3L8QA

Structure analysis of the type ii cohesin dyad from the adaptor scaa scaffoldin of acetivibrio cellulolyticus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
338
structure length
338
Chain Sequence
MAPTSSIEIVLDKTTASVGEIVTASINIKNITNFSGCQLNMKYDPAVLQPVTSSGVAYTKSTMPGAGTILNSDFNLRQVADNDLEKGILNFSKAYVSLDDYRTAAAPEQTGTVAVVKFKVLKEETSSISFEDTTSVPNAIDGTVLFDWNGDRIQSGYSVIQPAVINLDMTKASYITMGYDKNAAEVGEIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVSEDYGPIVQGVHKISEGILNLSRSYTALEVYRASESPEETGTLAVVGFKVLQKKATTVVFEDSETMPNGITGTTLFNWYGNRIQSGYFVIQPGEINSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Modular Arrangement of a Cellulosomal Scaffoldin Subunit Revealed from the Crystal Structure of a Cohesin Dyad
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein, protein binding
total genus 81
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA01
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA02
1OHZA 2XDHA 2VN6A 3KCPB 5K39A 1AOHA 2O4EA 3L8QA 3GHPA 5LXVA 1QZNA 4FL4C 3BWZA 2B59A 5AOZA 4WI0A 3KCPA 4FL4B 2ZF9A 2CCLA 2W1NA 4IU3A 4UYQA 2BM3A 3F2LA 5G5DA 1ANUA 4IU2A 4UYPA 2VO8A 4N2OA 3UL4A 4WKZB 2OZNA 2JH2A 1TYJA 1ZV9A 3FNKA 4U3SA 2VN5A 4UMSA 1G1KA 2Y3NA 4DH2A
chains in the Genus database with same CATH superfamily
2HMIC 1RUPL 2CO2A 3PP3K 3QULB 5GGTL 5ITFB 4LLUB 4AVHA 2B2XH 2DV6A 2XKSA 1TQCC 1YEDA 3TO4A 5E1HB 2EO7A 5FS5A 4B95C 5FKPB 2QSVA 3UMTA 5FYKE 5AVUB 1AO7E 2ORBH 1X9RA 1E40A 2XBTA 4P4KD 3UGUA 1NFDE 4MDIB 5DWPA 1DJYA 5FA3B 4HKXA 2WWKT 2NY0B 4B27A 3EDJA 4XNUH 4B53A 1AS7A 4NKIH 1FGVL 1YN6A 1TZGL 2UX7A 2VDNB 2J71A 4OCMC 4Z77A 3MRLA 5DU7A 5E23A 3VM7A 5EO9B 1XSKA 2E59A 3L1FA 3HMXH 1WS7A 1CGSL 5IOPA 1TNNA 3Q8CA 1UACL 3B5GA 4AL8L 1HKFA 1OSEA 2A6IB 5I76A 5L88L 1OD9A 4YDVB 2HT3C 1AGFA 4UINL 5J56B 4OQTL 1KLUA 1KN2L 3G08A 4PJ5A 5KYYB 4OT1L 4HJUA 4XB3A 5AEAA 2DQUH 1QPPA 3N1MC 1QABA 4UZGA 1T5WB 3UO1L 1HILB 1FL6B 5IG7B 4CA4A 2Y23A 4M1CC 2AJYH 4FXLA 5IK3A 4AMXA 4E42B 3VRLF 2R1WB 3A22A 4KXZI 2CJTA 3F8UB 4FQ2L 3ZMNA 3L9RB 4GRWB 4G6JH 3HAEB 1WICA 2PO6A 4Q0XL 4FA7B 3BAIA 3D52A 4DP7X 3HG0A 4DZBA 5TQ0L 2ITCB 5F1NA 5IQNA 1DL7L 1GJWA 4U1IB 1ZHBB 5CJQH 4JFDD 3SCMA 2WKLA 1XR8B 1LD9A 2QKIB 3O8XB 4L2YA 5GXBB 1Q0XH 4H1LG 5LBSA 4HPHA 5KUKA 3BQUD 3C6LD 1OKEA 3P9MA 1Q8MA 3ARBC 3EBIA 4OLEA 1VB9A 5AYTA 5EU4A 4OD1L 2Q76B 3EHBC 4HALA 3SPJA 1NCWL 5GZOC 5I18L 4OZIE 2OPCA 3FCGA 1PZ5B 5J12C 3OVUB 1DDHB 1NWOA 1MAMH 1U4EA 2HAZA 3DMMC 2WUCL 4NKMA 1L9NA 2ADGB 3L5JA 4U6TA 4ZQKB 1DVUA 4DW2H 4UDTA 1AJ7L 3FCUB 2ZCKL 3O9WA 4P2RA 4C57C 4ENEC 2W80C 3VXPB 2GEEA 2AXGB 4F24A 4G7SB 3MBWB 3O3AA 4PJEF 1YJDH 4MCZA 1ILUA 5ITBH 1J8SA 5DD1H 4GAGH 1E4XI 4LHUG 5F0LB 4Z7UF 3CUPA 4R2GB 1S7XA 2C9QA 1IGFH 4JY5L 2XG5B 3HW7A 5IVZB 4R4FL 1NMAL 3VD1A 3OKOB 4QGTA 3B56A 3MODL 3PE9A 5H2BA 1E9PB 1KXVC 2IANE 3WY2A 2GVYA 2B4CC 3EW3B 3GFUA 1MG2C 3FTSA 1AZZC 1A4CA 2D03H 4PRIB 5LVEA 2XRAL 3KLSA 3GF8A 5DHXB 3S5LA 2ERJB 4DKTA 1ETB1 3K4AA 3SKNB 3N40P 2H2SC 5CP7A 2IPKB 2CAKA 3JBG7 4F9PC 1OVZA 1QASA 2FB4H 4Z0XB 4PCSA 5DHVA 3UH8A 4XVJH 4L4TE 3SGJC 3NCYS 5CZRA 5DS8B 3UJJH 1G87A 3V4PA 4WFED 3KXFA 1IC7H 3SY6A 1M6OA 4ATTA 5DEZA 2Z91B 3FO0H 3IMTA 4Z7VF 4KKZA 2UZIH 1BECA 3VXMB 1ZSDB 1TYEB 3MLVL 4JE4B 2VLJE 1JK8A 4H25A 1G7JA 4PJ7E 4KXDA 4JFZL 4NP4L 1E0OB 1UUNA 2CJSA 4YXKL 1PS3A 4UTBH 1IM3B 1IU1A 1CLZH 2VSMB 2OCCB 3FB7A 1ZLUK 2D4FA 2D7QA 2ZWNA 4RNRA 5I0XA 4XPGL 3LS4H 2NXYC 3GTVA 4K2UL 3N55A 1CL7H 3KMDA 5J6GB 1WJ3A 3B9KC 4TRPL 4N3UA 3S3BB 4ODXA 2AABH 3TFBA 2V3DA 1V55B 1JGVH 3HTLX 3KPQA 1T4WA 4QRFA 4QHLA 1T03H 3LNGA 4M1DL 2C9RA 4M6AA 1L9OA 2Q6WB 4Z7QE 1RH8A 3CBJB 1FV1B 4ELMA 3D09A 3H9SE 5FO9A 3K2MC 2R4SL 3U9PL 4JDZA 3IDXL 3TIDA 1QTYT 4PJ8A 4ZFFA 4NBZB 1NCIA 3N9GL 4R8WH 4YSRA 3U1SH 5IM7B 2ICEC 5D1QB 4FJZA 4ODTH 1QLFA 3RA7H 5KVFE 2X4NA 3VX0A 5A2BA 3NIDF 1RLBA 3E1F1 3VFWB 4TL4A 1VF5C 4QXUL 4HUUA 4KJQD 4Q58C 4DEUA 1A6TA 3VFSA 1NLBH 2ITDA 5L4MA 2P8LA 5KANI 3V5KA 1CT8A 1D9KB 1IC1A 1SEQH 3DOSA 3OD3A 4PV8B 4K3GA 3ULSA 3SKUD 5KSBF 3ZE0E 5T1JA 1F56A 1PLAA 1OW0A 4L3AA 4R7VA 3P3UA 1DQJA 3VXQA 3VD7A 3LS5H 3QXAA 3WJLC 4MMYB 4R3SB 3FT2B 1JWUA 4O2FA 1U3ZA 3FFCA 1GA2A 4EDWH 25C8H 2IMMA 5I26A 3SSGA 2XPZA 4HIQA 4JJ5A 4LSVL 1Q4NX 2ZKHH 4DGIL 4WWKA 1II4E 2R83A 1FGNH 2JLLA 3ATDA 4OAWA 3TNNA 1XV8A 1FNAA 4DK3A 1JNJA 4N5EC 1T3FA 2ZSVA 1GGIL 3IJYA 3L1OH 4MD4B 4UUJB 1OTUC 2R9HC 2F0CA 5D96C 1H19A 2HJKB 4B0MM 1KCUH 2DLTA 3ZU8A 3L3KA 3CVIL 1F6LL 3QZWA 3ZQ9A 1DCEA 3WUWA 2IBGA 2OK0L 3UCRA 5CKGA 4H0HB 4QUOA 3ZKSD 3D2UD 4IMKA 4LGSB 4LCWA 4XVUD 3S3SA 4O58L 2JKLA 5HHPA 3K6SA 4JFFD 1YEGH 3KPSA 5C71A 3EYFA 2HLFC 1W8OA 3MNZB 1DSYA 5IGXL 3NIFE 3QWRA 4AQ1C 4ZMXA 1HU8A 1XSJA 2X70B 4WI8A 2FT6A 3MHZA 4L8BA 3BRFA 1Q94A 1DBJL 3ARDA 3ZDYB 3MKGA 3QA3A 2H32A 5J1SC 5HGAA 3V4VH 1F1GA 4EZLA 2Q7YA 1CLOH 1EXHA 4NNPL 4UTAH 1WHOA 5DYOA 3LQMA 1ZHKB 2FD6H 2BOCA 4YLQT 2Q3XA 1W0YT 3GTTA 4YSDA 3U4BH 2PYED 1EFXA 3OKEA 5EBLB 3C2AL 1RJLB 2FECI 5F1KC 5I1JL 4KDTA 4Y1AB 3X3GH 4TVPL 4X7TA 4PG9A 3JUYA 2HKAA 2CIKA 4FFYL 3NCFB 4HUWB 1BEYL 1E5CA 2FZ3B 4DCQA 4EPSA 3BEWB 1NFAA 1L0YA 2VABA 4PWGA 5ANMA 5FW7A 1S9XB 1QRNE 1VFBA 5IROD 1HWHB 5E8PA 1UH2A 2DQCH 3E6FB 4GI6A 1W16A 3VWJB 4EXPX 3N44B 3HNTL 3IJHB 4TNWF 3TZVD 2VZ1A 3H6AA 2K4WA 4P5TA 4BWUA 3MRPA 3MRJB 3REVA 5E6IA 2FLMA 3OKDA 1NGWB 4ABUA 4E41E 4XO3A 1BFTA 2DF3A 2C3WA 2WZ6A 1RXLA 2YO3A 2GCYA 3O4OC 1ZHLB 1LEGB 2XQ0A 3UABA 3C12A 5CD3A 1OK0A 5EUKB 4F9LA 3TGXA 3HE7D 2OTWB 1KB5L 1QSEA 1FLRL 2E9IA 4F20A 2P43B 3BH8B 3DVFA 5C2BL 3B3IA 3WL9A 4JLRB 1OLZA 2W95A 4CNIB 1PSKH 3IS1X 3LDBB 4FCHA 4IBUA 3QFDB 2CA3A 1PLCA 3ISRA 1MPAL 2GK0A 2FH6A 2XZCH 1VIWA 3ARQA 4B9YA 2VLRB 1H3WM 2QQQA 4PJGA 1P6FA 3HIZA 4M93C 2EDHA 4G6KH 5I8CB 4ZSOB 1XGZA 2XVBA 2JQAA 4FGMA 4PJDF 3SDDA 2V3FA 1TTGA 3X1EA 2HT4C 4FXGB 1BVKB 2XWRA 2WK2A 1KPVA 4PJ5E 4J6RL 4XE0A 2J8UA 2WZ5A 3F5WA 4JN1L 1G7QB 1EWHA 1HXMB 2DQIL 3NRPA 4XN1A 3KWUA 4Y2DD 4UV7H 3NTCH 4QWWD 1QZNA 4W9FC 3ZKXB 4Y2OB 5KEZA 1TVHA 4HEME 4E2OA 3VYPA 3X3FL 3KWWA 4RCAA 5K59E 1CLYL 1HHHA 4YVUA 4TKWA 4BSVB 2WWOA 2AXFB 4RMVA 2C3VB 4XNXH 2GSGB 5MP6H 3U79A 2VM9A 4KO7A 1XD1A 3F7YB 2H3NA 2BVUA 5IVXB 1Q9WA 2Q1EA 3BGMB 1EGJL 2WNWA 1FL3A 4FC3E 4ZOEA 2G9KA 3BPCA 3SYPA 4AL8C 2YXMA 5C8JA 2IH3B 2WCSA 3QFJD 5I6NA 3RJDA 1JXDA 3X1GA 4KZDH 1GY1A 3P3SA 3HG4A 1BM3H 3TM6A 4KPHL 4YDZA 1GVIA 1CD1B 1EVUA 3QAZB 2HKHH 5FFOA 4LSRL 5HDOA 2X09A 1CPUA 4I87A 5IB5A 2R2EB 2X4PA 4MLSA 5ESQA 4BINA 4ZFOL 2O6CA 3BYYA 1FVEB 4FQIL 3K8LA 2FEJA 1EO7A 1FFNA 1J9TA 4AQAB 3BT2H 2ZSWB 1OWWA 3HPJB 4A7VA 4RQQA 3LVEA 2B4CH 1U8LA 2A6DA 1KJ2H 1U36A 2F5AL 4OFYA 2NY3C 3QNYA 3U9UB 3QNZB 1UM4L 4S1RL 3QFGA 4HX1A 1HQRA 5IB4A 1L9PA 1S46A 4HXBH 3UAFA 5I5MA 4F7CB 3PHAA 4KKQA 3PHQB 1DE4A 1T20A 4J8QA 4HK0B 4JR9L 3G9VA 5C0CB 1ADQA 2HN7A 3VFRB 3EYVB 1WFOA 1XDTT 4XZ4A 1GGYA 1XZ0B 1P9MC 5FLVA 2XACC 1OHQA 3WAKA 2AK1H 3U0PA 4GAFB 2GIYA 2WLMA 2XYBA 3NACL 2QKSA 3GI9H 2CHWA 1OP3K 3QUKA 4RFEA 5GRVL 1L4IA 5AG8A 2EEXA 2Z9TA 1IFHL 4NFBA 4HJIA 1DBBL 4O00A 5F96H 4ZD3L 4BH7A 1LK3L 3QORB 5HDRA 4LKXA 4PP1D 3KXFE 4TS6A 2VXTL 2WMPB 3EH1A 4XR8C 4XP4L 4N2MA 5B3JF 3UYRL 3W37A 3JTBA 5AVVB 2NNRA 5CEZH 2NX5D 4QHMA 5DJ2B 2QGBA 3ZT5A 3X13A 2YMOA 3CFDA 1U93A 2ED6A 1DJIA 4FMVA 1Z5YD 1YZZA 4UZUA 4NGHL 3RPIB 3PHOA 4OLYL 3ZR6A 1I8UA 3NFNA 3LV3A 4OJYA 4YHOH 3SKOB 2W0KA 5C0RL 5CGYC 1BVOA 2ZX9A 2MCAA 1KENL 5KSAC 4EAEA 2VRKA 2HTKC 4FNPA 4HS3B 4IRSD 1F6AA 3WEOA 4FMFA 3NJMA 1XQ4A 3OJVC 4YDLB 1U8NB 3V8OA 3FTGA 3EJZC 1P6WA 5C0DA 1KGXA 1MXGA 2A9BA 5FYLL 5BZDB 5HYJB 2EIZB 4UBDC 1N12A 4U7MA 4F5CE 3ZHLA 2WQ8A 3L3OC 2OCFD 4LLMB 5TK4A 1R3IL 3U2JA 2IDUA 2F1EA 3NVQA 4D94A 2YAHA 3MAWA 1O0VA 2H2PD 3DX6B 5AW8B 5DQJA 2BINA 3VU1A 3HBZA 3KD4A 5CCHE 1DVQA 1LK2A 3IF1A 1G7HB 4ZMTA 1WAAF 5ESVA 4P2RD 1P6AB 1U8HB 2P3YA 4P4RA 2JSFA 2V7NA 3HHMA 4OM0L 5GGRY 3G5YB 3HS0C 2O5YH 3JYCA 2YPLD 4DFHA 1U8PA 1AGCA 3U82B 5LWYL 3OGCA 2OM5A 3GT6A 4YBQC 1SDDB 2FWOA 4AT6B 4S0TD 5HYSB 4NJ9L 1KJVB 2EXWD 2J5LB 4RMTA 5KVGE 2YSTA 4DGYL 4M6NL 1N0XL 1KG0A 3WBDA 2DTML 3D87B 4KK6C 4WKZB 5DFAA 1CXKA 1P84K 5E9DA 2V8MA 3GSOB 2QSTA 4IGBB 5FECB 1XH1A 4IHBA 4X5QA 1T1YB 3CN4A 4E5XG 1QHQA 4HUVB 4AEHH 1ZA6B 4FYQA 1LQSR 1QR4A 2NDFA 2PW1B 4GRMB 5DZ9A 1CGVA 5ID1B 1MFDL 2V2XA 2DD8L 4G9FB 3RKDC 5KVMC 3RWIB 3FFCE 4A2GA 2QADB 5KSVB 5BV7L 5F7EL 1SJHA 1YMMA 1NCHA 1H5BB 4P3DB 1N4XL 2B1HH 5DFWH 1ZGLA 4OU3A 4L1BA 3UJTH 4HJ1A 3W3BA 3CDFA 3IGUA 2J8HA 2XN9D 3ATBA 1CD8A 2ED9A 1MFAH 2GHWB 2R56L 2F53A 3QIUA 4MAUH 4ZAKC 2JKTM 5ABAA 5IEHB 3ULUD 2Y25A 4C4BA 1X5MA 4WI2A 5HJBA 2O4EA 3NEEA 4P57B 4OLWL 4X9YA 2NY1C 2N01B 3JWDL 3T5WA 1CIDA 1BX2B 3NEOA 4F2MA 2OJEB 4LEXL 1WFUA 1T80A 4I9XA 3VDBA 1H15A 4Q9BA 2IQAA 5FW8A 1UZGA 5D2NC 4I2XE 1C5BH 5MEQB 4JZOA 1YMHA 2OXGB 4XVTH 2J2ZB 4QY8A 5FF6A 5KBLA 3F84A 1BBJB 1T04A 1UH4A 2GUYA 2NW3B 3P4OA 3MBEC 3UTTD 1IZKA 3C8KB 3NZ8A 5FUCE 4I1PA 4GY4A 1PY9A 3H4FA 3M8OH 4EI5C 3T4AC 5F3BA 1MKFA 2OQJA 3JZ7A 4TULH 2CHNA 4JUSA 4DVRH 3RY6A 4JY4A 5D6DA 2GFBB 2PYFA 4DPCX 2R0WH 5KJRH 1B4JL 3G5ZA 1C12A 1KFAH 3OKLB 2K6ZA 4PJEB 1MCJA 4YZFE 4OZFH 5DRZB 5ECJE 1QBBA 1D7DA 1RUML 2RR3A 2HT2D 4G8EA 4ZX5A 4Z7UB 3S5ZA 2CU9A 2PWHA 3NCXA 1VLXA 5GGVL 3MV9B 3N85H 5BPPA 1DQDL 3PAZA 1Z7JA 2JTDA 4GQ9H 2ICWI 2WN2A 3BP6A 5PAZA 1UVQA 1I7RB 3AY4C 4MJ5B 4ACTA 1KNOA 4PJIF 5CWSA 3D34A 1EHAA 4Y0GA 4H7VA 3U1QA 4M6OL 3GRGA 4ZQTA 1NC4A 1A5FH 3BWAB 4EF3A 3PGDA 4IKIA 1FWXA 1I9EA 5EZLA 4WSKA 4CILA 3PABB 4HJ0D 1WVZA 1T2QH 4QYAA 3O3DB 5CJ8A 4Z8FL 2CBOA 4NN5B 3DUSA 1J11A 3ARED 4PJ9D 1SJEB 1K5NA 4YXLH 4Z78B 4ZFGH 5K9JL 3BI9X 3GS7A 1NDGB 3L4CA 3B5TA 3D25B 4PBWD 2PWGA 4NDMA 2P47B 3LKOB 4U3XA 4Z7VB 1C9SA 1TZ8A 4XGZB 3V6ZA 3QJOA 4XBGA 4PS8A 2YKKA 5EC1A 3WY1A 2WCGA 3IDYC 4HZAA 2GJ6E 4WZ9A 3KCWA 1RUPH 5H37H 4JS7A 5GGTH 4GKNA 1HDMA 4LESA 2WO2B 5G5DA 3QRBA 2EVGA 2PKDA 5BVJB 4PRHD 3IFPA 3FU7A 4FDWA 5ICZB 1CF8L 1FI8C 1I85A 2ROXA 2WLHA 2WZPD 2K6YA 3DO4A 1I1YB 1A2YA 4JZNA 3WTYA 5FWQA 4XN7A 1BZQK 1PVHA 3L4WA 2E86A 2RIKA 2J6EA 3I6GB 4NWTL 3PGCB 1USQA 1FGVH 1TZGH 4X6CA 4HHAB 2MJWA 4L9LB 5FYJH 4Z0BL 4RGNE 1E7UA 3OZ9L 3VXUA 3ARGD 4M7LH 1NGZB 4MGXA 1R3JB 1W91A 5EFIA 1WWWX 4IHOA 2Q8AL 3VNYA 4NUGH 3GZOA 3TNMB 1CGSH 5AYUL 4MNQB 3QJUB 3CLWA 1UACH 1QP1A 1EK3A 4AL8H 5IHHA 5L88H 1EFXD 3MJ9L 3MACL 3SN6N 2MQ3A 4UINH 3FUMA 4OQTH 1KN2H 4OT1H 1NCTA 3QI9A 2YAMA 3JV0A 4FYSA 5GHWL 5AAPA 5E4OA 3NIDB 1HEZA 3MJGX 3N42F 3UO1H 5C08D 4PW3A 1X9LA 3QQ3B 2SODB 4JFWA 1TQBB 5DD3H 2ESVB 5E00A 1DUZB 5ACMA 1UOLA 4A1RA 3F58H 2HVJB 2YKLL 3PNRB 3PS6A 4FQ2H 2H6PA 3R7RA 3UTSD 1OSZB 4Q0XH 5KSBB 5DHDA 4R7LA 4F7MA 5TQ0H 3IDIB 5ANHA 4LVHB 1DL7H 1XCTB 1H3XA 3QQNA 3RL1A 2ZIDA 1BA9A 1OLLA 3RWFB 3MRIA 2CKNA 1G43A 1AHWB 2XVLA 3QQ4A 1IQWL 4N6RB 3KYMB 3LH9A 4PHZA 1WC7B 2YPVA 3S97C 1DVFA 3ZYOA 4FNQA 4OD1H 5DEGA 3QXWA 1ZDQA 5FK9A 3T8MA 3WIHA 1NCWH 2VISA 5DUBA 5C09E 4UT6L 3SBWC 2G5BB 1IARB 2OYPA 4KO6A 3T0EB 3LXAA 4A66A 4KKLC 2WCPA 1MH5B 3BPNC 2FO1A 5DO2D 1A4KB 1HH6A 2WLKA 1AJ7H 2QDWA 2EUZA 2XNAA 2AQ3A 2V9UA 1JYNA 4H5SA 4OZ4A 3LNIA 4X9IA 1OZUA 4AJ0A 1A47A 4Y4HD 5C0AD 1LE9A 3QUMB 4FI8A 3SDDD 1B2WL 3WJMB 2WIIA 4KFZC 4LHUD 5A3IC 1NAMH 1QHPA 4POZC 3RTQD 1B3JA 2CO3A 1E2WA 4JY5H 3V0VB 5SV4A 4ANKA 1QI4A 4R4FH 1NMAH 5JORA 1MWAA 1WDAA 2P44B 3GSWB 4M3JA 1WFJA 2EZ0C 2W9LA 4IDJL 4KJYA 2M2DA 3POCA 1BAWA 1PJ9A 5KANG 4MX7B 2XRAH 2CK2A 4G7RB 1M71B 5AZEL 5DDHB 5E1GA 5JIDA 4P0DA 1KTDA 3G6JA 1WT5C 2W07B 4O9HL 5DRNB 4GLRI 1X5KA 2VXQL 3IGAB 3GSNB 4OIFA 2KT6A 4F37F 4Z3JA 1XF5A 4EUPH 5GS1C 2X4QA 3DTUB 2EKJA 2O5NA 1ZS8A 3MLVH 4RBPH 5EF0A 5KVEL 1JF1A 3TVMA 3CFMA 4GRLD 3RI5K 4HC1A 4JFZH 4NP4H 5AOLA 2W0FA 4YXKH 1H3UA 5AOKA 5KS9B 4CBZA 1OGTA 4PD4J 4C59B 3EDEA 4LRNL 4XPGH 4ZFZA 1UH3A 4P04A 4BFNA 1MZYA 1IGML 4TRPH 3ZMRA 4IOFD 2ZUYA 4NWUL 1EJ6A 3FQYA 4OFYD 4CVXA 1ZT7A 1VSCA 3OQ3B 3PNWB 3HE6D 2A77L 4M1DH 4UT7H 2UZPA 1JS4A 2YGQA 3LPWA 5IB3B 1TKWA 1KCLA 3W5NA 4PY8I 4JFEA 7FABL 2R4SH 3RBSA 3U9PH 3KPRD 2LE9A 3IDXH 4ZW6A 1OCCB 1U8CB 2TSAA 3N9GH 5E1AA 1ORQB 4N9GB 5E9DE 2DN7A 4AQ8C 4RMWA 1MLBA 3A4EA 5EEYA 4FXKB 3TBBA 3VMNA 3ZOAA 4HULB 1WWBX 3BN9C 3K2IA 3QNFA 3OPZL 4QXUH 4RDQG 1I8MA 2AXJA 3F01A 5DQ9B 4GINA 2AMGA 4K73A 1G84A 4BDVA 4ADIA 4TLUA 4K3JL 2KDGA 2Y1YA 5SWZA 3VXRE 5L2JB 4PMFA 3ULVF 3F7RA 3QDMB 3LIZA 1P2CB 3DRQA 4JM2F 5E2JA 2CUIA 3RU8L 3IE4A 3MV7E 2NW2A 1RPUA 3MRDB 2H5UA 3ZE2E 3RRQA 5D70L 4MXVF 2NT1A 4ZW7A 4N2LA 4JDVA 2ADJB 5D7JA 3RY5A 1PNCA 4LIQE 1I8KB 4WI0A 1N26A 2VRAA 5E24E 1UFUA 2FQGA 4HEPG 1EO5A 4LSVH 2JV6A 4LVOB 4DGIH 4UQBA 2WW8A 3K3QA 5HVHC 4F57L 4F2ME 2EUXA 2BVPB 4PU2A 5IMLB 1GGIH 2YEZA 1A9EA 4GUPB 3LPFA 4NZJA 3AWGA 1J0KA 3RUGA 5IKCB 5IEKA 1F86A 3CVIH 3QDGB 3RWGB 5BV7C 3QZNA 3TPUB 1ESOA 1TITA 4N8VG 4BGDA 2OK0H 2EYRB 5C0BB 1U3NA 3EOBB 2D7NA 1A7QL 3MJ6A 2XYCA 1U33A 1JNNL 5IB1A 4AZUA 2C9AA 4O58H 1MVUA 3TX4A 1XTLA 2GITB 1IFGA 1F02I 1P69B 3KZ8A 1OTSD 3LY6A 1OAKL 4NQCA 5IGXH 4H8UA 1LEIB 3JWDC 3RGVA 1CICA 5CHNB 2E6JA 1DBJH 4GXFA 5JIHA 2HRHA 2PW2A 4NQXA 5JHDD 3GHPA 3ME0A 2EDLA 4NNPH 3GI8L 1NLDL 1NBYA 2Z7WA 4C56D 3Q8BA 1FG2A 4HIEB 4YX2L 2VMEA 3WHXB 4L8SC 2BP0B 3KWXA 4NHCH 4JGNA 3KPTA 4U6VL 5I1JH 3C2AH 4HGWB 2QVFB 5DLLA 5D7LB 1QO3A 4R2GC 1A1OA 5FOBB 2Z8WC 3F7LA 4TVPH 1YMMD 1JPGA 4FFYH 1BEYH 3AMKA 1AR1D 1A9BA 3CQFA 2PXYC 1G5AA 2OSXA 1IFRA 4PB9L 2IAMB 4GG8A 1T21A 2FIRT 2WBKA 4PMEA 3IRPX 4ONGL 2ERJC 3HNTH 3OR6A 4LCUB 4NRZB 1F6FB 1UENA 2XPGA 3U4EA 4NERA 2VR5A 1MNNA 4HMDA 4WO4B 2CPUA 3KDMB 2PMZA 4P2QA 1C08B 4HCRA 4XPBL 4HIJB 4FEMA 5L4IA 1EANA 4B5ZA 3L16A 1WZKA 4IRJA 1HYSC 4C83A 3HG1D 3ZDZE 3GDBA 5EU7E 3QJVB 4AX3A 2WKGA 1H8LA 3MGTA 3E7JA 1YAIA 5HHNA 3CC5B 1ND0A 2CRZA 3IPFA 1I1FA 4JJOA 4YPJA 3L3HA 4PCYA 3MNDA 5I1EL 2WB1A 3V7MA 1KB5H 5GS2D 1FLRH 5C2BH 3VFPA 2HG0A 2NT0A 4LP4A 1YRKA 4ZW5A 2AVFA 4WFFE 5TE4L 4LLQB 2Q5BA 3UBHA 1MPAH 4FNSA 5DQDL 1C16A 3HZYA 2VSKB 3KVPA 1LP9E 2R1YA 3VXUE 3UGXA 5I6XC 2M83A 1QI3A 2XTJD 5SWQB 1TQTA 3K72B 3GXNA 4V1DA 2QR0A 5E5RB 3WS3B 3APFA 4UOQA 3ERXA 4LL1A 4EDXA 2MNWA 1HEJC 3D69B 2VLKB 4AIOA 3LNFA 3QPKA 3KBFA 2GUOB 1E7VA 4IBYA 2AP2A 3QULA 4J6RH 4QHKI 2DQTL 1PZBA 4LLUA 1J48A 3ULAB 4WW1A 2DQIH 4A2MA 3CZJA 4PJFE 1HZHL 3ZO9A 2IFGA 1U8IB 1DJGA 3BP5B 2X4UB 4R6UA 3V0DA 4DTGL 3X3FH 2BIPA 3N50A 1CLYH 4LK4A 1PD6A 4YO0B 5FA3A 5IY5B 4JHBA 2OMYA 1DJWA 4WLCA 3VXSB 3M17A 2F74A 3HHRB 3JV6B 2NNCA 1EGJH 4YL9A 2NYYD 3HBPA 4OFIA 4WEUD 4L3FA 1E5ZA 4X4XA 2FNBA 3S5LG 4GSUA 4FNRA 3OLDA 4Y5VB 2CLVB 3SPHA 1J1OL 1M4KA 1E43A 1RIUL 2A6IA 1RULL 2OFQA 4KHTL 4KPHH 4Y9FA 4F7TB 5C2UB 5DJYB 5C0IB 4LSRH 3EYSL 3JQOB 3P1VA 4QXVA 4X7EC 2X05A 1BEXA 3IYLW 2CALA 2AV1A 3AB0B 3HCVB 4ES8A 1T5WA 3E8VA 3DBSA 2E9WA 4LLVA 4TQ8A 1L0XA 1KC5L 3AVEA 3GQFA 2Z3FA 4OR1A 5F9WB 1MY5A 2X6UA 1UM4H 4S1RH 1E8XA 3E8UL 1MNUL 1FRGL 3L9RA 4X4YB 2WTRB 3SE4C 3S6CA 1GGCL 2OI9B 4JR9H 2R29L 4KK5C 3LPOA 3SDCA 1P7KB 1ZHBA 5EU5A 1WQVT 1HHKB 1X5YA 1D3CA 2QKIA 4J2QA 1BZ9B 4I77L 4QXGL 3HMXA 4LLYB 4NO2B 4XXDB 1KTBA 3UAJC 3NACH 3FN0L 4QRQB 3RWJB 2Q76A 1V7NL 3AABA 4I0PA 3QH3B 5EPMB 3I75A 3MRBB 4K4KA 4OCYL 1RPQA 4LSUL 5LAPA 1LO0L 1WPCA 2OXHB 1A7PL 1DBBH 4P59L 5F3FA 3TJHD 4ZD3H 4NQVB 2ADFL 1LK3H 3LSOB 1QEXA 4Z6AT 1ZAGA 1CFNA 3DIDA 5JXEA 3AJ7A 2VXTH 2Y6SC 3HMWL 3VXPA 4XP4H 3UYRH 1F58H 5EZIL 3D30A 3UZQA 1ONQA 3VFUB 1DJHA 1FG9C 1B4RA 1A7NL 2A4CA 5JHMA 5MENA 1UGNA 4S1DD 4NGHH 4DT2A 2EILB 1WBYB 4L9DA 3QEUB 4OLYH 2Z31A 5F8QC 1V3MA 5IVZA 5LGJA 1DVZA 5C0RH 3OKOA 3U7AA 5DHYB 1KENH 1E9PA 2YA1A 4XNZC 2MCG1 1R5VA 3HNVL 4PRIA 4O2EB 3WTTA 1OPGL 5CMAB 4AYBA 1LQBC 2KLRA 4WUUA 1DVFD 3QPQC 5FYLH 3SKNA 4L4VB 4BSJA 4DK5A 2BZ7A 2GSIB 3GSXB 4ISVB 2DM7A 3BD3A 1R3IH 4IOSA 1XGQA 4EZKA 3GRWL 4JN2B 4PS7A 4G7YL 4HIIA 5CGBA 3T3PF 2NXZB 2ZOKA 3BW9B 1CJYA 5CF3A 2XBZA 5DS8A 3D3VD 3ZRSA 3QHFL 3QUXD 1AMYA 2WQRA 3QIBD 3CN3A 2IG2L 4APQB 4F2EA 4GSQA 1JTTA 3MGOB 1UXMA 4F1SA 4OM0H 2DWTA 2ZXAA 4KI5C 3VXMA 1HSAB 1ZSDA 2CPCA 4L3EA 2YQGA 1ZJBA 2L4OA 1MJUL 3DX4A 4PGCB 1GGUA 1IMHC 3WFCL 1FLTX 5GRZA 4XAWL 3S96B 1ZV2A 2VJ8A 4R9HA 3ARWA 1AIFB 4YSOA 1ZV9A 4NJ9H 2VYRE 5FA4A 1VGEL 2FR4A 5F97E 4DGYH 3M86A 1N0XH 1UGKA 3QZWG 4M6NH 4V33A 3WUWG 1EAQA 1HESA 3KGRA 2BW4A 2DTMH 4N2EA 4PQXA 2OULB 3CZFB 5SWZE 3F7KA 4JBSA 2VIRA 4MTMA 3IJ9A 4U7KA 3FQXB 3SPGA 1B9KA 2X42A 1GJUA 3WXVL 1X7QA 1T6VN 3S36L 2FJGA 4PD4K 3DUHA 2QPDB 1UJTA 2F8OA 1C5DA 1MFDH 2Q6WA 1KY7A 2DD8H 1QD0A 2YEVB 1P5UC 4JGMA 4YHYB 1FL5A 2OSLA 5DTFA 5BV7H 5F7EH 4X6DF 5C86A 1N4XH 4PLKC 4GRWH 1XEUA 4DUVA 3HAEH 4J3BA 3R1GL 4UOJA 2H1XA 2HFFB 4DOHE 3VMPA 3ZKMC 4Z7OF 4QF1A 2R56H 4RAHA 4FG6C 4MXQD 3CCHA 1CBJA 1T7VA 3O6FC 1MVYA 5F1SA 3FB5A 4MD0B 2AANA 3WI9A 5EBMB 4OLWH 4WWID 4EN2A 3JWDH 5DMGC 1D9KA 1JWSA 3FHAA 4ZOBA 3W9DB 1AGBB 1SJXA 4L5FE 5CLWA 4JMNA 3X14A 1JTOA 4NPYA 4LEXH 3KLQA 4BCYA 3PYCA 4I85A 2AAAA 1G1CA 1DLFL 3MOAL 2BNQA 3QPXL 4NQCE 1FYTB 1W0WB 1BDYA 2VDKL 3KG5A 4MAYB 5IBLC 1S7TB 3FT2A 1MHHB 4JFED 2DQ6A 2YD4A 4F3FB 1SVBA 3UAAA 1CGUA 4FYRA 1HHJB 4OZIF 3UADA 1JJUA 4IEFB 4L3CB 1GHFL 1P7QB 2DL2A 2XXCB 3S35X 1S78D 2APVA 3ALXA 4MD4A 1XF1A 3SE6A 4GB9A 1ZSHA 3SE9L 4HPYL 1B4JH 1H9VA 3AQYA 1NKGA 2H0FA 2X1OA 4YHLL 3B2XA 2B9AA 5ES4B 4NQTA 3NESA 3X1NA 2FJFB 4G80B 5JMRA 4FLQA 4OD2B 1RUMH 1FAIL 2WKOA 4UCFA 2ATKB 4N1EA 5I19H 2IDFA 3ZHFA 5GGVH 1D5ZB 2Y7QA 1VKXA 1OGPA 2BNRE 4U1HB 5J1TC 3RIAF 1DQDH 2NOYA 3OAUL 4XOCA 4XMUA 3GSQB 5BXFB 3T71A 1AO7D 4OSUL 2X38A 4HWEL 2X70A 2KDYA 2FX8L 3VXOB 4HS6A 3BH4A 4MS8C 4A7GF 2RQEA 4Q4EA 1JI1A 4M6OH 3CDGA 1X7SA 2XU9A 2MPVA 2ZXQA 3I6SA 3KJ4C 2UWEA 4G70B 3S48A 1HZKA 4JZJC 3BD5A 4R7DB 1EFQA 2MTAA 1RV6X 1B88A 4Z8FH 1TUPA 2ZKYA 3OSKA 3QDHA 4BKLA 2QQNL 4AYFB 1D5MB 1TDQA 4D0DB 5K9JH 1CZ8L 3EDFA 4YUEL 3HB3B 1C8PA 1RJLA 3WNMA 2L7EA 2DRUA 4P2OB 4FP8L 1OCWL 4GAAA 3GMQA 1IGYA 2ID5A 1P4IL 2FZ3A 2PPCA 2FSEB 1MY7A 3DI3B 3KR3L 3Q43A 3SDXF 5B1KA 4MFHA 1CF8H 4RAVA 4KC3B 4B97A 4R7XA 5DJZB 3VWJA 3E6FA 2DI8A 3T1FB 2KQMA 3IJHA 1MCOL 4M48L 4O02B 1H6UA 2BRRL 3EH2A 2H7WA 3U4AA 1YDPB 5I74B 4NWTH 5E1QA 3S4SB 1G7PA 4ZS6C 2BFVL 4CSTA 1E9QA 4UYPA 1UOWA 4Z7QF 4Z0BH 3OZ9H 1ZHLA 2DWXA 3INUL 2Q8AH 1GZPA 3DRTA 4Z5RB 5AYUH 5CBEB 1BZ7B 3ZTCC 1HN1A 3MJ9H 3MACH 2WGXA 5J6SA 3LD8B 1BW8A 2YUVA 3TU6A 1MCLA 1KTRL 4CNIA 3FFDB 3PP4L 1VZIA 2XWBB 1L9MA 5D4JA 1LLAA 3EJPA 2AEOA 3HOGA 3O3EA 3QFDA 1Q90A 4U1SA 4W9CC 1ASQA 5D1ZB 5C07A 5T3ZE 3CFQA 1HL9A 2A2QT 2JB5L 2CMRL 2YKLH 3WHE1 3L5WB 1T0MB 4ZSOA 1QLEB 5J8OA 1KXQA 1FCGA 4PGEB 3H85A 4N20A 5CILL 4FZEL 3TP4A 4JM2B 3FL7A 3R18A 2XCMC 2JCCF 4FQPA 3EGSA 4ZTEA 3US9A 4IRJD 4EIBA 1SEBB 2XICA 2X5PA 1G7QA 1MCCA 1JYVA 1FO0L 4Y4KB 1HXMA 5DEFB 1SMOA 1IQWH 3OKYA 5GZNA 1PKQA 5I23A 1EAOA 5IQ9B 1XL6A 3LMJL 5GSRB 5LLIC 4MASA 5L7XL 1CDGA 4UT6H 3D6GA 4Y5XC 4GRWE 3CVBA 2C3VA 1S7WA 2VITB 4KY2A 3SKMB 4L4TD 2ATPA 5EOQL 5CZXD 5EORL 5IJVB 1G6RB 1QLRB 4YL4A 2VB5A 5FR3A 2ZXCA 2NSQA 2XA3A 5IVXA 3U30B 3BGMA 1AS8A 3A21A 1BFVL 4MCYB 1IEBB 4KUZL 2IH3A 3WKQA 2EE0A 4NQDB 3IN0A 5I1KL 1ZA3B 1IAIM 4NO0D 1ROCA 4JQVC 4OZFG 1B2WH 1OT2A 1V10A 4JHZA 1M1SA 1IGIL 3F2LA 4Z7WF 3CSYB 4HH9B 5DHMC 1NTDA 3RP1A 3TTSA 2GABA 4XB8A 3FSVA 3TH2T 3KLHC 3OSVA 3ARVA 3C60C 3KL5A 1FVEA 5HPOA 2ZWYA 6PAZA 3SQOL 1AXSB 4KWUA 2ZSWA 4TLKA 2Z8VC 4JFSA 5AZEH 2DI7A 4ETYA 3V79C 4XMKL 2R69L 3SGDI 2PETA 4U6XB 2JI3A 5EHFA 4PWIA 4WU5A 3B2PA 4O9HH 5GZOA 4P9MH 3BUYB 5AKRA 2NQDA 4JO3L 3UTQB 2NZ1A 2L0DA 3DMMA 4QTHB 4L8CB 2OMTB 5C0CA 3NMEA 4QRRB 4QLRA 2AV7B 2VR3A 3BESR 4N8PA 2Z92B 4HUXB 5HGHB 2WBJD 4PRIE 1OANA 1U8MA 2WLNA 5KVEH 3UTZB 4N2GA 4TQEL 5AW4B 1OIOA 1RZFL 3L2NA 4FQXD 1TPXC 1IKNC 2QGDA 1O7DC 1DLHB 4KRPD 5DK2B 2CDFB 5ENWA 2XWEA 4PGDB 4KTEL 1NPJA 2EADA 3HA0A 4E9VA 1P7BA 4LRNH 5T5NF 3MBXL 1OZTG 3QZLA 3QORA 2K3TA 1U3HB 1IGMH 1A4JB 2WMPA 2KZKA 3GB7B 4PRBB 5AW9B 1IAMA 4HVBA 3MREA 2XJKA 4NWUH 5DJ2A 4Z7NB 3TA3B 3HN3A 5EC2A 3VXME 5INDB 3LXCA 2A77H 1UXWA 5LG6A 1PIGA 5A2FA 1VFAA 3SKOA 3ILPB 3SGJA 5AVYB 7FABH 1ECYA 3MV8D 4HS3A 4ZODA 3WCYA 1AZUA 2WINA 4OKVA 2WYIA 5KSUA 4ZUUA 4PGJA 4BUGA 2W60A 3QARA 2AS5M 3FT3A 5HYJA 4XOAA 4J3XA 5TDPB 2QLYA 4U3CA 1B4LA 4HSQA 4LLMA 1B4TA 2X2UA 1AGDB 3ZZLA 1OB1A 3OPZH 1I31A 1OAZL 3D7PA 4HH8A 5MHSE 5A6LA 4NCDA 3DK2A 4K3JH 1JUFB 1U8HA 2KUTA 5JXED 3VSQA 2CO7A 1NUDA 3WTVA 3TBWA 1AS6A 1PNDA 3OMNB 2IGTA 5C0JA 3RU8H 2C3XA 4L9LC 3Q1EA 2IMNA 5EWIL 4XNQB 2NZ9C 4W4NA 5D1QE 1CE1L 1BQHB 2DQFB 4NC1E 4WFGE 5D70H 1Q9LB 3O4LB 3SDAC 4G1MA 3GMOB 4WV1B 2J57A 1N59A 3S2AA 2F68X 3AWFA 5BUGA 2LTQC 1KJVA 4BFOA 5HYSA 2C7UB 4KAQL 1QUNB 5ISZD 3STZB 2YAFA 2NNAB 3PQYB 3IFNL 1AMXA 3P3TA 1HL8A 3UG4A 4F57H 3MA9H 4Q6IC 1X5IA 1GW0A 3B9VA 4WUUD 5IROC 1XZWA 3BMWA 5C1MB 2C9XA 1M57B 3LN9A 3VD0A 2VL5B 4HUVA 4KTDL 4GRMA 4PTUB 1IQDB 4AXWA 2W9DL 2OX5B 3T09A 1F3DH 3MRHB 4MDJB 2O6FA 3U46A 1IKOP 1WBXB 2ITFA 2BNQE 4E68A 4S0SD 4U1MA 1QYGL 2DEXX 2VKWA 2ISDA 2IH1A 3EYQC 1IUZA 4PR5A 1NJ9B 3RWIA 3OKNA 5LAXA 1JPFA 3CVDA 5D1XD 1H8NA 1A7QH 4LDLB 1HKLL 1H5BA 5SX4I 3LNDA 4ZXBD 1S4IA 1JNNH 3WU1A 3O2DL 1IGJA 1N2RB 1CFSB 3U36A 5D7SL 5F88B 3PDOB 1QFWL 3QXUA 1OAKH 5IEHA 4NT6B 3F7VB 4JFYB 3M7OA 4UDUA 2QPFA 5IBUB 5BVPL 3UZVB 4PJBF 4LARL 3QIWC 3VFNB 3SO5A 4HUCA 5L2KA 4QEGA 1BX2A 3DXAB 2QSCL 4E41D 1BF8A 2BIHA 3BH9B 4GBXD 5C0FB 5IW6B 2GTQA 2X4RB 3GI8H 2MOQA 1IC4L 1NLDH 3DX7A 5FUZL 2DIAA 2WC7A 5DK3A 5LNEA 4GKZA 4D7BA 2LAGB 4LCCB 4YX2H 2VR7A 4P4KB 1UOVA 1AGEA 4U6VH 1XH3A 3QVAA 5K9KA 4HF5L 4F8PA 1JMXA 3IFOA 3WS6A 1BMWA 5DZNA 4UQ2A 1YNKL 5C6TL 4LPVA 3C8KA 4DJMA 1W2KT 2APSA 3ZDYE 4BZYA 5JW5B 1HINL 1QFPA 1MW1A 1NUFA 3L4TA 4QWWC 1IVLA 4Y2DC 2ETWA 4PB9H 3PFQA 5SV3A 3X11A 2DLIA 1AG0A 1E8YA 2IDCA 5EU6D 4Q9QL 2YD2A 2MIZA 3DVNB 2FEEL 4CDGC 2GJZB 5FW6A 4KU1A 2GFBA 3GRBA 4LOFA 1UD3A 3T0DA 3RVUD 4XMWA 4IJTA 1JGUL 1KBPA 4K5PA 4MWFA 3P30L 1G1KA 1J7VR 1E5AA 4PV9A 4XPBH 4Y1AE 4AENB 1WFNA 3L4ZA 1ZANL 5AW6B 3F65A 4CSPA 3LZPA 1OM3L 5E8DL 9PCYA 3B34A 1TZHA 4V2CB 4R26L 1K8IB 3KYKL 1NGXA 2AAVA 4PM1A 4URTB 1T1WB 1URZA 1R17A 3MUGB 4ELKB 2J44A 3D4YA 4Y4FD 1T7YA 5I1EH 3MUY1 1I7RA 4MJ5A 4CL7A 4FTVD 3D4CA 1HNGA 3RDTC 5JXAL 1F4WL 4AW7A 2G5RA 3OR7B 4P06A 5TE4H 4K07A 5AVZB 3PFUA 3BWAA 1YN7B 1UQSB 3T3PB 1DVXA 3WHE0 5DQDH 3PABA 3VGAB 5KZCD 2C9SA 4G3YL 3NA4A 3GUTB 4ELMF 3BQUB 4KJWD 1EV2E 3C6LB 1SJEA 2XV6B 5DI8B 1UWXK 5AW3B 5KAQG 5KBNC 5CKAA 2CCLA 2R0ZL 4ADJA 2Y07L 1Z6JT 1IBZA 2AQPA 4PUBL 1GYAA 3OKMA 3ZKNC 2DQTH 3I6LE 2DWDA 4I18A 5GGQL 1TF4A 3EIFA 4RZCA 4N0FA 5BVJA 2ICES 4UOW1 1W8NA 1MCDA 1IAKB 2VLRE 4XTRD 5E6SB 1L6ZA 1T4KA 1FVCB 1WBZB 4JO4L 4ZSOE 1Q1JL 5F0JB 4DTGH 1N8ZA 1OP5H 5FM5O 1KXQE 4HETA 5DD6B 3FSOA 4HJSA 5KYXA 4H0GA 3STLB 3I6GA 4PY7A 3W38A 3L5IA 4LB8A 4EQ2A 2R0KL 3NH7L 2C1OB 3MLRL 1A3RL 1DYZA 3FHQA 4MNHB 1NGZA 4JFPB 2HSIA 3RZCC 1WIUA 2DM4A 4KX9A 4ZJ9A 1EEYA 3W9EB 4MNQA 1K2DB 3BLKA 4X6DB 4RA0C 1TEFA 1J1OH 1RIUH 2OL3L 2NLJB 4X0NA 1RULH 3IT8D 4KHTH 5FAAA 5H37A 1S3RA 5GGTA 5EO0B 5A40E 4JG9A 4K5NA 3EYSH 3S37X 1RKRA 2WANA 1QSZA 4XMLL 4Z7OB 1EXUA 3U7WH 1OGAA 2DQJL 5J89A 5F0PB 3D4ZA 2IH8A 2ZUWA 3OMIB 4JRYB 2JJUA 1WCBA 3QQ3A 5IVXE 2DKSA 3MO1B 4WGVB 4WIQA 4I1RA 2WPGA 4XP9L 3A6BL 5I24A 3NIGF 1MNUH 5D4HA 1OSZA 5M94B 3PPEA 4WI5A 4RMBA 2OMXB 2VDOL 5KN5B 1SOSA 1H3PL 1S9VB 1TIUA 2PN5A 5DJ0B 1GGCH 3D0AA 5KYWA 2R29H 2CO4A 3H2PA 3JXAA 1E42A 5JR1L 5EZPA 2R2CA 3I9PA 1FNEB 1PY0A 4QXGH 4I77H 4X5RA 2CHZA 4Z76A 1UWEL 2YRBA 3MR9A 2V9RA 5F93C 3VWKD 3FN0H 2YMXL 1V7NH 3D5OF 1H8OA 2DL9A 5AB2A 4NNXB 3DOIA 3DETD 2EXWC 1RZGB 2W65A 4JHVA 4OCYH 3T0EA 2OZNA 4LSUH 4MMXB 2HMID 1LO0H 2VZTA 5JPMC 1MH5A 1A7PH 1A4KA 1UATA 3GPSA 2ADFH 1UA6L 1TJGL 5C0CE 2BZDA 4JFTA 5C07D 5EUOB 3SGKC 3HMWH 1XHHA 3QR2A 3FTZA 3J8F7 5EZIH 2PWEA 1UOKA 4HAKA 3NP4A 1WZAA 1A7NH 1XAKA 1DFBL 1UA7A 3KE0A 3WJMA 3Q01A 4AC4A 3OB8A 4BFIA 3O81A 4L1DA 3QT2A 2YIHA 1LO2L 3V0VA 3IBOA 1INEL 2AGJL 2A7BA 2CJUL 2G9HA 2MHAA 2HFGL 3DBXB 1ZIAA 3D50A 2FSDA 2E9GA 4P23C 3HNVH 3MVSA 1G0DA 1OPGH 3OBAA 2I26N 3RFRA 5K1JA 2J73A 2XZZA 4B9GA 4G2AA 4F15B 2ENQA 3GJEB 1TZIB 1OOWA 1M2VA 1Q9KB 4G7YH 4MKTA 1FFPB 3BZEB 2XWDA 3GSNA 2ZF9A 4IS6B 1X4XA 3QHFH 4Y5YC 1GTFA 3LIUA 3BAEL 5EIIG 2IG2H 4Y9CA 4R96B 4JCLA 2FHBA 5C92A 3IGKA 4RH4A 1HXYB 3MJ8B 3WKML 4M1CD 1L6XA 5C3IA 1MJUH 5HYJE 3WFCH 1NAMA 3OXSA 3VCLA 3DI2B 4XAWH 1MSPA 1J0IA 1ASOA 2BX5A 3PL6B 4XPTL 3WG7B 3WFEL 1Y18B 3SDXB 5KS9A 4PJGF 2Z35A 3SZKC 4E0RA 1VGEH 4AEEA 4WFHE 5F70A 3IWVA 4MRCA 3ES6B 1NL0L 3PWUA 1URLA 1EO8H 5KSAA 1CE6A 1L9TA 4PH8A 1OAYL 4MMZC 3JVGC 3TBYA 2N7SA 2Q7AA 2NRDA 3WXVH 1AP2B 3ARBD 2J8UF 2WXOA 3S36H 4Z7QB 1UXLA 3EHBD 3TEYA 1QWNA 4RFOL 2E7BA 3H9SB 3CH8A 2IQ9L 3QXDB 3DMMD 1E5UI 1A3QA 3CN0A 2CGRL 3ZTJG 1U8CA 2JF1A 5F7AA 4ENED 3ULVL 1ORQA 2Y69B 4RFNB 3R1GH 3GJFA 3LH2L 4MJ6B 3HS0A 5ETUA 1R3KB 2WV3A 2Q7NA 5E8OB 4RBPK 1H6TA 3HUJA 1NA8A 2AF2A 2QHRL 1GZHC 4YHKL 2WBWB 1U91A 4K5OA 2FQEA 5DQ9A 3L9BA 3T0VA 2X88A 5L2JA 1KCRL 4WNSA 1BQ5A 4JFUA 1R24A 4DO6A 3QDMA 4A04A 2OLDA 1P2CA 1BP3B 4HCIA 3V95A 2JCCB 3P77B 3VH8A 5IESH 1N8OE 2H2SD 1DLFH 3MOAH 4OCLC 4HK3N 1IZJA 5C0NC 1IKFL 5BOPA 3ZZ1A 3TZVB 3QPXH 3LN4B 3EYOB 2ADJA 2VDKH 3H3PL 1CC3A 1EUTA 2QGEA 1F5WA 1I8KA 3K6NA 1CI3M 1T2XA 4J8RB 3VRLE 3QCVL 4I3RL 3ZHKA 4AGPA 1V3LA 3MLTB 2VZOA 4QRUA 1GHFH 1KDIA 1TLKA 2BVPA 5GGRA 2P5ED 4YHPB 1OOAA 4QJ4B 2AEQL 3QJFB 1S9YA 1U95B 5AVQB 1R4XA 4LEBA 1MCRA 2LLLA 3HE7B 4N1HB 3SE9H 4HPYH 4QCIA 1SFHA 4ZAKA 3RWGA 3VRJB 1ODUA 3IRCA 4ODWB 3TCLB 3DOHA 4YHLH 5EO1B 3TLRA 3I2CL 1MRDL 5BS0B 3EOBA 1D7BA 1FAIH 4LRIA 5T3XE 4G83A 2EUVA 1N0LB 4Z7WB 3B37A 3Q05A 2CE6A 2IEPA 3B8YA 3B9KD 3DJRA 4PRPD 2D2CC 2AJ3A 2GITA 4ZUSA 5IJBC 3C09C 5FM5M 1UWYA 5IB2B 5LBVA 4OSUH 1LEIA 2H8PA 1PZ2A 4HWEH 5MEOB 4LOEA 2FX8H 4XC3L 4CC0A 4KZCA 4RDBA 5ALBL 4K3EL 4PJEE 5FFLA 1F11B 1GSMA 2HPOA 4QRSA 3C5ZB 2LLGA 3CMOL 4Z7UE 3T2LA 2WWMD 4YR6B 3DX0A 5D4QA 2AW2A 4X4MA 2QVKA 1BVLA 1T2JA 1KT2A 4MJID 5GGUB 2OMUA 2QQNH 3MV9E 3KLKA 2BP0A 1CZ8H 2VWEC 3QUYB 3H9YA 3UROR 3MYJA 1Z32X 1XB6A 3ELQA 4YUEH 4WDIA 1Y6MR 3KPMB 4WEBL 4HGWA 5T8IA 4MAZA 5LNDA 5H35B 1E4KA 4FP8H 3TN0B 4UOW0 1QSFA 2G3MA 3CC1A 2OYMA 1OCWH 2GI7A 5JA9A 1P4IH 1T6BX 2ZAGA 2JIXB 3KR3H 1HCZA 1VCAA 6FABL 2IGFL 3FB6A 3FUDA 4QHUA 5B38A 2G4EA 2CLZA 4OTXL 3H9HA 3QFJB 2P4AB 1MCOH 4LPTA 3F12A 3G5VB 2AQQA 3MOQA 4M48H 3WO3B 2BRRH 5DZOA 1S9WA 3TT3L 2E27L 4MVBD 1KLGA 1K72A 4WF7A 1PMYA 4HFWA 1SBSH 4QRPA 4WO4A 3KDMA 4KRLB 4Z7VE 4B3EA 2BFVH 4J5VA 1C08A 2B3IA 4UNVA 4RGOL 3POHA 5A2JH 3BVNB 4KKRA 1CFMA 1O6TA 1YEDB 3TO4B 1MFNA 3L1EA 3DC0A 3WE6B 2Y5TA 3INUH 2UY6A 1R75A 4N5ED 2FYYB 3U25A 1OTUD 2R9HD 4JVUA 3RTQC 1PL3A 4HKXB 3M45A 3EO0A 4A2HA 2AJVL 2LVCA 3DWTA 2BHFA 4P8QA 1KYDA 1E4HA 3DIVA 3FCSB 5C09D 3HAEG 4HW6A 2VMCA 3PP4H 3ROLA 2QJDA 4HDIB 3RWCA 4G8AC 4XBMA 1CDCA 1H3GA 1FPTL 1C5CL 3MRLB 4Z77B 1PX4A 1Z0MA 4GKSA 5F1IB 2JB5H 2CMRH 5DMIL 3GBML 4AH2B 5AUMA 3R4RA 3WS3A 3D85A 3UJIL 4MNQE 4TV3A 3LEVL 3EF7A 5CILH 3SPCA 1AGFB 2WLYA 1BZEA 3GZKA 1D7CA 5AB1A 2GUOA 2B77A 1C8QA 1J88A 1B0WA 2BM3A 4OJCA 2BSSB 2A6JB 2XFGB 1INDL 1SJVA 2COVD 1FO0H 3BPLC 1HIML 2DMHA 3NIDE 5IK3B 3TBSA 4P46C 2E7HA 3K80A 1U8IA 3L17A 2ESVE 3BP5A 2X4UA 1KB5A 1Z5LB 2SEBA 2JKJA 3LMJH 5L7XH 4XCCL 4OFKA 3WIAA 5DZJA 2PO6B 4YO0A 1TZAA 1NIDA 3JSSA 4DZBB 5CO1A 2BJML 3A4AA 3ZQWA 5KSBE 5F1NB 5EOQH 4BK8A 4FRWA 4KROD 5EORH 3BHBB 4HOZA 2WQAA 5E0QA 3JV6A 1FE8L 3MLXL 4IRSB 2XUWA 4IOFC 3KBEA 1BFVH 2CR3A 4HK3J 4NOFA 4KUZH 5LO7A 5I1KH 5JA8B 2P8MA 3HE6C 2CCVA 2CLVA 5CLZA 1CD9B 2VNCA 1IGIH 1YEEL 3FB8B 4WCYL 2CNZA 3I02A 1SYVB 4NKMB 4WTZG 4PBXA 3F6IA 1MI5D 4PWFA 3T0EE 4UDTB 1D5BB 3O9WB 4P2RB 4ABWA 1AKJD 4E9YA 4N87A 2BXZA 1BLIA 2P80D 5BOZG 5F2FA 2VOTA 3SQOH 1AAJA 3O3AB 4PJBB 4MCZB 1JZEA 2YPLB 4XMKH 2R69H 3CUPB 2EDYA 1S7XB 5FCSH 2ED7A 2FEDC 3OHXB 5MI0C 1KTLA 2WTRA 3QZOA 4TUJA 4X4YA 4JO3H 3SBWA 3SJVD 4U4BA 5JOFA 4L23A 2R39A 1EGJA 1MAJA 3KYNB 3LH8A 1HHKA 2FNWA 1BZ9A 1IV8A 4H13C 4MS6A 1EZVY 2CQVA 1I1AC 2FBRA 4FLRA 1KULA 3IN2A 5CP7B 4IBQA 2NPLX 2QQLL 3MROA 4H0IA 4TQEH 1SLVA 2ZCLL 4NUMA 1RZFH 1SN5A 5EPMA 5DHVB 1CXIA 3MRBA 3P4NA 2HT4D 1XB3A 4KTEH 3QSKB 4J7RA 4ZFOA 1U21A 3V4PB 4UNIA 3MBXH 1DVSA 4FQLL 2IF7A 4WJG3 5CJXC 1M6OB 5IHUL 3VXRD 5C70A 2DYPD 4BFGA 3K91A 4WW2C 4L1HA 1JK8B 1ROWA 2FQFA 1G7JB 3AG4B 4H25B 3QNXA 3WDIA 1FN4A 2J1ZA 4FABL 1OD7A 1GIGL 3FB7B 4OF3A 4RNRB 5KS9E 3D12B 3CDCA 5DHYA 3FCTB 2EC8A 3DYPA 4KQ4L 5EU3A 3NBNA 1KBVA 4W9LC 1SF5A 4X4ZA 4N2OA 2D7PA 1ECZA 4FKHA 2JH2A 5IT2L 5KTEL 2ENPA 5GS1A 4L4VA 3FQUA 4QHLB 3WELA 4TNGA 1JE6A 3GSXA 4X6CF 3NGBB 3FPXA 4BZ1A 2JJVA 3FTXA 3APNA 4OCRL 1MHPL 5FYKL 3U2SA 1OAZH 1AYRA 4X80L 4ELMB 3QHTC 5GRVK 1WA0X 1XWVA 5I5IA 3AU1A 4JDZB 3TIDB 1P53A 3LYRA 4PJ8B 4J4PD 3UTTB 4ZFFB 3PXJA 3S3PA 3CHOA 3HKFA 3GMPB 5EG6C 1BCIA 4MSWA 5EWIH 5HDLA 1YVLA 5ABDE 4BM7A 1CE1H 2NY3D 3GNMH 4TMPA 5T1KD 3MTRA 4A55A 4DKEL 1JFHA 2OMBA 4KY1L 2Y22A 5L4FA 2DLEA 4KAQH 3O41A 3S2CA 4HUNB 2BH0A 2WXJA 1RZ7L 1KPUB 3V5KB 1QOKA 3DOSB 5CXPA 4F27A 4NQQA 5BO1L 3PF2A 2NY2D 1IIIA 5FLUA 3BIBX 3QDME 3FUHA 2GIXA 2Y5EA 5D1ZC 2XWZA 3H56A 3V6OE 4AQ8A 4KTDH 4PLJD 4NENA 3NZSA 3CX2A 2W9DH 5EBWA 3MYZA 3QXAB 4N2FA 5DFTA 4O2FB 1JWUB 5JZ7C 4UTCA 2WTPA 5JMOC 2ZOTA 4JJ5B 3HC0B 1ZLVH 1UWGL 4WWKB 2GTWA 2YD1A 4OAWB 4NZDA 1HKLH 2DWEB 3COOA 2C9UA 2F8IA 2YJLA 3O2DH 2YAQA 4CGUB 2ZSVB 4H26B 2FUTA 2HFFA 5B1AB 2MTPA 5D7SH 2YAOA 1J9QA 4KO9A 4NC0B 1SBBA 2A4ZA 4N85A 1I1RA 1MHEB 3L3KB 1PY4A 4XBEL 4LOVA 5BVPH 2X4OB 4NBXB 2C4FT 3QDGE 4MD0A 1OARL 4LARH 1KYUA 3FMGL 2OMZA 4LEEA 5MEPA 4LCWB 2HTKD 2D9QB 3NIGB 2QSCH 5C0BE 1AGBA 3VFMA 2I7SA 3IS0X 1IC4H 5FUZH 2F1BA 2XTJC 3EJZD 5HHPB 3ZDXF 4LPYA 3WUZA 1N68A 3KPSB 3PWVB 3EYFB 5L9DH 3FQRB 3N1PC 2HFTA 4UBDD 1HWGB 6PCYA 1J5OL 1EDQA 5E8NA 4B6ZA 1XXFC 1FYTA 1W0WA 1S7TA 1DJXA 3R8QA 4HF5H 4DIXA 1Q94B 2BMKB 3CBKB 3ARDB 1TFHA 3WE1A 4F3FA 1WEJL 1QFWM 2H32B 5ACZA 1YNKH 1TCRB 2L7UA 5HGAB 4WFFD 2WVVB 5LCVL 5C6TH 4IEFA 3G6JF 1OCRB 1P7QA 2X9XA 1HINH 2Q7YB 2FBOJ 1M7DA 1NGQL 3HI5L 5DYOB 4Q9QH 2BOCB 2C9VA 2HJLA 4M7LT 3T9WA 2MKLC 3ARFD 4DEWA 4KX8A 1NC2D 3RI5F 4H1LH 3SE3C 2IPTL 4FYTA 3H42L 1EFXB 1JGUH 1VAHA 2BNUB 4WU7B 3P30H 3IVKA 1J8HD 1EEQA 2FJFA 2FHCA 4G80A 5D7LE 3MNMA 3UEZA 3U6XA 1ZANH 2ATKA 4DCQB 1IJNA 3GC3A 2VABB 2NYYC 2BIIA 5ANMB 1OM3H 5E8DH 3W0WA 3QEQA 4R26H 3KYKH 5E8PB 4G8GD 5AKVA 1EHLL 3UTSB 1RMFL 1SOKA 1T0PB 4P5TB 4DAGL 1CTNA 3MRPB 5JXAH 2YGVA 3NG5A 5B3JE 3N1FC 3TBCA 4P2CG 4ZRGA 3RKDD 3EFDL 3AADB 3WXWL 4MKMA 4WNJA 3MA7B 1HI6A 2GCYB 4R7DA 4I48A 1TG8A 4G3YH 5A6MA 1BQUA 4OF7A 1A8ZA 2PXYA 2Y36L 2IH9A 4IKNA 1GC1L 4CMHB 5F6IB 3ECUA 4OF5A 1LEKA 1JV2A 4QOKA 1T0OA 2PTVA 3S9DB 3NK3A 4ZAKD 2X6MA 1RJZA 1QSEB 1TVDA 5J5EA 2R0ZH 3ZZQA 3B3IB 5JQHC 3WL9B 2Y07H 2ZONA 2PP9A 4P2OA 1BJMA 4PUBH 5ID0B 1VPOL 2ZOWA 4M5ZL 4F8QA 2NY1D 1FNFA 5GGQH 2GK0B 2FSEA 1RLWA 1WHPA 4PJGB 5DD5H 4ZI8A 4APXA 4KRMB 4D9RE 1JZFA 5DJZA 4Y4HB 3P54A 4UM9A 4JO4H 4JRFA 3BKYL 3T1FA 1J0ZA 3SDDB 1WAAE 3VE0B 1IEAA 4D8PA 2A9AA 2IBZX 3AUWB 1QBAA 4AJYV 3C9NB 1TT6A 4ZX4A 4NO3A 2VLKE 3GHBL 3GO1L 3PAYA 5TFSL 3TJHC 4A37A 7PAZA 5KVFL 2R0KH 3NH7H 3UBXI 2J8UB 4UM8A 3MLRH 1A3RH 3MBED 1FNGB 3E2HB 1YO4A 3QUZD 2BSDA 4EI5D 3RTLA 4FAAB 1Z9SA 3NPSB 1TVHB 2VLLA 1B6UA 4NUQA 3PIQA 4W9DC 1FH2A 3N91A 3VUAA 5CBEA 1BZ7A 1HHHB 2OL3H 1ZDSA 5IMOA 3AXIA 4LVNC 5LQBH 4GUCA 4OBSA 1L0QA 2H3NB 3FFDA 4XPHL 5AZUA 3FOLA 4JVWA 3VXSE 4GG6A 4XMLH 5HYIA 3RUGF 1Q9WB 2DQJH 4W9EC 3STBA 1QVOA 1FL3B 5CU9A 3BPCB 5AW1B 2ZG3A 4OGXL 1OP3H 5I17B 1A8JH 1U8OA 1YQ2A 5G2NA 3TYFA 3TCXA 5E70A 4XMZA 4XP9H 4JJHA 4DP5X 3A6BH 4F8TA 4PGEA 1KOAA 1TQSA 4JFOA 4M7KL 2EEAA 5ERWB 2VDOH 1S5HA 2NY6B 5IB5B 2WJ7A 2R59A 4GW5A 5ESQB 5JR1H 4XCEA 3RHWF 1FFNB 2LQRA 4Y4KA 1RERA 2FECL 1UWEH 4FFZL 4PREB 1U8LB 1OP9A 4Y19A 5FKAA 1ET7A 2WWKO 4W6YB 2BY3A 2YMXH 3QNYB 4HX1B 5GSRA 1BJ1J 1HQRB 4N90E 4ZUWA 5E7BA 1UM5L 3WIIL 5DVPA 5FXCH 5I28A 1DE4B 2AQTA 3DJTA 4JG5A 5KBKA 4EE2A 3SKMA 1BMZA 2BIOA 2HN7B 1AI1L 1O9VA 1TJGH 2OP4L 2CZNA 2AERT 3BFQG 4QMEA 4TF4A 4YK4B 1YPZB 4F2FA 5HSFA 1Z9OA 4MCYA 4ZOAA 3U0PB 5JOPE 3ZT7A 4NQDA 3RJOA 2MOVA 3MC0A 3D85D 1DFBH 3GGWA 2H47C 4LZKA 5HY9B 3MN8A 1UC6A 2EDWA 4P2AA 1XAUA 3QS3A 4CU8A 2G2PA 1L9QA 1WRFA 4KH9A 3B6SB 1LO2H 1KIPB 1INEH 2AGJH 1ES0B 2CJUH 3SE4A 2HFGH 4BH7B 3CLEH 4UAOC 1OK8A 4LKXB 4X7SL 4YWGL 3TOPA 5I2IB 1JYXA 4QHMB 3HEIB 2DJ4A 5LDUA 2W38A 3CFDB 2F8VA 1K4DA 3KNBA 4UT6A 2V3EA 5DA4A 3NJKA 4BE6A 2NTFA 3PHOB 1EAJA 5CJOL 3NFNB 3LV3B 3BUYA 3OMZA 3UTQA 4BQ6A 2UUDH 4L8CA 2OMTA 2WXHA 1QFWI 3SBPA 1F6AB 5F7MC 1S7UA 4A6YB 4DQOL 1J0HA 1A6AA 4QRRA 4J6IA 3FTGB 4KMTL 5DHEA 3X2QB 3WKMH 5HGHA 2Y06L 2IDQA 1DQML 4NXKA 1XBRA 3RDJA 4ICXA 1LWHA 1EDYA 4L4VE 5BZZA 3VI4A 3OAWA 3P3RA 4BHUA 4X50A 3WFEH 2FO4A 4XPTH 5DQJB 4BSWA 3AG2B 1JXJA 1LK2B 3IF1B 4ES9A 1JGDB 5LB1A 5ESVB 1NL0H 2XQYA 4P4RB 2OZ4A 3Q8AA 2F54D 4DPAX 3VW3L 3K5RA 1A3LL 5CINL 3IB4A 1U3HA 1OAYH 1IILE 4PRBA 1TEGA 1UADC 2PF6A 3FO9B 3RFZA 1OCOB 5TE6L 2YRPA 1U8PB 4K5LA 1CYXA 1AGCB 4JG1L 3VGAC 5HXMA 2Y7SA 3AQDA 4BA8A 2XQYK 5INDA 1HVXA 2ZUQB 2VDPB 2FWOB 1CFQA 4RFOH 1EJ8A 2UZXB 1MCHA 2IQ9H 2R7EA 3IGFA 1W8EA 3MI6A 1BD2D 2FEEI 3ILPA 3QS2A 4NS0A 5FX3A 4KKLD 2MCPL 1KG0B 4F8OA 2CGRH 2FTAA 3UPAA 4F91B 5JHDB 5DURD 4DZ8A 2J72A 4AV5A 2NTSP 3BFOA 3LH2H 4XN9A 4NJAL 2FWUA 2ZG1A 4OI9A 5TDPA 4WSJA 4NKOB 2WN3A 1S7VB 5IWLC 5LGKA 1XIWC 3WO4C 1AGDA 2EDRA 3AWEA 5AOMA 3KM1A 4M61A 2V2XB 4XXWA 2QHRH 4GXVL 4YHKH 2APBA 4HLJA 2R15A 2K8QA 1AVAA 1EAPB 1KCRH 1JUFA 1SJHB 1VZHA 1YMMB 2Z8SA 4JW3A 5F71A 3CFEB 1AR1B 1ZGLB 2NUTA 5A6IA 1MCPL 3FH5A 4XNQA 3RX5A 3BPOC 2EIMB 4LF3A 3IDJB 2XKNA 5I1DB 3QIUB 2A0LC 2AK4A 2BNRD 1Q9LA 2F53B 1IKFH 2HH0L 3GMOA 3O4LA 3WN5A 5MERA 3HZMB 1TNMA 3VA2C 2P48B 3A47A 2Y7NA 5LBSL 4GSDL 4DETA 2C7UA 1QUNA 3STZA 1TTCA 3QCVH 2O61B 1P5UA 3PQYA 3MTXA 3AT8A 4MB1A 3G6AA 1XSOA 3HG1B 5HGGS 5FM8A 2AEQH 1JVOA 1I9IL 4EN3D 3DX8B 1IM9A 4G43B 4FN0A 4PTUA 1IQDA 5EA0H 4JZOB 4MDJA 3BUBA 1GCYA 1YMHB 2IOIA 3ARTA 1WBXA 3CZLA 1FYTE 4QY8B 1NCAL 4X8GA 5FF6B 1EEZA 1JNLL 1NJ9A 1T04B 3I2CH 1MRDH 3NZ8B 4GUQA 1RAMA 4DGWC 3NQKA 3APDA 3IMWA 5F3BB 2OQJB 3FSWA 3RWEB 1NGPL 4HCFA 1XTMA 5AVXB 4ZTPL 2PLTA 2CDGB 2R2BB 4JY4B 2PYFB 4S2SA 2H3KA 1UB5B 3AM8C 4JFYA 1JV5A 3E1ZA 3G5ZB 1RZPA 3GXFA 3WYRA 4XC3H 2G3ZA 5ALBH 4CC4C 5BO0D 4K3EH 4DKFL 2VQ1B 1UT2A 4G8EB 3VFNA 5FYLD 4MMXC 5J11B 2IWFA 3CMOH 5IW6A 4JRWA 5C0FA 4FCAA 5KVDE 4FA8A 2H1PL 2N0MA 4YSQA 4GH7B 4PFEA 4K7PY 4OFPA 4R97B 2V5RA 3II1A 3V4PL 4P4KA 1JZ4A 3BP6B 1UVQB 4YHZL 3BN9D 4OB5L 4WEBH 5CWSB 2RTTA 5J13B 1SLUA 2C3HA 1R19A 4K71B 3P69A 5A2IH 1C1EL 1NC4B 2O26U 5KBMA 1G1OA 1IGCL 3GD1C 3EO1A 6FABH 2IGFH 5J57B 1Z2KA 4Y16C 1ACCA 2GK2A 3DUSB 5DZLA 4A7QA 1K5NB 4FNUA 4OTXH 1K85A 2WP3O 2E74C 5FUOL 5F1OB 1FF5A 3FU9A 4XBGB 3TT3H 3U83A 2E27H 5I82A 3B7SA 5DCCA 5K1NA 2N4IA 3SIKA 5A2AA 3L9EA 4RGOH 1HDMB 2DQMA 4DO4A 4QRBA 2E7CA 3IFPB 3HRZC 3K46A 2J4WL 4JZJA 3OF6D 1IBYA 1V7ML 2VR8A 3MUGA 3UTPD 1A2YB 3QXVA 4JZNB 1JF6A 5BNXD 3AROA 3KBHE 5E6RB 3VGGA 1ID2A 5CP3H 1USZA 1TXKA 2AJVH 1U8KA 5CEYA 2FX7L 3OR7A 2P46B 3PL6C 5FB8A 4YSTA 3WJJC 3QWNA 4X6CB 1GC1C 3CPLA 4JFDA 1UQSA 5BUAA 4OH2A 2E0PA 5HHXL 5KVGL 1C5CH 1HT6A 5EFIB 4FL4C 4IHOB 3GUTA 4LSTL 1Y6NR 3FH8A 2JK5A 4YDJA 3C6LA 5DMIH 1QR1B 3O8XD 1KIQA 3GBMH 5DI8A 3LKPA 3UJIH 2KL6A 3L54A 3LEVH 4JDEA 1BHGA 2DQHL 4JREB 4PI0A 5INCA 3SOTA 4P3CL 3QI9B 4QHNB 1O6VA 4RLDA 5JW4Q 1J18A 1ET8A 1INDH 2IVFC 2R27A 5IV2A 3W0WD 1HIMH 2WBJC 3GXUB 3QEQD 3CVHB 4GP4B 5HHMD 1B0RA 1IAKA 4CC1A 3ALWA 2H6PB 4KRPC 4X8XA 4XCCH 3KCPA 5DD6A 1TMCB 3ULVE 1AHMA 1AZVA 4MJ2A 2BJMH 3CSGA 4R7NB 4R2GD 5B1JC 1W72B 3RL1B 5F89A 1FE8H 3MLXH 4AJWA 3GYRA 1Q72L 3MRIB 2HKFL 3LRSA 4MXVE 4YSPA 3FCBA 2PXYD 1LDSA 2BCKB 2DOCA 2NR6D 3CMGA 4HT1L 4A2LA 5I0WA 1DVFB 3T65B 4QOKD 2RBLA 2MOGA 5DEGB 3W9EA 2XOTA 4DP0X 5FK9B 1K2DA 2JKRM 3MXVL 4X6DA 5DUBB 1SN0A 2X0WA 3EJRA 4AJVA 2YSSB 4WCYH 4FQJL 4U2ZA 3D3VB 3QUXB 2OMVB 4OQ1A 4U33A 3MJ7A 4KH2A 1CTMA 2C4FU 3BQVA 3MUZ1 4XCYA 1HYSD 1E50A 4H5SB 4OZ4B 5D1ZI 3MO1A 2I9TB 3V9CA 4UNTA 4XP5L 3FO1A 4CGTA 5CIPH 2DB8A 4OM1H 2J55A 2W91A 2AC0A 3PHSA 4NQDE 5AWNL 5G4OA 2F9BT 4EEEA 3ZDXB 1A4BA 5JORB 1DQTA 4Y5XA 1MWAB 2ARWA 5KN5A 1FCCA 1OP5K 1IAOB 1NFIA 5FO2A 1S3KH 4QDGA 3B2DC 1IM3D 4KDWA 3JTSA 3PWNA 3CGTA 4KJYB 2FT8A 2TSBA 43C9A 1SY6H 4PEEA 3EH4B 3Q2VA 1DBAL 3ZDYF 4TLSA 5BCAA 2QQLH 2ZCLH 1KTDB 1TTBA 2UWEF 3G6JB 3M7FB 5FO8A 4M3KB 2QVIA 4M29A 3MKKA 4JQVA 4NNXA 4LPCA 4CRPA 4XRCB 3FH7A 2AEPL 3ETBJ 2X7LA 4FQLH 4WSGA 2IBBA 4J1UA 4HQQH 5IHUH 4CMMB 5EUOA 2X4QB 3V9EA 2L3BA 4QRRE 1NEZA 1ZS8B 4Z18A 3L5XH 2PNDA 1JF1B 4H20L 3RBGA 1MAKA 3TVMB 3FRPA 4HD9A 2W0FB 5D1QD 5F9AC 3VI4E 4FABH 3MZGB 1GIGH 1OGTB 2ZICA 4QXWA 2J56A 4J23A 4KQ4H 2GBUA 4A38A 2B14A 3ISWA 1OP4A 3THML 2RA1A 4IBSA 4Y19D 1E2VA 4A7GA 5LKNA 5IT2H 5KTEH 4HMCA 4R83A 1JZJA 1ZT7B 2OW7A 3RL2A 3SD5A 4BH8B 4CVXB 3LZQA 4PWHA 5I30L 1AKPA 4Z7NE 4KQ0A 2VC2B 2J20A 1JFQL 1RVFL 3EFOA 3GJEA 3KYOA 4JKLA 5DC4B 4OI7A 3CZSA 2L7QA 1MHPH 1TKWB 4OCRH 5FYKH 1IKNA 3L3DA 4X80H 5B21A 4JFEB 4IS6A 5BZXA 4JVPA 4GBXC 3LTVA 2M1KA 2NY4B 4GOSA 1T1ZB 3II2A 3DGGA 3MJ8A 3NYKA 3B3BA 1GGBL 1MLBB 3ASWA 2QPUA 1AXTL 4GW1A 3HJEA 3TTYA 4I7ZC 1BSIA 4DEPB 5AVRB 4AZ8A 4DKEH 1Y18A 4XO9A 1I8MB 2DS4A 5GS0L 3ILQC 4KY1H 2YZ8A 5JQ6L 3BRDA 5EF2A 3J2PA 4BDVB 3P4MA 2JFCA 3PAVA 1RZ7H 4H2CA 4BFEA 3D2UA 3KPPA 3BKML 3UOAB 3DX2A 2P42B 4AKQA 1OT4A 5BO1H 2NW2B 4JFFA 3WMSA 4GIOA 3O6ML 4JGJA 1AP2A 3UAJD 4FD0A 4AYGA 4JDVB 5F7LB 3O4LE 5D7JB 3TEXA 4FX5A 4YS4A 2B9BA 4M5YL 4KUCD 3K2UL 1UWGH 3ML9A 4G6AC 1SHXA 5HP5A 2F58L 3PQYE 4LU5L 3WNJA 4F1ZA 3G5WA 2EXTA 2RCSL 4JB9L 3BT0A 2YEZB 1I75A 1A9EB 4OIAA 3VD9A 2VN4A 2LAAA 1GZQA 1MN4A 3C5JA 4U3HA 2OCJA 5IVXF 3RUGB 5AVWB 3UZEC 2K9UA 5TE7L 4XBEH 2PYEA 15C8H 1OARH 5LJYH 3FMGH 3GXTA 4AMKL 1K6QL 5E99L 4Y1AD 2Q9OA 1MG3C 1BBDL 1XB8A 3SCMC 1MVUB 2XHNA 4Q6IA 2JCCA 3P77A 5IROA 1NUNB 3QPQD 5I15L 3IETA 1ZTXE 2AKRA 1J5OH 2EVJA 2E47A 1SUJA 5CD5C 3TZVA 3LN4A 3NK4A 3EYOA 2YD9A 3ZIMA 5CNHA 3V0WL 4R4NC 1WV7T 1WEJH 5DJAB 2PW2B 5LCVH 4NI3A 3P40A 4NQXB 1L3WA 2WXRA 3GBNL 3I85A 4A68A 3ZSTA 5EF1A 3DXAE 1NBYB 1NGQH 2IFFL 3HI5H 4YHPA 4KI5D 1FG2B 3JV4B 5L0QB 3Q7JA 2BSBA 1U95A 2ZP9A 4KOBA 2HX8A 3U7YL 1FIGL 2ITEA 4JNXA 3DGDA 3H42H 3HE7A 2VAAA 1NBCA 2EH8L 4QAWA 4KITB 1NSNH 1D5RA 1ANUA 1A1OB 1QO3B 4TL5A 4PVLA 1JPGB 1C7TA 4ETQA 3QZBA 3QIWA 2E5EA 4G59C 5AZ2L 4YEFA 3I6LD 7CGTA 4GG8B 1T21B 4XWGL 4P5RA 4GNKB 3W11D 1E65A 4E9TA 1YEJL 2AK4D 2VLRD 3OR6B 3S5YA 5KG9A 5IB2A 1P7HL 1RMFH 4WVRA 2XPGB 3U4EB 4DQAA 1ZMYA 5MEOA 5IW3A 1GYVA 4P2QB 5JPNC 4PJXA 3RVVC 4ZNCD 3EFDH 3WXWH 2VDQL 4XN5A 1NQBA 4IRJB 3KPNA 1YUKB 1HCFX 3V8CA 4XNYL 4YR6A 5EEVA 2ATAA 2X3AA 4Y2DA 3KAAA 2Y36H 3MGTB 1EHXA 1GC1H 3QG6A 1ND0B 4OUOA 1TQVA 4P5SA 5GGUA 1IT9L 1I1FB 4HLZG 3L3HB 4TVSa 1F4YL 4GS7B 4FG6D 4I5BB 1TTAA 1GMIA 5CAYB 1MFEL 3KPMA 3O6FD 3Q5OA 3VFPB 5B8CB 1BQRA 2V9TA 5CJBA 3FT1A 4M5ZH 4R5VA 2DWYA 5SWSA 4TUKL 4QAMB 2ZNXA 5DMGD 1I8IA 3HZYB 4BGLA 5B4MD 1VA9A 2V5TA 1G4MA 2R1YB 2VDPL 4ONFL 5SWQA 3T3PE 2EYSA 3GKWL 2P28B 3VWKC 1NPNA 3NJJA 5BW7A 1P5VA 2F8XC 1R3HB 4M4RA 4NZRL 3NSCA 5CU5A 5D93B 3QFJA 3QC5X 4V1DB 2QR0B 3UC0L 4G42A 2XG4A 3BKYH 3DYMA 4FMKA 3EDDA 2OTUA 32C2A 3LRMA 4GXUM 1MFMA 4DERA 2W9EL 5IBLD 3VSUA 3GO1H 3GHBH 5TFSH 1FSKB 5KVFH 2J6WA 2F08A 5CS7A 2MNJB 3BVNA 1OE1A 3PWLB 4WW1B 1F4XL 2KLTA 2EUWA 3M46A 1EJFA 3WE6A 2XWJA 3PUUA 3M1OA 5IF0B 2D3VA 4YGAB 4QYOA 2FYYA 4LGRB 3DSFH 1AZNA 5T5FL 2DDQL 1Z1WA 2OMYB 2BSRB 3M17B 4TNWK 3FCSA 2F74B 4XPHH 1AQKL 3DSNA 4HDIA 3DVIA 1I7ZA 3O2WL 1RIHL 3ABZA 4LIQL 4B9JA 4OGXH 3BIAX 3E3QE 5F1IA 4X4XB 4XE5B 5I1HL 1I3GL 3ZUNC 1SXSA 4AH2A 4NLHA 1D7FA 4FQXB 4X6DE 3V0IA 3D39D 1AANA 3TFKC 3VI3A 2O5ZH 3GM0A 1E5BA 2N1KA 4MS8D 4EVNA 3HI1A 2BSSA 2AV1B 3TH4T 12E8L 2A6JA 2WJ5A 1CI5A 1UJ3B 4Z7OE 1GOFA 4PAZA 4LLVB 4WFEE 4HKJA 1VEPA 2E8ZA 4JRYE 4FFZH 2NX5A 3CQQA 4RSYA 1T89C 1Z5LA 4NCC2 1NKRA 3D51A 3GMLA 2ZXDA 1UM5H 3WIIH 4DP6X 1U8JA 4NB7A 3AQXA 4U31A 4ANVA 1OWRM 2CM5A 1INQB 3BHBA 3SDCB 4PS3A 5EU5B 3MV8B 1AI1H 2OP4H 4IRSA 4W9GC 1JL8A 4ZUTA 4BD4A 4IMKC 1M56B 3ZDWA 5I5RA 2DLHA 5FOJA 2C4XA 2D3JA 2FT7A 1SUHA 1SVZA 2X44D 2Y4SA 4I0PB 4MQ7A 3I75B 4PVMA 5FC9A 5HVFB 2WIMA 3FB8A 5IOKA 1LVEA 5F7YC 1F42A 2APXA 3L13A 4BFRA 1SYVA 3Q06A 4H8HA 4ORZC 5CUSH 3L3JA 5HHOA 4ZS6D 1FO0A 4PRNA 2B08A 4IBTA 1D5BA 1XGPA 2WOBA 2FCBA 3ARDC 1CFNB 1T5XB 5FUCC 1FDLL 4LEOB 4YWGH 4YMPA 1F8TL 3L08A 2VE6A 3Q2LA 1T22B 5EUOE 4GFXA 1ONQB 1R5IB 4PJBA 3UZQB 1JZIA 1CDJA 1PCXA 2YPLA 1U30A 4NPKA 5MENB 4R0LA 3MRMA 2OAAA 4DP1X 3TESA 3OHXA 5CJOH 3FUKA 2Z31B 1D5XA 4WEMB 5LGJB 5ISZB 1LXMA 4TYUA 1E8WA 1XO8A 3T8XA 3NAAL 3KYNA 5JPMA 1PLBA 4FJYA 3G3LA 1R5VB 4DQOH 5I6MA 4OFVA 4KMTH 4XCNA 4WUUB 2Y06H 1HE7A 4YQXL 2E7DA 1DQMH 2J1YA 2R23B 1I8AA 2GC7C 1XGQB 5D5MF 1S6NA 4HIIB 2X2YA 1FFOB 3F04A 2KI6A 2ZOKB 4JK0D 1QTSA 2BP5M 4X5LA 3IU4L 4M6MH 2YAEA 4GW4B 4P5TC 1RK1A 4N8VB 5E6IC 1G7MB 3VW3H 5D1XB 4G9FD 1A3LH 2HX7A 5CINH 2Q20A 4ZXBB 3TC9A 1YY8A 4P23A 2J6EL 5TE6H 1P84J 4L3EB 1ADWA 3JYBA 4JG1H 5C7ZA 4MA3A 2XN9A 1NMCB 4HUMB 5C6WH 1N10A 3IDMB 2FR4B 5FA4B 4AUYA 2F1AA 3SDXE 2MCPH 2XZQL 3FCTA 4EBQL 1FAKT 5ICYA 2G0KA 2EAEA 3M1BB 4OLZL 5HJGA 2VIRB 4MJHA 1KGCE 2EE9A 4UMSA 1F18A 4EJ1C 4NJAH 1RJYB 3ZL1A 1X7QB 4XMPL 3V7AE 2FJGB 3GMRA 3UP1A 4YHML 1C5DB 1W0VA 4P49A 4ZPVB 4GXVH 1XCQB 3TYGL 1KXTA 4X7DC 2VLME 4KO5A 5F9DC 4G71B 1Q9OB 3AUVA 2NUPA 1FL5B 2OSLB 4ZG1A 1OAJA 4IIQC 5DTFB 3IMBA 3UTTA 2D0HA 1DN0B 2WWMC 5AW2B 3KLHD 1ZTMA 3C60D 4RGNC 3GMPA 2K7PA 1MCPH 1OAXL 4FOMA 5EU6B 3NFPA 3FUIA 2IDTA 5GS0C 3V0GA 4MMZA 4QJ3B 4QF1B 2HH0H 2BSCA 3CCHB 1MIEH 3LHPH 3RURA 1MJJA 5I8EA 1DQVA 1CF1A 3FB5B 5LBSH 1G9NL