3L8QA

Structure analysis of the type ii cohesin dyad from the adaptor scaa scaffoldin of acetivibrio cellulolyticus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
338
structure length
338
Chain Sequence
MAPTSSIEIVLDKTTASVGEIVTASINIKNITNFSGCQLNMKYDPAVLQPVTSSGVAYTKSTMPGAGTILNSDFNLRQVADNDLEKGILNFSKAYVSLDDYRTAAAPEQTGTVAVVKFKVLKEETSSISFEDTTSVPNAIDGTVLFDWNGDRIQSGYSVIQPAVINLDMTKASYITMGYDKNAAEVGEIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVSEDYGPIVQGVHKISEGILNLSRSYTALEVYRASESPEETGTLAVVGFKVLQKKATTVVFEDSETMPNGITGTTLFNWYGNRIQSGYFVIQPGEINSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Arrangement of a Cellulosomal Scaffoldin Subunit Revealed from the Crystal Structure of a Cohesin Dyad
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein, protein binding
molecule keywords Cellulosomal scaffoldin adaptor protein B
total genus 81
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA01
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA02
4U3SA 2Y3NA 4WI0A 3BWZA 3KCPA 4FL4C 2BM3A 2JH2A 1OHZA 3L8QA 2XDHA 4FL4B 5K39A 3KCPB 4WKZB 2VN5A 1ANUA 1ZV9A 3UL4A 2W1NA 1TYJA 1G1KA 2O4EA 3GHPA 2B59A 5G5DA 4DH2A 5AOZA 4IU2A 5LXVA 2VO8A 4UYPA 3FNKA 4UMSA 2OZNA 4UYQA 1AOHA 3F2LA 4IU3A 2VN6A 2CCLA 1QZNA 4N2OA 2ZF9A
chains in the Genus database with same CATH superfamily
4PEEA 4WO4C 1IFHL 1GH7A 1NOLA 5FOJA 3DPBA 2N7SA 2EDRA 2H3NB 3CHXA 2VUOA 3MRPB 5E08H 3L5IA 1PJWA 5F2FA 2PWGA 2EQDA 4MS8C 4UT6A 3WKML 15C8L 2UZXB 5F9JA 3P77B 3NMEA 3MBEB 2KZBA 2AQNA 2F19L 3AM8C 3AREC 3QUKB 5KVEH 3TEWA 1J0KA 3K71A 5EEVA 4G6FD 3HBPA 3AG4B 1Z9MA 2CKBB 3U2SA 2NYZA 3QQ9D 5A7EA 4HHWA 2VSKB 1KJ2A 5D6CA 3EO1A 5E1AB 3V95A 1U95A 3FQXB 3LX9A 3ARBA 1NKGA 1ZV2A 3VSTA 1M7DA 4QRPA 4DKTA 1T1YA 3QPXH 5FIEA 1BAGA 3TC9A 1GTNA 1ZHBB 3EXLA 2XFGB 2AQTA 2AEQH 3WHXA 2WLMA 1EH9A 1HZHL 3WV0A 1JNNL 4Q6IB 1GJUA 4H5SA 4YK4B 4U1HB 4MA3A 1LE5B 1ID2A 1KCSH 1L6PA 3L9RB 2R2CA 3WUWB 4PJAA 5J9PB 3O3BA 4PV8A 5L2KE 4NO0D 3D69B 2OTUB 1REIA 3KLAB 3FOLB 3JWOC 5EMYA 4FEIA 1GSKA 3U6RA 4JN2B 3NZHH 1P4IL 2OP4L 3FO9B 2G2RA 3OC5A 1D6EB 2FQEA 2GEEA 2N7AA 2ZKWA 4JZJB 1EDQA 1U3NA 2E0PA 2B1AL 4LGPB 1RH8A 4O02A 4Y4KB 5GGRA 3VFNA 1JP5A 2B4CC 5INCB 2XWTA 3MNVB 4M8QA 3O6LL 5E8OB 3WMPA 2OK0H 4LF3B 1FYTD 2H32A 3HAEH 3DWTA 1GL4B 4PPTA 1NWPA 5GGTL 2J4WH 4M7ZB 2MNUA 4FQQA 4UQAA 1INQA 4AQ1B 1NDGB 3WN5C 4OGZA 5M7QA 1HINL 5ISZE 4RAVA 4BINA 4PGZA 4ZPTA 3FU7B 3BI9X 2H2SC 2OMVB 3P0GB 3RGVA 5FUZH 1MFDH 3DRQB 2ODIA 3N85L 3U4KA 2PETA 4TL4A 4DK5A 1PVHA 1KJMB 1KXTB 1OSPL 4PS8A 4E9QA 4GLRI 3VFSB 2BNQE 4J28A 3GB7B 5JIMA 3HG3A 1XIWC 2ISDA 4H0IA 4FA6A 3GMNB 4JZJA 3GLAA 1S9KC 2EYRB 2G0LA 2NNAA 2VAAA 3VFWB 1AAJA 1OGTA 1WAAE 3WS3A 2L7JA 4Y5VB 1CLZH 1B4RA 4M1DL 3UBXA 4G8GE 4P07A 3PPSA 4GP8B 4O5LL 3RG1C 2JKSA 1RVFH 4LAQH 2ZE0A 2X4QA 1QFUL 1WZMA 4D3CH 5LBVA 1ORSA 3BXNB 2MCG1 1HNFA 4TNWK 4LDOB 1E2ZA 4H20H 5IB1A 2WXIA 1P4BL 3CC5B 2XN2A 1AS8A 3T3ME 5AFAA 1HC1A 1C7TA 3ARUA 3PHSA 4PMEA 3TEYA 1OE2A 2OXGA 2XWEA 4JY4A 2X0UA 2VXUL 1LVEA 3EYUL 3K5RA 5J11C 4M7LH 3ECQA 3ZU8A 1YEHH 3V5DA 2XWRA 2VQUA 5DD5H 3ARGA 2H2PD 1CICA 4YDZA 3LNGA 3ARGD 1WITA 2VDNL 4W9KC 4X6BB 3QUMH 2CRZA 4AQOA 4L8CB 2DBLL 1HXMB 5C0AB 2CJSA 2X4TB 2DMGA 4JM0A 2CWRA 4GO6B 3RBGA 4RAHA 3QDMD 4A55A 3EYOB 4ZMPA 4CVZA 3PHOB 1JTTA 5DJAA 5T5FH 1BXXA 3G6JB 1QBLH 3RWDA 3QORC 4XNBA 3SQBB 3ZMRA 4IMKC 4R96A 2H1XA 4PS4H 3DSFH 1DANU 2FB4L 1OAQH 3ETBF 5DJ6B 4IRJD 2C26A 3OHXB 1U3HB 2VDNB 4IK7A 3EJRA 2FYVA 4K3DL 4WWOA 1IT9H 3QDJD 3GMNA 2EACA 1CJYA 1HCFX 2XYCA 5DFWH 4PGEA 4KI1A 4U1JB 3M86A 1XBRA 1Q9LB 3VXSE 5TE6H 5T1DH 5GGVH 1WBYB 4M62H 4PR5A 5AW4B 2DLHA 5IBTL 1Y0LA 3ZDWA 5J8OA 3P77A 2OJZL 1E7UA 1A65A 3CZUB 3DIFB 1BA9A 3WI9A 1QFHA 3LPGA 2Y36L 3VNZA 5F7BA 4Q6KA 1XDTT 4OGXH 4DP6X 4RMUA 3RTQA 1Z3RA 4H2AA 5HHPB 2E47A 5DURB 5AKRA 5JMOC 1AYRA 2MCMA 2PCFA 1ZA6B 4GXFA 4XTRC 4YE4H 2BP5M 4J8RB 5C0IB 5L7XL 4I1RA 5CINL 4B5ZA 1A8JH 4HUUA 1HE8A 3DX1A 1OP3K 2FJFB 1URZA 4HCFA 2R69A 4BFOA 4GT7A 7PAZA 1PSKH 1WFTA 4N1HB 3PDOB 4TUOB 1A6AB 3RVUC 4EI5A 1HSAB 5IW6A 4QI3A 1N19A 4Z3HA 2H8PB 1S9XB 3Q2VA 5IIEA 2NLJA 4M7ZC 2PPEA 4HS3A 1M2OA 2ZUQB 3MO1B 3G5XA 3TEZA 4B9GA 1T4KB 5DXWA 3VD0A 3ZZLA 3Q6GL 1KULA 4Y4KD 5FXCH 1TMCB 3BJ91 4N0YH 1TJHL 4Y4KC 4QGTA 5I1AB 1N0XH 4WLCA 2Z64C 2K4WA 3AXLB 1UZ6F 3UYPB 4WAFA 1LGVA 1SN2A 1HL4A 2Y22A 2FD6L 2YEQA 3BKJH 5GHWL 4HJIA 2ADGB 4BQ9A 3ILQC 2BIQA 4LRIC 1NEZA 1YEDB 4JN1H 4J5VA 4FZEH 3BE1L 4A7GF 4B9YA 4FYTA 5L88H 5KANI 3T4AB 4Y2DC 3ARZA 3VYPA 3EOAA 3EYQD 4KUZH 4RNRB 1JMXA 1IGCL 3CLFL 4DN3L 4JO8A 4NNPL 1YNLH 3IGKA 3CHQA 1RK0A 3KW7A 1HH6A 4KPHH 5AEAA 1P0SE 2DQMA 3RWGB 3N55A 1ILSA 1I9EA 4WW1A 5C08E 3KGUA 2HVKB 3RX8A 1YECL 1KACB 3BH4A 1MDTA 2WXFA 1F4XH 2YAEA 1JF1A 3QEQD 3BSHA 4MJ6B 5I8EB 1W72H 3CPLA 3K3QA 1NCBL 3O0RL 3VGHA 3FC8A 4NQUA 5KSAC 3N44B 3KYKL 1K4DB 1RZ7H 4LSQL 4G8IB 1BWWA 4ZMVA 4NOFA 5E8NA 2D31A 3NCBB 3BQUA 5DSCA 3A6BL 3MBEC 1OQOA 2XPGB 2IFGA 1OE3A 4JNXA 1A6VH 2BFVH 4L5FL 5I5RA 2XZAL 2Z35B 4G3YL 4HEMA 2NY5H 4GLRH 1OK8A 2OMYB 4HIXH 2A99A 2WWOA 4NFDA 4I4WB 5I26A 2J8OA 3PXJA 2EDTA 2PTTB 4X5LA 1UM6H 3UEQA 4WO4B 1J5IA 4WU5B 1VJSA 2HFGH 2X4SA 5ITFB 4F1SA 2X4PA 4FN0A 3FXIC 5EFIA 1Z9PA 2ZYHA 3E6FB 1N0LA 2CO7B 3ZDZF 1ET5A 1N6QL 2W0LA 4S1QL 5C97A 1R1CA 3CPLB 5DLML 4K94H 3GMQA 1XR8A 3MRNB 1V7ML 3GO1H 5AOLA 3RGVB 5EO1A 2PW2A 2IQAB 4AYMC 1Z5YD 4K8RC 4OZIB 3A6CL 4JRYA 4OSUH 4OKVB 2VMCA 1R3LA 2YFNA 4G6AC 1EDYA 4Q9RH 2JK5A 5HYSA 5EEZA 1MLCA 4WW2A 4IJTA 3FPXA 1QFWH 3TM6A 3B2VH 4NXSA 4LSRL 3HNTH 4MCZB 4OZHA 2BVQA 3QEQA 2IPTH 1I3VA 3GXMA 1IV8A 4L1BA 2RALA 4Y1AB 3MNWB 4IIQC 5GRWA 1VFBA 3VI3E 1WG3A 2EABA 2NUTB 4GW4A 4Y2LA 3L5XL 3RYMA 1DVFD 3MRFA 1OTSD 2H0PA 2Z3FA 3F6IA 3OZ9L 3QS3A 3BEVA 3ZZQA 1EGJA 1VPOL 2FATL 3CBKB 4YBLC 2BZ7A 3UAAA 5BRZE 5D4JA 4YWGL 2NZ9C 2VDKH 4X98B 2IQAA 2WCPA 2R0KL 3OQ3B 3IRPX 4FHKA 3PGFH 3GJEA 5KAQG 3FO0L 5DTFB 2R27A 2BDNL 2AXGB 2BS8A 5FUCC 3W0WA 2TRYA 1RJZB 3HI5L 1T1WA 3CFQA 2FSEB 3O3UN 1MWAH 3TO2A 2R4SL 4IQHA 1OT2A 5C0JA 3PCYA 1BVKB 2H0JA 1U8OA 3VE0A 3V2AR 2NUTA 2ZKMX 4HIEA 2D7TH 3I85A 5C07D 2XG5A 3TOPA 1I8MB 5DK2B 4M6ML 4PCYA 3NPZB 3BYTA 4NUJA 5T3ZH 2KT6A 1TCMA 2P52A 2VDLL 1PCXA 1A7NH 5B3NA 5JQIB 2YQ3A 1GVIA 1BJ8A 3LKPA 5DQ9A 4IYKA 2WIIA 3BFWA 3VXOA 1A1OB 4KKZA 5GSVB 4K9EC 1UWGH 3HI1B 1M57B 5MEPA 5C1MB 4BFJA 5AW0B 2QPDB 3VG0L 2NSMA 3GEFA 1U0QA 3ULUC 4APQD 3V4PL 1YPZE 2J71A 4NQQA 3ARDB 3AITA 2XBTA 4AYGA 3QHTC 1Z3GL 4OVUA 4QHNB 4C55A 5EUOE 1MFAL 4HIPA 3DETD 2IH3B 4QNPF 4WF7A 2VDMH 4JPIA 4PN6A 2JB5L 4WI0A 1RLWA 3QO0B 4GBXD 2W07B 3NCMA 1MLBA 1S8DB 2AK4D 1CI5A 3EBGA 1NGQL 2F8OA 3UTQB 3VFTB 4NQDB 4NQEA 4OF0A 4GRWE 5J11B 2DEYX 1UVQB 3FB6B 2R59A 1CLYL 1CFVL 1WWWX 4QOKD 4ZAKB 4YDKH 2CALA 4RQQA 5E1QA 3MLZL 5AENA 3KPSA 3NJNA 3Q7JA 1I3GH 3LKSA 3TLRA 5I0XA 2ATPB 3R4RA 5DWUL 2NX5B 1QUNA 3QRGH 4HUMB 4E0RB 5IUSA 2J5WA 5IW3A 2AEIT 3AM8A 4Y16A 4HLJA 4ZSOA 1IEAA 2V2XA 5JXEC 3K8MA 5D1XE 2NY0B 2VDRB 5K9OB 1YN6B 2EKSA 2PYED 4HFWA 2IO5A 4FRWA 4PVNA 1A4KA 3L7EA 5GGSA 3RIKA 5IF0B 3UTPD 2DYSB 2MRYA 3IMTA 4MS8D 1DVUA 5K9QI 4KKBD 4LBEB 1GGTA 5BUGA 2F5AL 2AITA 1XIWB 2AKRA 5F0LB 3DX8A 4PJBE 4YHMH 3BRFA 3ES6A 5KS9E 4HGWA 1HH9B 2X9YA 2CIKB 3FTWA 4JM2B 5E6IC 2CHNA 5G55A 1YNTA 4NKIH 1KJ2H 2ZSWB 4K5NA 3LRLA 1W8NA 3Q48A 4KZDH 5I5JA 1LO4L 3BVDB 3D25A 5C09E 3WXVL 3MJ8B 5FYKE 4EBQH 5IEHB 2HTLD 4XAKE 4IGBD 4XOBA 3DOSA 3MU3A 4OU3A 4MA1B 2QSVA 1CGXA 3VGEA 4I3GA 2KQMA 4WJG3 3EFFB 1OHQA 2WXOA 1N2RB 1TJMA 3WAJA 5AZEL 4QRSA 1A1MB 4G8EB 5DZ9A 4C47A 1UD2A 5DYFA 3TN0A 4GI6A 1NLBH 1YNTF 2NY7H 2HH0L 4XX5A 3BP6B 3VA2C 2X10A 3PE9A 4YHLL 3CFEA 3TCTA 3EJTA 1HVXA 1F8TL 5D55A 5AVTB 3N04A 1JYNA 5L8LB 4G7QB 2YRPA 4NWTL 3DHMA 1YMMB 2CLRA 6FABL 4E68A 1PFCA 1PNDA 1FIGL 2OMWA 4O02H 1IFGA 1OZTG 32C2A 3GI8H 4NUQA 2ZCKL 1MCNA 2VWEC 5HGAB 3P02A 4K15A 4Y5YC 4DNLA 3CFJB 4I77H 4JB9H 5F7EH 2H32H 1M71A 3HAEA 4Y0GA 2WCGA 5ESQA 5BV7L 3T77B 1A9EA 1ZXQA 5DJAB 1UCBH 1HL5A 1WBXA 5ALCH 1B9KA 1HSBB 2AEPL 4YPJA 1AQMA 1KBBA 2P5EE 3FB8A 1UWYA 2GAZB 5E99H 4LEXH 2H6UA 43C9A 2ICWJ 3H42H 3CFCH 3FS9A 2XPZA 3BP5A 4OM1L 5FYKU 3KLLA 5B3JE 1NAML 5IMKA 4LLAA 4RCAA 4PJ6A 4WEMB 5JHDB 1NCOA 1C5DB 2DLEA 3SBPA 4NP4L 1ES0A 5C86A 1A3QA 2J1YA 3NZ8A 4JPSA 4OQTA 5C3TA 2NQCA 4ETYA 5GSRB 4N26A 1CWVA 3LZFH 3RVWC 3TA3A 1ZDQA 5K1JA 3CFIC 1RPQA 4JPWH 1EFXB 4XCCH 4KY2A 2WBWB 3GSUA 4GMSH 4KXZI 4P0DA 3RDTD 5EEUA 2BHUA 1IL1A 1RP9A 2J1KA 3ABLB 4QGYA 4QO1A 2ITEA 3UADA 1AI1L 4M56A 4NI3A 5DO2D 3G08B 4NM4L 4R8WH 1JWSA 4NO5B 4A6YH 4Z3TA 2WGXA 1NOFA 2V9QA 1NCNA 3BKCH 3D0LA 5I74B 2G3ZA 4KO7A 4QY8A 2WKOA 3FUMA 1A3LH 3AXHA 5D1ZA 3RX9A 5MI0B 4G42A 3HZMA 3R8QA 3QE5A 1CQYA 3FOMA 3NABL 4X80H 5IFAH 3ARFD 5J13C 5IFJB 2J5LC 5J1AB 2UUDH 3QUMA 3HHSB 3KYOB 1KC5H 3MXVL 1EXUA 3OGCA 2EEDA 4G1MA 5BO1L 3RL1B 4I18B 3MGAA 4MJ6A 5I8EA 1IAIH 1F4YH 3ARSA 4HZLA 3ZKXC 4UIMA 5I1JL 3ZYIA 3TYFB 3F62A 4POZC 4ZODA 4N9GA 1INEL 4I0PC 3ZL2A 1G9NL 3ARDC 3EH2A 3NCJH 2HLAB 5I1DA 1CFSB 1N70A 3ZE2F 1NBYA 1KBGL 2LAGB 3AXIA 1EAPB 2WD0A 3FDWA 5GJTH 4PTTA 3CZLA 3MNZA 5EUOA 1BVKA 4Q6YA 1VCAA 1AY1H 1MNUL 1PQZA 5GS0H 3OKOB 2J72A 4KQ4H 1MCIA 1JZJA 5HJDA 5AD0B 4E41E 4AKQA 1H3XA 5I1AA 3BGAA 1T7ZA 3IU4L 2IWGA 1U8MB 4WY7H 1JZ7A 3TNMA 5DZAA 2DZEA 2L04A 3VG9C 2BIHA 3X1EA 4M00A 1MAML 3MJ7B 4XODA 4LLQA 3ML8A 1TMQA 5F96H 2SODB 4GP5B 1RURH 5LXGL 3T6QC 2UY7B 4N5UA 2AXHA 4YHZH 4UAHA 1BVNP 5CJQL 1TNNA 2AEWA 4XVTL 4DGWC 1KN2H 2X2UA 3K2UH 3P73B 4K7PX 4MAYB 3DRTA 3R1GL 3WE1A 3BEWB 3FSVA 4OLXH 3DTXB 2HFFB 4XH2B 1U8JA 3UEZA 2GJ6B 4K8RH 1Z9LA 4Q74A 5BV7C 3OKOA 1HDMA 2IGFH 2MH4A 3UTZB 5E1AA 3HMXL 1F3JA 4ODSH 4XN4A 1FJ1A 3HRZB 3ZR5A 1NWOA 1F1DA 2OTWB 5CXPA 7FABH 3FOMB 3IMVA 2W88A 4NC1E 4A68A 2KPNA 3O6ML 1KBKA 1RZIB 1NMBH 1XCTB 2YEZA 1BAFL 2WN2A 3DIDA 3F01A 4HIIA 3F12A 5LWYL 4H26B 4LLYA 1QG3A 3NN8A 4BFFA 1ZT1A 5KS9A 4HT1L 1B0IA 4JHWH 5LAXA 4UMGA 3L4WA 3I3BA 5FGBC 4X4XA 4BSVA 3C5ZC 3M6DA 4K5LA 2YD2A 3DXAD 3GMOA 4IRZH 1TT6A 1XB3A 5EUKA 1CFSA 2F0CA 2FECL 2ODHA 5EZPA 2PCXA 4CU7A 1L9SA 4WU5A 2XY2A 3WFCL 2E86A 5K9KB 5IMMA 3BAYA 3EO1B 4DFIA 5JHLL 3HBQA 3ULVH 3V6OA 4PGEB 5GXBB 1V3KA 4I18A 5HJ3A 1Q0YH 3AG3B 4JRXA 1AZRA 2WP3O 9PCYA 3CFBA 2VNCA 1JVLA 3MRPA 3NJGA 3V0IA 2NR6C 5KJRH 3L08A 2C1PB 1D5ZB 2F7PA 3I50H 3LVTA 3MV9D 1L9MA 3D8MA 2BOBA 3IXTB 4Q4EA 5KJ7E 5KVDE 5MP6L 4XX1G 5T3ZE 2ZKHL 4WDIA 2C9VA 2H5UA 3W9EA 3CFTA 3QCVL 4UBDD 4Q9QH 2G5RA 4Y2DA 5JIQA 1WFUA 3LXAA 2QSQA 5IKCA 1WC7B 1KXTA 2JQAA 5TGBA 1IC1A 1XSJA 4KXAA 5T1JA 1A3RH 3GSVB 5INDA 3R7RA 2CZNA 3U9PL 2NNAB 3VFWA 1PZAA 3KL3A 3LHPH 3OL2A 4GW1A 3FFCA 1ADWA 5A16A 1BFTA 1UEMA 1BD2E 4J39A 5C0RL 3EGDA 1EFXA 3C6LC 3BN3B 4JO3H 5LCVL 2GJ6D 1P6AB 1XF4A 2HRGA 4I7ZC 4L3EA 4QRAA 2PLTA 1GS7A 2V6HA 3EO9L 3SYQA 5JXAL 3HNVL 4P4KB 3E9TA 2OMWB 3UAJC 3MR9B 2VH5L 1KDJA 2A2QT 3EO0B 4K7PL 5IM7A 2VDQB 3NA9L 3TWCH 2YAPA 3CLEH 2D0HA 3DLQR 4M3JA 3T77A 2GUOA 3MRFB 2ADIB 4D8PB 3X12A 5MEQA 4ZMNA 1NC2A 4M8QB 1E27B 2JJSA 3LXBA 4Z7WB 2VAAB 4OCYL 1L7IL 4KHXL 2CM6A 3IMRA 3S36X 4MNQD 5IW1A 4EKJA 3KPNB 3X11B 2EXTA 1ET8A 1FZOB 1WF5A 2HLFD 3CCHB 1A4JA 1WISA 3UZQB 1JS4A 2YO3A 4CJ0A 2X70A 2EC9T 5KVGH 1FDLL 4HG4J 2QDVA 5CBAB 3TBVA 1T83C 1TZIB 1D9KC 1S7QA 2Y2WA 5T1KB 4ZYKB 3HZYA 3VX0A 5A2JH 2ZX9A 2D4FA 5G4MA 4DO6A 5HHOE 1JBJA 2OYMA 5INCA 1ZVYA 3TT1L 4OJEH 1BF8A 1WFMA 1G0DA 2H9GA 3S97C 1LMIA 5C70A 4U31A 1TZAA 4RSVA 1XO8A 5TFSH 4EDXA 5F71A 2WXQA 1G9MC 5DRWA 3OXRA 5DMKB 5BQ7B 3GSNL 1H3PH 2HFEB 2LE9A 1EHLL 1CQKA 3CVIL 1XCWA 4WSJA 5E51A 5B1BB 1YNKH 3MV8A 1JZEA 1Z5HA 3G08A 3TO4A 1SBBA 4TSBL 5I6XB 5E4EB 4ZAKA 2XBZA 4M5YH 4RMQA 1FPTL 1U8KA 4U4BA 5GS0C 1KTBA 2OFQA 4HFUL 4KV5F 5HHQB 3P9WB 2Q3AA 5CCGE 1XH3A 2C5DC 4PMFA 4OT1L 2PYEA 5D7KE 1OAKH 2EXSA 3IK2A 1RKRA 3OHXA 5HGGS 4HVBA 1GKOA 4AC4A 4PRPD 3ATFA 4JJHA 3VXRD 1PZ3A 1S7TB 2HCZX 1QNZL 3IJSA 4ZD3L 1TQBB 4XRCB 5IBLD 2FJGA 3ABGA 3F85A 3V4LA 5BS0B 2X3BA 5FV2A 3MOBL 5JPMA 4RX4A 4PG2C 4IU3A 3GNML 3TVMD 1KF9B 2F74A 2N0KA 2AF2A 2Q76A 3IFNH 2X6MA 1QWNA 5IHUH 1FO0L 4PGDB 4HC1L 3NCWA 3BVNB 3S8FB 1E0OB 1K6QH 4WNQA 4KJYB 3PWNA 4AGLA 2FWSA 1BF5A 3V9EA 4C54A 2UXGA 3VXTB 4M8RA 2P5WA 2FEEL 4Z8FH 4GKNB 2NX5A 3CMOL 4XVJH 5JW5B 4U05A 2NUPA 4MHHG 4BFGA 1H8NA 4G1EA 3WNKA 1IGTA 2WC7A 5IFHH 1WEJL 4MAUL 1RJYA 4YFLF 1PJ9A 2K9UA 3L3JB 4XBMA 3HS0B 2XTJC 2GI7A 4MDIA 4ZUUB 1HQRB 1ASQA 2ICWI 2ESVD 1NBVL 1N6VA 3T0DA 2VW4A 1ADQA 4E41B 4QRTB 4AXWA 3DJRA 3IN0A 1KGUA 1QW9A 2GSGA 2E59A 3ZE1F 4OCLC 5A1AA 3NIDB 1CXLA 3HPLA 5CSZA 5KSUB 5IIEB 2C3WA 2P80D 5DUBA 1ZLWH 1KXQE 3LS4H 4YDVB 4W4NA 5KYUA 3WIHL 1XSKA 3V6OE 2KH2B 5C08D 3BAWA 3WN5A 2GT9B 4GYBA 3MZTA 3KNBB 4ELMF 1JK8B 3Q2LA 3MUGB 3O4LE 3BQUD 5EZJA 1QMUA 4M9PA 4NNYB 2QGDA 5DK2A 5B21A 3ULVF 3E1F1 3C8KA 5LQBH 5L8KB 3TXAA 1UTDA 1N2RA 4HPOH 2L7QA 2QVFB 4MASA 4Y9GA 3S35L 3TONA 1RIHL 4JR9L 1ZE3C 3PWVB 3N1FC 1ASPA 4I2XE 1KGIA 4OBSA 4PB9L 5HYEA 4LLMA 25C8L 2O6PA 4X8XA 4GAFB 1MHPL 4ELKA 1J0IA 2WLHA 1KGWA 4LQFL 3HPLB 3L3GA 5DO8A 1BZOA 1TTGA 3H3PH 1YYCA 5EV7A 1XIWD 3NH7H 3HVNA 4KKPA 4ZDHA 5KYUB 3D0AA 4JAMB 3A3YB 1Q9KA 1RULL 5CNHA 1CLCA 2X6BA 1MJJB 2NY1D 1U3YA 2C9SA 3MV01 3FB5A 4M3KB 1MRDH 3S35X 4YHIB 1T0NB 2J2ZA 5C2BL 4JM2F 1T0MA 3U83A 1KTLA 1TQSA 2P5ED 1BREA 5D7IB 1SPDA 4HJ0D 3H9SA 4ODWB 3VD4A 1NIEA 2O6DA 1SXZA 3L3JA 1UEYA 2V9TA 4R90L 1XF1A 3IDYB 4OFPA 2ZCHH 1UH2A 5EOCH 3T4YB 4LRNH 1LEKA 4ZTOL 3QI9C 4YVUA 4PJXB 3TNNA 3GM8A 3ZRSA 1F4AA 1AGCA 2Q3ZA 3RL2A 3M46A 4BZ1A 2GEQA 1NJ9A 2IMNA 1IEAB 2V2XB 5F1IA 3F83A 1WBZA 2F5BH 2HKHH 4JRFA 5KYYA 1YYMH 3AWGA 1AZCA 2H26A 2XG4A 4R5TA 1F90H 5FA4B 1FWXA 2DN7A 3N43F 4Z77B 3PAUA 4PVMA 1NFKA 2MCAA 1P2CA 2NXYB 5F9JB 1J05A 1OGAD 4M7JL 2YEVB 4F24A 2EIZB 2R8SH 2ITDA 4R26H 2A77L 3DO4A 5DJYA 3VFUB 1TF4A 4Q8BA 1NCTA 3PFQA 1G9MH 1HIML 2AMGA 3GHBL 1XH3B 3Q13A 2HXAA 5DZNA 1NC4A 3NJVA 1CGSH 2VZOA 2BIOA 2V17L 3D7PA 3IJHA 5F8QC 3KXFB 5B39G 3SDCD 5EULV 4HKXA 1IGFL 2QQNH 2VQ4A 4JFPB 3RL2B 2HX9A 2VR9A 4OQTH 2NYYD 5AVXB 5LG6A 3KGTA 4JG5A 1WBZB 3K2IA 1RZKC 2CGRL 4WTQA 4F7KA 1OSZA 4F27A 2BWQA 3KH3A 2C4FT 3BQUB 5DSCB 1IBGH 1CD8A 3KJ6L 1MPAH 3VGFA 4N2DA 1AS6A 2X9XA 2XG5B 3ECUA 4TYUA 2XIBA 3IFPA 3GK8H 4ZTPL 5B1JC 4ZT1A 4ALAC 2RCSL 1DN0A 2IMMA 1R75A 1YEIL 2QHLA 4G6JL 4DVBB 2CE6A 4A6YA 5DS2A 1HKLL 4JKNA 3DRQA 4Y9CA 3ZX1A 1A66A 3ULUE 4HV8A 3S5YA 2XQYK 4PJBB 1FGNH 1WGOA 4JG0L 3UTTE 1KB9J 2K3HA 3LEXB 5DD1L 1CVSC 3P69A 3ESPA 4RFOH 1WIUA 3FQUA 1S78C 3LZLA 4X8CA 3DMMD 4IS6A 4J3XA 3VFNB 2OYPA 1F4HA 3Q5OA 2YQ2A 2B2XL 1WLHA 3SD5A 4WEUD 4DGIL 4ENED 1NFDF 3OR6A 2P8PB 1FE8H 2P7TA 4FXGA 5GGUA 3CN1A 4JHZA 4NUMA 4AGOA 4DEPC 3GRBA 4YHKH 1FG2B 2NX5E 3HPJA 1BF2A 1ZS8A 3QEQB 4UILL 4CADA 3U7WL 2BSCA 4DHLA 4JVWA 4ODXB 3GPEA 1MHHA 5EU6D 3TJPA 1IC4L 1MJ8L 3S37H 2Q8AH 3K91A 4MNHB 4A7VA 1TFPA 3DVFA 1FCGA 1UOVA 2DQDH 1B4JL 3OPZH 1WSST 2YGOA 2JB6A 1GGBH 1OZUA 1F02I 2YRZA 3LSOB 2VN4A 4HWUA 4M5ZH 3LTVA 2R23A 4NKOB 3GRWA 5D1XC 3TVMB 1JYVA 5AYQA 1UFGA 1V05A 1X3DA 4WEBL 4HJ1A 3B2MA 5JA8B 5E9DB 1HNGA 3VQ2C 2AK1H 3ZL4L 4EI5C 3ZTJH 4L37B 3E8UL 1HX0A 2YN5A 1FNEA 2AV1A 4XAWL 4CVZB 4GT0A 1TQVA 3KYMB 3VQMA 1NFIB 1LO2L 4MGXA 4YXLL 1AE6L 5TGBB 3U0PB 1E4JA 2WUCH 3L4XA 2F7OA 2OQJB 1OCRB 4Y8AA 1CT8B 3N43B 2QADB 5DJ6A 2X38A 4JHBA 4FZ8H 3OHXC 2H47C 3QUMB 3H9YA 1DVFA 4UB0H 3FFOA 1N64L 3LRKA 5KSAD 5FYKD 4FQHB 4ES8A 3F6LA 2V7HA 4GS7C 4KO5A 4KO9A 1X5IA 2VDOB 2XQYG 4MWFB 4Z0BH 2BPBA 3Q8CA 2QQKH 1KB3A 1MOEA 1AIZA 1JD9A 5IJVA 1Q0XH 2WQAA 4LZKA 1RUML 4FGMA 1XB6A 4HUWA 2XIIA 3LH9A 1OW0C 2WUBH 2K7PA 2PF6A 3MSPA 1JNHB 1AG6A 1KFAH 2BIIA 3LQZA 4FTVA 4ABVA 4XE5B 1AKJA 3FTVA 3H9ZA 5TE4H 3A4DA 1QZ1A 3D85B 5DVOA 1RZGB 3SDAB 4KX8A 4HKJA 5LBSA 2Z8SA 1QI3A 3EOYG 4DF9A 4WI9A 1DDHA 4JM4H 5K69A 5A2BA 3F7PC 1BVOA 4WIQA 3GMPB 3ZJAA 2WWNA 4KDTA 1EZLA 15C8H 3OWRA 1A6UL 3BT2H 3S8GB 2Q2EB 5FDYA 3IDIA 2R4RL 3MYJA 1PLBA 3ULVD 5AB2A 5EF1A 3KPNA 4OVVA 3HHMA 2VDOH 5B7MA 2W38A 1RJCA 4IW4C 5D71L 5IWLC 2QGCA 3RY5A 4AIEA 4NZUH 8FABB 2EDMA 4HUWB 3Q44A 4PBVC 1QA9A 4OLUH 2FVNA 5KOMC 3U9UB 1TTAA 3WY4A 2IV9A 1JFHA 3MO1A 2O5YL 2XN9B 2VXTH 3G5ZA 2EO9A 4M1CC 2ZOOA 1HK6A 4WHDA 4OIAA 2XXCB 5JIIA 4IBYA 3FN0H 3HJ0A 3OLDA 3QI9D 5I6PA 4AQAB 1KTJA 3ZYJA 4JDTH 5HHVH 2FJUB 1JNNH 5EZOH 2HFEA 3HE6D 4OZIE 4MXQC 2WSDA 3QNFA 2FJFA 5D2LA 4UQ3A 3D52A 3N3EA 4NIYE 5D7JC 4F15B 1UYWH 3CIAA 3MCLH 4MNQE 4NJAH 3WCYA 5CEZD 3ZT6A 3K4DA 2DWTA 5BOPA 2BVPB 5F7DB 5DA0B 3HB3C 3M8OH 3CCHA 4MQXD 4NP9A 5IQMA 3QNYA 3TO4B 2DOCA 2VM9A 5ICXA 2OP4H 2CCVA 3DUHA 1H5BA 4KXZH 4L1LA 5GRJL 1SJMA 3QUXD 4PREA 2B1AH 1E8ZA 4K9EL 3QQ4B 4RAUB 5HHOD 4HUKB 5HHPA 4IOFD 3NP4A 3C5XA 4OZIF 2EDJA 3PAVA 5GGRY 3OKNA 4TUUA 3VD2A 4P9HC 5DUBB 1G1CA 3TEUA 1SDDA 5K9QG 4AJYV 4NQCB 5IBLC 1HXYB 1HINH 4JFVA 3TWYA 4CN4A 4PCSA 5B7FA 5HDRA 1BZ7A 1OCOB 3PWLA 3VU2A 5F7HA 3CQPA 1PF3A 3N85H 5KZCB 5D7HA 4DH2A 1UADC 4N8PA 4QJ4B 1FI8C 4HZLB 2BFGA 5FEBA 4GKOA 4IRJB 3D0VB 3NG5A 2X1PA 3SPCA 5D7KD 1JJUA 2X1OA 3SGJA 5HXMA 5B38G 2V7NB 2VDPH 4G83A 3VGAC 4XMKL 4IRSA 5JW5A 4RLDA 1YN7B 1A5FL 1NGXA 4MJ5A 2CXGA 5E6SB 4WO0A 3O3AB 1M7IA 4PJ8B 5F88A 2EXWD 3DJZA 4YEEA 2P47B 1O6SA 3BAEL 1CURA 4NHCH 4QY8B 5ACZA 4B9ZA 5BZXA 1WA1X 3GSVA 1PZ5A 2AVGA 2ITCA 5HYSG 2PMZA 4XXWA 1IX2A 4E5XB 4U1GB 5HY9B 2BC4B 1OE1A 2DMHA 4A39A 1OIOA 5FO9A 1A7OH 1FL5A 5FF6A 2VDRL 4FQIL 3C5ZB 3FT1A 4L4TD 2FIKA 2Z91A 1P4BH 1E2WA 2FJHA 1RMFL 4EN2A 3PAYA 4O2FA 3AREB 1YQ2A 3HC4H 4E9SA 3KG5A 3OMZA 1A8ZA 1YHPA 4KHTL 3UJTH 3RKDD 4P59H 1YEHL 3SY0B 1CDJA 1FFRA 3UO1H 3ARFB 2GTQA 2QVKA 4Y9EA 4BV1A 3D87B 1DQMH 2AQ1A 2J1WA 1AC0A 1OXYA 3WY2A 4H8QA 2FT6A 3DRTB 5B1KA 4OM0H 3U0PA 5IK3B 2WWMC 4KGJA 4ONGL 3V9FA 4UZSA 2R56H 3NAAL 1C16A 4JO2H 5K1VA 5I75B 3BC9A 4HUXB 2DWSA 1HE7A 5J89A 4KKQA 1FFPB 3T08A 5EIIB 3VM7A 3LN4A 1AIFB 4LLQB 3PP3K 4NYLA 2HUEA 3AABA 1QBLL 4LP5A 3DOIA 2J88L 3B1UA 5TDOB 3U4BL 5J1TC 4L29A 1ND0A 5FLVA 3LZPA 4K7FA 1XH1A 4H0LC 1OAQL 1J86A 4KNSA 4LLMB 4ELKB 2C4FU 2UY7A 3MV8E 4FQXC 2YPLE 4RMVA 3O0LA 4K3DH 1T03L 2CUHA 3CFDB 5DVLA 4ZMQA 4FNQA 2DQCH 2JQMA 3W2DH 1LEGB 3S96B 3AADB 1PZDA 1DFBL 4FMVA 4FAAB 2YD4A 1XSOA 4AT6A 1HEJC 2BVEA 4C83A 1M42A 4M62L 1K3ZA 4QXGL 5IBTH 4LDEB 4XNYL 3UTZA 5HI4C 1Y07A 2OJZH 4FL4C 2M2DA 2DWDB 2G9HA 1S7XA 4MQXC 3FOLA 1CE1L 2WANA 4NRYB 3NIFB 1S5IL 1W91A 3F12B 1VF5C 4IHOB 3NYKA 1HHIA 1ONQB 3MV9E 1Z2KA 4GRWB 3CVHH 2X0VA 2ZYIA 5CP3H 3EYVA 5TQ2L 1L7TH 4YR6B 1Z9NA 1NBZA 1JFQL 5T3ZD 1M05A 2QGBA 2APXA 3T6VA 5IQ7L 3HMWH 2Q20A 1CL7L 1HHJB 3N40F 3KPQA 3OKMB 5TJWK 3ZOAA 1RFDL 2WP3T 3W38A 4C59B 4ANKA 2NDFA 1P5VB 3TFKD 3ARFA 3PFUA 5EO9B 2XZQL 4GI8A 5I0YA 4AQAA 2IADB 1PSKL 3ULUH 2YBRB 5ELIA 4ZS7H 1EFXD 1MNNA 3AT0A 1USQA 3GBMH 5MI0C 3PWPE 2ENYA 4JBSA 5MERB 5IOPA 1QP1A 4BHUI 5F7UA 2OBGA 4N2FA 2ID5A 4BFNA 2GHZA 1OVZA 1HYSC 1E4WL 4KRLB 5L0QB 4KK6D 1XGUB 2Z93A 3ZZ1A 4PLJD 5DWPA 3BN9C 4N0YL 1JZ2A 4H1LH 2EH7L 3IE4A 3HC0A 3TA3C 3V0AC 1WCBB 3HRPA 3NSXA 2YARA 3OJVC 3HE7C 1S9WA 4GJTB 5LN4A 5FUCE 3JV0A 3C5JA 3U4EB 3WIIH 1XXFC 2EEFA 3O2WH 5FFOA 1J0ZA 1IBHA 4TNEA 5LB1A 1FZMA 2AXWA 4UDUB 4W9IC 3PP3H 1EEYA 1DCLA 3GMRA 4FFZA 3MRCB 4JKWA 5IROC 4LGRB 1DJSA 4FYRA 3BVVA 4M3HA 2DI9A 4KROC 2WB1A 1A1NA 1ORSB 2XKNB 1Y1UA 3U0TA 4U1GC 1IGCH 3UG3A 2YMXH 3WIFA 2R1XB 1RIVL 4GBXC 2NQ3A 1OQXA 1OGPA 3TZVA 2WVTA 2WZ0A 1MRCL 3Q06A 3WHE1 1QVOB 2HT2C 1G7QB 2QMKA 2UWEF 4GFTB 1FNEB 2AV1B 1MREH 4QHMB 4NUGH 2IDTA 5J7CC 1KBVA 1MCRA 3DK2A 1NC4B 3WELA 4UWQB 2XXFA 3ARDA 4L4JA 4Y5YB 4NXKA 2ZF8A 3GSOB 2AAVA 5J6SA 5C6WH 1GGCH 1VFUA 4M4RB 4N0UB 4CW1B 5DZPA 3BLPX 4CU6A 4LOUD 3MYZA 4ZTEA 1QR1A 2H9GB 1MI5A 2VSMB 4N2GA 3UYRL 1MCKA 3A6BH 3NBNA 2O93L 1MI5D 1NSNH 5KOVC 4G6MH 5EC2A 3IVKA 1A6VL 2BFVL 4YOKA 3RRQA 1BQSA 3F7VB 4PJ5B 2NY5L 3JSSA 4UT7H 5FYLE 3VRLE 1RAMA 3T6ZA 1DQDH 4P3DA 3ZK0A 2EUXA 4RDQF 3LH8A 3VXUA 2HRLA 4D0BA 5E56A 1TLMA 2B16A 4DESA 4WI8A 4MVBC 5D4QA 1HYSD 3QQXA 3B9DA 2QT6A 5GJSH 1I9RH 5CCKH 2DEWX 4K71C 2P8LA 5EPMB 1NBCA 3ES6B 4YZFE 1C5CH 4UM9B 3ERXA 4J3OD 4RWYL 3JVGC 3FUNA 4ZFOL 4KI5E 4PRPE 1VENA 1DYZA 1GCYA 1UD4A 2HG0A 3WXWL 4YDMA 1QQDA 3KWTA 3MJ8A 1N3NB 3A6CH 5D7JB 3DI2B 5D7IA 1J5OL 2MSPA 5IV2A 4OFDA 4RETB 1C8QA 4AGNA 2IPUG 4HMDA 3FTSA 4HF5L 3I84A 3B5GA 4RFEB 1TKWA 5I1EH 3L4UA 4K23L 1JHTA 1BLNA 3D2UD 5HDLA 2DI8A 2WYTA 3FQXA 4MCMA 1H3TA 4GSRA 4BXVA 2M26A 2XQ0A 3QULA 3VM5A 4B0MB 3WLBB 2P5EB 1RQ5A 4YXHL 4D0DB 3AS2A 3WUWG 3KPRB 4XP9L 3IJYA 5DMGC 1BMGA 1NCJA 1OAUH 4UTAA 5CMAB 1DE4B 1X5YA 1I1AB 1IFRA 1CYXA 1SJVA 2GK0A 3ASNB 3RA7L 3PGDA 2GW5A 4W9JC 5ACLA 1TQCC 5AUMA 1Y18A 4HOXA 3PIQB 3MJWA 4PW9A 1KPRB 4U1NB 4R4NC 4OGYH 5DJZB 1CT8A 4FA7B 1J1XL 4R4ND 4N1EA 5MEPB 2HVKA 4FXTA 4KDTC 1FFPA 3VXTA 4JFXA 4QTIL 2W95A 3SOBL 1ETZB 2H1LM 4ZUTA 5BRPA 1CXIA 1KT2B 3HUJA 4XXCA 3APMA 3QEUA 5SWSA 4K4KA 3U1PA 3V7AE 1N26A 1K8IA 2M1KA 1QASA 5BZWB 1UWGL 2DKUA 5MERA 3MMEA 5D96B 1JPST 1W6WA 2GTZB 3IRZA 5ENWA 4PRIE 1QO3B 3UTQA 3VFTA 2QADC 1XCXA 3RWGA 1BGXH 1MHEB 3WJJA 5DS8A 1X4XA 2JIXB 5HHXH 4GBXA 1MY5A 2DKMA 5TH2B 4BUQA 1MFAH 2COVD 3N42B 1EO5A 1X9QA 1WZLA 3BVXA 3M1OA 5D96C 1IC7H 4A7GA 1L9OA 2Y7NA 1BOGA 3O3AA 4YC2C 1PY0A 3K6DA 5JPMB 4R0LA 3MX0B 4QRQB 4GUPA 4KU1A 4M6NL 4P2RA 1ZTXL 3M1CA 2VO8A 2A9NL 3J27A 4UNUA 4LCIH 4XNMA 5E8EA 1RZ8A 3VSQA 1CDBA 2W94A 4LLVB 2W0FB 1XF5A 3OKLA 2VERA 4FNLL 3Q8AA 1HESA 1IGIH 1I3GL 3RIFF 1BP3B 1G0XA 4M5TA 4UTBH 1LILA 2AABH 1BX2A 2QBWA 4NPJA 3UBFA 4R97C 1HEZB 2AXFA 1Q9KB 4D94A 3SGDH 4P06A 1SFHA 3L2NA 3LPFA 2QVMA 5SWSD 4G59C 1NMAL 4JL2A 1SDDB 1DN2A 2UZPA 2GC4C 2PO6B 4HBCH 4XB8A 1AXTH 3VE0B 3FHEA 1HQ4A 2WCSA 1L9TA 3E9UA 1E3XA 1U8LB 3EJZD 4PI2A 2Q6WA 1DE4A 4QRTA 4PJBF 2IDSA 4J23A 5IB5A 4HS8L 2FX8L 4G8AC 5F44A 1D5XB 5E5MB 3BKYH 2Q2LA 1E8YA 3ESOA 2B14A 1NBYB 3EYSL 2ZG3A 4ZPVA 5FM5M 4ENZA 5JW3H 5IT2H 1TZOA 1KBPA 1CZ8L 3B9KB 3FU7A 3IKCB 3FT4B 3IMWA 4J27A 3SSGA 4K7FB 5E2TL 4TF4A 2BP8A 1JGLH 4XN2A 4UQCA 3VMOA 2E27H 1VGEH 2I9LA 3V8OA 4NQED 1IAKA 3COOA 1IARB 3MUZ1 4NCDA 5ETUA 3TX4A 4UOJA 5HVHC 4UYQA 3RWCA 2F15A 4NNYA 1DL7H 3VD5A 2O6EA 1EXUB 3RL1A 1GOGA 1P9MA 1RZQA 5I75C 1J1OH 3QC6X 2NZ1A 4JFQA 3PGCB 4XP1H 4OCNC 2FJHB 3ULUF 3VFVB 5FCUL 4H8WL 4QYOA 3IFOB 3QFGA 4OIBA 5FO9B 1LLAA 5DR5H 1QVOA 4TVPE 1ANUA 2ZWSA 3FUJA 3TT3L 2CK0H 3LH2H 3VXMD 2OX5A 5B4MC 3CH1B 2WXGA 1D5IH 4KKLD 2R0WH 2Z92A 3IDJB 2IH1A 1TQWA 4APXB 2CH8A 4M4RA 4PJ8A 5F88B 2J43A 3PQYB 5DJ2A 3CLWA 5E08L 4IBWA 2Y6TE 3LRSA 1MI5B 1M6OA 1RZKL 5H35A 1E7VA 4E9LA 1UCBL 4PGCA 5HY9A 3CDCA 5KVEL 2WLIA 1PLCA 3KR3L 2PXYC 3INUL 3TIEA 1IEBB 2BX5A 1FL5B 5FF6B 3KM1A 1Q9OB 1LO5A 4HG4K 3V6FB 1ETJA 1NC4D 3VGAB 4OM1H 3GRWL 2P43B 2LU4A 5EOTA 1SJHB 1BIIA 5SWZB 1XL6A 3SYPA 5HDBE 3OB8A 3BLBA 1UD3A 1KLFA 1P4LB 1WS8A 1YUKB 3G5WA 3N5AA 4N90E 2DTML 4XWGH 5JO5A 3APNA 5ES4B 1TVBB 1NGYA 3MC0A 1ZS2A 2K0RA 3DJ9A 2EYSB 3KCPA 2ATAA 1KPRA 4U1NA 3PL6A 1L6ZA 3BIKB 3KJ4B 1GAFH 4Z7NF 1N10A 4ODTH 1LWHA 5EU6E 3EFDL 1MIMH 4W9CC 1FN4A 1J5DA 1U3JA 1U2HA 1BSIA 4F7TA 2NY2D 3IRCA 2Z7ZA 4AYEC 5E4AA 2YLHA 5DC2A 2DJSA 2OXHB 4NM4H 1FGVL 2Z4QB 1RUQH 3GPSA 2RB8A 1QSEB 1A1NB 3U0TB 1SVZA 4KVCL 3WIFB 3X11A 4BWUA 1JYWA 2CBOA 5DLLA 1TSHA 5SX4H 3QUXB 3VI4E 1EZUA 3WN6A 4BD4A 1OTTC 5C3LD 3I75A 4XZ4A 5HI3D 3W9DA 4HALA 1QKZH 5E7BA 2E7BA 1KEGL 1KC5L 1O9ZA 1U2YA 5BJTA 2V3FA 4Q0XL 3T2LA 4AKOA 4NC1C 5LVEA 3MR9A 5FUOH 1A7RL 1J9SA 1INEH 1BEXA 3A22A 3HE6B 1JZGA 1M7XA 4ESKA 5AG9A 4FTVD 4C57C 5CR8A 2QEJA 5ECJE 4PVLA 2DQFB 1E8WA 3IXAA 3US1A 5GJTL 2IWKA 1H6EA 1OSPH 1Q1JH 5GRVL 4AUJA 1VEOA 2XZZA 3PDOA 4TUOA 4EAEA 1BG1A 5E6UB 2X2IA 3D39D 1IGML 1MG3C 3DJTA 1G6RH 2CHXA 4HJJH 2N59A 1L3WA 4ZSOE 4JE0A 1M1XB 3MRKA 3LIUA 4B9CA 4D9QE 2OMUB 3CTTA 4HKJB 4RRPA 3TZVD 3HI6L 1YJDC 3WKNA 3ZIMA 4HWBL 4LFHD 3X1GA 1M9SA 3DHJA 3TH3T 4OAWB 4C58B 5F96L 1VCBC 5HPOA 1KENH 4O00A 1WZ1H 5MENA 5LXGH 3EDEA 2CGZA 1S3KH 1QATA 4QRRB 2X6CA 2UWEE 4ZUWA 3FFDB 1QX1A 5I6MA 4BRVA 3KZ8A 4O4YL 5KBLA 1OCWH 2V0AA 5JHAA 1M6UA 2G4GA 4XPAH 1OARH 1MFCH 3MJGX 4Y8DC 4L2YA 3CWGA 2N1TE 4PWEA 3AMLA 2Z8RA 4X5WA 2V2WA 4C56D 5CP3A 4OZHE 1JD7A 4B0MM 3S3DB 4F8LA 2IGFL 1N68A 3H9HB 4G7VL 2EYSA 1I9JL 2DIAA 3HMXH 4ODSL 3MTRA 1CICC 2VDNH 3F04A 4PGBA 2IFFH 2J6EH 3W3BA 4YHNB 4YN3A 5JPMC 3BCFA 5A2CA 1ACYH 5KYWB 2Y2TA 3TIDA 4Z7NB 1UT9A 3CE1A 4F7TB 1RZJL 3GMMA 1WS7A 2X12A 5EF0A 3QFJB 1OPGH 3BWAB 1AANA 1AXSA 1FBIH 2LFEA 2OI9B 4B53A 2FUQA 5JIPA 4WI5A 2XKNA 1BBJB 4N4YB 2LU3A 3VWJC 1SUHA 4MNQA 1SEQH 2VKXA 4PS4L 3AS3A 2X4RA 2FB4H 4QDGA 4H1LA 2I7OA 2QSCH 2EEAA 3G6DL 1D5ZA 3HNSL 5GRVK 3QG7L 4OCSL 4G82A 2BP3A 3NJFA 5D1ZB 3UO8B 1JF6A 1N8ZB 2DYPD 4TPRH 5D6DA 4YX2H 3VD1A 4CUCA 1E28A 2FHBA 5D1XB 1EEZA 1E8XA 1JWMB 2NW3A 4DQOL 4OZFA 5I73C 4X7SH 4MA8L 1T20A 2EYRA 1CFTB 5EN2B 5I1GH 1IL1B 3EKCA 3B43A 4ZRGA 2BHYA 4U1LB 4ZUVB 2ZXWB 1CMOA 2WLIB 3AGVA 4URKA 4FS0A 2XC8A 3SBQA 1KTKE 4BQBA 3AQYA 5IVXB 1H5BB 4LCCB 3F7QA 4XNAA 5F1SA 1E6OL 4JE4B 4WHTB 1KGJA 3U2IA 4DIXA 1SMAA 1M05B 4YE4L 5L7XH 2AJYL 3U4AA 4UUJB 2G5BA 1D9KB 3QO1B 5CINH 3QQDA 4JLRA 4HWEH 5KTEL 3ZYOA 1N4XH 4J1UA 4QXTB 3P4NA 4MMXC 3LHPL 1BBDL 5I30L 2GJ6A 3I9GL 1JV2B 5D1QA 3QUYC 4DK6A 2GUYA 2NY3D 4JO4L 2JLPA 2KUTA 3QZNA 1C08A 1BVZA 1CFQB 1CTMA 3VRJB 4ZUVA 3RTLA 1UWEL 3X3GH 1K4CA 3AQZA 4FHBD 3L45A 1J9TA 4WEEA 2XTJE 3Q6GH 2LTQC 3OM3B 1GGIH 4ZFZA 4P3CH 4PSRA 5AB1A 1PKQB 1T2XA 4HQQH 2E8ZA 2I5YL 3IDMA 1FH2A 2Y5TA 4NO2A 4EUPA 1B0WA 3CSPA 1N0XL 3KMDA 5KS9F 4M7KH 1U8PA 2GT9A 3CZNA 3W9DB 3DURA 5KVFH 1T1WB 3C6LB 1T2JA 1RJLA 3HHSA 2R2BA 3HUJF 4FFYA 3UXFA 3LV3A 2DJUA 2QPSA 1HZLA 1THCA 1RCYA 1SM3L 1QEXA 5L88L 3QNYB 1FDLH 1NCGA 4HJUA 4NNPH 3SJVA 4LSTL 4Y4HB 1HHHA 5CD3A 1FA4A 1AO7D 1AJ7L 2VDPB 4MYWB 1X9LA 4UU9A 4YIQB 1TQTA 5FC9A 4JHAH 1P1VA 5DJ8B 3VH8B 3VYOA 2LU7A 3CSBA 3TT1H 3PV6A 4OJAA 2GIMA 2BNQB 4G7YL 4R7XA 2HJLA 1AGCB 1AZUA 1NM9A 4K3HA 1H3WM 3MRLB 4AH2A 2YPLA 1RZFH 2ZUWA 1E9OB 5KJ4A 2NQDA 3KYKH 4W9ZA 3OKKA 3MFFA 1QLFB 3FBKA 2YGNA 4KUCD 2EYTB 1CFTA 4KFMA 4TSBH 4CBZA 4UT9H 4DGVL 2LLLA 1G7IA 1UFUA 1XD0A 2HT4D 3D51A 4HFUH 4ISVB 4N28A 2P45B 1K8IB 1I53A 2Z31C 1GZPB 3M17A 4NB7A 4R2GB 5E9NA 4G3YH 4XXDA 3O9WB 2BY3A 4PBWD 3SCMB 4PRID 2W07A 5F7LB 1YDPA 2J25A 3M88A 2DWXA 2IG2L 2FWUA 1YN7A 3MLXL 1AD9A 4MJ5B 4NKQB 4N22A 3QC5X 5E2UL 3FUDA 1XGYL 4IJ3B 4OF8A 4F58L 1Q90A 2BCMA 4OF6A 4PJXA 3TNNB 3LKNB 4QRPB 4ELDA 1DBBL 2AJVL 1DUZA 5T3XE 1QABA 1CYGA 5HDOA 4HETA 4AUYA 2ZIDA 4TS6A 3TESA 3SE4A 1R3KB 1BMZA 1OOAA 3GO1L 1IBFA 1K5NA 4TSAL 1P5VA 2NY6D 2XBDA 3H8NA 5HGHA 2AJUL 1QEWA 3L54A 1OM3L 4ELMA 4N5EC 3MRHB 5DQDL 1ZLDA 1A4CA 5EOQH 4NUPA 1XGRB 3PWPA 4NPYB 4XP5L 5LDSA 2BZDA 1EBAA 1T5KA 3PUUA 3IKCA 3LDBC 1O0VA 1YEFH 2OSLA 1JXFA 2A7BA 4AIZA 5BV7B 4U6XA 5KBMA 4JUSA 5DFVC 4D2NA 1QRND 5JPNB 2NZ9D 2WIIB 2LGNA 4JFUA 3CVCA 1GOFA 3FO2A 3KPPB 1E65A 5EIIG 1I3UA 4UM8A 1VDGA 3ZSTA 3OF6D 2I9TA 1I8KA 2TSBA 1AO7A 5IFHL 4F9LC 3GSNA 4MMXA 5LNEA 5SWSE 3OZ9H 4FABH 5IJDC 3C75A 3HZYB 1UH4A 4X6CF 1R0AL 4E42B 3FRUA 3T65A 2FLMA 3L6FA 3QHZH 2A5UA 1XR9A 5J06A 4YFEA 3FT0A 3MA7B 3CZGA 4XVSL 3SE3A 4JFWA 3QEGH 4LHJB 3MRHA 2AZUA 3EJUA 4LL4A 5H2BB 3ILQD 4DW2H 2EVFA 4XI5C 2IANE 2VZUA 2ZAHA 5IOPB 5EF3A 4ZZKA 1A64A 2XQBH 3GXNA 3WIHH 3S4SB 2ZCLL 2VRKA 5K33A 3ISWA 1T2QL 4GO8A 4UTBA 3QDGB 2YA2A 5IREA 3RWHB 1L6XA 3FU6A 1V7NL 4NQEE 1MH5A 2R2EB 1GY1A 3HS0C 1S7SB 1F6AA 5JQ6L 4G42B 4PRIA 5DFTA 4PVBA 4D8PA 4XPHH 3LZQA 4GG8B 2DI7A 2OM5A 1QUNB 2HRHA 4DP0X 4HPOL 1MWAB 1KXVC 1H3UA 2GJZB 3HCVB 4WUKL 5F6HI 4PB9H 12E8H 4Y1AD 3RJDA 2YMTA 4RISH 3GUFA 4PJAB 4U2YA 2XV0A 1MI5E 1IEBA 4LK4A 3MMEB 5J9PA 3S2AA 3NDZE 4ONFL 1A4KB 3AUVA 1KCKA 3D09A 1AD9B 3V4VA 2AHIA 2ENPA 2Z7UA 1WP6A 4PH8A 2ARJQ 2R15A 5F21B 1AKJB 1Z3GH 4WNQB 1G1KA 1ZXKA 3LNEA 2ED6A 3NUKA 1UXWA 2CBMA 2IPUK 3CSTA 2VABB 3ABZA 3HBGA 2NDGA 4J8RA 1KJ2B 5D6CB 1TYEB 3ME0A 1TCRA 3SQOL 5C2BH 4KI5C 5IUCA 2YAMA 3ULSA 4YE0A 3QG6A 4MXQD 5I82A 1EV2E 4HLZG 1DQJB 4KI5D 5B3SB 3UC0L 4ABQA 3KAAA 3FU5A 4G1EB 4I8DA 4BZ1L 2A4CA 1JERA 3B9EA 2P3YA 1HCZA 3KXFD 2KDGA 4ICWA 4PJ9C 2ZCHL 3T0EB 1EFQA 3BSZL 4HK0B 1UJ3B 3MODH 2ZOTA 3QDGD 1MVFA 2F54E 3QRGL 2XXGA 1FFOA 5EU3A 5I6XC 3QCUH 3RU8H 3DYMA 4I48A 2EILB 1SEBA 4QHMA 2Y24A 3HE7D 5I76A 3IETA 1YYML 3QH3A 1VEMA 2EINB 3CX5J 3NRQA 1BLNB 3A47A 5FHBL 3GMRB 4DUWA 1O6TA 3B83A 1F90L 4N2HA 2P44B 4R2GC 3WFBL 2Y9RT 3OXRB 4E9RA 4KQ0A 1HHKB 1U91A 3V55A 1QLFA 5KANG 3DOHA 5E9DA 3QJQB 1HFUA 2JJVA 3UTSB 3Q0HA 2YPVL 2A1WL 2G3NA 4R4FL 1C1EL 1E5BA 4P5TC 1JZFA 1OTUD 3GXFA 4YSDA 4LVHB 3IMBA 3RAJL 2QHRH 5IVXE 3OJDA 3IFLH 4XXDB 4NKIL 5E4OA 1V55B 2EC8A 4WGVB 5HHMB 5IMOB 4EIBA 1EJOL 2IAAC 5IMKB 1JCKA 3CXFA 3QJHA 1RUAH 3WXVH 2GPZA 3L13A 3C08H 3BDBA 5IGXL 1DHKA 3IDYC 1Q1PA 5AVRB 5CILH 3LQAH 4H25A 4P23C 2D7PA 3C09C 3D4CA 1MFEH 3MRKB 5SV4A 3QUGA 1W0YT 3NCXA 4WWNA 2DW5A 4AK1A 3AS0A 4XNUL 4BJLA 4AE0A 3KJ6H 6PAZA 3QXAA 1IAII 4RESB 1TZ8A 3RNQA 3BSGA 4IBQA 3FCGA 4RWHA 3WLWC 1TU2A 3VO0A 2NSQA 4IHBA 4NQTA 3EOTL 1VFAB 4PJDA 1T0MB 3BUBA 2Y0SA 3BZFB 3MJ7A 1G7HA 3K0YA 5CIPH 4MB5A 3WSQH 2NY6B 4N0CC 3QIUB 1T6BX 4K0OA 6FABH 1FGNL 4DWHA 5CD5C 2UY6B 1UKQA 2ZOLA 3MA9H 5GIRB 5JZ7D 4XMPH 2AQPA 2Y5QA 4JM2C 1ITBB 4OCWL 4ABWA 4AQZA 3UGXA 3QZPA 5CBEB 2BW5A 3IDIB 1OP5H 3BMVA 4J4PA 1KYFA 3SPVB 5AYTA 1MDAA 2Q7YB 2NW2A 1MIEL 1OWWA 1XFPA 4C4UA 1JE6A 1JV2A 1P5UB 2ZYRA 3PWVA 3ARWA 1WBYA 2HLAA 4PRDA 4MZ3A 5F7DA 3ZRCC 3QUYB 2BSSA 3QJFB 5HVFB 3ZKND 3QEUB 4OIFA 1GPOL 4U1JA 4UIKH 1NAMH 3UBXG 1CFNB 4C56E 5I9QB 2UXTA 3O4OB 3ZYZA 3IPBA 4FG4A 1N8ZA 2UWEB 4GXUM 4XHJD 5AKTA 1CDIA 3SBRA 4Z7VA 2BRRH 3DX8B 1NUFA 3VXNA 2VLME 3G9VA 2DQDL 1SUJA 3PL6B 5PAZA 3HVDA 3ZDYE 1AGFB 5LJYH 3LZFL 4JY5L 5CLXA 4AV5A 1CD0A 3SO5A 1BM7A 2XN1A 4JPWL 5CJBA 1UM5H 2GBUA 4NM8L 4FQLL 3DVIA 5C7XH 1DLHB 5KVFE 3QJZA 1A22B 2WZ6A 4JKPH 5AW9B 3BKCL 2A0LC 3OTTA 1NCAH 3P11L 1P7QA 4WV1C 4NN6C 2MPVA 1A7QL 4EMZA 4QOKA 4ONHA 4YZFF 1SY6H 2EO1A 2CG9X 2CKBH 1TTUA 1D7DA 1B6UA 3QDMB 2XXMB 5E6IA 3GKWL 2J6EA 3CU1A 3OMNB 4JFHE 4PBDA 1FUNA 2DQJL 2YK1L 3LPPA 5TPWH 2HWZH 1NGZB 3MLUH 1HI6B 5F93C 2R0LH 4QWWD 1QTYT 3NCJL 2WTRA 4UOQA 1ZT1B 3QNXB 3AXLA 3W82A 3S34H 5CJOL 3ARYA 4RGNB 2YEZB 4KTEL 4AVHA 1JRHL 5JUEH 2PP8A 5TE4L 3MXWH 3K8KA 1WBXB 1D9KD 2BOCA 1NMCB 2WN3A 3VX1A 4EI5B 5MENE 3L4VA 1MNUH 3OLGA 3FB8B 4IHOA 5CSGA 4V2CB 2I26N 3WY3A 3TV3L 1M7IB 1NAMB 2G4EA 1MVUA 2WZ5A 3LRMA 4IRSD 4L8SB 4PM1A 1VADA 4HXAL 1JI1A 5DA4A 2ZG2A 5ETUB 4GG6B 4LPTA 3J8F7 2A6IA 1RD6A 2XWJA 3O8XA 1P53A 3CQFA 4PLOB 1EZVY 5D7SH 5AKSA 4B96A 4BA0A 4OV5A 2JWYA 1XX9C 2XJKA 3ZDYB 4EF3A 4LE8A 4H8WC 3MTXA 1E9PA 2BW4A 2VR3A 3L1OH 2W1NA 2JTDA 4ZUSA 4XTRD 3VXRA 2LR4A 4NQSB 3PV7A 4JKLA 1KN2L 2XTJD 1WHPA 3MUY1 5SWZE 1SJEB 3FN9A 1ZIBA 5HI4D 3AMKA 3F2LA 1R17A 2YXMA 2NNRA 4F8PA 3IGUA 2W9LA 1EUUA 1PW3A 3JWDL 5EEWA 1Q38A 2DTSA 1A4JB 2G9KA 1ZHNA 3UZQA 4N90D 5D5MF 3ILPB 2EH8H 3FHQA 3CZEA 2GCYA 5KBKA 3GS0A 1LEGA 3S96A 4F8NA 1QPXA 4N8CL 4UNIA 3BKML 4X6FB 4L4VA 5IQLA 4EXPX 4IK6A 3MCLL 1FYTB 2EVHA 2XVKA 1EO8H 5KWYC 4YQXL 4YXKL 3OX8A 5E5LA 3WAKA 2K9FB 2Z65C 2A6DB 1D5MA 4N2AA 2HTKD 1JVKA 1J0YA 4N6QA 1KGYE 4MDIB 4EDWH 5E23A 4X6DE 5GRJH 1AGDA 4CSPA 4I89A 3FFCB 4ZFGH 4P4KC 5E1HB 3KGRA 4FQXD 3QIBB 1SNRA 3HN8A 1ZLUH 4GINA 3PDDA 1QLEH 3TNMB 3WFEL 3KCPB 4YSSA 3A5VA 3C5JB 4OKVA 3O6FA 1PZSA 2PP9A 3VD9A 3EZ8A 2DQ6A 2P49B 4MNGA 2G60H 3D85A 4N8VB 4PJBA 3HR6A 1N12A 1NUGA 1EAJA 1NCCL 3F7KA 4Z95L 4CRPA 3U2SB 1ZLSH 5GZOA 1E6JL 5D2LE 2MEJB 1KLUA 1ZHLA 4JKMA 1F4WL 4N2CA 3TA4D 3C2AH 4F9PC 2H41A 4XPBH 4F5CA 4HU2A 2FEDD 3ZKMC 4N2OA 2V2TB 3B2XA 4YGVA 4A2HA 1MFBL 2DF3A 2FX7L 2ZKHH 4YDNA 4PSPA 5CU5A 2BK8A 1SN5A 2VDPL 2HN7B 3S5LB 3ZE2E 1MKFA 1FFTB 1JUFA 4A7QA 5MHSD 2YR3A 4Q9QL 2YQBA 1QSED 4HDIB 2AQ2A 1G7QA 2ICWA 1X5FA 1UC6A 3PPEA 3PQYA 1X4YA 3MV9B 4EKXA 5F3HA 3TZVB 1L9QA 4OGQC 5JHBA 4K7PY 5C3IA 5KAQF 3MCKA 4ECNA 1A3RL 2R1YA 3QZMA 5BVJB 3D9AH 3U9PH 4Y2DB 5IBUG 3BPLB 1Z0NA 2V37A 2EDLA 2E9WA 3ESUF 2VDRH 4FQIH 4UT9A 2R23B 5D2NA 5GGSY 1RMFH 3CU7A 3QGVA 1OALA 4OI9A 4OGAC 2EDXA 4KHTH 3MNMA 4HWNA 4MB3A 4XPFL 4RVBA 1D5MB 2CR3A 4LLYB 2BSDA 4A2DA 2VR7A 4P57B 2D3NA 4F2MB 4HS6A 1WCBA 5T5FA 3R19A 5HDWA 3K72A 3SIKA 3BP5B 4K7PH 1FORL 3ZUNC 4BYHA 2DLIA 1F97A 1DVXA 3TWCL 2R56L 2ZONA 4JO2L 3CLEL 5AYUL 4DN4L 1O5DT 3FRPG 3SPVA 3V6BR 2DM4A 1A47A 4PP2A 3IGLA 1JZIA 3H9HA 2FAUA 35C8H 3KBEA 4YPGA 1CDYA 3EDJA 3LRGA 1PBYA 2J88H 1TZHA 5E8OA 4PRDB 1PPIA 2OMUA 3QFJE 4MJIE 3IB4A 1U93A 2GUOB 3REVA 3SE4C 4P23A 1T0PB 3GHPA 3ZTNH 3OLIA 3HLKA 2VXQH 4RA3A 1KELH 4AV4A 1MUJA 3APFA 2HT2D 2W0KA 1EHAA 2DYPA 1XCQB 1NICA 3JBG7 3MKKA 1AQDA 5EBMB 3CBJB 3VWKB 3W2DL 3L16A 3DIVA 1E4KA 5FECB 2ICES 3TURA 5BJTB 3GIVA 3D3VA 1T1XA 3GXTA 1ZANL 4PJIA 2P8LB 5EPMA 1R46A 2B20A 1B4LA 3GMPA 1XQ4A 3QQ3A 3GSNH 3QR0A 1I7ZA 1FL3B 2FQFA 5KSBF 1T0OA 1QHOA 3CVIH 3DUSB 5HHNA 3ESMA 4MJ2A 2VT0A 1XH0A 5DD3H 4FXLA 1Q9WA 5TQ0H 2MPAH 3HBZA 1KYAA 3ZE0B 4KITB 4ZOEA 4KKAC 4JPQA 3IXAB 4AEHH 2Y23A 2Y1ZA 3PDGA 5TQ2H 3ATEA 1QFPA 1UZGA 1JFQH 5IQ7H 4ZAKC 2IANB 3CNKA 1U3HC 5D5MA 3TCXA 3V0WL 4P99A 2EVGA 4DVBA 4Z7AA 2Z6FA 3MLYH 1HH9A 2OYKA 3FBQA 5F1NA 2WWKT 3PNRB 2XZQH 2ZQKA 3M7FB 4GH7B 1SQ2N 1NGXB 4AYSA 1IUZA 2JCCE 3QORB 3UCQA 5LHDA 3RY4A 5ESVB 3IETB 5I15H 4MVBD 3LKRB 5KSVA 3GD1C 4FADA 3EJSA 4HK3N 5TF1H 3IFNL 3CV5A 1NLDH 3BHBA 3EJYD 2YRLA 3MX0A 4QRQA 4YDIH 5JDSA 3SZ6A 3GMMB 5IHWA 4OJDH 3IM1A 1U91B 5F1IB 5A7BA 3ZSSA 2PP7A 2CDEA 4I3SL 3IF1A 1TPXB 1T04B 2FBJH 1NL0H 3W0WD 3WEBA 1RLBA 4M48L 5DS8B 3V4VH 2VR4A 3WIIL 5HPMB 3GXUB 1FLRL 3PL6C 4GAJH 3EYFA 2VLRB 2KKQA 2GTZA 5ENWB 1KCUL 2P1YA 2Y7MA 4CJ1A 4AM0Q 2Z34A 1KN4H 1XGPA 1MHHB 3N1MC 3SKMA 1AR1B 2P5WB 3DYPA 3BAJA 1X4ZA 2EDEA 5TDPB 1WTGT 5C07B 3MLTA 5KYYB 1BFSA 4XO9A 4NSKA 5HYQA 1W72A 1CR9H 3MBWA 2OZ4L 5IJBC 3FRPB 5SX5H 3HR5A 4WHCA 4H26A 5EU6B 3M07A 4LPVA 2IDQA 1FNHA 1PEZA 4PUBL 4NUJB 2A0LD 3CX5K 4OUUB 4PJCB 2C9UA 1FZKA 3EJPA 3ML9A 1BZQK 4BWTA 3T4AA 4HUNB 4HK3J 4QCIB 5F6IC 2JI2A 3MRRB 1SOQA 2BJML 5CBEA 5ERWA 4PJIB 3AGWA 4WKXA 1LEKB 1WK0A 2Y5EA 1TQCB 1DBAL 1DVYA 5CUSH 5ILTL 1JPSL 2O5ZH 3IT8D 1HYRC 5KSBB 3I2CH 2Y1YA 2EIJB 4UT7L 4CNIB 4L3CA 3T1WA 2ICEB 3RI5F 2OL3L 32C2B 3S35H 2RQ8A 5EH1A 1QLRA 4UZUA 2ZXGA 3O3DA 25C8H 4R6UA 5ID1B 4N87A 4QYOB 5T33L 3RWEA 2DWDA 1P6FA 5I0WA 1LK3H 3GTNA 4LQFH 3PQYE 4Q97A 3ALWA 5SV3A 2NXZC 2NLJB 2X1WL 5CHNB 5T1LA 2CO6B 2PR9A 4PP1D 4QHKJ 3MGTB 1DO5A 5C0EB 2HYMA 3V4UL 4QRPE 4YFLI 1L0YA 3NSDA 4OCMC 1OAZL 1DDHB 1IAKB 2MCPH 4LSVL 3IGAA 1HEZA 2AXFB 4OFQA 2EVJA 4Y4FB 5LNDA 5IQ9B 4TLUA 3BGMB 1EMTL 2CAKA 5J56B 1T89A 1E50A 5H94A 2A74C 4LGSB 4BSWB 1FNFA 2UX7A 3CC1A 1HOCA 2HA1A 1BZ9A 43CAB 4Z5RA 1H8SA 4OIIH 2VSCA 4PG9B 3QB7C 1DJXA 5IB4B 4OCRH 1T5WA 3TYFA 4XCFL 3P3SA 5J1AA 4F57L 2Q6WB 4DERA 4NSKB 1RJYB 1D7BA 4HF5H 1DQLL 3MRCA 1NFDE 5E6YA 1CIDA 4NZTL 5EOCL 4DKDC 4DOHE 4ELME 4Z23A 3ZO9A 4Z1PA 5I1EL 1JK9B 1MW0A 4AGPA 4M93C 1P9MC 4TULL 5L9DH 2BY0A 4CMMA 4LBEA 3FUHA 1F1AA 3GBNH 3QPKA 5JORA 3TBYA 3AQDA 3EUDA 1JWSB 3KLAA 4YXHH 1FAIH 3ZDXF 2F5BL 2DQIH 2PKDA 4K5MA 2A74A 1DEEA 5FOBA 4JFOB 1EK3A 3TBWA 5J6HA 2PXYD 2IGLA 2APWA 1K5NB 2PPAA 2ZJSL 2R7EA 3LNFA 3ZKQD 1G9EA 4BE5A 4N0UA 4OZGB 1NOAA 2SEBB 5H35B 4WHYG 2NXZD 3J07A 2QTVA 4TV3A 4AOFA 3SKJL 2HLFC 5C0BD 1G7JA 4Z0XA 4LSSL 3UPRB 3Q3GB 1HIMH 3LIZL 3BYYA 1PYWB 2BNQA 4QOKB 1CGSL 1J1XH 2FBOJ 4M5SA 4Y19B 2IANA 3I6LD 4DFHA 1M56B 5JORB 1YY9D 2HT3D 2P5WD 1IBBA 3SOBH 5CZVL 2VJXA 5I6NA 4H8VA 2V3DA 2VL4A 4GMTL 4YUEH 2PABA 5AOZA 2EZ0C 4CADB 1OP3H 3EBHA 4CDHA 4M1GH 2VSDA 1MH5B 3GSOA 3F3HA 1FJ1B 4G8GA 2AS5M 5HGBB 2WO3B 3I3EA 4KJPC 3A6OA 4WFHE 1KCVH 2DQGH 5DK0A 5HGAA 2RCSH 4UTCA 2XKUA 3WLWD 2VLJA 5D5ME 5CEZH 3AU1A 1U21A 3VWKD 4OF7A 3VWJA 2C3HA 3KDPB 3S3SA 5CD5D 5JZ7C 3LXUX 3N9GL 1IC7L 1TDQA 4NQVA 5CGYC 2CLZA 2IOIA 2WZPD 2XWDA 4PRIB 4Y16C 5AVQB 4BDVA 4ODHL 1AOHA 2F7QA 5AB0A 1ZHKB 2A9NH 3OHMB 4TQHA 1FRGH 1CD1A 2B2XH 2B4CH 5DJDA 3AG2B 3HCVA 3U36B 2DM7A 1HSAA 5IW6B 1JPTL 1BZDA 1FE8L 1CG9B 2ENQA 4NQSA 1I8LA 4L8SC 3T3PB 1LO0L 3KXFE 1BOYA 1PAMA 3HE7A 5E5RB 1PZCA 4FXGB 3R0NA 4HISA 1AO7B 3N50A 1MF2H 4XN8A 4Y1AA 2P24A 3LYRA 2AVFA 4M5ZL 4J4PC 1KLGB 2FYYB 1UT2A 2QTEA 1KIPB 2B77A 4GSXA 3B3IB 2BNQD 4RBPH 2E7CA 2FE0A 4HS8H 3FB7A 1PIGA 3C6LD 4Z78B 5JIHA 4MXWL 2XT1B 3E8UH 4GW1B 4L4VD 3OWEA 1DVSA 3CHSA 3IDGB 3ZTJG 1QSFD 1B0RA 4XPTH 4JANA 4BH8B 3G6AA 2WLJA 2H45A 2K6ZA 3ATBA 3REVB 4YDJA 2X4OB 3KHQA 4POYA 5L4JA 1JGLL 5KYXB 4TTGA 3RY6C 1ZGLM 1E90A 1NIAA 3M1BB 5DT1H 1C12A 1NCDH 4JQVC 3VQ1C 3ECVA 2X6UA 3OJDB 1GYCA 4PD4J 1WPCA 1FFQA 1M1SA 5DGRA 3L1GA 2VDQH 1NCIA 1G4RA 1JTPA 2OXGB 3UDWC 2C9QA 2QVTA 1WAPA 4FXKC 3KPLA 1UZ6E 1FVEB 4H8WH 4QMEA 3H7BB 4OZFB 4DT2A 2E9JA 3DX2A 3S8WA 3VW3H 1KT2A 3HUJB 5FYJH 4X6BA 3SGJC 3BDYL 5T1KD 2CK0L 3ZE1E 1KIRB 2IDUA 2M83A 2E76C 3ENEA 3LZOA 1QSEE 2WKOF 4HDIA 1U33A 2Z0BA 1S5HB 3QNZB 2ZWLT 3HG5A 3BDXA 4MNQB 5EBGA 4ZMOA 2W5PA 4Y2DD 2F8VA 4LP8A 1R5IB 2EIKB 3LKOB 4JY4B 4H1LB 2R4RH 2R1YB 2O4EA 4M8VA 2HG5A 1KCRH 3FSOA 3HG0A 1AMXA 1CK0L 4PJ5E 2VUKA 4LASL 1W9XA 5MENB 3ABMB 3BGFC 2EE9A 3QPQC 3ARGC 4Y4HC 2DQTH 1LXMA 5GGQL 4L8CA 3TYGL 2PPFA 3EGSB 3ZT7A 1F13A 1LD9B 2Q0ZX 3DROA 3MRQB 1RZIA 3BISA 2DH3A 4H40A 4WJ5A 4AEIH 1SRDA 1P5UA 3F5WA 4LPXA 1TQUA 3GSWB 2WM0A 3VXSD 3U30C 3VUAA 1BLIA 1JPEA 2FNBA 3D3VB 3MV7D 3FN0L 3IN2A 4BIKA 2VE6A 2D7OA 4HUVA 2E5EA 4JDTL 1GAFL 3D2TA 3C5SA 4ODTL 4H1LG 3CDGA 2FL5B 3EFDH 4EI6A 5CCJA 3J2PA 3P4NB 2XFXA 3NPSC 4OLYL 4WW2C 1CU4L 4JJ5A 1S2EA 4AYFA 5GIRA 4F5CE 3D08A 4X5RA 1GYVA 5IG7A 1TIUA 5E94A 3ZZSA 2WOBA 4HH9A 4HW6A 2BS9A 1BQHG 1BJ1J 3ELAT 1U93B 5GGTH 1DZ0A 3DX6B 4GPVA 3RJOA 1QSZA 4P23B 1K4CB 2H8PA 1FZOA 2C3GA 3PHAA 3RVTD 4UQ3B 1XAUA 2PW1B 4Z3EA 4KRPD 4ZX6A 4K3JH 2J44A 4AMXA 4LKCB 1NANI 3G5XB 4K9EH 3U6XA 3DIFA 1OM9A 1CTOA 1S9XA 2X4NA 5ICXB 4NO0B 1QAWA 3ATAA 5FYJD 1G43A 1T1XB 3IPEA 4J1UB 4Q6IC 2XFXB 3FQRA 3ZTEA 3TO4C 5A3IC 1MW1A 4WNSA 1BIHA 2VLJE 4C56B 2ZWZA 4RH4A 4NO3A 1TVHA 4UCFA 1IZKA 2DWEA 3VXPB 5I8OH 1F2XK 1UB6B 3V5HA 3MJ9L 3LQAC 1I7UB 1F11A 5E2VL 3L5WA 4XMKH 2WINB 3BPCA 4HJJL 1CXFA 1PS3A 1S5HA 1UA7A 1W6LA 3MLVH 3QNZA 4GXVH 1FNLA 4HGMA 1DEDA 4S1SH 1VFMA 4ZI8A 5I1LB 2E3VA 5DMIL 1H3VA 1IAOA 2I32A 4IBUA 4JG1L 4E41A 3LOWA 3EYUH 4M7LL 4AQ8A 5I8CA 3KVQA 4RSYA 3MBED 4ONHB 2HG5B 2AQ3A 3NJJA 3P30L 4OBRA 1T7WA 4JPIB 1LNUA 4HIHA 1EDHA 5AVYB 4P49A 3B7UX 5TE7L 1LQSR 5FKAA 5AW7B 5D1QD 1P7QD 3L4TA 5IEKB 3QEQE 4UDUA 1YEWA 5CFHA 3KYNB 5T3XH 2OI9C 2XCMC 4FP8L 4J3WA 3V5HB 4L0YA 2HJFB 4CKQA 1ZK9A 3QUZD 4D9LL 2F8IA 1RY7B 3V6FA 3UO1L 3FL7A 5CP7B 3RFRA 2WINA 4BCZA 4GUOA 1I9JH 4TNGA 2HUHA 1SJHA 2J6EL 3KBFA 4IBTA 1MCSA 1BXAA 3DSFL 4WRLA 1YDPB 4I3RH 1NGWA 1FVDA 1HU8A 3Q8BA 4X83A 1L9RA 4P5TA 4IRZA 3GINA 1RZJH 2CRMA 3KWXA 1S7QB 2VN5A 1HAUA 1G84A 3FTGA 2N7BA 1FBIL 4IEFA 4J4PD 7CGTA 1XBDA 1MQKH 1WFJA 1L0QA 1CFBA 3LSOA 2CU9A 1PTZA 2GG1A 5IMLA 5T1DL 4QR7A 4KKCC 2Q3XA 2OW7A 3DPBB 4PU2A 2MTAA 4KVNL 1JNJA 4EQ3A 3H9SB 3EZJB 4NGHL 5JOPD 4BEIA 1M53A 2DWEB 1X5HA 3QIBD 1ZJBA 3CVBA 4OCSH 5DUML 3QEHB 4ZXBD 2F9BT 3PV6B 2Y36H 4MAYD 3ORJA 5LNGA 1NFIA 1W16A 2DQCL 4LIQH 2X3CA 2D03L 4TPRL 2DJ4A 1YQVL 1IC0A 4CVXB 2IH1B 1T5XA 4ZMXA 4XVOA 2BSRB 3UFIA 2XWBA 1S7SA 2G0KA 5K9JH 4XOCA 4B7IA 1YEJH 4OFYD 2Y7QB 2XN9D 2ALWA 1MCBA 2JFCA 3E6HA 3P3TA 3VFSA 2XWTB 3MNVA 4M43L 3MOAH 2ZD0A 3MNWA 5I1IL 5LGJB 1E3FA 1K8DB 4Y5VC 1H0DA 4FFTA 4TRPH 1QSEA 5EORH 4OAWA 4W4OC 2GVYA 4DP1X 1E6OH 1FAKT 1ACCA 4J2XA 2K70A 1YUHB 3VWKC 4UOZA 4QIRA 3JXAA 3I75B 4PJ9D 5G2NA 4I88A 3SPHA 1YEGL 5CJ8A 2D9QB 1QSVA 1SJEA 1ZS8B 2PWFA 3G5YB 3MLSL 4BK4A 1U8HA 1W0VA 1YMMA 4FCHA 4TMPA 5C2UB 1GR7A 3I9GH 3SO3B 4JFFB 3ZHKA 4O02B 3ILPA 4DEPB 4IRSC 4OV5B 3WFDH 3QAZB 4PTUB 3DDFA 1U92A 2B1HL 3VFOB 4Y89A 2R0ZL 2W92A 2FWLB 3X3GL 5GHWH 2JQZA 3KBHE 2YGQA 4HCRH 2XWZA 4HUXA 1E4WH 4HH9B 2EC9U 1GGIL 2TSAA 4RAVB 3BE1H 2FUTA 4P3CL 4YHOL 2H26B 2VCOA 3RKPA 4TOYH 5HJ3B 4FFWC 3MRDA 5A6MA 3RVXD 4PLKD 3OAYH 1NAKL 4YO0B 1KIUB 5JLZB 3B9KD 2UYLB 3B56A 1G5AA 4GRLD 1PYWA 4KPHL 3WFHA 1NDTA 5E95B 1A6PA 2DM3A 1JHKL 1KWGA 2Q10A 4H88H 3RWDB 3SQBA 4LCVA 2Z31B 2KERA 1F4XL 4WUUE 4RA0C 4AV0A 4TVSa 3HHRB 4IBVA 2VMFA 2D3VA 1W72L 3O0RH 1OCZB 3EGSA 1MEXH 4DKEL 4WV1A 2VLJB 1S8DA 2YMXL 4LSTH 3BQUC 5C0AA 1ZDSA 3ME0B 2E74C 4XP4H 5FA4A 3OKDA 2I60H 5EIVA 3MGOA 2QELA 4XI5D 2WXNA 1JZDC 1NCUA 5JHDD 1PX8A 3GBLA 1MREL 1NDMA 4BHUA 3BIBX 4NI6A 5CWSA 4BH8A 2YC1A 1KDIA 5HHOA 4WI2A 1GGCL 4UINL 4P2OA 3NESA 1T7XA 4ODBD 1MHEA 3N0AA 4RQQB 1JAEA 3O2VL 5C7ZA 4JFXB 2WNGA 3X13B 2GTWA 3DV4A 2O5NA 4LARH 3AWFA 1NSNL 4IOSA 2CJUH 3K5SA 5CJ5A 4FULA 2XTSA 5E1GA 5CU9A 4AEEA 2P5EA 4KBPA 3H7BA 4AJWA 2AFNA 3SDXB 1Q72H 3EFOA 4PRHA 1T0NA 4MDRA 4TNVK 2NNFA 3UBGA 4JDZA 5J12C 4QRSB 2PYEE 4DKAA 4WK4B 1I9RL 5CCKL 1SYVB 3UTPE 4XC1L 2GK0B 1QFWL 2BSEA 5DJZA 1CDCA 1BFOB 3IDJA 1KLGA 2FYYA 1KNOA 4LSRH 4WZ9A 5GRXG 2ZAIA 4W9EC 1ZWIA 4I9XA 4WTZA 3F7RA 2IPTL 3D07A 3CG8A 1USZA 4W4OA 3BD3A 1TZIA 4HUUB 3VJ6B 1IO4C 3WD5H 1U58A 4FKKA 3JWNE 4A63A 5IEHA 4I13B 2CUMA 3GSNB 4MMXB 4EJ1C 1ID5I 4WKZA 1XF3A 2VZVA 4N2NA 2Q8BH 3FH5A 5IW1B 3QK0A 5IF0A 3SYAA 3PGFL 1HQ4B 2P26A 1G7HB 3HN5A 1J5HA 2APBA 4K23H 2EAEA 4JM2D 2OR7A 2Z0UA 4GSDH 1HCYA 2DH2A 1AP2B 3IBOA 5I8KL 3HG4A 3BP7B 4N0UE 5ADOL 3ZHNA 1P6WA 3C6SB 2AJZA 4HAFA 3L3DA 4BFEA 1BFOA 1H3GA 1J12A 4EOWL 4H25B 5IM7B 3BESR 2NRDA 4CN6A 1SXAA 3RWFB 3G7TA 2KZ1B 4CDGC 1IKFH 5F6IB 2JSFA 4CL7A 1JL8A 1N8OE 5C9KA 2EE0A 2KLRA 3F58L 3G04B 4K2UL 3CUPA 5B7EA 1H9VA 5I73B 3ZDYF 2C1OA 1ASOA 4CGTA 2YPVA 3RA7H 2VDLH 1WA0X 2DLFH 2LVEA 3B8SA 4YC2B 4FQPA 1OP5K 3RWJA 3T0VA 2R29H 1IKNA 2B15A 5HPMA 3L3IB 1UOKA 4RBPK 2YD1A 3WO3B 1H15A 1F58L 1LP9F 1E42A 2AJSL 2KBGA 3HC3L 4G9FE 4L9LB 1FCCA 3PG2A 1AGEB 1C5DA 4QTIH 1I1FB 1Q8MA 3Q2NA 3RFZC 2V8MA 3DHUA 3NFNA 1BQRA 1HTYA</