3L8QA

Structure analysis of the type ii cohesin dyad from the adaptor scaa scaffoldin of acetivibrio cellulolyticus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
338
structure length
338
Chain Sequence
MAPTSSIEIVLDKTTASVGEIVTASINIKNITNFSGCQLNMKYDPAVLQPVTSSGVAYTKSTMPGAGTILNSDFNLRQVADNDLEKGILNFSKAYVSLDDYRTAAAPEQTGTVAVVKFKVLKEETSSISFEDTTSVPNAIDGTVLFDWNGDRIQSGYSVIQPAVINLDMTKASYITMGYDKNAAEVGEIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVSEDYGPIVQGVHKISEGILNLSRSYTALEVYRASESPEETGTLAVVGFKVLQKKATTVVFEDSETMPNGITGTTLFNWYGNRIQSGYFVIQPGEINSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Modular Arrangement of a Cellulosomal Scaffoldin Subunit Revealed from the Crystal Structure of a Cohesin Dyad
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
molecule tags Structural protein, protein binding
total genus 81
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA01
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3l8qA02
2JH2A 3GHPA 2OZNA 3FNKA 3BWZA 4U3SA 1TYJA 3KCPB 4UYQA 1AOHA 5G5DA 2ZF9A 1G1KA 4WI0A 4FL4B 1ANUA 4UMSA 1QZNA 2Y3NA 2XDHA 4WKZB 5K39A 2BM3A 3F2LA 4DH2A 2B59A 2VO8A 4FL4C 4N2OA 2O4EA 3L8QA 5AOZA 2VN6A 2VN5A 4UYPA 3KCPA 1ZV9A 4IU2A 2W1NA 5LXVA 2CCLA 3UL4A 1OHZA 4IU3A
chains in the Genus database with same CATH superfamily
2JCCF 1S5IH 2Z31A 4XCEB 5C0BA 1OAYH 4DSYA 2HVKA 3DX7A 1UM5H 4LZKA 3U30B 1FYTD 1BZ7B 5GRVL 3B7TA 1FZOB 5EOQH 1M42A 4S1RL 4D0BA 3IMVA 3MGTB 5AVXB 1OTTC 4F8TA 2JCWA 4UNTA 3F3HA 4F7CA 2W95A 1J1OL 2GJ6D 3NPSC 3GF8A 2OL3L 4UAOB 1ZLVK 4QCIA 5DJ8B 3FF7A 5AVVB 3FU9A 4HOZA 3MBED 3HS9A 3HZVB 2JFCA 3MRHB 4A7SA 3CZLA 4DKDC 3UAFA 5KBKA 3LEYL 4H25A 3MV9D 5CN2A 3V4VL 3WMPA 4XMKH 2DWTA 1CTMA 1SOXA 5AW8B 1WBYB 2MNJB 4JDTL 4HZAA 3O0RL 2R4RL 4PJEE 2FZ3B 2HN7B 3MN8A 1BM3L 2GCYA 4L8DA 4PW4A 3DJTA 3JWNG 5IOPA 4NWUH 3I9PA 2C9XA 4GLRI 4PJ9B 1NPJA 1Z66A 3MJ9A 2FGZA 2Q6WB 4BFFA 1T83C 2DMKA 4KI5D 3ASNB 2DTML 4R90L 4HIIA 1JPTL 1MKFA 3CH1B 1G7HA 3TO4A 4B9KC 3LEYH 2XC8A 3V4VH 43C9A 1CFSB 1BQ5A 4OF5A 3H3BC 1F11B 4GSXA 3G5WA 4JDTH 1XGTB 3O0RH 5CLZA 5C0CD 2R4RH 2XOTA 5K9OB 1BCIA 1BM3H 1JRHL 1QNIA 3B5GA 3B7RL 3CUPA 3OJDB 2JKNA 3Q5TA 1VEPA 4I13B 2IF7A 2YC1A 2VQTA 1A21A 1B0RA 1TT6A 3MROB 4QKXB 4LF3B 5HYEA 4P2RE 1X7QB 1DVTA 1F4YL 2Y3NA 1IFHH 2EO1A 4XI5D 3P3SA 4R90H 1YEJL 1KIQA 3D9AL 2V2WB 5ID1B 1J5CA 1Y0LA 3H3PH 4IOFD 2P24B 3S36X 2D7NA 4I1NB 3T8MA 4TLKA 3WJLA 3PQYA 4LLYA 1WDAA 2BP5M 1S7QA 4KXAA 2D7OA 2WAQA 4KJYA 3SKJL 1KFAL 3CHXA 3PFUA 5C09D 3C6SA 1JRHH 3FO0L 1MG3C 4JPIB 4WI0A 1SMAA 2VH5L 3V9CA 3L3DA 3FQTA 1ZS2A 2RB8A 3MRLB 5D7JD 1WZLA 4GRLC 2IAMD 2X1WL 3OZLA 3D9AH 4L48A 5SWSE 3WV0A 4AIEA 4XN1A 2X87A 1UGKA 3BDBA 1S7SA 2MOGA 4BA0A 2ADGB 4Y1AE 3UTPE 4N2BA 5LCVL 2AQSA 4L37A 2WYTA 1OHZA 2OW7A 4HS8L 2DWEB 1P7KB 1RPKA 2X4PA 3O9WC 4C83B 2DQUL 3GBML 3QJSB 1O7DC 4MYPA 1IE4A 4KBPA 3N06B 1NFDB 1DO5A 3EH4B 1QRNE 3AMKA 3FO0H 1TZGH 3EBAA 1LGVA 3PP4L 2CM6A 1XSIA 1ZVHA 3A47A 3ARSA 3FT1A 5DHVA 2VH5H 4NUGL 1IEAA 4PD4K 4PJDA 3LKNB 5F6HI 3M46A 1FFNA 1PLBA 3A4EA 1GYCA 5BS0B 5DQDL 5FO9B 2DM4A 5A2LH 3RIAF 2BIHA 2K45A 4UT6L 5GS1A 2B16A 3IFOB 4BUHA 1LJMA 4IBYA 3DRTB 5KS9E 4ODSL 4B9PA 4HS8H 2R27A 4KROC 1BAWA 1I1YB 2DQUH 4WSJA 5HJ3A 3WDHA 1QFWM 2NNFA 1OKEA 5IREA 3D4CA 4M1CD 5C08A 3PWLA 4RIRB 3PP4H 4QYOA 5J6GA 3TBYA 1WTLA 1AS7A 1M7IA 3GS4A 4NUGH 3MCYA 3Q3GA 4NSKB 3BUBA 3QUXB 5HHNA 2B1AH 1U2HA 1ZEAL 2OPCA 1KJ2B 4NCDA 2D4FA 1LVEA 1BJMA 3VXTB 5CD3B 4A2GA 1NEPA 5F97E 3QQNA 5IQOA 4MJIB 5FS5A 1EEYA 3N1QC 2B1OA 4IGBD 4ODSH 3FYIB 4DN3H 1F1AA 1YNTB 2ZOLA 3II1A 5GZND 1ASOA 3BVUA 1LEKB 2Z4TA 1WBXB 5B3JE 4QD2E 4DEPC 2OSXA 3QDAA 5EH1A 4EQ2A 3CVIH 4CDGC 4W9LC 4NQDB 4E0RA 1ZEAH 5EBMA 3F2LA 2BK8A 2Z65C 2VLKD 5D1XD 5GGVY 4KO5A 4JFQB 4MQTB 4P46B 2HP4A 2WLNA 5E5LA 4XNMB 2YKLH 3CN3A 4FMKA 5HGDA 3HG0A 4FGMA 2NY6D 3QDMB 2NX5A 3P73A 3DC0A 4N2KA 3RX9A 2NUTB 1FCGA 1IKNC 1MSPA 2ZTBA 3JYBA 2VN3A 4OZHA 4LRNL 1RXLA 3U46B 3QYNA 4X7CC 3GLDA 3WLBA 4XZ4A 4PCSA 2AC0A 5JZ7C 3SKOB 1P7QA 1CDGA 4QAWA 1OM9A 1YUHA 3FO2A 3LDBC 1MI5B 3B34A 4G6KL 5DD0H 1JRHI 4LRIA 1UD4A 1N67A 2LU4A 1HHHA 5SWZD 3VXRE 2ICWJ 2ZUVA 4TSBL 4IRJB 3C5ZD 1F90L 4GINA 2ESVD 3OMZA 4PJDE 5ISZE 1M53A 5C9KA 3QNZB 1A7QL 2J6EL 3VTTA 5C0EA 1CGWA 4TUOB 1HE7A 1U3NA 3STZB 3QAZB 5ALCL 2NR6C 2V8LA 1ORSB 2XQYG 2WOBA 2PYED 3GSXA 3VTAA 1L6PA 3T3MF 3VNZA 2ED6A 2IH3B 2WNGA 3CDZB 5I5MA 4G6KH 5GGSA 5HGAB 3A4FA 4EEEA 1E9QA 2NYKA 3CZGA 1II4E 4R2GD 1KXTA 5C08E 3FQUB 4NBYB 4TSBH 1S7WB 1JCKA 1E27B 1F6AB 1UOWA 4FTVA 3IRPX 1F90H 3NOIA 2NDGA 2UZXB 1L3NA 3QDGD 4U1IA 4JGMA 1B9ZA 4H0GA 2VDQL 4IMLA 4TNWF 4XNAA 1YC7A 2I24N 5BRQA 4YDVA 4JY4A 5DF0A 3KPRA 1A4CA 5ALCH 5FDWB 5EC1B 1DBJL 2DQEL 2COVD 4K71B 3RX7A 4JGUA 2MSPA 2VRAA 2FLBT 4MS8C 2XWDA 5IVZB 3WNPA 4J27A 3ZZ1A 3MZGB 4LPXA 2DD8H 1HT6A 4EI5C 2JJUA 3ARTA 2KHAA 2NW3B 3SPGA 3CFDA 4CN1A 4JMXA 3R06A 1NAKL 2VDQH 5B4MC 4AQ1C 4JFTA 3TLRA 1MREL 2PW1B 4WU5B 4ZMVA 3QZWB 5IROD 3FCTA 4HBQA 3F6JA 2OMTA 4NKOA 4N0UA 2GABA 3FTGB 4I4WB 1HHGB 1I9RL 3CCHB 3MU3A 3BO8A 5FHBH 2FJFA 5KSUA 3S5LG 1DUYB 3GRWL 4JL2A 2E47A 2VN6A 3DARA 5TE6L 3TS8A 4HFWA 2FO4A 3MACL 3ROLA 3DJ9A 5A1AA 1AZZC 2YA0A 4OU3A 3N42B 4OZHE 4UQ2B 3OMIB 1ODUA 2FNBA 4JPSA 2UY7B 2PF6A 2QTEA 1NAKH 4MDIB 5D4JA 3SEPA 3UTSD 1T4WA 3QIWA 4BCYA 1MREH 4F80A 4IQHA 2G75B 2B9AA 1XGQB 4NI6A 3OSKA 3NACL 1HXMA 1RUQL 5IBLC 4NUQA 5F3BB 1MAML 5LHDA 2VDPH 4ZFOA 1MZZA 2Q3XA 3VD0A 3GRWH 3ZQWA 5ILTH 4FXGB 2ZNWA 2Q7AA 5EBWB 3MV8A 5GGUB 3C6LC 1UWEH 1CZ8H 3ZT6A 3VQ1C 4F92B 4NP4H 3VWKC 4RBPK 3C8KA 1CU4H 5IP4A 4Q89A 4YL4A 5IBUG 3BH9B 3NACH 4JFXB 3UO8B 1RUQH 4ZW3A 2H6PB 3BPLB 1MAMH 5G5DB 4F8OA 2X89A 4NQCA 3MV11 4XB8A 1Q38A 4FTVE 5TK4A 2IDCA 1K4DA 5MENB 1B2YA 3WN5B 2AV7B 3HG2A 5FV1L 5T1LD 4LKCB 1P69B 1OO2A 5F1SA 3T0EB 4TQEL 4HEMA 2ZP8A 1RZKL 2JQZA 4YLBA 1WZAA 1U8QA 4OLZH 1BD2B 2UY6A 4M93B 4OZIA 1ZA6B 3V4PB 2BLFA 1BDYA 3I84A 2VLJA 1MPAH 4LGPB 5I9QB 4J3SA 5I1GL 3SDCD 2WO4A 4Y4HC 4Y9BA 1OB0A 3I9GL 1INEH 4GNKB 1AH1A 1VFOA 3VD2A 2QGDA 4G3YL 4YGVA 3H9SE 5AQ0A 3W9DA 4L9LB 2E7LC 4Q6IC 1KULA 3MRJA 3GSWA 1WV7T 4TQEH 1QLFA 4N0UE 3RDTA 3AG3B 4OH2A 4TMPA 4PB9L 4UF7C 3ROOB 2P7TA 2W5PA 1TQSA 2RGSA 2Z6FA 3RPIA 3BVTA 4CA4A 5LN8A 2I26N 3CQPA 4PJDF 3UC2A 3ZSTA 3NBNA 2PKDA 4X9IA 2L7JA 5IJDC 1QAWA 4NERA 5IFHH 1NBYB 3SE3A 4Y2LA 3RIFF 2AJSL 4ZPVB 4OLYL 2XVKA 4BFJA 1MHHA 4P07A 5EPMA 3U9UA 2V7NA 3MLVL 3UZVA 3QUML 3ZUNC 4G3YH 3RGVD 1A6PA 4AV4A 4IIQC 4HD5A 3B6SB 4OV6F 3PNRB 5AKSA 3RFZB 3O6FC 1CGYA 1IVTA 3N9GH 4PB9H 1GYAA 2X4NA 2HTLC 1BVOA 4NI3A 5IB3B 5E1AA 2AK1H 3EJYC 4R4FH 1BQLL 5I71C 1LNUB 2HLFD 3FS9A 2KI6A 3CFJB 4FE9A 1RZJL 1TQCC 2BOBA 2XCMC 1NCBL 2NZ9D 1EVTC 4FQQB 4MWFA 4W93A 2YMXL 4J3TA 4F37K 4Y4FD 2AJSH 3MJGX 5L4MA 1VKXA 4OLYH 2NSXA 4MAYA 3K72B 2EDWA 4HUWB 3OXRA 4L8BB 1F45A 5E9NA 4RWYH 4Z8FH 4JO4H 1XL4A 1UOKA 1WA0X 1EBAA 4N0CD 1IQWL 1VACA 2X5PA 3JWDH 1YDPB 5D7IF 5BZWB 4WI4A 1J0IA 1KIPA 2L7QA 3QI9D 4CSZA 3HE6D 1S7UB 1RZ7L 1TJXA 1H3WM 5FDYA 1OLLA 3CN4A 4ZQKA 1BQLH 2EDQA 3QIUC 5F9WC 3BZ4B 5GGVL 2IV9A 1QQDB 3R4DA 2XKNB 2VXTL 1NCBH 2KKQA 3QJTB 4QOKA 2YMXH 1SY6A 2QV2A 3Q2VA 3EYQD 4HEME 3BPLC 4FYQA 4OZIE 4QRPA 2CLZA 3RI5K 1A9BB 3ARZA 1IQWH 1RH8A 3LIZL 4HH9A 4O02A 1N19A 2XWJA 3QPQC 1H8OA 3H54A 1M57B 5ENWA 3ECBA 3ZHKA 1QPXA 1XF2A 1R19A 2WZ0A 3PRZA 3PPSA 2OR7A 3V6ZB 4OZHF 3HS0B 3QNYA 4I0CC 1EO7A 4ELKB 2HMID 3TT3L 4HGKC 4M93C 3GHBL 2CWRA 5GGVH 5JQHC 1U8IB 1XX9C 3W1ZA 4IOSD 4I0PA 4WJ5A 5TGBA 1KGXA 1BP3B 1UFGA 1SHSA 4LPTA 1KB5A 4BGLA 1RHHB 2OULB 3OKEB 4FQXD 5A2JH 4MA1B 4UQBA 2OMUB 1R5IB 4Y5YC 1LO4L 3LRMA 1YMMB 1RK0A 4U6YB 3V6FB 3CTTA 3E7JA 3T2LA 5FPIA 3V0VA 2J8OA 3CPLB 3LIZH 2QZQA 1M9WA 5C0AD 1G87A 4NQXB 5JQ6L 1LMKA 5L7XH 1SXBA 2BWQA 2AP2A 4ABVA 4OCSL 2BNRA 3NJFA 5LDSA 1MCWM 3TT3H 3QC6X 2DW5A 3GHBH 3VG0L 2YD3A 5EBLB 3Q9PA 1N18A 4UTCA 5KVFH 1ZLWH 4HULB 1UQSA 2ITDB 3O0LA 1TQTA 1DL7H 4G1EA 5CCKL 1YEFH 3K2KA 1LO4H 4JJOA 4F1ZA 1MLCB 1F4AA 3UPAA 1QFHA 5BNXD 3Q48A 5KYXA 4K15A 2PCPA 3NVQA 4EZKA 3KLHD 4JFWA 4HFUL 2J20A 2XZZA 3IMRA 4DNLA 1GR7A 1FO0L 4U1KA 3DURA 3KLAB 32C2A 4F7MA 3SGJC 1DN2A 3V95A 5J6HA 1I85C 2WKLA 1T3FB 3ALXA 4TQ8A 1IKFH 4UDTB 1EHLL 2IOIA 4JFVA 3VG0H 5F9JB 5AAWC 4W68A 1VADB 3RWCB 4NUJA 5IF0B 2DQFB 2XSKA 1EGJA 1S78C 5F7MC 4HJJH 1TZHA 3LQAC 1M1XB 1NDMA 1SOQA 3VCLA 4TTDC 1PYWB 3FMGL 4YBLB 5I17B 1JD7A 2FYYA 4HFUH 2VXQL 3ME0A 3MLXH 1FO0H 1UZ8A 3IGAA 1JI2A 4CGUB 1T0NB 3G6JA 4MQSB 4DH2A 1QFOA 3C60D 1RU9H 1KMGA 3WIHL 1OANA 3MOBL 1SFDA 4GRWF 4ICWA 3VXSD 4DAGL 1U41A 1HQRA 2F58L 3OHXC 4YFEA 5HPMB 3VRLE 2PW2B 3B8SA 4X6DE 5DJDA 1AFVL 4JFPA 3SGEH 4TLSA 4JKMA 2HKHL 4RWHA 2I7SA 3MBXL 5CKGA 3IKKA 3D52A 2XFGB 3HVNA 3NEOA 3TVMA 3FFOA 5KSAA 4NM8L 5D71H 5GGSY 2VXQH 3UCQA 1KPUA 2ZYSA 3QHTC 4J2QA 4HK3J 2GQHA 1QBLH 5E03A 1QUNB 3WIHH 3MOBH 3UAEA 1TITA 3HS0C 2APTA 4DAGH 2P42B 5EOTA 4LU5H 3OLIA 2F58H 1BFVL 4ZFGH 3OAZK 1AFVH 4UTAA 5EN2B 4CBZA 1LP9B 3L6FA 1RK1A 3QH3B 1UEMA 3HAEB 1FDLL 3CFIC 3P77A 4Y5XC 4QHNB 3MBXH 3UPRA 2BNRE 2CK0L 2NY4D 3VXUB 3T0AA 4MA1C 4K7FA 1CDUA 4IS6A 2NY2B 2B39A 2B1HL 4LAJH 4NM8H 5HGHA 5IB1A 1SHXA 5EZOH 5I8OL 4MD0B 4XNZB 4PRHA 4NKDB 1B4LA 5CZKA 1AMXA 1G7LB 4EI6A 4AEEA 4U6XA 4ISVB 1IEHA 1JK8B 4F9LA 4O2FA 3F6IA 1NDTA 3B2VL 6PAZA 1PS3A 1CJYA 3KCPA 3WTWA 3B3IB 4P04A 4L4TB 3MLWH 3UZQA 4G83A 1AGCB 3ZO0A 1FC1A 1UA6H 2BP8A 1SLVA 3V7AE 5I8CA 2CK0H 3S5YA 1IQDA 4BH8A 5C07B 4EBQL 2B1HH 5HHVL 1ZJAA 1OPGL 5CIPH 4BH7B 3QPKA 1UJ3C 5I8OH 2DKUA 5IIEB 4OZIF 5AD0A 1TTRA 4QRBA 3DPDA 1XBDA 4NT6A 4I18B 1T80A 3MODH 4Z7UA 1VFBB 4ZUWB 1CDYA 1B3IA 1TTUA 4NO2B 3B2VH 2FQEA 4JZJC 1PG7H 4WI2A 3QQ9D 1SYVB 1A1MA 1ULVA 2OYKA 1ACCA 1HQ4B 3GZKA 2EE6A 4AC2A 3U36B 4ZXBD 2Q10A 5HDBB 1RD6A 3FUKA 3TONA 5CEZH 4EBQH 3Q2LA 1H3PL 5DZAA 3O9WA 2CZNA 5CBEA 3V5DB 5EIQA 2E9GA 3Q01A 3IMSA 4HJSA 4M8RA 2G9KA 3KPQB 2AV1B 4XCEA 5JPMB 4JJHA 5AAPA 1BZ7A 3CN0A 2WANA 1IBBA 1FZOA 3BKJL 2DLEA 1DZ0A 3MGTA 3MJ9H 3PPEA 1ZGLP 1ZXKA 3FB7B 5DJ8A 5TH2B 1U8NB 3RVWD 3U1PA 3QNXB 1I1AD 3HZVA 1LXMA 1H3PH 5E99L 2NY0B 2EJ1A 3SGEI 3HE7D 4N86A 4ZUSB 3VTMA 1IX2A 1WBYA 2F19L 3T2NL 2B14A 3K5RA 3GTNA 2FZ3A 2HN7A 2HB0A 2RIKA 1BZOA 3SDAB 4JJ5B 4FG4A 4NIKB 5IJKC 4HEPA 1I8KB 1AYRA 2FIKB 2PUQT 4PJ9A 1PY0A 5K5YA 5FOJA 2Q6WA 3UOAB 3L2LA 5J0BA 1M7UA 5J1SC 3CH1A 5HTSA 2A7BA 5E99H 1R0AH 3NFSH 2P5WD 2TSAA 1CLZL 1UT1A 1I9IL 1CFSA 5AG9A 1WWBX 1A4JB 3BZFB 5EU7E 4RA3A 1EJ6A 3T4AC 2F19H 1ZGLB 2H4EA 1F11A 4XNZC 2DMBA 1XGTA 3QWRD 3N3EA 4TXVB 3T2NH 3B2PA 5I75C 5K9OA 2ICEB 3O3DB 3MUUA 1MVFA 3OJDA 4U3CA 4U33A 3ILQD 2Y07L 1XH1A 2J72A 3K6NA 2J8UB 5DZVA 3MROA 1K4CA 4LF3A 1MJ7H 3SCMB 1K3ZA 2HKFL 1X7QA 3BYYA 4MHHG 4D0DB 1EHXA 2V2WA 4N5EC 2ZUSA 3VACA 5ID1A 1HZHH 1X9RA 3NJXA 2OI9B 2G3NA 2P24A 3E8UL 4WWKB 1Q9KB 2VR3A 3LRHA 3LY6A 1CLZH 2YIHA 2A9DA 1I9IH 4PRIB 4S1SL 4XXDB 5DQJB 3L9RB 3RY5A 3N41F 4MA3B 1U30A 5HVWA 3NYKA 4OBRA 2NY1D 5DHVH 1GH7A 2O30A 5F8RC 3KS0J 1KC5H 4JPIA 2HG5B 5D7EA 4X6BB 5LLIC 3L9EA 3O2DA 2FAUA 1IIKA 4NZRL 4PSRA 5B7EA 4M7JL 1KPRB 2IQAB 3T65B 3T8XB 1AC0A 1AIZA 5D1ZB 3P3YA 3SE9L 4Z7OE 3RJDA 4YJZL 4K55A 5DD5H 2ADGA 2BERA 1ZPLA 4ODUB 1KLGB 1AKJD 4J2XA 3MRIB 5E94B 2DWEA 1P7KA 2EIBA 4G8FB 4C83A 4E9QA 1PKOA 1DJGA 2V2TB 1NFDA 1NMBH 2CM5A 3C08L 4KTGA 5HYJE 2F9BT 1DP0A 1B0GB 1PJWA 5HI5D 3FQXB 2Y23A 1GC1L 4RZCB 3WCYA 3S96B 3VA2C 3LKNA 3IT8D 4NZRH 1NOAA 1KTDA 3WL9B 1FJ1B 5L2JB 5JHDB 2ZYRA 3SE9H 2YQGA 7FABH 1TU2B 1TZIB 5BS0A 2VABB 1A6UL 2QJDA 4MLSA 5FO9A 2VDOB 2WJ5A 3ARQA 3JV6B 2CRYA 5DS1A 3IFOA 4FYRA 4MCYB 1JZDC 4WRLA 3DRTA 3F58L 1IT9L 2ZWYA 1SLUA 1I1YA 1YEDB 2GBUA 1M71B 1FUNA 2IADB 3U2SB 4TF4A 5I0VA 4RIRA 3RWJB 3HLAB 3GRGA 3HRZB 1WICA 2Y06H 1GC1H 4ZO9A 5JW4R 4X7EC 2YOAA 2PABA 4NSKA 4K94C 3TEZA 2FK9A 3D07A 3Q43A 3UTZB 1PD0A 1KJ2A 1N7ML 5DEZA 5DEGB 3VXTA 5CD3A 4PCKA 4Y9EA 3MRKB 1J1XL 4MJIA 1HHIB 1N8ZA 5L8KB 4HSQA 3F58H 1IT9H 3GMOB 1SEQH 3MXVL 3G6JF 1YNTA 2FH8A 5F7KC 3FN9A 3D06A 1LEKA 5I16B 5CKAA 1DJWA 1WBXA 2Y9RT 4OCXL 2VLRB 1QBML 2UX7A 4YBQD 5E6RB 3BAWA 4NQED 4PQXA 3X1NA 2VXSL 4ODVL 4X5LA 4NQDA 4L3EE 4XN2A 1SHMA 1O7VA 4HU2A 5CBAB 1WBZB 1N7MH 4JFQA 2DMGA 4P46A 2ATAA 1YEIH 4J4PC 5IVXB 3VE0A 4XNMA 3V7MA 4TUKL 3IDXL 3EH5B 4MX7B 4LSRH 4TSAL 3MXVH 1OAXL 4JFOB 3QDMA 4W6XB 3I02B 1JI1A 4XVUC 2NUTA 4L1SA 3A6BH 3HC0B 2JIXB 3IPEA 4M5YL 4OCXH 4N28A 4CVUA 3U46A 4K3HA 1MOEA 4J6IA 2DJSA 4ODVH 4FF9A 3SKOA 2AEOA 2DQDL 1U95B 5GZOC 5CGTA 4XPFL 4KMLB 1MI5A 2NT0A 2YD8A 3WTVA 3VD1A 1O5DT 1OCZB 2VR9A 4TUKH 3IDXH 4TSAH 1RUAH 5EZLA 2ODIA 4IRJA 1LD9B 3ZMRA 2AS5M 1OAXH 1OT4A 3VQ2C 3GNML 4DJMA 3EJRA 5CEXB 3CVHA 4JW3A 4M1DL 2A74C 4A7TA 1XCQB 3QNZA 3U4EB 3MRBB 4E5XG 3DBSA 4M5YH 3U6RB 2NXYD 2P47B 2XWTB 4LFHG 3C8HA 4TUOA 3SY6A 5BS0E 1VZGA 3STZA 1NCUA 4W9FC 2XETA 1ZS8B 2DQDH 3WGUB 3CWGA 4F3FB 3S3SA 2IH3A 1C8QA 1KNOB 3CDZA 4NPKA 4Z7VB 1A1NB 2FT8A 5HGAA 3WFBL 5ACMA 3AQYA 3NQKA 1QLEB 4L1HA 4OJFL 3FQUA 5DTFB 4JK0D 1S7WA 3W3BA 3K6IA 1E27A 1F6AA 3MA9L 5DR5L 3VSUA 4Z7UF 4UIMB 5BCAA 4PLJD 2UZXA 3BWUC 4JM4H 4PJ8C 1KEGL 4DUVA 4KZEL 5DJ2B 3IDIB 3OF6A 5EU4B 3NCBB 4GRWH 1JPST 4AWJC 4MB4A 5FGCB 4ZFOL 5FDWA 3FUDA 4MJIE 3ZDWA 1MQKL 2XA8L 1WUNT 4N8UA 1GAFL 3QW9A 3MNVB 4Z3FA 1TNMA 4PJCB 1AG0A 4YAQB 3WFBH 2X4QB 5IVZA 3DOSB 5BOZG 4OJFH 4X8CA 2Q3ZA 3MA9H 1F97A 4RMRA 5DR5H 4Z7OF 1U3HC 2NW3A 4HLZG 3QCTL 5CILL 4ETYA 3EJSA 3VM5A 1KEGH 3WY3A 2BIMA 1UM4L 4D8PB 4KZEH 3RZWA 2IG2L 5C70A 2X0UA 3UP1A 2PW1A 4WU5A 3SQOH 1FBIL 3B9KD 3FFCE 4XVSL 2Z64C 1MQKH 3FTGA 4I4WA 1HHGA 3BXNB 3CCHA 4EUPB 1GAFH 1DUYA 3S4SB 3MJ8B 4C57C 4Q97A 2WMPB 2NY3D 5EULV 3I74A 4UQ2A 3SDDD 3QZPA 3APCA 5CILH 4IOIB 3KGUA 2UY7A 1TZAA 4Q9BA 4MDIA 4HUCA 3ZR6A 3BLKA 3TA3C 2IG2H 1JNNL 3TV8A 4AGQA 3L2MA 1KJMB 2G75A 4IKNA 1FBIH 1XGQA 5C6TL 4XVSH 5F3BA 2F1BA 2C1PB 5IR1B 4P2QE 1TETL 1F8TL 1R4XA 2B8OT 2VJ0A 1OGAB 4PJ7B 5FYKE 2VZVA 4FXGA 2WIIB 4DPCX 1YCSA 2VMCA 4I8DA 2MJWA 5EBWA 2OMVB 4ODHL 5GGUA 2VZSA 3DHJA 3HPLB 3SBQA 4C59B 3TEXA 1L9MA 3RWDB 3LQZB 2Y1VA 5HJBA 1Q0YL 4PW9A 3S37X 3GIZL 4LNVA 1MW0A 4JVWA 3BH9A 1Y1UA 5C6TH 4JFXA 3T0WA 2MQ0A 2H6PA 4GT7A 5DVKA 1NJ9B 5G5DA 1JZHA 2DM2A 4M7LH 1F8TH 3N1GC 1VEMA 5AVTB 1WAAA 5MENA 4P49A 3WN5A 2AV7A 4PLKD 5IWLC 5SWSD 3M1CA 1CMOA 4LKCA 1KN4H 2Z31D 4QRSB 5C0BD 1DQLL 5T3ZH 1KXVC 1TQUA 2DI7A 3T0EA 3BYTA 3SDXB 2Q20A 1BD2A 2XIDA 3AWGA 1ZA6A 1E8WA 5FCUH 3D25B 2AHIA 1Q0YH 3V4PA 3OJMB 1OY3B 2AI0L 1A5FL 2O61B 2R1XB 4LSTL 4D3CH 1JGEB 3O3AB 2IWGA 1NEUA 4B5EA 4L18A 1HYSD 4N90D 3KDPB 4JZOB 2BY2A 5TE4H 5CEZD 2K3HA 2LABA 1A3RL 3OPZL 1EDQA 4XO9A 1RP9A 2C4XA 5F9DC 4J1UB 4L9LA 5AYUL 2P1YA 4OUUB 2WJ7A 4ZMAT 1THAA 4ENEC 2QT6A 1EZVX 1NFDF 3BQUB 3X3FL 5C0IB 1TJIH 3BN3B 2ZKWA 3ROOA 2YAEA 1GGYA 2X53A 5E2VH 2QGEA 5TD4A 2OYPA 2AABL 2AI0H 1MNUL 3NIFB 1A5FH 4PRPE 1HKFA 3VGAC 1DVFB 4LSTH 6PCYA 1NBYA 1JG9A 2WC7A 3MGAA 4ZPVA 3TO4D 3U4AA 2Y1AA 1U93B 1A3RH 2AVFA 3OPZH 5HVFB 2E4FA 2XYCA 3IJSB 4K9EL 2XVLA 5FV2A 4WIQA 3TPUB 5J06A 2WXQA 3DX3A 5AYUH 3B6SA 5AFAA 1VRSA 3RFZA 3X3FH 2VERN 3FQYA 3HZKB 5IB3A 2AABH 3CHPA 4UM9B 4OZFA 1LNUA 1MNUH 4HH8A 4EIGB 3CFJA 5M95B 3B43A 2FT7A 3QXAB 4AKQA 1SY6H 8CGTA 1AKPA 1V10A 2KQMA 2Y7OA 2IMMA 4FQQA 4WI8A 2YFOA 5BJTA 4OJAA 3NSYA 3TFKC 3Q2WA 1NC4A 3K72A 4HUWA 5I1EH 1E4KA 3ZT5A 4L8BA 7PAZA 4BK4A 3ZKMD 3PQYD 4O02H 5DD3H 4K9EH 1CD0A 3FB8B 5CMAB 2X40A 3A22A 1CGVA 1YNTF 3K8LA 5JIKA 5BZWA 1YDPA 1BPLB 4ZTPL 1G1OA 3QEUB 1GCYA 4PBWD 1ZDSA 1URIA 4AVKA 1AS6A 3U25A 3QFJE 1S7UA 3ZU8A 4NO3B 3UTTB 4R7DB 3O6LL 2LU7A 3BAKA 2PWGA 3LRGA 4K3DL 5H4YA 5MENE 3GZOA 3BZ4A 2R56L 2CE6A 3GO1H 3BCFA 1KB5H 1QQDA 3BGFC 3JWOL 8FABB 1QA9B 2XKNA 3D0LB 1QRKA 4E9TA 5FLVA 1DQDL 3WS6C 4YDMA 3JV4B 5FECB 4J3OC 4ZW5A 4X0KB 1BD2E 1OTUC 4YSEA 1INQA 2GAZB 2JQMA 1YYCA 2WLYA 3NJHA 1A9BA 3ULSB 2ZAIA 3LAFA 3GBDA 4ZTPH 3LRKA 4J3VA 1R24B 2JB5L 3CFUA 4LOUD 1X9LA 2BW4A 3NZ8B 2QKIC 3DLQR 4XOCA 3O6LH 5GPRA 3HS0A 1J9CT 3V6ZA 1K6QH 4W9JC 2Y69B 4ELKA 2KBGA 4K3DH 4KKZA 5ISZD 1U8IA 4KJQD 2A77L 1C16B 1EGJL 3PS6A 1UKSA 1DQDH 1RHHA 2MNWA 2LFGA 3OKEA 4RGOL 5D6DC 4TOYL 4UCFA 5J9PB 2OMUA 1R5IA 4PJHE 1YMMA 2CPCA 4U6YA 3V6FA 2JELL 2MIZA 2IO5A 2X38A 4LDOB 3L08A 1KN2L 3CPLA 5AG8A 4NQXA 5JYMA 5C08D 3DJZA 4OFIA 4W1TA 1CD8A 5H37A 4OW6A 3DK2A 1U8KB 1G0YR 1MXGA 5KW9L 2R0KL 4U2ZA 5EBLA 1F4HA 4AGLA 5CZVL 4N3TA 4P9HL 4DO6A 3TBVB 3P54A 2Y36L 1EGJH 1U8HB 3WTUA 3DSNB 3EXJA 2VDLH 2ITDA 3F62A 4RGOH 1INDL 5EF1A 1BVZA 2BX5A 1MLCA 4PGEB 3UYRL 5F96L 2G4EA 2JELH 1P53A 2VIRB 4LPYA 4ABUA 1KN2H 4YIQB 3W9EB 4MGXA 3DIVA 4PJ6A 2WLHA 4PVBA 4B53A 1IEBB 2BINA 3LNGA 3KLAA 4R7VA 1QR1B 3WY1A 4RLDA 2XXFA 3L3OB 3ECWA 1T3FA 5KW9H 4UDTA 5CXPA 5F9JA 3SSGA 4P9HH 3RTQC 3RWCA 2Y36H 4UTAL 3ZL2A 2Y1ZA 5IF0A 2DQFA 4LOEA 4R4ND 3WFCH 4LL1A 1K2DB 4S0HA 1INDH 2R4SH 4UBDD 1G9NL 1M1XA 3UYRH 5T1DL 2Y6SC 3QJRB 1WHOA 2RQEA 5AVQB 2X1QA 1PYWA 1Q9WB 2NX5D 1XSJA 3IJ9A 5I17A 2DY2A 4NGHL 5DHMC 5IT2L 1CDJA 2AEIT 5DZ9A 4HC1A 5HHXL 1RURH 4K9JA 3B7YA 3D2TA 2ZXWB 5DMGD 2XZQL 1T0NA 2E9BA 1P7QD 2J1YA 1E90A 4G1MB 4YSOA 4UTAH 2XRAL 3F01A 3MUZ1 5HPMA 2CPUA 2JI1A 1VFAB 2CA3A 2PW2A 4M48L 3ZX1A 3ARYA 1K72A 5EZJB 1NUDA 4ZOAA 2CO6B 12E8L 3ZTDC 5D2NE 3N42F 5T1DH 1NIFA 3ETTA 3V79C 1R3JB 4XNBA 3REWB 3OB0K 2VDNB 3AZUA 3ZO9A 1AD0B 4NGHH 4WEUD 2HRPH 5IT2H 3BDYH 2GC4C 2YJQA 4ZMPA 3H55A 5I6KA 2ZWNA 3O8XB 2ZWLT 1JK9B 2O5YH 3OLEA 5EUOB 4FC3E 4JM0A 1YMME 5D96C 1QUNA 4S0SD 3EJTA 4M8VA 3BWAB 2FHFA 3CSTA 1AZBA 2XRAH 3N2JA 4GG6E 1BBDL 4L3CB 4GAFB 3TPKA 1J10A 3KVQA 5EN2A 1LP9A 12E8H 3QH3A 1I4FB 5DGRA 3HAEA 2ZOTA 1HSBB 3ULVC 3EDEA 4QHNA 4HIPA 4PGBB 3H53A 1AR1B 4FTVD 1A25A 3ML8A 3QZLA 1JF6A 5BV7L 3WMQA 4R96B 5IQ7H 3OAWA 2FD6H 2XQYK 4MD0A 1UA7A 5KVDE 4NKDA 4XH2B 4XO5A 3LVEA 1G7LA 2PWFA 3KPRD 4ISVA 3HNVH 2CDEB 1JK8A 3PJNA 4FQCL 3SKMB 4GQZA 3LZOA 3TC9A 4KKBC 1BBDH 3B3IA 2PPDA 5KOMC 4KRPD 4HVBA 1WAAF 4L4TA 1AGCA 3TJEL 2YPLB 1U8OB 5CU5A 3UX9B 3W11D 3IXTB 4UTBA 4E9WA 2E8YA 3L5WB 3C8DA 4QTHB 4EVNB 2E8ZA 2W94A 5BV7H 5C07A 4W9EC 4BH7A 5D4IA 5KBNC 5IIEA 1ZHBB 4JB9L 2D0GA 3NCWA 4I18A 5DJXB 5E08L 2MKWA 1DE4B 1VFBA 4ZUWA 5HYFA 2XBDA 4NO2A 2JTDA 4U1NB 3I50H 1CFVL 3C9NB 1ANUA 4JFDB 1L9QA 1P84J 2CJTA 2XY1A 1SYVA 5JA9A 1HQ4A 2UZIL 2AJXL 2GIYA 5FUCC 3U36A 4MQ7B 5D7SH 2ATKB 3ABMB 1EX0A 3CC1A 3DVGB 5GS2H 3SJVB 4QWWD 1ZLWK 1A02N 2CXGA 3LEVH 4XRCB 3V5DA 3I6LE 3TASA 3QIWD 2DKMA 1JGLL 3P40A 4V11A 1CT8B 4MSWB 2IDQA 5E08H 3KPQA 2AV1A 2WW8A 3GB7B 4PJFE 5BRZB 5JPMA 1TSRA 1FZJB 1Z5HA 2CBMA 2F0CA 3F7RA 2R0LL 3MBEC 4R5XA 2UZIH 2AJXH 3MV8D 5JHLA 3FB7A 1ZE3H 1IZJA 3V0HA 2RHEA 5FHAH 5TH2A 3GMMB 1U8NA 1TQVA 1S9YB 3QNXA 4WY7L 3ZGIA 3S2CA 5IB2B 1P9MC 5ECGA 4P4KB 4DP0X 1HK6A 5L2KB 2R29A 5JIMA 3WO4C 3IDYB 5FYKU 1PX4A 3HLKA 1JGLH 3VA6A 5FO8B 4ZUSA 4X5QA 1LP9E 3H9HB 2X89D 3EUUA 4HK0B 4NQCD 2BS71 3VXUE 4RGMB 4KI5C 4LHUB 3SDAA 3E8VA 1ET7A 4JJ5A 3X1EA 1E0OB 3TWCL 3F65A 1MQ8A 1KB9K 4TV3A 1U8CB 4XVJL 4OLXL 4KDTC 1I8KA 2FIKA 5I30L 4LP5A 3TURA 3AACA 2FBRA 5HVGB 3FTYA 2X6BA 4WY7H 1U8PB 1XGYL 2DMHA 1OD7A 2CJUH 5AKTA 1J1PL 5BW7C 4WFFD 2VLJD 1V05A 1A4JA 2V6HA 3B2XA 3BZFA 5A7BA 4L4TE 4LQFH 5EMYA 1ZGLA 1CF8L 35C8L 2RTTA 1A6VL 5JXAL 4TNVK 1GGTA 4MNHB 2ICEA 3O3DA 4XI5C 5KYUB 2FEEI 1R3KB 5C07E 1RULL 2J1WA 3O2DH 2WXJA 4OJEH 3TWCH 3O2VL 4XVJH 2J8UA 4IOFC 2X1OA 4HUUB 5GGTA 4EF3A 3SCMA 2J1KA 3NSDA 4GJTB 4JHWL 4M1GL 5I30H 4X7SL 3VH8B 3WO3B 4D0DA 5I19L 3RDTD 1KTCA 4K8RL 2G2PA 3LNHA 4WWKA 1Q9KA 5DK2A 1J1PH 3LS4H 4PRIA 2YWYA 1ZVNA 1FI8C 4XXDA 3L9RA 5DQJA 4MA3A 3SYOA 5JR1L 2PMZA 3QARA 2HPTA 5B38B 2NSMA 1CF8H 4NOBA 5DCCA 35C8H 5D7JC 5JXAH 4KDWA 3D69B 2IAMC 3WG7B 2BO0A 3VGBA 1RULH 2QL1A 1BZEA 4GT0A 4LPUA 1KJ2L 4X6BA 3PAYA 2OX5B 1KPRA 2IQAA 3T65A 4JHWH 4M1GH 3T8XA 4X7SH 2QSCL 5L8JB 1VPOL 5D1ZA 4AGNA 4HPYL 1RSYA 2P8MB 2WV3A 2B59B 1QLRB 2JH2A 4ODUA 1KLGA 2LW3A 3Q2CA 4OLUH 4JHAL 4UOJA 2H6OA 3MRIA 5E94A 4G8FA 5JR1H 1JNLH 1P2CB 4QGYA 1S6NA 4KO6A 3S3BB 4AIXA 2V2TA 4WJKB 1E65A 1B0GA 4MAYD 3FQXA 3ABZA 5EEXA 4RZCA 3WFHB 1KYDA 1I8UA 1KJ2H 4PTTB 3S96A 2DZEA 3EZ8A 4FFWD 4W9ZA 4NAJA 2CBQA 2CCVA 3WL9A 3QJFB 1FJ1A 5L2JA 4X9HA 2QSCH 5JHDA 1VPOH 2NZ1A 4HPYH 1TU2A 1TZIA 3RUGB 2VABA 3HC3L 3WEXB 2L4OA 3TGXA 4WUKL 3JV6A 1FWXA 4MCYA 5F71A 3CBJB 4W4NA 2IGLA 4NQTA 2B0SL 1YEDA 3HIZA 4H1LB 4S1QH 1M71A 1QHOA 3WKPA 3T8VA 4YLCA 5F1NB 2IADA 4QOKD 4JLRB 3U2SA 1I3GL 1MZYA 3NRQA 1PZCA 3FQWB 4R3SB 1IL1B 5DK0B 3HLAA 3ABGA 3HRZA 1O6TA 4JM2B 4Z7QB 1M3JA 4QRPD 4G7VL 4RGMC 3UTZA 2E9JA 2MOVA 4IGBC 7PCYA 5GZNC 3F12B 5DEGA 3HC3H 4MDRA 1A65A 4PHXA 3BI9X 3LQMA 1A1OB 3MRKA 4RGND 3VD4A 3IAPA 3VI3B 3X1BA 4W4OC 1HHIA 2QPFA 2ZOKB 5FYKL 3GMOA 4OZFG 4WK4B 4F24A 2M2DA 2XFXA 4JRYB 1MCDA 4FRWA 5I16A 4I0PD 5KZCD 2AQ1A 3GKZA 1I3GH 4YN3A 1FF5A 3ESNA 2WQRA 4S10A 1Q94B 2R2BB 2VLRA 3L3JB 5D1XC 5B7MA 2FTAA 2VUKA 3KL5A 2DIBA 2ED7A 5JYLA 1VCBC 1EPFA 4GY4A 2NY6C 4J3UA 5CBAA 1WBZA 2LLLA 4MRBA 2DDQL 2X6CA 4KHTL 5F7DB 4BQBA 3LS5H 1JJUA 1SFHA 4MX7A 2BNRD 3CVHH 5FYKH 4JFOA 3CMOH 3PGCB 5DJCB 2QHRL 1FZMB 2BS9A 3I02A 2JB6B 3I3EA 2IV8A 4HMDA 1BF8A 3HC0A 2JIXA 2D2OA 4NO5B 1X7SA 2ZJSH 2WNXA 5KUKA 1RHFA 3EH3B 3AQXA 4KKAC 3H7LA 3HN5A 2Y7QB 2QVFB 1U95A 3DI2B 4KXBA 1AXSB 1ET5A 3C5ZC 4QRRE 3FQNB 4E9LA 1KTKE 1PDKB 1NDGB 4KHTH 3EFDL 3N55A 5J3HD 2BH0A 2VR6A 1TYJA 4NN5C 4DGVL 3VGHA 2HX9A 1LD9A 4XP9L 3L17A 5CEXA 2QHRH 3JBG7 1NINA 2UVEA 1XCQA 3U4EA 3MRBA 1RJLB 4U7MA 3U6RA 5JHDE 3RWIB 2XWTA 3ARBB 5A6IA 3VWJD 4R2GC 1ZS8A 3UBXB 3C2SA 5SX5K 4F3FA 1KNOA 4Z7VA 1BZ9B 5IWLA 1A1NA 5JPNB 3NIGE 1GOFA 2L7UA 2O6EA 1EUTA 1PTZA 3IMUA 1KXVA 3VUAA 5DTFA 5H37G 2XN2A 5A6MA 3BP6B 3NA9L 2P5PA 3NCJL 4UIMA 4GFXA 4XP9H 4YSRA 4KK6C 3DHUA 4UI2A 1G43A 2XTJB 4L8SB 3NT0A 2WCGA 1KWGA 1H6TA 4PS3A 5DJ2A 3IDIA 4HCGA 5EU4A 3F04A 4GQ9H 3H9ZA 4I2XE 5HDBF 3KWTA 4AZ8B 5KSAD 3TVMD 2AMGA 2WYZA 1WAEA 3MNVA 4XPHH 4PJCA 4YAQA 2YD0A 5M94B 1NUNB 2X4QA 3EO9L 4XE5B 3DOSA 1LWJA 2EDFA 3FUMA 3NSJA 3TJPA 1E67A 1XZ0B 1ZK5A 2VE6B 4KUCF 5BO0D 1FE8L 3MRGB 1KENL 5IROC 2ZUQB 1J5OL 1ZIBA 2X10A 3SZ6A 3V0DA 2MRYA 1OD9A 1W6WA 2JJWA 4MKTA 5CS7A 1EFQA 2CRZA 4LEEA 3WELA 4YXKL 3RGHA 1U9KA 3HB3B 1QX1A 3AFLA 2VUYA 4P2YA 5IVXE 1IV8A 1I7UB 3H3KA 4YFDB 3REVB 5EOCH 4EUPA 3BXNA 4GQRA 3S4SA 4H13C 3MJ8A 1EBPA 4D9QE 1PGRB 3RNKB 1YEEH 4PRHD 2WMPA 3EO9H 1MRFL 2EE3A 3ARGB 3FHAA 5JA8B 5K9QG 2DYPD 3HA0A 1KENH 2OL3B 2VC2H 3HR5B 4QHKJ 5DGQA 1NEZB 1J5OH 4IOIA 3HC2A 3IETB 1A7PH 1K8DB 2Y7NA 3KWVA 1KJMA 4YXKH 1D6VL 5AW5B 1GIGL 1MIEL 2YD1A 3D4GA 4U6TA 5FA4B 2C1PA 5IR1A 3MFFB 5CCJA 2DWDB 2XWRA 4HZ1A 2YWZA 4MA7H 3V0FA 4A38A 1OGAA 4JG5A 4PJ7A 3NRPA 1MRFH 3DX9B 1AQMA 3PJSA 2OMVA 4C4UA 4NC2B 2VMDA 4GSDH 2X2HA 3HPLA 1OV8A 3RWDA 3LQZA 1JZEA 2WUCL 4M6AA 4XBPB 3V4PH 4APXB 3P02A 4MB5A 3GSNA 1PPIA 3U6XA 1D6VH 1GIGH 2J8UF 3HBZA 3WFZA 2IC2A 3HAEG 3NIDB 4F7KA 1IJNA 1NJ9A 4GAJL 3BP5B 3J07A 5FUZL 4CN4A 3L45A 2IDUA 3ES6B 4CKQA 5C92A 3O9WD 3QR2A 4AUYA 4MB3A 3HRPA 3QE5A 4LVHC 3QORB 4KTYA 4RDBA 4LCWB 4M00A 4QRSA 4UQ3B 1X5MA 5FAAA 3SDCC 3SDXA 4G8EB 1UD8A 4YE4L 3MV7B 3S8WA 5I1KL 1W9XA 5MERB 3QULB 2O61A 1CYGA 1ZTMA 5D6DA 2R1XA 4QPEA 1JGEA 1WFIA 3O3AA 1EDYA 2W60B 4GAJH 3RZCB 4UOW1 4N1EA 1NUFA 5T5NG 4N87A 4HJ1A 4GXVH 4JZOA 4IK6A 2K0RA 2PO6B 3LOWA 2MWCA 1XMWA 3GI8L 4MFHA 4XHJD 1X44A 1FGVH 4J1UA 2VYRE 4I9XA 2AXHA 4OUUA 3OG4B 3BD4A 4NN7B 1KJVB 4BZYA 5D93C 1XB6A 5J89A 3BQUA 1RMFH 5C0IA 4OZFH 2P44B 1AZUA 3G04B 4XC1L 4JQIL 1QPPA 2IVFC 3FQ4A 2R8SL 3NGBB 5AOLA 5I1KH 1XH3B 2EDRA 5TF0A 2E7MA 3ZIMA 1GXEA 4PJ9D 4ADGA 4MZ3A 1X5LA 3RGVC 1I31A 3OHMB 3SE4A 2UV3A 1OB1B 1YZZA 2UZPA 2X2UA 4RMUA 2RA1A 1SJHB 3LD8C 1ADQA 1U93A 3GI8H 3NAAL 4ETQB 3E1ZA 3U48A 4KUZL 2FDBP 3N85L 2YEZB 1E43A 3IJSA 2KZ1B 1U4EA 1V7NL 2DPKA 4P23B 3TPUA 5F6IC 2HLFC 1AZCA 5H2BB 4JGNA 4Y5VB 1B0WA 1E8ZA 1ACYL 2NZ9C 5C7XH 1CPUA 2R8SH 2RFXB 3BJLA 4JDZA 3V55A 4Y4FC 3ECUA 4UM9A 3WEAA 1XSOA 3S36L 5IJVB 2EDYA 1F56A 2WXRA 2K70A 3GSOB 3WXVL 5KTEL 3QXAA 2E46A 2V5YA 3TNMB 2OZ4L 5L0QB 5ANMB 4N0CC 2X3CA 2WLIB 1P5UB 4G7QB 1R75A 1KGJA 3K1DA 4I9WE 3QI9C 3NAAH 3HE6C 4BUGA 4KUZH 5E8EB 1NCHA 2VDMB 3N85H 4JCMA 3FB8A 5CMAA 4EOWH 2YGNA 1V7NH 3HG1E 2ALWA 1CXIA 1RI8A 4FL4B 4FADA 1WEJL 1VCAA 3QEUA 3RL2B 1COBA 3DETD 4UWQB 1ACYH 3B9DA 4GRMB 4NNXB 3L5IA 2EEBA 1AXTL 3CFCL 1BEYL 4KTDL 4MMZC 4NO3A 1DQQB 4R7DA 3UTTA 4EPSA 3EYQC 1HAWA 1GYWA 3S36H 1Z3GH 3P0VL 2QFRA 5INCB 4Q0XL 5KVDL 2B4CL 4B9CA 5KTEH 8FABA 4DZ8B 1QA9A 3D0LA 4OQ1A 4YSTA 2CUHA 4JY5L 3GXFA 5IQ9B 1YNLL 3HG5A 3JV4A 1ZLUH 5FECA 1S9KC 1TJGH 4X0KA 3NJVA 4N20A 2GAZA 2AERT 1UXSB 3ULSA 2GSGB 1JNHB 3RGBA 5D1QB 3TOPA 2HMIC 1WEJH 2AQNA 2OJZH 4WV1C 4XAWH 2D0FA 5H37H 1R24A 5DC2A 4BFEA 5LGHL 3VFRB 4HKBB 3NZ8A 1U3ZA 1TQBB 4KTDH 1AXTH 3CFCH 4GMSL 1BBJB 1T66D 3QJOA 4FQXC 2KDYA 4N2HA 3DDGA 3P0VH 2EO7A 3GPEA 3LPGA 3PHAA 4H4NA 1P0SE 4PREB 1C16A 5I0DA 1JAEA 3KPLB 4JY5H 4KFZC 5IG7B 3Q8FA 5BZZA 5BS0D 4PJBF 1DLFL 2DJUA 2GUOB 2Y2YA 4N0FB 4OQTL 4DVBB 5J9PA 5DJ0B 5IW6B 5GSRB 2YPKB 4N2NA 4K23L 4XMUA 2XKUA 4HC1L 4QR7A 2Y1YA 1HKLL 4N3UA 2UXGA 3VXOB 3RY4A 1WISA 2Z93B 5LGHH 4TQIA 3AS0A 1OCOB 1G4RA 3KW8A 5F7HA 2WQVA 1UWFA 1U2CA 1MAJA 3DMMB 4AEIL 1U8KA 3B8YA 6TAAA 3QUXD 3Q06A 4PRAB 1IAKB 5EU5B 2CR0A 4AT6B 1ZK9A 4F7EA 3TBVA 4AYSA 1VZHA 2OMWB 1U8HA 3SBRA 4Z7VF 3DSNA 3QHFL 1DLFH 4Y19B 4GKLA 4POYA 3KLHC 1FCCA 4MJID 4PGEA 4K23H 3D34A 4JFFB 2VIRA 2ZXCA 4AKOA 4HQQH 1I75A 1NQBA 1YJDL 4YIQA 3W9EA 1GGBL 4HC1H 2Z92B 3H2PA 1HKLH 1D5RA 4ZO6A 1IEBA 2OP4L 1DVSA 1WH0A 3K81A 3KL0A 3WTSA 2WXOA 5LBGA 1QR1A 3UDWC 3MNDA 3FRUB 3L3OA 1CFQB 5AVYB 3CHQA 4KO9A 4GSUA 3G6DL 1DQJB 5IK3B 1ORQB 4PJCF 4P46D 2A5UA 1K2DA 2VSCA 1SBSL 5L0QC 4HCRA 1URLA 2R51A 2A9CA 2ITCB 1R5VB 3QDMD 1LE5B 1Q9WA 2J71A 1YJDH 2F7IA 2Q2LA 3VXME 3C60C 1M9SA 2A9BA 3IE9A 4AW7A 2OP4H 3F83A 2JXMB 4R7LA 2V17H 4FL4C 1GTNA 4PJGE 4IMKA 1GGIH 5K59F 1YAIA 4ZFZA 4G1MA 1L3WA 4QRUB 1S3KL 2EYSB 3IPFA 1MI5D 1AAJA 1G5AA 3RVVC 1Z0NA 5E2UL 2PTVA 1IGMH 3ZRCC 1VFAA 4OFVA 3HAEH 1JGVL 3LNFA 4UTBL 5GRZA 3L95A 3QS2A 5EZJA 1O7DE 5AYTA 1SBSH 2AGJH 2CO6A 2O6PA 2WOYA 1P9MA 2YJLA 2DRUA 3Q8EA 4XWGH 1R3JA 4IRJD 1IBGH 5T1JA 3REWA 1X5AA 2ZPKL 5FYKD 1AD0A 2QSVA 3J8F7 2ORBH 4Z3TA 3R7RA 2OJEB 4IRSB 3O8XA 4MNGB 1JK9A 2XJLA 1TMQA 3QAQA 2WLLB 5EUOA 5F7WC 5HYSG 3FAXA 2J2ZB 3IBOA 4MBOA 4PG2A 4L4VB 3BWAA 1W8OA 2I60H 2NY4C 1HIMH 5DFAA 4V2CB 4L3CA 1LK2B 1Y7VA 1JGVH 2OA9A 4JFEB 4PJ7F 4UTBH 1CDBA 4B41A 3T0VA 1IO4C 1GHFL 1I4FA 1PKQE 5J12B 1HSBA 1NSNL 4PGBA 4KQ3L 3QCUL 5DEFB 5BW7A 1NGPH 2ZPKH 4JGJA 3ZN6A 4AKPA 2ZSWB 4HETA 4R96A 3FTVA 4YR6B 4XH2A 1AGDB 3OF6D 5DVMA 3WUWB 2WP3O 2XVGA 2CDEA 2OMBA 2QQLL 5BQ7B 3SKMA 1NGWB 2YSSA 3FOLB 4YPJA 5CN1A 3TBTB 5JW3H 4PCTA 5JHLL 3KLLA 1HWWA 4AC4A 1IGYB 1GHFH 1U8OA 2C4FU 2YPLA 5HD8D 1N9PA 3IXTA 2Z0UA 3STBA 4ZNCD 1NSNH 1QWUA 2N7AA 3L5WA 4KQ3H 3QCUH 4QTHA 4EVNA 2IALB 2BZ7A 2R29L 3SDXF 5CF3A 2WVTA 1ZHBA 2QVTA 4N2OA 2IPUG 2OV0A 2V3EA 5E51A 4KQ0A 5F0MB 5DJXA 3BWSA 1ZV9A 1DE4A 1YNKH 2QQLH 4Z78B 3O81A 3ZTJG 4U1NA 4Z7NE 3C9NA 1T0MB 2UWEB 4JFDA 5F8QC 5JHLH 5K9QI 2ADIB 4A7QA 1PSKL 1VERA 2CIIB 3AY2A 1HOCB 1XCWA 2YSTA 4MQ7A 1QW9A 4G7SB 2ATKA 3EJYD 3MNMA 3EF4A 3DVGA 1U92B 2R29H 4HXAL 3SJVA 3SODB 2GFBB 4XRCA 2BP0A 2VXVL 4XMVA 1YPZB 3IFNL 1BVLB 1CT8A 3NIFF 4MSWA 4L8CB 5B3SB 3GB7A 1XF5B 4TLUA 4X9GA 5BRZA 1RP8A 5INDB 5LGJB 3QXUA 3KXFB 1FZJA 5GGTL 1PEZA 2FLMA 2VQ1B 2GBTA 2GI0A 1I1AC 4UM8B 3RVWC 4YX2H 3AT9A 2N3JA 1LLAA 5E2WL 2ZCHL 1A14L 4HOXA 1M1SA 4MD5B 3FCUB 4NN6B 1BLIA 3L81A 1CD9B 1I9JL 3HE7C 3GMMA 5HDQL 1GMIA 1S9YA 5EUOE 5IB2A 4HXAH 3DGCR 2CO7B 1XH0A 2C3XA 2MFNA 1OAKL 4P4KA 4E41B 4YO0B 4HMCA 4CMMB 3B9VA 3V6OA 2VXVH 3IFNH 3ZZSA 2EYTB 3QUMB 4KMTH 5FO8A 4MBRA 4RFEB 2Q76B 1ZWIB 1UZGA 1AC6A 4IRSC 3INOA 2PCFB 4HK0A 5DVNA 5FK9B 4YXLH 5IOKA 3JVGC 4Y16B 4TL4A 4JUTA 4U4IA 5GGTH 4LHUA 3S4SG 1U2YA 1KPVB 3TU6A 2G30A 5MEND 1CURA 1Y07A 5CJOL 2M83A 1U8CA 5E2WH 3U1SL 4YHZL 4P8QA 2ZCHH 1A14H 4TVSa 5I74C 4F8PA 2NCMA 2Z91B 1T2QL 4WWNA 3VD5A 4W4OA 3T0ED 5HDQH 1UHVA 4FCAA 3DECA 1U8PA 3ZHFA 2ADYA 1BD2D 1L9SA 3PV6B 5G4NA 1OAKH 2VZ3A 5HPOA 1HCZA 2HUHA 4YNYB 1PIFA 1IJ9A 4M6OL 3VFTB 2K1MA 3ILQC 5DJAB 4ES9A 5I1IH 3M7OA 1IFRA 2MKLC 5J56B 1DCLA 2O5XH 4LIQL 2AJZB 3H4FA 3LKRB 4HJGB 5EEZA 5KYUA 3VSVA 1R3KA 2XPYA 1KGUA 4JN2B 3ILDA 2PYFB 3KPSB 2DLGA 3NMEA 3U1SH 2BIPA 4HUUA 4YHZH 8PAZA 2A73B 3O3UN 1QSEB 4K5PA 1YEKL 2XV6B 1SXNA 2VDOL 3VH8A 2NY1C 2P52A 3IDUA 2WO2B 3F7QA 3LZNA 1KZYA 4X7TB 1T6WA 4JFDE 2IWFA 3ZDXB 1TPXB 4FYSA 4TSCL 4M6OH 4FQHB 5T5FL 5CSGA 5DXWA 5B38A 1P5VB 4DESA 4LIQH 2GJJA 1FORL 1AIFB 3D69A 5SWZA 1IGJB 2XX1A 5HHMB 3SJVE 1N6VA 3FTZA 2HCZX 5ITBH 3MRNB 1RPQA 2H3NB 5AAMC 5SV4A 1TSHA 2OX5A 3QXDB 1X4XA 4DUWA 2VDOH 5FUOL 2P8MA 2B59A 1QLRA 3LHPL 1JTTA 2XN9B 2YEQA 4M3HA 1T6VN 5DD1L 4Z3IA 4TSCH 5HI5C 1IZKA 4ODWB 4YDNA 1NBZB 4S1DD 3O4OC 1P2CA 3EO1B 1P7HL 5C1MB 1UADC 3BKML 3ZKXB 2GC7C 4Z9KB 1B6UA 3L9BA 5DUJA 1CE1L 5J13C 1IRAY 3WFHA 4QRTB 4PTTA 5L2KE 2AJ3A 3V6OE 5DYOB 1G9MH 3QJFA 1MHCB 4OB5L 5FUOH 1NMAL 3RUGA 1DQIA 4AX3A 5LQBL 5DSCB 3WEXA 4BKLB 4XVTL 3LHPH 4NN6C 2D31B 5DD1H 1HL4A 4YK4C 1UKTA 4PWJA 3KLKA 1MXDA 4H1LA 4P59L 1NAMB 5F1NA 5KANG 4JLRA 2GHWB 4IM8A 3BKMH 4ZZKA 2VDKB 3FQWA 1IL1A 4FYTA 4R3SA 4FXKC 5DK0A 1CE1H 1WG3A 3GUTB 3Q8AA 4JM2A 7CGTA 4E2OA 1UCBL 3ZHLA 4UOZA 3H2QA 1JDDA 2QPEB 2AQRA 2GY5A 4LVOB 1CXEA 3BAEL 2Q8AH 1NMAH 3F12A 5I1AB 1A9EB 1OHQA 4D9LL 5LQBH 4WVRA 4PYGA 4XVTH 1A1OA 4FFVD 5IROA 4H0IA 4K3JL 1RZJC 3NCEB 3VI3A 4MS6A 3ARVA 3L3HB 1GVIA 1PL3A 2ZOKA 3OAYK 1BFTA 4WFGE 4YBQC 5G55A 4JRYA 4PBXA 3GSRB 4P59H 3ATAA 1J86A 2D8KA 1UZ6F 4RSVA 5K33A 2Z1PA 1I1RA 2X2JA 4N2FA 1YG9A 1KV3A 1Q94A 5F1KC 5M7QA 2R2BA 3L3JA 4CC4A 1YMMD 1UCBH 2UUDK 3PGDB 3SDDB 4C8XA 1SJXA 1UXLA 1ETZB 4ZUVB 2PNDA 2JI2A 3WD5L 5IQNA 4JY6B 3BAEH 4LAQH 1QLEL 1KG0B 2HZHA 3CFEB 3NZSA 5DA0B 5F7DA 4K3JH 3IGKA 4ONOA 2ETWA 3X11B 4AV0A 5IHLB 5D1ZI 5EUOF 5DJCA 3PGCA 4RESB 1FZMA 5ACLA 1F3JA 1DCEA 1RJZA 2JB6A 4CADB 3BD3A 4P2RB 4CC0A 4NO5A 4M6NL 1L6ZA 3E1F1 2CRMA 5MI0B 1KFGA 2ZYIA 1ZV2A 4UOQA 4ZS7L 3W0WB 1AXSA 4Z1PA 1D2PA 1QLEH 1CXFA 1MCCA 3AY4C 2WB1A 3FQNA 4IKIA 1PDKA 4OJYA 4PM1A 3GFUA 1NDGA 2LLGA 2R9HD 3J27A 4FX5A 2NXYC 4ZJ9A 2XV3A 4Q6KA 4WHYH 5JXEA 2CCLA 1VENA 4I85A 2I25N 2LVCA 2GTWB 2JKIS 4HHWA 1RJLA 2DQTL 2EE9A 4MCNA 1OCWH 3D7PA 3KEDA 3C2AL 4M6NH 3RWIA 3ARBA 5SWSB 3UTQB 5ES4B 2J57A 2YS4A 1MCIA 1KF9B 5KAQF 4BK5C 5C0ND 1IC5L 3BIAX 4ODBD 4Y1AB 3UBXA 4ZS7H 1HI6B 5E8OB 4OR1A 3TF4A 1BZ9A 2TRHA 4PLJC 5JPNA 3AB0B 3T3PB 2VLME 4N2AA 4WNSA 1OAJA 3P11L 2VMEA 1QRNB 3PYCA 3BP6A 3SPVB 3K6OA 4PMFA 2XQ0A 4ZMOA 5LBVA 3H56A 3L1OL 3DX4A 2E76C 4KOCA 3NK3A 5DS2A 4AL8H 1QEXA 4UNVA 4L8SA 3FHQA 4KZ0A 4Q8BA 4FJ6A 2DQTH 4MCMA 1HXKA 4FKEA 5CM1A 3C2AH 3LB6D 2N1TE 4R26L 4EUPH 5ECJE 2WN2A 5DUBB 3VI3E 1IC5H 4KY1L 4Y2NA 4AZ8A 1OZTG 5KS9B 3FU5A 4ILDA 4JRYE 4OVVA 4RVBA 3CLFL 5HVHB 3P11H 4YE0A 1XZ0A 4U05A 2VE6A 3PHOB 4AQ8C 3MRGA 2OSLB 3QJZA 5DFTA 1VAHA 3B9KC 4FA7B 5E9DE 3L1OH 4PJ5B 4FQLH 3IU4H 4GO6B 3HBPA 2B5IB 3ATDA 4KXDA 3E38A 4YHML 25C8L 4R26H 1Q1PA 1OAUL 1OE1A 3KG5A 3L4WA 1I7UA 4YHLL 3REVA 3VXUD 3TEUA 3WFEL 4FJZA 2NY2D 3CZKA 3MPCA 3F7LA 4OCLC 2R1YB 4MMYA 3AC0A 3SDDC 4KMQA 3RNKA 2F5BH 4X5RA 2OW6A 2WK2A 3ARGA 4J3BA 4PAZA 2VOTA 1OF0A 3C5SB 4K0OA 4WWOA 4X5WB 2AAAA 2A9NL 1I8MB 2OL3A 3HR5A 4N5UA 5LGKA 3GSNH 1NEZA 2FE0A 3OC5A 1OQOA 4K7PL 3I9IA 3IETA 4OLEA 4QHKI 25C8H 4K3EL 4YHMH 4L4TD 1K8DA 1OAUH 4HT1L 4Z95L 4EZLA 4QRQB 3QC5X 2ZONA 2JKRM 4QTIL 5FA4A 3TX4A 3AREB 1BQSA 4CN6A 1VDGA 2NOYA 3MFFA 5AUMB 5C07D 2DWDA 2F1AA 5J11C 1B2WH 3GLAA 1N6UA 4O58L 4YHOL 3S3DB 3DX9A 4J3WA 4CU7A 4NC0B 5LBSA 1QWNA 4XBPA 1ESOA 2W91A 2YO3A 5AVUB 3ZZQA 4APXA 4FMVA 4B50A 4KH9A 4DGUA 3MKKA 4K3EH 3IS1X 4ICXA 1MFMA 4KOBA 4G9FE 4HT1H 5EWIL 4Z95H 4YXHL 4PGZA 4YDLB 4QTIH 1LWRA 4I88A 4OIIH 3T71A 3VXRB 4PLKC 4X80H 3BP5A 4WKZB 1ADQL 5I1LB 2GUYA 3QISA 3QGVA 3ES6A 2BVQB 3F7PC 3H1ZA 4FI8A 5CSZB 4O58H 4YHOH 2XTJE 4NXSA 3MMEB 4KUCD 4OCRL 4Z3GA 4NWTL 2X4SB 1ZVSB 3AB0C 4LCWA 4ELMB 2E7BA 4UQ3A 2K3TA 1JN6A 2ICWB 3PHQB 4G8EA 1MCHA 4KKCD 2ZKMX 5IQMA 4JREB 4QHMB 1HYSC 3MV7A 1NCWL 3ARDB 2NRDA 4GI8A 4JHUA 5MERA 3QULA 5EWIH 1KGCE 3V9FA 4YXHH 4QF1B 3SYAA 3RFRA 4A7UA 3SE8L 2W60A 3RZCA 1ADQH 2H32B 2NY0D 2PO6A 2ZOOA 3OMNB 5E8PB 2HTKC 4IBSA 5EO1B 4OCRH 4HPOH 2YAOA 3Q5OA 5AB1A 2EABA 3VFWB 2VR5A 3HN3A 1UYWL 4R6UA 1KJVA 5CLTA 1BXVA 3G04A 4TL5A 3SDAD 1A0QH 4JO3H 1ECYA 2QQKL 3N1PC 2HWZL 1O7SA 3TO4C 3NP4A 3WEBA 2BDNL 1XH3A 1EJOL 5LCVA 1F4WL 2XTLA 2WXMA 4PCYA 5T3XE 1OK8A 5EU6E 1D7BA 2FEDC 2V9TA 2E27L 4PY8I 3SE8H 3RUGF 2EO9A 1OB1A 4YSCA 5I82A 1SJHA 1JE6A 3Q5YA 4ETQA 1T7VA 1GJIA 4C47A 5ANHA 4YDKL 4CMHC 3BISA 5C0FB 2YEZA 5GGQH 4P5TB 3RU8L 3JUZA 1KYOJ 4OI9A 1D9KD 1FHGA 1NA8A 4Y5VA 5H2BA 4O00A 1C5CL 2RFXA 2QQKH 4JKNA 2HWZH 1ZAGA 4Z7QF 4JM2F 4UT6A 4F91B 4AM0Q 2BDNH 5IJVA 5JOPD 1EJOH 1J0JA 3SCMD 1IE5A 3WJLC 3QXVA 1QMUA 4Y7OC 1HU8A 1N2RB 2QGCA 3TNMA 2E27H 2LFEA 3RILA 5ANMA 3CXHK 4EN2A 4OM0L 3KGTA 3PFQA 2BNQB 2WLIA 1P5UA 3L8QA 3HCVB 4YGAB 5EDSA 1AQHA 1FA4A 4WWKD 4CU8A 5IJBC 3L4TA 4XVUD 3VSTA 3VI3F 4XZUB 4PRID 5E8EA 3S88L 3FTWA 1QWHA 4G42B 4L23A 4L5FE 3IDJA 3QCVH 3RU8H 1MW2A 1BFSA 1J05B 3RL2A 1OOWA 4OI8A 3K91A 1C5CH 3CZUB 1QW8A 2C3GA 4GRMA 1GOGA 1DQQA 4PYHA 5EZIL 3TM6A 2CG9X 5INCA 1CF1A 4ADIA 1G7JB 4OKVB 4AVJA 1TTCA 3U4KA 4DZ8A 1O75A 3GJFK 1OIOA 2CGRL 5D1ZD 4M4PA 4HJ0D 4LCWE 5IQ9A 1KCVH 3D39B 1BYNA 4NKMB 4TQPA 5FYLE 1BFOB 3AQZA 1F4XH 4FN0A 1KUMA 4LOUC 5DRZB 3S88H 2LAGB 1EZVY 1FLRL 4AV5A 1S46A 1UXSA 3WHE1 2GSGA 1JNHA 5D1QA 3TCTA 4ZS6D 3VW3L 4ZUTA 5IKCB 4KJQC 2KQNA 3VFRA 3IDNB 4HKBA 2OXHB 1LO0L 1OQXA 3K1KC 1BBJA 4LARL 1KCUL 2X6UA 2BY0A 4ZMYA 4OAWB 3S0PA 1URZA 3MDJA 4L1DA 2ALAA 2C9SA 1SXZA 1NH6A 3M1OA 4PREA 1PNDA 5JHDD 2CGRH 3KPLA 4LE8A 4AEFA 5IG7A 4HCRL 2GUOA 4N0FA 4DVBA 3BPNC 2NDFA 5DJ0A 1L0PA 5JUEL 5IW6A 5GSRA 2YPKA 4S2SB 2ZXAA 4HGWB 1GL4B 4NS0A 1J9SA 3ZDZF 1FLRH 4GSRA 3QA3B 5C6WH 2YQBA 3HW7A 3K2MC 4J23A 3VXOA 3VW3H 2XLLA 1YYML 1UXMA 1Z3RA 5FM8A 2Z93A 3ATBA 5I6PA 4P5SA 5ICUA 1LO0H 4LARH 3DMMA 4OZ4B 2H1LM 2YGVA 3T5WA 1RKRA 4FHJA 3K0WA 4DEWA 2EVGA 2J56A 4P3CL 4PRAA 1IAKA 5EU5A 5FLUA 4AT6A 4NO0B 2RH0A 3D5OF 2OMWA 3H9SB 4W9HC 3RAJL 2W80C 2AANA 2WTOA 2J6EA 4HCRH 3EOYG 1GGCH 4Y19A 4ZOBA 5JUEH 5FFOA 4KH2A 2ZUTA 2VQ4A 3MLRH 4X4ME 2VDNL 1T5XB 4JFFA 1OSZA 2FQGA 3QFDB 2IANE 4M62H 1UD6A 2Z92A 1GC1C 1YYMH 3CN1A 3BVWA 4HWZB 3UZEA 2WBJB 5ANME 1TTGA 2VLRD 4AENB 5E6ZA 3UIZA 3FRUA 1CFQA 4R4NC 3B9AA 3HKZA 3KZ8A 2RAMA 4UBDC 1BQRA 1JV2B 3NJIA 1DQJA 3RAJH 2V3FA 5IK3A 3TTSA 1ORQA 2K8MA 4JO8A 4PIRF 4LSUL 3PGFL 2DQIL 2VN5A 4EZJA 2VISB 2K9FB 3DXAE 4D8OA 2VDNH 3BKCL 4XN9A 3GXMA 2ITCA 5DMGC 5EZPA 1R5VA 2VO5A 2ZG1A 4D9QD 1LE5A 2O1AA 4H1LG 2JIXD 4J12A 4X50A 1XBRA 5BVJB 3HFFA 2JXMA 5J6SA 1UWXK 4LRIC 3SB3A 5CJQL 5A6LA 1G9HA 4NENB 4BCZA 5KVGE 3SGDH 4HA1A 4QRUA 3A6CL 2EYSA 3FRPB 4M9PA 4XWOD 5D1QE 5L4IA 2DQIH 1YRKA 3N40P 2DH2A 3BKCH 3I2CL 4AVHA 3LKQB 2D0HA 3H8NA 2GI7A 5DC4B 5DHYB 3BHBB 4OVUA 2E56A 1ZKAA 2OJEA 2ZCZA 4IRSA 4FULA 2UZYB 5I0YA 1GCFA 2XY2A 4MNGA 5JW4N 2WLLA 3BW9B 2J2ZA 1E5CA 4TPRL 1J8KA 4L4VA 2GSIB 1UURA 4OZGF 1X7TA 1LK2A 4WGWB 4WJG3 3L1FA 4JFEA 4BGDA 4MNQE 5FOBB 1LO2L 5KSBF 5AW3B 3B2UD 4AW4A 1MG2C 1S8DB 4LCYB 1FSKB 3I2CH 1CLOH 4FMFA 1YSOA 1J8HE 5DEFA 1JGDB 1DO6A 3S35H 2XTSA 2ZSWA 2JKWA 4UOW0 4AI7A 1ZLUK 4YR6A 1KTLB 2F74B 4GIPD 1XGZA 1AGDA 1OALA 1ZLSL 4Y19E 3WUWA 4KRPC 4R83A 2E3VA 3TYGL 1FN4B 5D7LB 5BQ7A 3NIDF 1NGWA 3FOLA 3W11C 4GBXB 4JFFE 3TBTA 3V8OA 3HZYB 2AXJA 1YY8B 1ZHLB 5E2JA 2R1WB 5ILTL 3LXCA 1N5AB 1JWSB 1LO2H 2FATL 1IGYA 1YY9D 5B39G 2HFFB 2CNZA 4MDJA 3WN6A 4TLTA 2X4TB 3EGSB 3P9WB 3OPUA 2IALA 2FVNA 2YXMA 3K2IA 3CU1A 2FHCA 1E4WH 3RBGA 1IAIH 3QJXA 1CYXA 4H0HB 3ZQXA 1OSPH 2P45B 4BHUA 3LRSB 3FOMA 3K8KA 1ZLSH 3LSOB 4JR9H 1MJ8L 3TYGH 4N0YL 4DN4L 4Z78A 1JBJA 4QXGH 1AE6L 1T0MA 2UWEA 4MRCA 3UBXG 4LNRB 3GMRB 2YD9A 2ADIA 2ZCKH 4FTDA 2CIIA 1QSFE 4JCWA 5A2FA 2AK4E 1HOCA 2YD6A 3V0IA 3P9MB 1W0WB 2FATH 3QR1A 4XMLL 3QIWC 3K2UL 1I3RB 4RFNC 1ET8A 5AOKA 1LK3H 4XCFL 1U92A 4FNRA 4NCC1 3DSFL 4GXUM 1T7ZA 2GFBA 3V9EA 3M6DA 4U1GC 1YPZA 4LMQE 4XO4A 1BVLA 1A47A 1KT2B 2N56A 4RDQF 4JEGB 4L8CA 4U3SB 4OF8A 2NTSP 1XF5A 4N0YH 4ZNEA 1EUUA 4P0DA 5INDA 1MJUL 5LGJA 1SJMA 3KXFA 1OGAD 2VQ1A 4WO0A 4UM8A 5DHDA 4I87A 2VWEE 3S37L 4MD5A 4LVNB 4FQ1L 3K2UH 3SGDI 4AMXA 5DRWB 1OK0A 3ZTEA 3M07A 4WZ9A 4XCFH 1IVLA 2CO7A 1WSST 3DSFH 1XD0A 3QHZL 4WEBL 4XBEH 1PQZA 1FFOB 2E6QA 4L4VE 4YO0A 4E41A 4YSSA 4CMMA 2FGWL 2DKSA 1KBGH 2WSKA 2EYTA 3QUMA 4JG0L 2IOOA 4X6DB 4RFEA 1ZRUA 2Q76A 1ZWIA 2V9QA 5FK9A 3FT2B 4HJIA 2PCFA 2YLHA 4Y16A 1DLHB 3BUPA 1MJUH 3OLGA 3IAGC 1KPVA 4XNQB 3TZVB 3D18B 2DICA 1N26A 3PWJB 1BG1A 2VJXA 4XMPL 2X70B 5C7ZA 3S37H 1DBBL 1WT5A 4JG9A 4FQ1H 2DLHA 3Q8CA 4CC1A 5BZXA 4YUEL 2Z91A 3Q7JA 3POCA 2K6YA 1CTOA 1JF5A 2EKSB 3GEFA 3GIVB 3SPHA 5ABDE 4AQOA 3FAWA 2AVGA 3PV6A 3QHZH 1DVXA 4M56A 4NBXB 3KYMB 1BW8A 1RV6X 2FGWH 4YNYA 3GJEB 1P4BL 3BVNB 4LGRB 4LSDA 4JG0H 5DJAA 3VFTA 5ADOL 2GG1A 3MLPA 2ZCLH 2BZDA 2CA4A 3EIFA 3LH2H 2AJZA 3LKRA 4HJGA 2H5UA 1TJMA 3JXAA 3N44B 4U49A 2V4LA 4JN2A 3RDTC 3OGOE 2PYFA 3KPSA 4XMPH 3FBQA 4FABL 1W0YT 1DBBH 3ZE1E 2A73A 1QSEA 5AZEH 4X8JB 5IY5B 4YUEH 2GY7B 2YN3A 3BQUD 2CSPA 3SYPA 2V8MA 2XXCB 3SE3C 2AJYL 4X7TA 3VD7A 4ZBJA 1P4BH 4FQHA 1VIWA 1G0XA 4UNIA 5ADOH 1DVFD 2VERA 1P5VA 4UIKL 3WDJA 1KCRL 1JZ4A 1IGJA 4WU7B 1XGPB 4PP2B 4Q4IA 1IAII 2IH1B 3EADA 1XSKA 5CCGE 1A7OL 4WI5A 3GSUB 3MRNA 3AY4A 3D33A 4M29A 2H3NA 3MLZH 1DFXA 3F84A 1SHWA 3QXDA 4LDEB 5GHWL 4PUBL 5GRUL 2X88A 4MLIA 3VDAA 4ZNEE 1U8MB 2Q8BL 4QI3A 3S7GA 2XN9A 3T2OA 2AJYH 4N8VG 4R0LB 5D70L 2HFEB 2NUPB 3KXFE 2ERJC 4UM9D 3AITA 3CIAA 4H1LH 4MAYC 4BE5A 2BVPA 5G2NA 1H3TA 2AQ3A 2H26B 4ODWA 4L3FA 1A9VA 2QPUA 4JO1L 1NBZA 5IGXL 4FFWC 3EO1A 4UIKH 2YAMA 2ZYHA 1KCRH 2WLMA 3EGXB 2WLZA 2WQ8A 4Y89A 3TV3H 2R59A 4QRTA 4PD4J 2WXLA 2GW5A 5IV2B 1PFOA 1T6BX 1WITA 2KZBA 2W92A 5DYOA 2YARA 5GHWH 1MHCA 4LHQB 4PUBH 2A0LD 4RISH 5GRUH 5CFAA 1VSCA 1NLBL 5DSCA 5DVPA 1RSFA 2Q8BH 4BKLA 1G6RB 1W16A 3UTTD 3DOIA 2D31A 3NH7L 3WNKA 4RDQG 2IBZX 2IBBA 5L9DL 3RWHB 4Z7WE 5IGXH 1GJWA 1NAMA 2DJMA 1A6ZB 1BECA 3EO0B 3P0GB 4OFYD 4K9EC 3GUTA 2OSYA 4NZFA 5A2CA 3RPKA 3KL3A 3IFPB 2J3SA 1B4JL 2AMUA 4RGNC 3BMVA 5GQBA 5JIIA 3NFPB 3VG9C 1IKOP 1FNAA 2ZICA 2NY7L 2YZ8A 5I1AA 1A9EA 1NLBH 5DUMH 4ZPTB 2AZAA 5EN3A 4I0PC 2CKBL 3L3HA 1A4BA 3NH7H 3VX1A 3DHPA 4KHXL 5DLMH 4YHYC 1J5HA 4UT9A 4ODTH 3ZMEA 2HX8A 5L9DH 1S9WB 3GSRA 1A3LH 4BK8A 2WSDA 4MZIA 3GC3A 3IMTA 3LN5B 2WHVA 3MRQB 3CZFB 3FZUC 1E40A 1TCMA 2DQHH 1S7RB 3PGDA 3SDDA 1A4AA 1R3IL 3EJUA 4KX8A 1ETZA 1CR9L 5DZLA 3ARXA 3ZDXE 4ZUVA 4AMKL 2QFPA 4E9YA 5D5MB 4JY6A 4HIEB 2NY7H 1KG0A 4K5OA 2FJUB 2NNXA 3CFEA 4DFHA 3ZMNA 1E7UA 1RZQA 2APFA 3AT0A 3BZDA 3WLWD 2E9IA 3X11A 1EXUB 3C5JB 4KHXH 5TE7L 3T0XA 1S3RA 2ENSA 1MJJB 4KC3B 1QYGL 2C9PA 4CADA 4P2RA 4YHKH 4EN3B 3FU7B 3ULUE 1IGIL 3SO3B 4AQAB 1NCCL 3OR7B 2XN9E 5J3HC 4AMKH 3U0WH 4Z5RB 5I73B 3FUEA 4KKNA 1M7XA 5C2UB 5GS0L 4DP9X 5TE7H 4G6AD 4PMEA 4PTUB 3I6GB 3VWJC 5DDHA 3MRDB 1X5KA 5FFLA 2GTWA 3W38A 4ATWA 1DHKA 3PAVA 4D9RE 1IGIH 3M88A 5SWSA 3UTQA 4BQ6A 5MEOB 4Y1AA 1JPFB 2C7FA 5FM5O 1HI6A 2D9CA 5E8OA 2BS8A 5T3XL 5I2IB 3MRMB 1SXSA 4XPTL 5GS0H 3A21A 4KZDL 3FSAA 1W2KT 2ENYA 3FH5A 3NCYP 5HYJB 4KNUA 2B9BA 3LEXB 1QRNA 1KELH 4P9HC 5AZUA 4FJYA 3MCLL 3SPVA 1L0YA 3LH8A 3LHAA 3U0TB 2GK2A 1HDMB 2UWEF 3OG6B 3X12B 5KSAC 4KU1A 3TVMC 4HGMA 1JZJA 4JVPA 4LPWA 5DUBA 1UA3A 4AYFB 1XH2A 3U2JA 1PY4A 4Q2ZB 3PL6B 1QHPA 1ZSHA 3RQ3A 1FIGL 3ZQ9A 5KS9A 3GMNB 3D1MC 4S1RH 5T3XH 4E9RA 1W6LA 3F5WB 2PP9A 1HVXA 3VD3A 1ZIAA 3QR0A 1J1OH 3UEQA 5LBSL 3G3LA 2OL3H 1YPZF 3O8XD 4ZTEA 2KPNA 3PHOA 2OSLA 3MCLH 1TCRB 4J6RL 3C6EA 4PJ5A 2ISDA 4NC1E 1BJ1J 2X09A 3E80A 1UOLA 4L5FL 4HCIA 5CN3A 3QO0B 2IJ0C 2XI9A 1UT9A 1WAPA 4PHZA 3EF7A 4KFMA 4PVNA 4IEFB 3BJ91 2VZUA 1AR1D 3SPJA 3TH2T 2KMWA 3MAWA 3LV3B 1FIGH 2X44D 1I8LC 2R1YA 4F9LC 3LNDA 4GS7C 3JZ7A 2P8PB 4U7SA 1HJCA 5LBSH 3C5SA 5EU7C 3RJOA 5FYLL 4X5WA 2DTMH 1JPTH 4HKXB 1UB5B 1I8MA 1HS6A 4G2AA 2JMRA 1RY7B 3DVNB 2XUWA 4L5FH 3W0WE 4L3EB 3NQIA 4FKKA 9PCYA 2AXFB 1KACB 4DKEL 4HHAB 5EV7A 4B60A 4BWWA 2YPLD 1AGBB 4UILL 3QYMA 4QRQA 5D9SB 4HOWA 2FUQA 3RJQB 3AREA 4HDIB 5AUMA 1AACA 5I15L 2EDNA 4OJCA 4WFED 1F4YH 3G6AB 3UBXI 2P8LB 3BLPX 4DK3A 1YEJH 3BAJA 3BIBX 4X83A 3KBPA 4JFDD 3NJLA 1WO2A 3CZEA 3NZUA 2DLFL 3UABA 4Z7IA 2CD0A 2EACA 4ZX4A 3T3PE 2BCKB 3KEHA 5BV7C 1HTYA 1ZLEA 1P7BA 3HFML 3SKJH 3UP6A 2C7UB 1UGNA 1KFAH 4YSDA 2IPUK 3VXRA 2JWYA 4WKZA 4ONGL 5I1LA 5I15H 3SJVD 2ID5A 2BVQA 2QBWA 5CSZA 2FT6A 3U30C 1PX3A 5ISZA 5LUMA 3NJNA 3MMEA 3RKDD 4C58B 2WQAA 2X4SA 1BF2A 1NCIA 3D09A 1SMOA 1ZVSA 1RJCA 3LKSB 5KJ7E 4ELMA 5BRZD 5LNGA 2ICWA 4UAOC 3PHQA 1N12A 1Y1DA 5LCVH 1A4KB 4KWUA 4YQXL 4ZO8A 4QHMA 1J0ZA 2WLJA 5JHMA 5CP7B 3ARDA 4XN4A 5IMKB 3GBMH 4XHJC 1C08B 3PLYA 4WEMB 4QF1A 2V5TA 3AQDA 3CPUA 3ULUF 2IWKA 4ONGH 3FCBA 2H32A 4H7VA 2EEXA 1EO5A 2VDML 3MOQA 4P4KD 4PJ5E 5LNEA 5E8PA 2PETA 5F89B 5L2KD 1IBYA 4DIXA 3FN0L 3VFWA 1F2XK 4LP8A 4W70A 3GBNL 3DRQB 5DQDH 1Z9MA 4PJ9C 1GZHC 1CGSL 4UT6H 3ULVE 2LOEA 4LHUD 4ZOEA 5I1JL 3L13A 1SEBB 1KCBA 5I1CL 4YQXH 1ZE3C 3EFOB 4AY0A 1GGUA 3MJ7B 5AL0A 3DV6B 2MPAL 4KKRA 5KVGL 2FB4L 4KK5C 5DD6B 2VDMH 2JKSA 1NCAL 3L54A 1SF3A 3VDCA 3K7UA 5C0FA 3FN0H 4MJ2A 2JE8A 2NNRA 3L16A 1NCDL 3QUZB 3IN0A 4MB1A 4P5TA 5HYIA 3GBNH 2WQUA 3FFCB 2ZX9A 1J18A 3ZDYE 5I1CH 4XPAL 5I1JH 1DBML 1NCNA 2K7PA 2FJHB 1TUPA 1QO3B 4F20A 4WFGD 1TJHL 5ICXB 5AW2B 2CLVB 5TQ2L 5HYQB 1TOXA 1N2RA 3OQRA 5TQ0L 3L1GA 4JPWL 5F1OB 5HXMA 1FVCB 3US0A 5KVGH 2BNQA 2FB4H 3BEWB 3HCVA 2GJRA 3DETC 2LTQB 4PJEF 4XZUA 3S3CB