;  1WWP A;  2XS1 A;  2KW3 C;  3L0I A;  4I42 A;  1H9G A;  5KYX B;  1ZZP A;  4JKV A;  3UMI A;  1OKK D;  2VCC A;  3GM3 A;  3CZ6 A;  1TFK B;  3EZI A;  1FFT C;  4N4W A;  1RMV A;  2MHR A;  2Q9A A;  5T3T A;  3WAQ A;  4IRU A;  4FZW C;  2P7V A;  3UMK A;  3E9V A;  1O5H A;  4QIJ A;  1NLX A;  2LP4 A;  1SF8 A;  2Y3G A;  5BQG A;  3B29 A;  3KPH A;  1E85 A;  1BDJ B;  1E83 A;  4CJG A;  4IAO A;  2XLD A;  2EPN A;  3I4U A;  3TOM A;  3KL4 A;  1RJ9 A;  1Z5Z A;  4AK9 A;  3FMS A;  4MVO A;  4N6C A;  4U18 A;  1LS4 A;  3DE8 A;  4I1M A;  3JCU Q;  4O6Y A;  2B0H A;  2A1D D;  1FNT c;  1Q0M A;  4RD9 A;  2NSG A;  2QUP A;  4U9D A;  4PJJ A;  3H2U A;  4RBN A;  3FDQ A;  1VMA A;  1UX4 A;  3IPM O;  4XPY A;  4DVZ A;  3NMJ A;  3SLL A;  2J46 A;  2QTV A;  4XPW A;  1A7E A;  3TD7 A;  3ADC A;  3A4M A;  1SYQ A;  2G3K A;  3T89 A;  4H54 A;  3KKB A;  4JRZ A;  4EUK B;  3W2W A;  3K7D A;  4QDL A;  5KYW A;  1V4A A;  3SP1 A;  2G3V A;  3B71 A;  4MVM A;  4F47 A;  1LE2 A;  2UUH A;  1I4Z A;  3NRH A;  5BUO A;  2IYL D;  2LFD A;  1J8M F;  2Y3B A;  5JLI A;  1H7I A;  4Z9J A;  1F1M A;  1TWH A;  2Y3D A;  3LNR A;  2HMQ A;  4KI2 A;  1FFH A;  5COF A;  1HY5 A;  4CJO A;  3HIN A;  4BG0 A;  3O39 A;  4MOU A;  2A69 F;  4MQ9 F;  2NSF A;  5COG A;  2A68 F;  3O4X E;  4EWC A;  4P9T A;  1FTS A;  1CGN A;  1TR2 A;  2DGJ A;  2LD6 A;  2XM4 A;  4KNW A;  2ZQR A;  5JP7 A;  3U9J A;  4YL0 A;  1OXB A;  1U6H A;  1DCI A;  1AEP A;  2H8A A;  2Y39 A;  2OCC C;  1SMY F;  1OW7 A;  2PFD A;  3JRM O;  2XSE A;  2LCH A;  4JEB A;  1Z23 A;  4JTC B;  2PX3 A;  4RDA A;  2M4E A;  3FOO A;  3QXZ A;  3I5Q A;  3ZIB A;  1IW7 F;  2R7Q A;  3PZK A;  3H65 A;  1OKK A;  1LIH A;  3O10 A;  2D5R B;  3AQC A;  1A0B A;  1YYJ A;  2EPO A;  1ORS C;  2ZD9 A;  2KSF A;  2X51 A;  3JT1 A;  4MTG A;  4XWJ A;  3ZDL A;  1HE1 A;  1EKY A;  1RKC A;  1TQG A;  2J9W A;  2HMZ A;  2JX0 A;  2YQY A;  3M15 A;  5JRA A;  2CNW D;  2XL8 A;  4M63 A;  3ZTM A;  4N06 A;  4OD5 A;  3AG2 C;  3NYL A;  3V5X A;  5DQZ A;  3AG4 C;  1CPR A;  3ZG1 A;  1T9K A;  2RSE B;  4IJJ A;  4DRH B;  5JVE A;  1TWA A;  2VB6 A;  3Q6M A;  3ECS A;  1OR2 A;  3GEH A;  1VB5 A;  3L34 A;  4R32 A;  1MMA A;  3EFO A;  2CDQ A;  2AP3 A;  2OOC A;  3JRT A;  5DQT A;  2IEX A;  3POV A;  4Z9I A;  2XLE A;  4KC9 A;  3TJ6 A;  2QLA A;  4MVR A;  4CSA C;  2XL4 A;  4ANJ A;  4MVZ A;  4U5H A;  5CI8 A;  3F46 A;  1GS9 A;  3NKE A;  4X0R A;  3RSI A;  2PP4 A;  1KTM A;  1PV3 A;  4FES A;  5A6K A;  3Q7L A;  4OD4 A;  2J0X A;  3W4Y A;  5JT4 A;  2CGE A;  4U5E E;  3W8H A;  2OKU A;  4CS8 C;  4DXW A;  2ZQQ A;  4OIQ F;  3JYY A;  3QK8 A;  3LNM B;  1FMW A;  1A41 A;  3OA1 A;  4CS7 A;  2YEV A;  1KU2 A;  1YLM A;  3V5Y A;  4JZA A;  5KYX A;  1QLE C;  2YRF A;  1XWJ A;  3S29 A;  1Z7Q c;  3C8G D;  4MND A;  3S28 A;  4MI2 A;  2YKZ A;  4CS9 A;  4E0I A;  1V54 C;  2WVQ A;  2J9V A;  2YLD A;  4E0H A;  1Q0F A;  1D0X A;  2R25 A;  4U5B E;  3AOU A;  4YN0 B;  1APC A;  5KYN A;  1MNE A;  2R7V A;  2R05 A;  2YWA A;  1D1C A;  4BJ6 A;  1JXZ A;  4JTD B;  3QZC A;  1A7V A;  1E84 A;  5T3W A;  2QNL A;  5KYW B;  3MOY A;  3T9O A;  3KMI A;  1MMD A;  1V55 C;  3VM6 A;  1VYI A;  3Q6N A;  4JIO A;  1J8Y F;  1U0B B;  4OLQ A;  3B0V C;  3S90 A;  2EPM X;  3LLI A;  3M4C A;  4W8P A;  5L3V A;  1OCZ C;  4O6N A;  3DI5 A;  4JCH A;  2NUP A;  4FAP B;  1ZHY A;  2Q00 A;  1Y64 B;  3DE9 A;  4NCQ A;  4PJM A;  3GOD A;  3MYB A;  2FW2 A;  4C3E A;  3O55 A;  3QVY A;  1C03 A;  4IAR A;  3ABK C;  1EF9 A;  2CNW A;  1O87 A;  2FFH A;  5DS5 A;  1TFO B;  3MFN A;  4YT4 A;  3HLZ A;  1S7Z A;  5HSW A;  4QI2 A;  2FAP B;  5L0I A;  1DOW A;  3RKO F;  1NG1 A;  1YA7 O;  3GOR A;  1BZ4 A;  1R5I D;  3WHN A;  4XEK A;  2R7T A;  2YL3 A;  4KNV A;  2OU6 A;  2R7X A;  5KYU A;  1ZHX A;  1RKE A;  3EG9 B;  3QMK A;  3K33 A;  4JCZ A;  5DVW A;  3SNH A;  1RXQ A;  3MX3 A;  4WJ0 A;  3T6G B;  4GEH B;  2P1A A;  3FDU A;  3O6X A;  4JE9 A;  1UIY A;  1NZY A;  1LVK A;  3OC7 A;  1K40 A;  5AGF A;  3VF0 A;  1ZYR F;  1G4U S;  5B1B C;  5KYY A;  1IZM A;  2MWQ A;  4GEH A;  3TJ5 A;  2XXA B;  4WGZ A;  2I8B A;  2LIG A;  2YLI A;  2J9B A;  2YZS A;  3X2Q C;  5DLJ A;  4QII A;  3DM9 B;  3W8I B;  2L6H A;  4MVS A;  1RJN A;  2PPY A;  2VAS A;  3ABL C;  2AU5 A;  1T6Q A;  4BJ1 A;  4OIN F;  1TWC A;  2A0U A;  4XPX A;  3SXK A;  3G64 A;  2XXA A;  2EIL C;  3IEE A;  4IAQ A;  2DB4 A;  2I15 A;  1JPN A;  4I44 A;  4D4N A;  1L3P A;  2CW0 F;  3N0T A;  1U89 A;  1K05 A;  2HKV A;  2L81 A;  2XLW A;  3EGX A;  3L1M A;  4LLC A;  4CBE A;  3DWW A;  4YWQ A;  5DS4 A;  5L3Q A;  2GDC A;  1GQA A;  1M2V B;  2Y3H A;  4DBQ A;  4G7O F;  1RKE B;  2YHS A;  4HE8 D;  2L7A A;  4GYT A;  1M2O A;  2HJM A;  4YK5 A;  1LI7 A;  2IBF A;  1PCX A;  1ZHZ A;  2Q7R A;  1QPU A;  1JAF A;  2YL7 A;  3DJN B;  3T6B A;  1LE4 A;  4I1O B;  3MYF A;  3EH2 A;  3EGD A;  3UGO A;  3QW1 A;  3NMK A;  2H7B A;  4PJL A;  3JSE O;  1ZVZ A;  2YL0 A;  2A0B A;  4FWV A;  5FCL A;  1BR1 A;  3EGD B;  3H81 A;  1T6U A;  2YVK A;  3RVY A;  1NFN A;  1K04 A;  2A6H F;  3DMD A;  4LDQ A;  4PJN A;  3BEH A;  5C9G A;  2R7O A;  3CEX A;  3FHD A;  3NYM A;  4WAB A;  3ZTZ A;  2XLV A;  3ZWI A;  3RQF A;  3DZA A;  4DVY P;  1OW6 A;  4HFK B;  3U2L A;  2XLH A;  1NU7 D;  4EBJ A;  4CSA A;  3A11 A;  3RF3 A;  2V26 A;  4MTO A;  4I4Z A;  3TRR A;  2P63 A;  3N24 A;  3OEO A;  3R2P A;  3R7C A;  4NTB A;  1FR0 A;  2HUJ A;  2DYS C;  5A6B D;  2QE9 A;  1YZC A;  3U2M A;  4ZLD A;  4EBB A;  1NSG B;  4P6I C;  3SXZ A;  2IXN A;  2PBE A;  2XS8 A;  1OXK A;  2XL6 A;  3T4R A;  4E7S A;  3Q0J A;  4H4K C;  3C7J A;  4BJ5 C;  1HMD A;  2R7S A;  3U5S A;  2UUI A;  2DYR C;  2EIN C;  2IM8 A;  2YLG A;  3HTK C;  3JTL O;  3K1H A;  1O3U A;  2CCY A;  5E2Q A;  3WG7 C;  1NU9 C;  1Z3I X;  3ASN C;  4A4A A;  2VCA A;  1VOM A;  5FZT A;  1LKX A;  4IZD A;  3LEV A;  4LER A;  1UFB A;  4XEV A;  3P5M A;  5KJP A;  4DOZ A;  3PHF 2;  2L9J A;  2Z15 A;  4U1A A;  2WZF A;  5E3C A;  3S9O A;  3V5Z A;  5DS6 A;  3AG3 C;  3EG9 A;  2OQM A;  4ELW A;  3TK0 A;  4EKW A;  256B A;  2BC5 A;  2NG1 A;  3PMR A;  3UNG C;  1YAR O;  4MVQ A;  2HSB A;  1L7C A;  4KNP A;  1EI7 A;  4O79 A;  2XLO A;  3EZH A;  2R02 A;  4U5C E;  2NPU A;  3DKA A;  3T8A A;  3VAY A;  4K1O A;  4ER9 A;  5KYY B;  2ZXW C;  3ASO C;  1OR3 A;  3C18 A;  4LAC B;  5COM A;  4IB4 A;  4IZC A;  3ZQV A;  2NUT A;  1UX5 A;  1JMW A;  2B0J A;  4MVU A;  2J45 A;  2KQ9 A;  3GAN A;  3GM2 A;  3SZR A;  4AE4 B;  1N1C A;  4O7G A;  4BPM A;  4DRI B;  2HFI A;  5B3S C;  4PFO A;  5AC4 A;  2R7U A;  4U5D E;  3ADD A;  2E87 A;  4JJG A;  4GQH A;  3X1O A;  5BQI A;  1ZW3 A;  2J0W A;  1OW8 A;  2R7W A;  2QY9 A;  2ZXP A;  4EHP A;  1DUB A;  3CAX A;  4QI0 A;  5E33 A;  1GGQ A;  3EPV A;  2VCB A;  1I5N A;  3FAP B;  1S05 A;  1MMN A;  2XM0 A;  2HS5 A;  4BJ6 C;  1YJG A;  2WZG A;  5L0F A;  3NKD A;  4WGY A;  5F5F A;  3E70 C;  2KNH A;  2OJQ A;  3DM5 A;  4E18 A;  3DJU B;  3C63 A;  2KJG A;  3RYL A;  3B0P A;  1HW2 A;  3Q7G A;  4WCZ A;  4JTA B;  2LQG A;  3AJM A;  4C3B A;  4E7Z A;  5A6B A;  3UGP A;  4C7O B;  1QSP A;  4PFP A;  1NZE A;  3RQG A;  3I5P A;  3GWL A;  4J7Y A;  4MW3 A;  2EPK X;  3LEO A;  2GTR A;  4ELS A;  2RD9 A;  3ZVR A;  2AWY A;  1OCC C;  3OWT A;  3SEO A;  2R7R A;  1G5Z A;  3TLF A;  3A4N A;  3R0O A;  4ELX A;  2C04 A;  2GAQ A;  1NFO A;  3KYI A;  4XQ1 A;  1YAU O;  3S0X A;  5CI9 A;  3PCV A;  5KYU B;  4NC3 A;  2FGY A;  3DD7 A;  4NQF A;  4ONS A;  4ZLC A;  4CIH A;  3ZSU A;  1T6I A;  2P61 A;  3HNK A;  3QXI A;  2CYD A;  2IXM A;  2M64 A;  4JC7 A;  3EJN A;  3K1I C;  1FAP B;  3G50 A;  3QW0 A;  4IWB A;  5A6J A;  4YT2 A;  2P0N A;  1BBH A;  3U3B A;  1H6G A;  1W2W A;  2ICW G;  4C7O A;  1ZU4 A;  3U3F A;  3HNI A;  3AG1 C;  4XLP F;  3M4B A;  5JUA A;  4I3M A;  4JJF A;  1TKN A;  4YT5 A;  4OG1 A;  1G8X A;  1MND A;  2HZ8 A;  4FJW D;  3GEI A;  5E3A A;  5L0J A;  4IZB A;  1JPJ A;  3U8V A;  3A4L A;  3R9T A;  2W4B A;  3ATP A;  3IHU A;  4PR9 A;  2ETS A;  1Y6D A;  1D0Y A;  4U5F E;  4AL0 A;  2KC3 A;  1SZI A;  3EFO B;  3GWN A;  1SR2 A;  3DAF A;  5L0C A;  4YT8 A;  1UG7 A;  4K0D A;  2Q4F A;  4EML A;  3AM1 A;  4G7H F;  1HMO A;  1MMG A;  4NEK A;  2L6G A;  2LSE A;  4OIO F;  1LPE A;  3R9S A;  2ZPA A;  2DI3 A;  1PD0 A;  3QVZ A;  3NMI A;  5EK0 A;  1EA8 A;  2WL8 A;  2G62 A;  4K3W A;  5CIV A;  3MBG A;  2JPU A;  1YZA A;  4ULV A;  3Q1T A;  3IQT A;  3IQC A;  1CPQ A;  4I52 A;  3C8G B;  4ULW A;  2Q9C A;  4AX2 A;  3IQ6 A;  3MYI A;  1Z6A A;  2HSQ A;  1OQC A;  4BEM J;  1D1A A;  1FMV A;  2J9U A;  3BRJ A;  4L6R A;  5L0G A;  3S84 A;  3HRX A;  2D4U A;  3KYJ A;  1TWG A;  3LS0 A;  5HV9 A;  4AL1 A;  1OCO C;  2WVN A;  1M6T A;  4Q7C A;  5D92 A;  4J32 B;  2WZL A;  2IOQ A;  3SXM A;  3G4X A;  5EHH A;  2P6V A;  1B68 A;  2R03 A;  3CSK A;  3IQ5 A;  2EIM C;  4NY3 A;  1CGM E;  4BJT A;  4A2N B;  2J8W A;  4UDV A;  3ABM C;  3HKK A;  4JWV A;  1ZHW A;  5D91 A;  3ADB A;  3K6B A;  2HV6 A;  2EPL X;  2EIK C;  3VRC A;  3LUT B;  4NTF A;  3DAG A;  2GFH A;  5TJ5 E;  4YJW A;  2PF4 E;  2OJE D;  3FAJ A;  2PBP A;  4YL3 A;  4BJ5 A;  1D0Z A;  4HFF B;  3LES A;  3WOD F;  2LK4 A;  4Z9H A;  4CS9 C;  3EQL F;  2F22 A;  4LLE A;  5JBW A;  1CGO A;  2VRE A;  1WZ8 A;  1ZW2 A;  3W8H B;  3G4Z A;  4LDK A;  4N6H A;  3DXJ F;  3AQB A;  2WB7 A;  1M56 C;  3ITF A;  4CS8 A;  4OIP F;  1VLT A;  2L6F A;  1JR8 A;  1WAS A;  2BL2 A;  4G78 A;  2X0C A;  4J7T A;  4CX9 A;  1HZD A;  1E86 A;  1YYX A;  2PX0 A;  1V74 B;  1YVI A;  2C03 A;  2AWC A;  3EH1 A;  3HNJ A;  4JW1 A;  4JEA A;  4U5G A;  4DJ9 A;  4DBR A;  3M1C B;  1NBB A;  4EIY A;  1RJM A;  1C02 A;  3KQF A;  2YL1 A;  3AGT A;  4W8K A;  4AE4 A;  5JBX A;  4JYL A;  4XLN F;  5A69 A;  2V3C C;  3FOP A;  4Q4Z F;  3A9C A;  5JS5 A;  1AVO B;  3B0U X;  2QQ3 A;  3HJC A;  4O6M A;  3T6J A;  5B3I A;  1VTM P;  2OEV A;  4JUR I;  3U8P A;  4JVS A;  5GPG B;  4U19 A;  1XZQ A;  4JCS A; 
#chains in the Genus database with same CATH homology
 3C8G B;  1WOL A;  2LK4 A;  2PBE A;  3GM3 A;  1UX5 A;  4GEH B;  3ADC A;  3U3F A;  3A4M A;  3GM2 A;  3O10 A;  3RQG A;  3W8H B;  3U0C A;  3C18 A;  1K40 A;  3BRJ A;  3K7D A;  1V4A A;  3B71 A;  1O3U A;  3JYY A;  3ADD A;  2L6F A;  2Q00 A;  1KNY A;  1Y64 B;  3A4L A;  3GM1 A;  3JZ0 A;  2JX0 A;  1OW8 A;  3RQE A;  4XEF A;  4XEV A;  3A4N A;  1UFB A;  1K04 A;  3W8I B;  2L6H A;  1JOG A;  3L8I A;  3IRB A;  3C8G D;  3L8J A;  4NNQ A;  4EBK A;  3S9O A;  3MFN A;  1RJM A;  2KK1 A;  4NQF A;  3C8G A;  3RQF A;  3O4X E;  3AM1 A;  4R32 A;  1OW6 A;  2L6G A;  4EBJ A;  2YWA A;  3ADB A;  1K05 A;  5F28 E;  2HSB A;  2P63 A;  1WTY A;  1QVX A;  4XEK A;  1OW7 A;  1WWP A;  1UX4 A;  2JPU A;  3TUL A;  1KTM A;  1ZZP A;  1PV3 A;  3AJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...