3L91A

Structure of pseudomonas aerugionsa pvdq bound to octanoate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
TGLAADIRWTAYGVPHIRAKDERGLGYGIGYAYARDNACLLAEEIVTARGERARYFGSEGKSSAELDNLPSDIFYAWLNQPEALQAFWQAQTPAVRQLLEGYAAGFNRFLREADGKTTSCLGQPWLRAIATDDLLRLTRRLLVEGGVGQFADALVAAAPPGAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-homoserine lactone acylase pvdQ subunit alpha
publication title Structural characterization and high-throughput screening of inhibitors of PvdQ, an NTN hydrolase involved in pyoverdine synthesis.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 55
structure length 164
sequence length 164
ec nomenclature ec 3.5.1.97: Acyl-homoserine-lactone acylase.
pdb deposition date 2010-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 3l91A00
1FXHA 1KEHA 4K2GA 2WYBA 1AI5A 1GK9A 4HSRA 1KECA 1GKFA 4WKTA 4WKSA 4YFBA 3SRAA 4K2FA 3L94A 1K5SA 1H2GA 4YFAA 2AE4A 1K5QA 1OR0A 4PEMA 1PNKA 1AJQA 2ADVA 1FM2A 3ML0A 1GHDA 3S8RA 1GM7A 2AE5A 4WKUA 1GM9A 4E55A 4PELA 4E56A 1AI7A 4HSTA 1AI6A 1JW0A 3L91A 2AE3A 1AJNA 4WKVA 1GM8A 2WYDA 4M1JA 1PNLA 1JX9A 1K7DA 3K3WA 3SRCA 4E57A 3SRBA 2WYEA 1GK1A 1GK0A 1FXVA 1JVZA 2WYCA 3JTQA 4YF9A 4BTHA 3JTRA 1CP9A 1AJPA 1PNMA 1AI4A 1E3AA
chains in the Genus database with same CATH superfamily
1FXHA 1KEHA 4K2GA 2WYBA 1AI5A 1GK9A 4HSRA 1KECA 1GKFA 4WKTA 4WKSA 4YFBA 3SRAA 4K2FA 3L94A 1K5SA 1H2GA 4YFAA 2AE4A 4BWCA 1K5QA 1OR0A 4PEMA 1PNKA 1AJQA 2ADVA 1FM2A 3ML0A 1GHDA 3S8RA 1GM7A 2AE5A 3FGRA 3FGTA 4WKUA 1GM9A 4E55A 4PELA 4E56A 1AI7A 4HSTA 1AI6A 1JW0A 3L91A 2AE3A 1AJNA 4WKVA 1GM8A 2WYDA 4M1JA 1PNLA 1JX9A 1K7DA 3K3WA 3SRCA 4E57A 3SRBA 2WYEA 1GK1A 1GK0A 1FXVA 1JVZA 2WYCA 3JTQA 4YF9A 4BTHA 3JTRA 1CP9A 1AJPA 1PNMA 1AI4A 1E3AA
chains in the Genus database with same CATH topology
1FXHA 1KEHA 4K2GA 2WYBA 1AI5A 1GK9A 4HSRA 1KECA 1GKFA 4WKTA 4WKSA 4YFBA 3SRAA 4K2FA 3L94A 1K5SA 1H2GA 4YFAA 2AE4A 1K5QA 1OR0A 4PEMA 1PNKA 1AJQA 2ADVA 1FM2A 3ML0A 1GHDA 3S8RA 1GM7A 2AE5A 4WKUA 1GM9A 4E55A 4PELA 4E56A 1AI7A 4HSTA 1AI6A 1JW0A 3L91A 2AE3A 1AJNA 4WKVA 1GM8A 2WYDA 4M1JA 1PNLA 1JX9A 1K7DA 3K3WA 3SRCA 4E57A 3SRBA 2WYEA 1GK1A 1GK0A 1FXVA 1JVZA 2WYCA 3JTQA 4YF9A 4BTHA 3JTRA 1CP9A 1AJPA 1PNMA 1AI4A 1E3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXH A;  1KEH A;  4K2G A;  2WYB A;  1AI5 A;  1GK9 A;  4HSR A;  1KEC A;  1GKF A;  4WKT A;  4WKS A;  4YFB A;  3SRA A;  4K2F A;  3L94 A;  1K5S A;  1H2G A;  4YFA A;  2AE4 A;  1K5Q A;  1OR0 A;  4PEM A;  1PNK A;  1AJQ A;  2ADV A;  1FM2 A;  3ML0 A;  1GHD A;  3S8R A;  1GM7 A;  2AE5 A;  4WKU A;  1GM9 A;  4E55 A;  4PEL A;  4E56 A;  1AI7 A;  4HST A;  1AI6 A;  1JW0 A;  3L91 A;  2AE3 A;  1AJN A;  4WKV A;  1GM8 A;  2WYD A;  4M1J A;  1PNL A;  1JX9 A;  1K7D A;  3K3W A;  3SRC A;  4E57 A;  3SRB A;  2WYE A;  1GK1 A;  1GK0 A;  1FXV A;  1JVZ A;  2WYC A;  3JTQ A;  4YF9 A;  4BTH A;  3JTR A;  1CP9 A;  1AJP A;  1PNM A;  1AI4 A;  1E3A A; 
#chains in the Genus database with same CATH topology
 1FXH A;  1KEH A;  4K2G A;  2WYB A;  1AI5 A;  1GK9 A;  4HSR A;  1KEC A;  1GKF A;  4WKT A;  4WKS A;  4YFB A;  3SRA A;  4K2F A;  3L94 A;  1K5S A;  1H2G A;  4YFA A;  2AE4 A;  4BWC A;  1K5Q A;  1OR0 A;  4PEM A;  1PNK A;  1AJQ A;  2ADV A;  1FM2 A;  3ML0 A;  1GHD A;  3S8R A;  1GM7 A;  2AE5 A;  3FGR A;  3FGT A;  4WKU A;  1GM9 A;  4E55 A;  4PEL A;  4E56 A;  1AI7 A;  4HST A;  1AI6 A;  1JW0 A;  3L91 A;  2AE3 A;  1AJN A;  4WKV A;  1GM8 A;  2WYD A;  4M1J A;  1PNL A;  1JX9 A;  1K7D A;  3K3W A;  3SRC A;  4E57 A;  3SRB A;  2WYE A;  1GK1 A;  1GK0 A;  1FXV A;  1JVZ A;  2WYC A;  3JTQ A;  4YF9 A;  4BTH A;  3JTR A;  1CP9 A;  1AJP A;  1PNM A;  1AI4 A;  1E3A A; 
#chains in the Genus database with same CATH homology
 1FXH A;  1KEH A;  4K2G A;  2WYB A;  1AI5 A;  1GK9 A;  4HSR A;  1KEC A;  1GKF A;  4WKT A;  4WKS A;  4YFB A;  3SRA A;  4K2F A;  3L94 A;  1K5S A;  1H2G A;  4YFA A;  2AE4 A;  1K5Q A;  1OR0 A;  4PEM A;  1PNK A;  1AJQ A;  2ADV A;  1FM2 A;  3ML0 A;  1GHD A;  3S8R A;  1GM7 A;  2AE5 A;  4WKU A;  1GM9 A;  4E55 A;  4PEL A;  4E56 A;  1AI7 A;  4HST A;  1AI6 A;  1JW0 A;  3L91 A;  2AE3 A;  1AJN A;  4WKV A;  1GM8 A;  2WYD A;  4M1J A;  1PNL A;  1JX9 A;  1K7D A;  3K3W A;  3SRC A;  4E57 A;  3SRB A;  2WYE A;  1GK1 A;  1GK0 A;  1FXV A;  1JVZ A;  2WYC A;  3JTQ A;  4YF9 A;  4BTH A;  3JTR A;  1CP9 A;  1AJP A;  1PNM A;  1AI4 A;  1E3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...