3L92A

Phosphopantetheine adenylyltransferase from yersinia pestis complexed with coenzyme a.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
159
structure length
159
Chain Sequence
MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
total genus 58
structure length 159
sequence length 159
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l92A00
3K9WA 1M83A 3AFHA 3SDBA 3CVUA 3CVXA 1QJCA 1U7XA 5TEWA 3FWKA 4ZT2A 4OJMX 2DPLA 3HGMA 1O94C 4JYZA 3NBKA 1IQRA 1TFUA 3FHJA 4MVCA 1MOPA 2C5SA 3IMGA 1JEDA 4MUKA 1KKUA 1MB9A 1OWNA 2R5WA 5H16A 1M8FA 1OWLA 2X3FA 2AZXA 4ZCRA 4HJRA 4MAFA 3RFFA 2D54A 3PXUA 3FH0A 1R6XA 2TS1A 4U63A 1R6TA 2CFOA 3FG9A 3IOEA 3H99A 2J5BA 2DUMA 5EKDA 2GKSA 1T6ZA 2A4MA 2O5RA 3LE8A 1WQ4A 4RUKA 5DB4A 4ZCTA 2YWBA 4P2BA 4R2MA 5LFAA 4I6GA 3IODA 4R2LA 2VTBA 3KFLA 4WNYA 1I6KA 1N2JA 2H2AA 2HZ7A 3P0HA 2A7XA 3ZUGA 1ZUNA 1BS2A 4KPUB 3U1VA 4HPWA 5J5AA 1RQGA 2CYCA 1JHDA 2V0GA 3RJZA 3COZA 1I6LA 3DPIA 1O95C 3X1MA 1F7VA 3CLSD 5F23A 2IELA 3N8HA 3MLAA 1F4LA 1NP7A 2CV0A 4CDMA 4H3SA 3KT0A 2Z3VA 1M8PA 3BL5A 5HG0A 1I2DA 1LI5A 5IHXA 2V0CA 4K0RA 5JBNA 1PFUA 3COYA 4NAUA 3MLBA 1WXHA 1J1ZA 1COZA 1QU3A 3ISJA 5LM3A 4MW2A 3ELBA 4GRIA 3CA8A 3RK1A 2A1UB 3OTWA 2EL7A 4ARCA 3L92A 4U7JA 4MUNA 4HK4A 3COWA 1IQ0A 2OV4A 3TS1A 5DEOA 1YUMA 5FO0A 3SZGA 1R6UA 2YY5A 2J4DA 2HMAA 4MUGA 1P7PA 3SZ3A 1KR2A 5DK4A 2J08A 2I1LA 4L2IB 4A91A 3TNJA 1NUPA 4MVXA 2JANA 1DNPA 4JXZA 3SEZA 2XRZA 2QJFA 2A84A 1K97A 1WXFA 1X6VA 1KAMA 1EUYA 3RK0A 4MWEA 2RD2A 1QRUA 1B6TA 5J58A 4MW0A 3F3MA 1KORA 2O8VA 4NAHA 1IRXA 2B7LA 4DDMA 2DERA 1T6YA 4PBTA 1JZSA 4R0NA 4EG8A 3MXTA 3HZRA 3A05A 2QJTA 3GMIA 1O6BA 1EUQA 2DETA 1A8HA 1OWPA 1KQNA 3AG5A 4AQ7A 4OUDB 5TGTA 1F9AA 4YP5A 3UY4A 2E89A 3UK2A 3H9CA 2J07A 2PZAA 4G5YA 3IUEA 3M5WA 1WZ2A 3X1JA 5KWVA 2E0IA 4XFJA 1XJQA 4DLPA 1WY5A 1G8HA 2CV1A 4WSOA 1GTSA 3N05A 4I6EA 3VU8A 1J20A 1YUNA 3G5AA 4XFDA 1H1TA 3ZJVA 2AKEA 1KQPA 3FI0A 1G8FA 1S4MA 3LOQA 5J59A 3ZXIA 1U0BB 3QTBA 1TYCA 2QUKA 2QJOA 3N9IA 1IVSA 3GUZA 4MW6A 3CVWA 1M8GA 2CT8A 1QRSA 2BTEA 2A1TS 3L93A 3SP1A 1JIJA 3RBAA 1D2RA 3AIIA 4MUFA 4DE5A 2Z08A 2CYAA 3KT8A 1O94D 3KT3A 4QREA 1CT9A 4EGAA 3AG6A 1MBZA 1N2GA 4ZT7A 2PZ8A 4NATA 5H7XA 4DDHA 1JIKA 3IVGA 2YWCA 1QNFA 1WKBA 2YXNA 1K4MA 1NUUA 1Q15A 5LLTA 1MRZA 4QRDA 3AL0C 4MUJA 3P0IA 3Q10A 4YP6A 4DNXA 1YULA 4K03A 4RPIA 1NSYA 4FZJA 3FY4A 1LI7A 3HMQA 1PFYA 1ZH6A 5FNZA 1O0BA 5DASA 1LW7A 3SEQA 2QUIA 3JXEA 3G59A 5HUJA 1GTRA 1H3EA 5K0SA 1NYLA 1T6XA 1M8KA 2D13A 1QQTA 1EFVB 3FOCA 4MW4A 3INNA 1U3DA 3HV0A 3ZJUA 3Q12A 4NX2A 1O96A 4MUHA 3CLTD 3RHSA 1JEEA 2OQ2A 3CVYA 3A2KA 3PRHA 1KH2A 2WB2A 4ARIA 1OBCA 1EFPB 1VL2A 1K4KA 1TQ8A 4KR9A 1TYAE 4ZT6A 4TS1A 4G6ZA 4KKVA 3UMVA 2BYTA 3VRHA 1EE1A 1U7DA 4MW7A 3ND7A 4DJAA 3CLUC 1N75A 3TZLA 2ZUEA 1PG0A 1KQOA 1N77A 3SYTA 1WOYA 4XSVA 3ZJTA 5KCMA 4HJXA 3IOCA 3IVCA 2G36A 4ZCPA 4QBTA 2A88A 1TYDE 1PG2A 4KR6A 3CVVA 1JECA 2ZUFA 2E21A 1T9GS 4MVWA 4YMIA 1N2BA 4EG4A 5TEVA 1N2IA 2QTMA 1O0CA 1VBNA 2IJGX 1GAXA 1U3CA 4NDAA 1Q77A 1GPMA 1MJHA 1O5TA 4I6JA 3CLTC 4G5FA 1VBKA 2GM3A 4EG1A 3PNBA 2WQ6A 4UZEA 1GLNA 1WXEA 3P0JA 4MWBA 2EJCA 1OWOA 1J1UA 2DLCX 1FYDA 1WQ3A 3FNRA 3GLVA 1NUTA 1ZJWA 3N2YA 2QTRA 3FETA 3G6KA 1IQUA 4EG7A 3H97A 4Q93A 1XNGA 1PFVA 1N3LA 2IP1A 4CT0A 2J09A 3VGJA 4Q16A 4EFKA 1Y42X 1TYBE 1K92A 1VBMA 3NV7A 1QRTA 3QTTA 2GOYA 1N2HA 3ZIUA 4ZCSA 2CYBA 4ND7A 1F7UA 1MB2A 2DEUA 1YIAA 3OP1A 1VLHA 3IH5A 3E27A 1N1DA 2A1UA 3I05A 3A4IA 4MLPA 4JFAA 1N2EA 2X0KA 1KP2A 1J70A 2NZ2A 1ZH0A 4CQNA 2PZBA 1NURA 3D6UA 4BWVA 3CLRC 3MMXA 1FFYA 4YBRA 2Z09A 1IH8A 1XNJA 2PXHA 2QUJA 2RE8A 3ND6A 1Q11A 1YI8A 2D5BA 2QTNA 4PY2A 1N78A 2X1LA 3HFJA 1JGTA 1OWMA 1ILEA 2PIDA 1TEZA 2E18A 3LCJA 3K32A 5TS2A 4J75A 1QTQA 4KR7A 1V8FA 5K0TA 3TQIA 5AHWA 1I6MA 1PFWA 2XRYA 2WQ7A 1J21A 4L2IA 2JAXA 1JIIA 2DR2A 1KP3A 3COVA 3UOWA 3IMEA 2ZP1A 3IUBA 1SURA 1GN8A 4MUEA 2VTBB 4PBSA 4F4HA 3D6VA 2AG6A 4KPUA 1EXDA 2H29A 2DXIA 4E1AA 1NI5A 4MQ6A 4OUDA 1O95D 4MULA 2WSIA 4U8HA 4MUIA 4MVYA 1EFVA 3Q4GA 1O96B 1QU2A 3H05A 2NSYA 1O97C 4ND6A 4ZT5A 5BNZA 3ZGZA 3CLSC 1H3NA 3CLRD 4MW9A 4ZT4A 3FDXA 4CDNA 2A86A 1KH3A 2HGZA 4JXXA 5IJXA 1GZUA 3IVXA 1OD6A 3TQOA 4ZT3A 4YP7A 3C8ZA 2VXOA 4PBRA 3ZXSA 1ULHA 1MC1A 4S1OA 3DO8A 2QUHA 4JZYA 1EJ2A 4DDKA 1G8GA 4AS1A 2CSXA 1NUSA 1WXGA 1NZJA 4MWDA 1OBHA 1Q19A 3IDFA 4EG6A 4UZFA 3MUEA 4MW5A 1MAWA 3NBAA 1IFXA 2X1MA 3TZEA 3CLUD 1JILA 3KT6A 3P52A 3IMCA 2PFSA 1UFVA 1V47A 3PNYA 1T9GR 3PNVA 3QE4A 2JA2A 3ILVA 5FO1A 3DV2A 4F3RA 1JZQA 1J09A 3X1KA 1M8JA 1KH1A 3ND5A 2A1TR 5KHAA 1NUQA 3CR8A 4EF6A 1X8XA 3AKZA 3FIUA 1H3FA 1WJGA 4J76A 1JMVA 4EG5A 1G59A 4NZPA 1XNHA 4GU5A 4ZCQA 1IHOA 2PG3A 3DLAA 4X0EA 3S3TA 1KAQA 4EG3A 5HUHA 1N2OA 1YIDA 3IOBA 1HYBA 3HL4A 1M1ZA 3UC5A 3A04A 1WXIA 1O97D 4MW1A 2CV2A 3H9BA 4MWCA 1MAUA 2CUZA 1EFPA
chains in the Genus database with same CATH superfamily
2XOXA 4BB5A 5FFFA 2YQ5A 3QLVA 4KYUA 3CVXA 1UKVY 2J3IA 3KJGA 4FFMA 1U3GA 4OJMX 4DA8A 4LC1A 3ES9A 4P4LA 5E1OA 1ND6A 1X19A 2BFBB 1TPYA 1NLYA 3A26A 2I8AA 4TSKA 4C7OA 2A30A 3E7WA 2V4MA 4OX9Y 1EXMA 2LNDA 4MUKA 1WXWA 5C8YA 5A4DA 3QVWA 5C0OE 4RQTA 1DVRA 1NYTA 1XVIA 1OWLA 3HDGA 3MJEA 4Q82A 5F35A 4N54A 5GGYA 3SLKA 2CZGA 1JR3D 3NDRA 3M4ZA 1K8XB 4BX9A 5DVZA 1CE8A 2IGTA 3GZ4A 5EUMA 2G09A 1XLTA 3SMQA 4MV3A 4IF4A 3WJ7A 2ZLBA 3UAXA 1C41A 3MGBA 1Z2DA 3JQAD 3GFFA 1JQAA 1P29A 4MVJP 3KPYA 4RJ2A 5ALQA 1GPYA 2C4MA 4ZTBA 4H1TA 4UXJA 4L7VA 5EKDA 3VZBA 2B1IA 2ILVA 4Y2TA 2NUBA 1E8MA 3EAGA 4YMUA 1RCFA 1ID1A 2QT9A 5BSUA 4C14A 1KYYA 1GLGA 3D1JA 1Q6YA 2O0JA 1ZHHA 4C2UA 4L9RA 1EVKA 2G08A 3ZCRA 1WB9A 1EE2A 1HLDA 3DNMA 3NOVA 4QBGB 2UZ1A 4EGQA 4FOTA 2PPVA 1ZUNA 4DBLC 3PGXA 1G6OA 3LUDA 2Y92A 2RI1A 2IYWA 1ZOSA 2VRCA 4NG4A 1JHDA 1WLYA 4JJFA 1XV5A 3WY9A 3SKYA 2HEIA 5CXQA 5JS6A 5EWMA 4FN5A 1Q7RA 3COZA 3DZDA 3FMOB 1HC7A 3H2HA 3DF9A 4I4TF 4KGXA 4E1VA 2DPMA 4NNOA 4R1UA 4AZ0A 4DCNA 2UVPA 3ETEA 4YR9A 2W8BB 3LYAA 5BMVB 2CV0A 4MR7B 5TF0A 4XWYA 1R16A 5FBZA 1MX1A 2F3QA 2Q6TA 4ZMBA 1OAOC 1U2GC 3AJEA 4MX8A 2QMHA 1JQ5A 5FEMA 1TVMA 2COUA 1O4VA 1BVYF 2JIQA 3UMGA 5JCXA 4E46A 2PQ6A 2D2VA 3TLBA 1ADYA 4ER6A 1KTIA 1E2NA 2FSVC 1X7WB 1YRQA 1NNUA 2XYHA 4ZMSA 3F71A 1QG0A 4FHEA 5HFNA 5JQGB 3IT3A 3ETCA 2KW5A 1LB1B 2WBLC 5DPMA 1SZCA 2IDMA 1HY3A 3HABA 4HSGA 1R8YA 4KSBA 4XEHA 1ZUIA 2RGDA 3GLIA 3RFTA 1EX6A 3KJZA 3L6UA 1FDVA 1MUUA 2EFGA 1QUFA 3SYMA 4QU8A 1ZFNA 1O0SA 3PITA 1FSGA 5LOVB 3OQOA 1WXQA 5REQB 2PFGA 1CR0A 4WERA 1RFGE 4Z1MD 5JRJA 1DIHA 2GBLA 1SG0A 2WMOB 3BFXA 4CIYA 5T57A 1PZHA 4BS9A 4GBED 2FEPA 5F2EA 3TJZA 1W8DA 2DB3A 1H2XA 1QP0A 5IXJA 1H8HA 2CVOA 2G83A 3GT4A 4FMBB 4CKWB 4CR7A 4CIBA 1OZ0A 4ZANA 1FXSA 1SBTA 1BSVA 1A9RA 3EZYA 4R2IA 4TZTA 1DNPA 1FDUA 1J2RA 3ZDXB 3MBIA 2QJFA 2FKNA 1CRZA 1P0IA 3WSTA 3OA0A 1G2IA 4N7MA 4U6QA 4DGQA 2RJOA 2X9NA 4HT3B 1XVTA 2WNHA 1R50A 2OG1A 2X15A 3KPUA 4TRJA 3WL4A 4JUFA 1F6WA 1WL8A 1SO8A 5ESDA 1F0NA 4R3NA 3D7NA 4BX0A 4DSUA 3R7BA 1POXA 2C8LA 2GNOA 1WF6A 4CLDA 4AZ3B 2A5FA 1ZRNA 1RWOA 2GO1A 3K3PA 3L4SO 1U2EA 3KJQA 3ND9A 4Z3DA 5TVKA 4H3KB 3VNSA 5DNVA 4DMHA 3NUZA 4PC6A 4RE6A 3MNFA 2JCXA 1NATA 3O8BA 5TJ9A 3T8YA 4YMTA 2ZTLA 4GPIB 4BLUA 1LLQA 1MNAA 1OFUX 1Q2XA 4XWWA 5FL7D 3AY0A 3BZBA 3KQSA 2QG6A 3GNSA 2XOKA 2IDZA 2LWIA 3V33A 4B7AA 4RJKA 1RJGA 4MNTA 3IFSA 3L0IB 3WG9A 4F4CA 3CW2A 2HUNA 3RVQA 3P9RA 5CB8A 1OIXA 2PE5A 3CXRA 1XZKA 2QR3A 2WJGA 2CXQA 3PEEA 2V74B 1RKBA 2AXQA 2YYZA 3F49S 4RL4A 4AWBA 2P2GA 2XYVA 4I9UA 3TSCA 5KWVA 3MTQA 4P3PA 1JXMA 4WLNA 5A62A 4FLFA 1O5OA 3TGWA 1WY5A 2H2DA 4UREA 4UU7A 2AG0A 5K8JB 4I6EA 2JK0A 2B99A 5J59A 3KP1A 1TYCA 2QJOA 5KI6A 2RHWA 1RQLA 4K9MA 2QP3A 3UB3A 1OZHA 1DV1A 2HHJA 1I7QB 2X42A 3M0EA 3DVQX 2H1CA 4I5EA 4UNIA 2FMUA 2R8OA 3HCNA 4EO7A 2FWMX 1RI4A 2PR7A 2EWVA 1PNRA 4D26A 3E9RA 5TPZA 4QSMA 1NULA 4MYHA 2C9OA 4DDWA 3DLHA 4JITA 3MIZA 1ZZEA 1WBDA 2J9FB 1ZGCA 3BB3A 4RBNA 4I4TA 1TK2A 1ONNA 4DDHA 2GBCA 2BONA 3W2GA 1T5HX 4GE0A 3FOBA 4IPTA 4J1NA 3IUSA 5AR1A 4F8EA 3A3YA 5IF3A 1JHXA 4IR7A 4QNNA 1ICIA 1Q15A 2VLBA 3CJTA 3O1IC 5ALRA 4UHCA 4AB1A 4EJ0A 6GPBA 3GV0A 1AQYA 2Q6OA 1UKZA 1XLTC 3IAXA 3Q10A 2CB0A 1U0HC 3AF5A 1PO7A 4YJFA 3R7WB 4OKSA 4CXMA 1NI4A 1T8SA 1E63A 5ESXA 4CTNA 4KIUA 3G23A 5AKEA 1M2VB 1U3WA 3EXIA 2O1EA 3CYFA 2R48A 1FVFA 5ALXA 5FUVA 1KO4A 4DRXB 3JXEA 4JLPA 3H0KA 2ZG6A 1M34A 3D5QA 3IQWA 3JVUA 3WAGA 3EFHA 3HKDA 4W6ZA 4LXGA 3MUFA 3UQZA 3FNEA 3HUTA 3HB9A 4ZEOA 3CLTD 2AJTA 2GYYA 2H2HA 2XUHA 2GFIA 2OQ2A 4XAQA 1Z4OA 2DFNA 3PLRA 5HKKA 5IVPA 3DOJA 3M6WA 3ZQUA 1EFPB 2FXVA 3N76A 2PRJA 1HXHA 4NE2A 2DTEA 5KYUB 4N18A 1QFMA 3T3DA 1P2VA 2AE2A 2YXBA 1XZAA 1I1NA 4NCNA 2EFHB 2POCA 1CY7A 2P6PA 2FPUA 1GARA 4P58A 3V4SA 2YN2A 1JS1X 4BKPA 4POOA 2BMFA 1TAQA 2E37A 3IHWA 4FK8A 4RTQA 4QFCA 1WLSA 1QYRA 3MWJA 2XXAA 3DDZX 3EJ6A 1TUGA 3GJ6A 2CVQA 1Z88A 2FEXA 3T9CA 3WWYA 4EJSA 1XEXA 2BP7A 5HF8A 3GF4A 3LFTA 3R3XA 1QGUB 5EKTA 4CQMD 5LU8A 1EMDA 3IBTA 5U4XA 5IYZF 5T4FA 1Y7HA 4EB0A 4X41A 1EVLA 3JZMA 1KMMA 4QXPA 1EEXB 4GMXA 4L5IA 3ZHCA 4O0LA 1M6VB 1Y8CA 1WNTA 4I5IA 1VGQA 1E64A 3O1JC 1AS2A 1H0RA 1OJLA 2JGKA 2ZUFA 1KE2A 4MVWA 3DAHA 3M4NA 4M54A 3VJMA 2YH2A 4EA7A 1WVGA 2FN3A 1II8B 4IJQA 3I5UA 4PCVA 5F7JA 5AUQA 4PYKA 5GZ1A 4BVBA 1UBTS 2VUUA 1ZGAA 3CE9A 1ZNYA 2E49A 2EBWA 4FZ5A 2XQKA 4IVNA 4Y9DA 2WFAA 5JG7A 1I10A 3WYBA 5T7BA 1YFLA 4IJVA 4MDYA 4EELA 1FUEA 2P8JA 1CZHA 3IDOA 5IH3A 3EEOA 4LFCB 4MV8A 4EIWA 1QRAA 4Q3EA 2FH5B 3A2MA 4FMCF 3ZBTA 2RH9B 3SHVA 2PJRA 3PHJA 3TBFA 4RULA 2RGAA 3B9PA 4PPYA 3LCVB 5IVIA 2Q7DA 4PINA 5ALYA 1A2OA 2RHTA 1WPXA 1NQWA 3BTOA 2D2EA 3FCEA 4RO0A 1IY8A 4D9BA 2MSLA 4EVIA 2NXNA 2FXIA 3PDCA 1NSFA 4HFNA 5B1DA 5EXDA 2FWBA 5DXFA 1H4TA 2K2WA 3LBFA 3S29A 4J0EA 1PD1A 3KZMA 1N3LA 5CW1A 3UFXA 3CRRA 4TKVA 1BX1A 5FOWA 1X9IA 1A5ZA 1I33A 4KQKA 1J8YF 2JVJA 3NNDA 2OD2A 4RFLA 6Q21A 1TTPB 2ERYA 2NSDA 3SR0A 1ZA2A 3VKFA 3LM8A 1OASA 2IEIA 2A4KA 3CEMA 4OIFA 1I3CA 3QEMB 2NLOA 3QOFA 5LLSA 3L6EA 1VKOA 1M0TA 2Q1TA 2DBQA 3ZLVA 3I61A 2QVLA 3IJRA 2YYAA 2MT9A 3AEUB 4RIFA 3EFEA 4A9AA 2ID7A 1WB5A 4E5NA 2A5JA 1MG0A 1MCZA 2GCPA 2JHGA 3BICA 5I8PA 5ELXA 1L4UA 4RZQA 4JR1A 4JA0A 2VH1A 1G8AA 4RYLA 5KWIA 2UYHA 4FYMA 1I4WA 1RWWA 4BV9A 2H1LA 3EIEA 4AKHA 3I9OA 2YVKA 4WJKB 2DR0A 3PUYA 2H4WA 1GKLA 3BWVA 3IPYA 1ZU5A 3NHUA 4O1HA 4YBRA 2OA0A 4X66B 4MV4A 5IZCA 3RG2A 3STVA 1GZ5A 2Q49A 1YI8A 3IIEA 3EF3A 1CB7A 3JR3A 5EIHA 3U4QA 1T26A 4QICA 3PQFA 2Y1CA 2GI4A 2H18A 3EY4A 1QQ6A 3HS3A 3QUTA 3UV7A 1ULSA 4O3MA 5AJVB 3GWGA 4BGEA 3W9UA 3G9QA 2HSDA 3K32A 5EJEA 1MOZA 3AI1A 4J75A 2ZTMA 5BYBA 1GG9A 2W5UA 4XARA 2QTVA 3FGPA 3ANYB 5DFAA 1L1EA 5I8ZA 3ZV4A 1Q6ZA 1AF4A 4BNYA 4LDPA 1OCEA 5IWCA 3IR6A 3EN0A 4OQXA 2XCOA 1CQIB 4M7PA 1SHJA 4OHPA 4Y2SA 5I9MA 3UJ8A 4CQLA 2ZWMA 2ZI4A 3PDHA 4RVHA 3K6SB 2BH2A 1UBOS 5FTWA 1JB9A 2O1XA 4B3JA 4RAOA 1QH1B 2JPDA 3HR8A 3GN1A 4A6EA 2PPLA 2LCQA 1N8KA 1OKKD 4PLGA 2X19A 1G20B 5DU2A 4KWTA 5HKBA 1KQFA 1U1GA 3DE5X 1K5HA 1XCMA 4PZZA 4AL4A 1FPMA 3I32A 4XGIA 2UUPA 4M0CA 2DXIA 4BN0A 3HJFA 4LRTB 5B6IA 2FZ4A 2IXEA 4EY5A 4YRSA 1SVOA 4II7A 2BFCA 5AYVA 5CA0B 4I99A 3S7ZA 3QUAA 4MVYA 1XZQA 5CVUA 1E1CA 3PP8A 3ROXA 4R7ZA 3ZY5A 3HV2A 4XIYA 1GA1A 2GBPA 2CK3A 1PJ3A 4TYPA 1GUFA 3NP9A 2ZBVA 3WAKA 5CBKA 7GPBA 2ZB8A 2AFRA 2XLCA 4CTOA 2R11A 3PR2B 3QU2A 2OO7A 4IUBS 2A78A 5ILOA 4J6EA 1OXSC 2YN0A 1PQUA 1WA5A 2V58A 2XMCA 3LX6A 1FDIA 1IXKA 1ZN8A 4IICA 5IJXA 3VDQA 3LPMA 3RYFB 2H1VA 4ECEA 4BECA 2VQEB 3AR2A 4LVUA 4DWVA 3Q9SA 5IAJA 2NQ8A 2A58A 2M32A 3S1AB 2B94A 1UBGA 4NNJA 3L4EA 4D9KA 4DIBA 1J7JA 2MYNA 2RB4A 3KYDB 3BXOA 4HQ6A 1P7WA 2HM7A 2WJVA 5EXEA 4DIDA 2IH2A 1XZEA 3AF2A 2WM3A 3K9GA 4IM7A 1OT5A 2HKIA 3QXHA 5HE9A 5I7EA 3QVGA 3L7DA 4HUQB 5HCUA 3RTEA 2PAFA 2E4UA 2VYFA 3K6JA 1UFQA 4MWOA 3U7QA 1ORTA 4EDFA 1L4KA 2I7VA 2XH8A 2H3EA 1OBHA 4CODB 1AUPA 4E08A 1J0BA 1O6ZA 4LECA 4JKIA 2EBFX 1DUIA 1JVSA 4GOJA 1G5PA 1H42A 1GWNA 1V37A 1TNDA 4M0KA 1U3FA 2P3OA 2Q21A 2HHLA 2X1MA 1A3CA 2PZKA 3TSAA 4DRZA 4MKGA 3L1HA 3EIUA 2AWOA 4OH1A 4WLVA 4WZAE 3GBPA 4BVKA 3TDNA 4OL9A 3CISA 4Q48A 4H1VA 4PZCA 4WVLA 5J2TA 3MD9A 1GQSA 4BO3A 5ICCA 3TQHA 3P2YA 4WN9A 3PNVA 4GZ3A 3FJYA 3WYNA 2IS2A 2JA2A 4GVPA 4ABYA 2XCTB 4J0IA 5C34B 2X8WA 3ROMA 1XAJA 4B2PA 2IHYA 1FJGB 3DWEX 4OHFA 5EMJA 3TLGA 5CDHA 1M8JA 4D8VA 1FXWA 1U0LA 3WRXC 3U49A 1AS0A 2BPOA 3IIKA 2CVFA 2AZDA 2GN9A 3GT3A 1BGXT 3KQWA 2JZNA 4WPGA 3ECAA 3L8ZA 1FLAA 4L0DA 5AJZA 4A8JB 4BQNA 5JSZB 2IS1A 4NLLA 4EP1A 4U6SA 3E8SA 2VJQA 2Q5LA 3C3WA 4G0VA 4GU5A 3TJMA 3IJ5A 1KMHA 1XWFA 4MQEB 1OGJA 2BF7A 5DEIA 5A9SA 3EVNA 1KAQA 3P20A 2ZUBA 5EIBD 4HVAA 1H2HA 1H8EA 1YJ5A 4QEDA 4MYDA 5LD2C 3COJA 4RXUA 2V98A 3RRFA 3PHHA 4YYZA 1DKPA 4QA9A 2WUVA 1QWSA 5LQSA 3DAGA 3SIXA 2QVCA 3THYB 2CEAA 2HK6A 3T4PA 1YU9A 3HU3A 3WAJA 3PG5A 2O3QA 3UJNA 1P72A 4R3WA 4XR4A 5DN6A 5I6DA 1E3LA 5LVAA 4QG3A 4EGSA 5MFZA 2GWHA 3DAOA 1VTKA 1F48A 1V8OA 4E5DA 2WJZB 2YJ3A 1V5GA 3ORRA 3LPDA 2V4ZA 3HNRA 2WVGA 3QENA 4WLOA 2M6SA 2ZYVX 3LA8A 2B8NA 3JARA 3QQ5A 4RD2A 3EGEA 3NBKA 4WBXC 1MJ5A 1PP4A 1VKHA 2C61A 2O2XA 2W6JA 4JOSA 1XCLA 5D5HA 3H9JA 1ATIA 5EXXA 2O8EB 2C3OA 5C4MA 3RYCB 2Y99A 3AIOA 1DIOB 1Q7EA 1X1RA 3GNTA 2Q7XA 3NTRA 3R1IA 4MS1B 1JR2A 2OUKA 2YTZA 3UENA 3WMWA 3VR1A 3FYDA 3DMPA 4TQ9A 1F0KA 1S0UA 1Y6RA 3TBKA 1T1RA 3TDMA 1FP4B 2WAYA 3FOAA 3DBLA 3E8XA 3K9CA 3STUA 1SA0B 4FS3A 5E95A 3KTDA 4NOJA 3R6TA 1A8SA 1MMFB 4RZ2A 3ZWDA 3Q5EA 2ZETA 1TJ4A 5E0KB 1YQEA 2DJIA 1M5RA 3C6YA 1KYXA 2OV6A 2QUAA 1GNQA 3D4BA 4KWHA 2B35A 1V11B 3UMCA 1TRKA 1V2HE 4PO3X 2GK3A 4R2MA 3UOAB 4BFVA 4US0R 5JC1A 5JPCA 2B8WA 3FTEA 4GM0A 3N8NA 3E2IA 3DQQA 3KFLA 3LPCA 4WNYA 4MDHA 3A3KA 4TUYA 2A7XA 1GQYA 1BS2A 1SWVA 4NG5A 1W73A 8LDHA 1CQJB 2CXUA 2O4UX 3BX1A 3HJNA 3ZIDA 5C1OA 2OB1A 3I8SA 3JYOA 3IIIA 4FFPA 2O8FB 2JAQA 3IBFA 4J03A 5JCZA 4HAIA 1EEHA 1O95C 1E7YA 2J7PA 3I72A 1GKUB 1T4DA 2CD7A 2DUWA 3KL2A 4BVAA 4RSRA 2BGWA 1FJHA 1ZAKA 3MWDA 2IC5A 2FUEA 2NPOA 4MPJA 4CMEC 3ENVA 4Q24A 4YT2A 1J23A 5AKZA 2W2OA 3EE6A 2J3DA 2WV7A 1WUTA 1PYOA 5EHIA 5BSGA 1C1YA 1TK9A 3BD6A 1H0KA 4AYTA 1RU3A 1SB9A 4IIXA 4LV6A 3SXJA 1QXSA 3KYBA 5JBNA 3L8CA 3IQHX 3N3BC 3MTBA 4HXEB 1EPUA 2DSNA 4J3FA 3U62A 2VJMB 3X3HA 4TLLB 4DT1B 2ZTUA 3LBAA 1VG9B 1VLLA 2BD0A 3LF2A 3QI2A 5COBA 3VOAA 1UXJA 3VR3D 1QQ7A 1E6LA 1SG6A 2DKFA 3MMZA 1OU0A 5FUMA 3NHMA 1R18A 1WHSA 1DJOA 2AXPA 1KVRA 4YIKA 4F1KA 1OXBB 1L5SA 1XAHA 3CS3A 3HNOA 1NF2A 4U7JA 2WUGA 1OFIA 4XJVA 3HDTA 4WKPA 2P2YA 1P5FA 1V3VA 3D54D 1N1EA 6AT1A 3OHSX 3ZCXA 2EQAA 1CWUA 2YFHA 1H66A 1T13A 5C1BA 4QFBA 3DWGA 2XBMA 3RUFA 3U2QA 3KJIA 4GP9A 3FYUA 4RGVA 3A1WA 4A91A 4CLRB 3EFOB 3DW3X 2OCIA 1ZW1A 1CSEE 2HEGA 5AOBA 5HKLA 4ALNA 3OOHA 4M1YA 1WXFA 3WGYA 4TL6A 3QKIA 3AUXA 1WB6A 4EUNA 3UHOA 5LDDC 4NMHA 4I1SA 5JD4A 1A9ZA 1XFDA 3ZD7A 1OX6A 1W35A 2D1RA 3DV9A 4B3CA 4XD7D 3KXPA 3OT1B 3OIWA 5DNYB 4CI9A 3H9QA 1FFCA 2B7LA 4TQAA 3T7JA 4DDMA 4RV4A 1IJKA 2WMYA 2Z6AA 4LN1A 4OB7A 2FPPA 3QPWA 2Z1MA 3RR2A 2AF4C 3IESA 3ZHZA 4FC7A 2W2MA 2DETA 1EVEA 1KO5A 4JT9A 3MFYA 5M29A 4HH4A 4KXYA 2FSIA 4EATA 1NBWB 4UVEA 1O4WA 1PJZA 5B3AA 3UWKA 3WBJA 2C88A 4TTPA 4DLXA 5KHLB 1GPWB 4WBSA 3EGDB 1RBMA 4MGYR 1LK5A 4CGYA 3AP3A 3IDZA 1B74A 1KI1A 1RRGA 2VJKA 1UF9A 2XDYA 2XCQA 3EG9A 1FTYA 4I0WB 5MDHA 1OIVA 3S2ZA 3ZU5A 2CNWD 3I9FA 2VRCD 1Z35A 4BNHA 4PC1A 4G4GA 5A4FS 5AVVA 4P98A 4F9FA 2ESRA 4D4LA 1KI9A 3ESAA 3ZW8A 2BDEA 3SSNA 1UODA 2J6BA 1ONBA 3CJQA 3QFTA 4DLPA 3CONA 4AM8A 4DIOA 2BFBA 5L53A 5KOIA 4QYTA 3KQUA 2AKEA 3FI0A 4JI8B 2M1XA 3TD2A 1W5SA 1TT5A 3NRJA 3P96A 5TDHA 1EIZA 2ZAIA 3N0VA 4B0PA 2C54A 4BMOB 2BRUC 1QRSA 5EQTA 2BTEA 3P97A 4UE2A 3VNVA 5EQFA 4WFJA 1QKIA 1JJAA 4UMEA 3PVZA 2BR3A 4MHSA 2FV8A 1GCUA 2I4TA 3JZIA 1KKLA 3QG1A 2HA2A 2PD3A 4J7UA 4QDOA 2B1JA 3L2OB 3Q5DA 4MCIA 1M7BA 3LRPA 4QJBA 3O8OB 5IDVA 2Q0QA 1HRKA 3FNQA 4ER3A 5FYDA 5KYVA 2FEMA 3ZDDA 3FPHA 2CE7A 1MTZA 4G9BA 3FIJA 4YFVA 1R0RE 1HT0A 3ZHYA 1XTZA 3DTVD 3QX3A 1KOGA 3ESXA 4PR3A 1G5HA 2OWDA 5LYJA 2HMYB 1GRCA 2OO5A 3JYLA 1SUSA 5DHUA 2NVUA 3KQVA 4FUQA 4CM9D 1A9XA 4L4XA 2G77B 3IOYA 1LC3A 3M9LA 4KQ1A 2O54A 2A92A 4ENPA 3C4JA 4YP6A 3MT0A 2X41A 1BXGA 3U19A 3BUSA 3Q3EA 3LUAA 3GQBA 3HMQA 1JDJA 2E5WA 1Y4DE 4DN6A 4FZRA 4GECA 4Q9KA 1BJKA 5KO2A 1LRLA 3LV8A 3D6AA 3H83A 2O2EA 2IYVA 4MS3A 1XEFA 3B2NA 3FCAA 4QU5A 4YAGA 1NTOA 4C4PA 1FEZA 4CV3A 5IKPA 1K86A 4B2YA 4ZPJA 2EJVA 3WLSA 5GINE 4MUHA 2ONKA 1YXMA 4FBGA 4CG2A 3I37X 3PRHA 2Q3JA 2R1ZA 4KUHA 2GBGA 1ZGHA 3KFVA 2IXTA 5TF4A 2NUPB 3QJYA 4YJ2F 1TYAE 3F2VA 4R41A 1X7WA 1D1TA 1QC5B 2XNJA 4KZKA 3EGVA 2C92A 1BDBA 2FJPA 2Q0SA 3M1AA 2GPSA 2NNLD 3HWWA 4JHLA 1BG6A 4KC0A 4V0RA 4L5JA 2UUBB 4NJMA 5E9JA 4BFWA 3ZWWA 2REOA 4OX9B 2V8OA 2WD7B 2JARA 2FLWA 1NFQA 4D3ZA 2WUEA 3ORQA 4DJAA 4X54A 2EEZA 5TPZD 1RXWA 1A69A 1KQ3A 2CDCA 2QTGA 3TZLA 4M3NA 1A7AA 1OYWA 1Z4MA 2IGBA 1DWUA 3DLCA 1IAVA 3N2KB 1AT1A 3CPHA 3SYTA 3VH4A 4GI1A 4HJXA 2J30A 2X58A 4LZPA 4MQFB 4NV1A 2GEUA 3JTMA 4W5HA 3PFCA 3X1ZA 5DNCA 1HOXA 2AA3A 3HJHA 3EAFA 3Q2IA 1G21B 1Q22A 3HUDA 2CLMB 1RYEA 3DEYX 4WQMA 4ZAYA 1PWEA 1QORA 3PDUA 2HJRA 4GBJA 3ZI0A 5CVTA 2XADA 4YQEA 4C0XA 1T9GS 1XR3A 4BQQA 3PENA 4BP3A 1Q0SA 1Y8RB 1GUZA 1D6JA 4MKZA 2FZWA 5F5XA 1I3NA 1YB6A 1P0QA 4KXVA 1HV8A 4YP0A 5IM5A 4KGVA 4A03A 3AHJA 4ON9A 4AJPA 4JEMA 1J0AA 2ZIEA 2WYWA 4I66A 2ZVDA 3BB4A 4M76B 4P4SB 1JJFA 1OYYA 1O94A 2JAPA 1CR1A 3PUHA 1N3IA 2AFHB 3FVRA 2XEDA 3THRA 3EZ9A 3HUFA 3L4BC 3QMPA 5DI9A 4ZAFA 4QASA 2EJCA 3VGPA 3WNVA 3D0RA 1QG2A 2II6A 3FA2A 1U0SY 2A8YA 2AYXA 4PC3A 4TLDA 5C5DA 2NPFA 1OAOA 1FLVA 1X86B 1KYQA 1YZQA 4BFZA 2GFQA 4FDAA 4AD8A 5JAIA 4DR7B 3HG7A 4UOQA 2FN8A 1T34A 4BATA 1J2UA 2O3TA 4XSGA 3BB1A 1I13A 1HFKA 3OE7D 1D7AA 1TKRA 2F90A 2J4CA 2V6IA 3CX4A 2VO1A 3DFUA 1YL7A 4OKIA 2FCRA 1K4YA 2WFLB 2XE6A 1XZ8A 3FLMA 1Q7TA 1CUWA 1MH1A 3T5AA 2AXEA 2HMTA 1XZLA 2GOYA 2QJRA 1J4AA 2P9QA 1TL7C 3C15C 3HHEA 4BZZA 1VXOA 4TVSA 4W99A 1V3TA 3J7TA 3OP1A 1QAMA 1MZVA 4NCJA 1VGVA 4JGBA 4DV4B 2B83A 1Y82A 3PS9A 5ITZB 2A1UA 2ZXFA 1R4AA 1XELA 2IPXA 1C29B 1VGRA 2BM1A 2DHDA 4Q00A 2ODNA 3E9EA 2XCUA 5AXCA 1LFAA 2PH7A 2VXYA 1K6JA 1O9BA 1QV7A 3Q1KA 1EXNA 1ZD3A 2C0CA 3CLRC 4PX5A 4IRUB 2B2NA 2P67A 4N6NA 1ZJZA 2FSHA 4C4AA 4LPKA 3DXYA 4Z4FA 3ELYA 4L8LA 4G09A 3ND6A 5K0ZA 3RKSA 4XYEA 1E9FA 4K9KA 4MRPA 1CX9B 1OLXA 3T4UA 4H77A 4LZWA 1ODFA 3ZC3A 5AK3A 1TEZA 3QFFA 1GKIA 1YONA 2YIVX 1D1QA 3D8HA 4G8JA 4P4GA 1P73A 2Q5IA 1GT6A 4ZOCA 1FJXA 5ICEA 2JIMA 1CZOA 2ABWA 3C74A 2I9KA 5LP6F 2C1EA 1QKKA 3EUAA 4B45A 3FMVA 3NYRA 1YKFA 2PRYA 3RSLA 2Q5HA 2JDIA 2FWNA 4D43A 3OCUA 4ZVRA 2WQ7A 2Z98A 3JPWA 3C4QA 5K8UA 4B4OA 1QF7A 3ZXXA 4U5XA 3A4VA 3VNBA 1GQ2A 4GXRA 1BJRE 1TZ2A 3OCCA 5M3BA 3D3NA 5IMBA 3HO1A 3RYIB 2W71A 1XCPA 1Z4LA 4ZK6A 1SHTX 1TUBB 2OFFA 3MS2A 3NKFA 1S7CA 1XDGA 3PIDA 3P5BA 2JFOA 3FZEA 1WKVA 1WOMA 4BAGA 1DUSA 3K0AA 3WHPA 621PA 3O8RA 1D6NA 3SC6A 1H2ZA 3GRKA 3AR6A 3LO5A 2IYFA 2GYWA 3ACBA 3CR3C 4ROSA 3SHTA 3Q8LA 2VPQA 3LOUA 3PC4A 3F8TA 3UYKA 1OV4A 3E81A 3DFZA 3K94A 3MCVA 4JZKA 4U39A 4EAAA 4NZYA 1U1IA 3RWBA 3FPJA 2B8JA 2ACEA 1N5LA 5AVUA 4EO4A 2NAFA 3ON5A 2R6R1 2QM0A 3E22A 4IXMA 3BHNA 3EA0A 3TD6A 3UJ6A 4CL0A 1VHWA 4Q4DA 4MRRA 1IOLA 5THXA 1CF4A 4DLTA 3SHWA 1XYVA 1NW9B 4J0JA 1FRQA 2E48A 1FFBA 2RI6A 4X1KB 5JH7B 5IDYA 4JI3B 4RF3A 5ESWA 4WCFC 4L57A 2XITA 3ADKA 1Z39A 2YXDA 2H6EA 5KU7A 1FJ2A 2FRDA 5JD5A 1QKJA 1P7YA 4LK3A 4X7RA 1E8DA 4PU0A 3PGLA 2Q07A 2OESA 3DR3A 1XMSA 5ALUA 3WL6A 3TLMA 2OBYA 1MC1A 4C9BA 4PXSA 2C83A 2C78A 1AV6A 4O2LA 4WXEA 1TO1E 3DZGA 4P3XA 3U4HA 4US2R 5L3RA 4MLDA 2IZ1A 5IF9A 4V2UA 3PCRB 421PA 1R9GA 3R5KA 4U5QA 5CJ2A 1I3KA 3CLKA 4B32A 5EE3A 3BULA 1KWKA 5KTMA 5IJ0A 4WKNA 1J2YA 1MABB 4JENA 1PLJA 1EK0A 2EARA 4I5FA 4XVQA 2VP0A 2E1RA 1SUBA 4CF5A 5CDFA 3WQBA 4RHUA 2ZJZA 4MIYA 4UATA 3T5DA 1UCFA 3F74A 3KUXA 3IURA 2WAOA 1X7XB 1QDUA 4G8CA 1LBTA 4HDNA 3MAGA 4A8JC 4BKRA 2G07A 1G8KA 3KG2A 2ZBUA 3O21A 4C3ZA 2WJIA 4YRIA 2HO5A 4H35A 3BRWD 1CIPA 4BJHB 3LO8A 2CMFA 2EKLA 4PIMA 4OHZA 2I4NA 1C1XA 1Z45A 5LD2B 3NVAA 3SYLA 4YCSA 1V8ZA 1MQAA 5CXXA 2HF9A 2AX4A 2QUZA 1KH1A 5U9CA 3NM4A 4QIHA 3JD3A 4TYQA 4XJTA 3RT7A 3ZIAA 3BMQA 3CZCA 1GSIA 2FW8A 4M83A 1HFEL 3CR8A 3A0UA 4CUKA 3E3AA 3CUWA 4KREA 4QVKA 3AFMA 1HX7A 4J76A 5JYBA 1FA9A 4TKVB 5E1MA 1V1MB 3DMHA 3GIWA 3TNYA 1Z15A 2CXOA 1FFDA 3ZWQA 3N39C 2IKQA 3DKIA 4LY9A 4UCQA 3S6JA 1DAGA 4LRWA 1SD1A 2AR0A 4IXNA 5SYNA 5G3ZA 4NFYA 3RHTA 2X7JA 3U40A 1XBTA 3OOJA 3DTVB 2CW5A 3GRUA 3FDJA 5CH8A 3NBUA 1T3SA 5TT1A 3G8BA 1A2QA 3H9BA 3JYPA 1I3LA 4GVXA 2GXQA 3TXXA 5L7WA 1Z8NA 4KEAA 1ZZGA 4GIBA 2PTGA 3DL4A 1OB5A 1Z06A 3KOUA 3S2IA 5B12A 5DYIA 4ERXA 1A4IA 3DA8A 1XX6A 1TEXA 4AF7A 1QHGA 2NVWA 2KLHA 4M0FA 3A28A 4OG2A 4FHZA 3HBJA 2IV7A 3RSFA 2XQIA 4H1HA 4CMIA 2XJ4A 1IEWA 1AGRA 2WHRA 5AXBA 4JA2A 2ZREA 2OHOA 3FR7A 3KM0A 1JX6A 4LRYA 4WH0A 3CWCA 4KYIB 1RWQA 4N8EA 1PR6A 3VDMA 1KKUA 3HTXA 3L7MA 2SKCA 1A04A 2KBEA 2WHXA 1JJIA 1PHPA 5DM4A 1LDEA 2H06A 4DNQA 3CX3A 1I94B 3JQ8A 2H52A 3BG5A 2ZROA 4JYCA 5CAEB 2RC5A 3DQPA 1OSNA 3EC2A 3ZPXA 4R1PA 4DQLA 4QDXA 1FX0B 2PV0A 4WY8A 5ILQA 4ZU1X 4GWKA 5TPWA 4BY9E 4GWLA 3AKDA 3R77A 4KE7A 1X15A 1GZ7A 3JRNA 2G4VA 1MD9A 1Q20A 4PNPA 3HR4A 4TL8A 1K7EB 4RKFA 1C30A 4N12A 2VRWA 1SVSA 2JEOA 3NATA 1OBFO 2JIRA 2ZWOA 1JDSA 3HCPA 3LL4A 4GQAA 1K2WA 5CLQA 3KKEA 1N3BA 4R8MA 2GPNA 3GJ7A 4IS3A 3AUUA 1WE2A 3DHWC 3I0NA 3R4CA 4ZOEA 1GGKA 2AMFA 1G16A 4WBNB 3OPVA 4AXBA 2JFPA 4JNCA 2WSMA 3PQ4A 2P9ZA 2OC4A 1F38A 4JUIA 5GQSA 2DBRA 3JASA 1JHMA 2W2TA 3F7MA 3KOWA 1C9NA 3I6IA 3KZKA 3EWIA 4H6WA 2IUTA 3UWDA 5G3YA 4IIVA 2VBCA 5CA0A 2IELA 3N8HA 5TXGA 3U0BA 5I4BA 3FVVA 1T0PA 4JKYA 3SX0A 1T2AA 1PS8A 4ALIA 2F1JA 2IA5A 4ZZIA 5L4SA 1VDZA 2GTHA 1SUFA 3UT0A 2WSLA 3ET5A 4LJLA 4BFSA 1C14A 1FNNA 3OMLA 3AEYA 2FUG6 3GFRA 2CDRA 2G0TA 3DPSA 1M76A 1VYTA 4A0HA 3JALA 2QTAA 1JDNA 4IUDS 5FORA 2F55A 1CVRA 1G3RA 3BORA 3KKPA 4YEDA 1FMJA 2E6KA 5EUCA 3JQ6A 4RY9A 4G65A 4WA8A 3ELBA 4AKIA 3W5AA 5CJJA 4RSGA 4B6JA 5D00A 1QP7A 2FZKA 5J2UF 4MR8A 3G1UA 4HZUA 3R3SA 3SX4A 1KK1A 5H1YA 3RIGA 1EX7A 2XY4A 2Q8NA 4RTLA 3UWSA 4RK6A 3THSA 4CEJB 1U2PA 1SQ5A 3BWCA 4GO1A 1EQ2A 2NAPA 3K0CA 4JJ8A 5FNVF 2XECA 3F3SA 2XQVA 3Q7QA 4NU8X 3E6AA 3EYAA 5J2UB 3GPLA 2AR9A 2GO7A 4IIHA 5HK9A 5A0VA 4WNAA 4MMXB 4FSXA 1A2BA 3QPVA 1E2EA 4DEXA 3ORSA 5J2TB 2Z5LA 1H65A 1TMKA 3IR5A 3ZNNA 1Y8AA 2XZLA 2Q5CA 1QHFA 5I9NA 5IT5A 4ML3A 4GM1A 1XLVA 4OATA 4N41A 1GR1A 1ZD1A 4H4CA 1AC5A 1Z83A 1XTJA 2OFXA 1WBJB 1NOKA 1G3QA 2I8LA 3CMMA 1V4NA 3GEEA 3NONA 3WS7A 2JLXA 2H54A 3EEQA 3RK0A 3NWOA 4R69A 3T06B 2KPOA 1N7GA 1ZK2A 4WECA 2QX6A 1G7TA 1X7GA 1FDOA 2RHHA 1RYMA 4RYDA 4F96A 3HUUA 4BZWA 1I5RA 1GU0A 3RRJA 4BMCA 1A1SA 4P5EA 3Q87B 5HTKA 1I51A 4YJ3A 2QD1A 1E5DA 1O6BA 3H8JA 2F3TA 5K4AA 3AHDA 3ZS8A 1H4QA 1PT6A 4Q02A 2PVSA 3VR3A 4PC7A 2PGJA 3OKFA 4CV0A 5JSYA 1TVEA 3VYRB 3PF9A 4P84A 5D87A 4FR2A 2OGTA 3ICCA 4TN5A 4OEHA 3KLMX 2OAP1 2HNBA 2V55B 1QCYA 2WF8A 2IZ0A 3GT0A 1YJXA 5B36A 5DM70 5FLXA 3ANTA 4PZLA 3ZCPA 2GZAA 2DC1A 5ITVA 4OMDA 2MINA 4DZRA 1P17A 4LZJA 3ZY3A 5JSUA 4ZVKA 1HDEA 3T3HA 2I62A 4MROA 3KVVA 1WD5A 3A3NA 4HFJA 4OOFA 5EZYF 5FP0A 1NOJA 4QYMA 4PZ0A 2BWJA 1PNOA 4KDRA 4N82A 3LWBA 3EYWA 2CMGA 2B0CA 2GNAA 2H4YA 3R23A 3ROPA 4Z3OA 3RYCA 4C5CA 3PYLA 4QPPA 3WWEA 4R2KA 2PBFA 2D1FA 2VQ6A 1Z0AA 1Z3IX 2B7CA 4OXKA 4TYYA 1D2RA 2FPGA 3A4MA 3D8SA 1B16A 3LYHA 5BT9A 1TKAA 2FWPA 3FNFA 4JL6A 3D3JA 1KHTA 4FX5A 4Y6OA 3WE7A 1NTRA 3T5GA 4UFNA 4KFRA 3KSBC 4R9UC 1C3EA 4JOBA 3CUSA 1KEEA 2WM8A 4Y1RA 3UUFA 4KE8A 4AJ9A 1CS0A 2DP4E 3TLEA 5LR6A 2Y0BA 3L7KA 3TW0A 5I9IA 3TF5A 3B12A 1M1NB 1PJCA 3GLHE 3ZI7A 1PJ4A 1YK0A 2EKZA 2HFJA 1QZ3A 3JTEA 2HQ1A 2ISQA 4JD5A 2XTNA 4H7IA 4J2TA 1WPGA 5T8KA 1V6SA 5AVTA 2G1UA 3LC0A 4MUJA 4S04A 4DG8A 3K05A 1CQJA 5F9MA 3LC7O 5AW9A 2IU4A 4IS2A 1L5LA 4CG3A 4BLVA 2WSBA 1JH8A 5CVVA 3EZXA 3TUIC 1EFUA 1UJCA 2MIIA 5BSMA 3SG0A 4QHTA 5DLDA 3TO5A 1OI4A 1U1EA 5TT0A 4F93B 4QELA 2GHTA 5K3DA 4WLEA 1YU6A 5EI5A 3CRQA 3P9ZA 3MWDB 4EKDA 1NYLA 3TB4A 5M5BA 3H13A 2G1PA 1B0UA 1DAFA 5D6OA 1S2DA 1THMA 4NX2A 4UD6A 3QW4B 4I9NA 1DLJA 4FJ2A 4EX7A 4DUZB 1PLKA 1NW6A 1UC4B 4JR2A 4EK9A 1BWQA 1H22A 2VP3A 3GXOA 1N0UA 1MENA 1SXJD 2ZVJA 3K1YA 3KR9A 4O2AF 4QSHA 5IJ9B 1XRRA 2F8SA 4ZT6A 1YDWA 3ZCSA 3K1AA 1V8PA 3WQQA 3GPCA 4G6ZA 2GVDC 1SXIA 5I7RA 4UTVA 2FF7A 2RK4A 2O2GA 3HFRA 4MZDA 1JDBC 1HDCA 4QARA 4JT2A 4OLAA 2Q9BA 4LK2A 5JTTA 3AWIA 1C7JA 3ZKAA 2D7JA 3NNNA 3CLUC 3CZAA 1LZKA 2YVLA 5EJFA 4GX1A 4XIIA 4PQEA 2CL6X 1Q83A 2ATIA 2YQ4A 4XSVA 4YGXB 2I55A 2DTDA 4ODIA 4Z7QB 3FYTA 1H4SA 3SCZA 2VYVA 3KZVA 3LHKA 1OGYA 3NVDA 3SJAA 2WG2A 1Q5PA 1PUIA 4OO3A 5EA2A 4AU1A 4D3FA 4AICA 1IIRA 2HTEA 2QRPA 3B78A 3HZZA 3JVVA 4CMBA 3Q8WA 1B3BA 1UQUA 1VSQA 4G97A 3O5AA 1W0KA 3NYWA 1E3WB 4PVDA 1HL7A 3N2IA 2V7XA 3MOGA 3BRWA 2QA5A 1N5IA 4G5GA 5EKXA 4OJNA 4TTAA 5EP4A 1OZAA 5F7XA 1GAXA 2ANCA 5A05A 1A76A 2EU8A 4FBMA 2A5YB 4I6JA 3GUHA 2PUTA 2FPOA 3ROGA 2PX5A 4J4TA 5LC1A 3BTUA 1IHYA 3S7TA 2XNHA 3K8ZA 5K5EA 5EYPA 4L9AA 3D7KA 3AUYA 3L8YA 2JBAA 3QFSA 4YROA 4NESA 4MUBA 4ZO9A 5E2BA 4IHKA 1IJFA 1IL0A 1PHRA 1BU5A 3BXEA 3H4VA 4RGBA 4ZOLF 5DULA 4DJFC 1USIA 1IHPA 1Y3FE 2BUBA 2EXXA 2AEFA 1ESZA 2C1ZA 1ZJWA 1K5DA 2ZBFA 1ADBA 1BDMA 1Q57A 1UDAA 3G6KA 4EF5A 1HUQA 2I2AA 1TJ3A 2LVBA 2O2IA 1PFVA 4W1PA 4X1IB 1JG3A 2FP3A 4Q16A 4X92A 1Y42X 3G6WA 1VJCA 3HGTA 5JMWA 3BGIA 4MGIR 3EHDA 2VYVD 2XGJA 3G5TA 4UTRA 1OKKA 1UEJA 1A9TA 2YIMA 3JQPA 3OG9A 5CU7A 1SCJA 3D6NB 4Z9FA 2PUJA 1SBYA 1NW3A 1SU6A 2FUCA 1U11A 2W0SA 4P3OA 1F8GA 3PC8C 1MA0A 2R47A 3KR2A 4M1EA 4M9UA 2HIHA 2ZUVA 3MQFA 3ONNA 4BAZA 2X1VA 2DKOA 2H08A 4FEEA 4RTRA 3PJEA 1Z4JA 4BWFB 1JHUA 1TZMA 4WZ6A 5DTIA 3U3DA 4KLAA 3I5YA 1OB2A 4NBSA 2G67A 4IXWA 2P9GA 2XBUA 3NJ8A 1VP3A 1W1WA 4KDCA 1RI5A 1P2GA 1C1HA 3BFPA 4O4IB 2N47A 2ZRAA 3H5IA 1L7DA 5FUQA 5LOVA 3DEKA 4GRDA 1E66A 1JXOA 1FFYA 4RWEA 1E32A 1TM2A 1W9HA 1QNLA 4FD2A 2H0QA 1E7SA 4X6LA 2B5OA 3A6KA 2R6CA 3BD8A 2FZCA 1C9KA 2LP4Y 4IXTA 4X3PA 3EULA 1J9EA 3IUYA 4NFSA 4PX9A 2WIKA 2V9ZA 4B85A 1XNRB 2PA0A 4GOKA 4NMWA 4K6KA 1E89A 3KTAA 1HE8B 4HQNA 4EUFA 1OVGA 1G6Q1 4L8WB 5FBWB 1KAHA 1J97A 3HFSA 2ODAA 2NU8A 1IMOA 3JWPA 5TX7A 1WRBA 2G28A 4R68A 3W6ZA 4RPCA 1OXTA 2DQKA 4IJMA 4OAPA 4GLOA 3I42A 4A10A 2HPZA 2WJHA 2GHIA 2SKDA 3HDYA 4LMRA 4P4UA 5DHPA 3DDOA 3Q98A 1VLVA 1I7NA 4A7PA 3AHHA 1HG0A 1DCKA 1GSAA 1SURA 2OHHA 3UMFA 3AM1A 3F5MA 2EQBA 2D5CA 1I2ZA 3ZOKA 1F2UA 3I04M 2GN8A 4B44A 2E4YA 5BP7A 3AM3A 3OSUA 3M81A 2DR3A 2VPYA 1PJBA 3NAGA 4JJZA 4MEJA 5E7JA 3U7JA 5LP6C 3U3KA 4I4LA 2CSUA 2V03A 3EZ2A 1Z7GA 3ANSA 1ZONA 3BCHA 4L74A 1NU8A 3N28A 1VMIA 3RFXA 4WUVA 1LPNA 3GOHA 2EAUA 4BFTA 1FYEA 4NSNA 3RRBA 3VZQA 4BCDA 2YL2A 1YZKA 1CTQA 3KJXA 2LE0A 1D04A 1MB3A 1PZXA 1UEXC 4ND6A 3RVPA 3CIOA 4DMLA 1S2OA 4WFKA 1U98A 4HLQB 4A23A 2PX0A 2VDPB 2PWYA 4NOKA 4U9IS 3ZD9A 5CTJA 4S1VA 3O1LA 1PCXA 4JBGA 2ADFA 5K6AA 3N8KA 4L22A 1LVUA 2OHVA 5I9SA 1USGA 1T6BY 2QRJA 2I6UA 2R2AA 3JQAB 3JS5A 1D1SA 4JBNA 2B61A 3RNOA 2EJBA 2Y76A 2O8CA 2GAAA 1KYWA 3P2MA 3IP3A 1X13A 2FPLA 2R1VA 3GW8A 3KYCA 4W6QA 2EW2A 2I65A 2OBBA 2P3SA 2I22A 3VAAA 3UGJA 3C8ZA 3URMA 4XB2A 3SZMA 2JGEA 3U7EB 3GJXC 5CT8A 3L8HA 3PHGA 4BU0A 5FTNA 4OBEA 4OM7A 1OU4A 2B98A 2C59A 4YJGB 3AF4A 1Z4PX 3M1IA 2Q6KA 2PKXA 2CZCA 2J0SA 4ARVA 1V16A 1IVNA 2C07A 3D1LA 4FFVA 4GMDA 1P9RA 4QU0A 4UZFA 1QIHA 1OLUB 1M5UA 2V7UA 3KFXA 2B6HA 5K2MA 3T3OA 1QVAA 3J7AC 2JW5A 1EINA 1EQAA 3EXAA 2A0UA 4TTQA 1VIMA 3PQ8A 5CCXA 3F73A 2BGNA 3LX4A 1KE1A 1JILA 5DCYA 4PHGA 4NU6A 4QE3A 1ENYA 2Z5VA 1EHYA 2A5DA 1N9ZA 3E9CA 3NTXA 1JLMA 4L27A 5B1HA 1EB8A 2F3RA 2XI4A 3AEQA 4HFRA 1ZD5A 2ODQA 4K1LA 1JW9B 4P4SA 3WIDA 2CE2X 2ETVA 2O1SA 1W29A 3BJZA 3ZTTA 1QLJA 5BNTA 1NI4B 3SXUA 1HL3A 3WLJA 3ZWMA 3IPCA 2FMXA 3M33A 1I7LA 3LDHA 4I3FA 5SY9A 1VL8A 2C0PA 4L5YA 2ZUCA 3IJPA 3ZWBA 1KIAA 3TLYA 1M34B 5G02A 3L9XA 3TG2A 1E5XA 2ZB2A 4FFRA 3UTCA 4E4TA 1E7WA 5KJFA 3AKZA 3TX2A 1WP9A 1YS6A 1ZI9A 1XKXA 4GC5A 1YTLA 3UMBA 4FYKA 2ASEA 3GEPA 2C4VA 1J07A 3DR5A 3ITEA 5AM2A 4CKXA 3MINB 1TM4E 5ALZA 1HE4A 3SJCA 4DNOA 3AB8A 4H6PA 3IELA 3U4AA 1NFRA 1DEAA 3K09A 3IUMA 4NJEB 3TRJA 3A1SA 3FXAA 1OYOA 4ZRMA 1KI7A 3CB2A 3WLLA 4ASUD 4Y67A 2VJOA 4Q3OA 1I0LA 2XXAB 1QSGA 2ICAA 1FNCA 1C1DB 1U4OA 1NVBA 5ALEA 2ORVA 3QUBA 4H7JA 3H75A 1IBKB 3M4JA 4V0SA 1QS0B 1UXIA 3IIMA 3LDGA 1YZUA 4OGLA 2QUBA 4ZT2A 1TCBA 3WGQA 4BNDB 1VLZA 1NL3A 1P60A 3RD5A 3KQQA 3HYTA 4MVCA 1ABFA 2RHLA 3DC7A 3H7AA 3PWKA 4BYGA 4Q34A 2BV3A 2AMJA 3MELA 3W8EA 3EUEA 2ZJ5A 3AHCA 1XPJA 1R0KA 2F4NA 2I4RA 3KXLA 5JJIA 1K6MA 3QKTA 1PDWA 4P0TA 4KRGA 4QEKA 1F17A 3BIFA 5BORA 4G2NA 1Y1RA 2MR6A 1F0PA 2BF4A 2HNAA 2VJLA 3NZEA 5JISA 4ZCRA 5K8TA 1VPEA 2D54A 3CT4A 3FKSA 5BPFA 1X7DA 1MX3A 3INTA 5C52B 1E3SA 1C4WA 1G4AE 3PDIA 1XTQA 3NVKI 1CRPA 2DM6A 3NO4A 2W58A 5G0UA 3STYA 2GKSA 1T6ZA 4IMPA 2Q9AA 2R85A 1GEEA 4QFDA 2X2PA 4TXMA 3T5MA 4FW8A 4B3DA 2X3UA 1K9VF 2PX6A 3LE8A 3RAEC 4ME6A 5AH0A 3ZU3A 3G0BA 1MRNA 2NZVG 1KBZA 1NVAA 5C18A 5HZMA 5LFAA 4NU5A 4I6GA 4GZ5A 2IBMA 2D2IA 2FX2A 1M74A 1PDOA 5KOYA 1O0CA 4PRLA 3JZAA 4DQKA 1K6XA 2C3MA 1JG2A 3D43A 5HA5A 1S3IA 5HF5A 4W9MC 2FMTA 4FYWA 2QM8A 1NQUA 2WU1A 2IS6A 3LFHA 3UFXB 4JBHA 1ZCAA 3I76A 4KXNA 1GZ4A 3LQQA 3RJZA 4ZDKA 1PGQA 4BMZA 5T3UA 3TIIA 1R27A 4M4SA 2QMEA 5CT5A 5F23A 5BW5A 3K6KA 4XIGS 1VHTA 3DGEC 3U3XA 1PQYA 1TMYA 2Q3CA 4H3SA 2JCBA 2V5UA 2Z8ZA 4QQRA 5AKJA 3E7PA 2O7VA 2VJDA 1KDVA 1CJTC 1LI5A 1HWYA 1FP1D 2VH5R 4N3NA 4X93A 1O08A 1XMXA 2ODWA 2Z95A 3AR4A 5TV2A 3T7CA 1TIBA 1XA0A 2DBVO 2JJ2D 5GJWC 2AQHA 2V7QA 4OHXA 1DL5A 1ZNWA 2O3RA 4R81A 1E7MA 4JUCA 4QT4A 2O05A 1RTTA 1SKYE 1WXHA 4HEQA 3ZGLA 1D0SA 1WG8A 1SQ0A 4D3YA 7REQB 3G49A 5LL6P 3ESBA 3LQ2A 4UKDA 1KSJA 3WGGA 1SQ6A 1TK3A 3NRBA 3TEJA 4AAYA 1HDYA 4LJ7A 2X9VA 2XMRA 3BQNB 4R0MA 1FZTA 1NY6A 3F8SA 3L92A 4HZGA 4K6CA 1WUJS 3OP4A 4KTVE 4QG7A 1CF9A 2WKQA 5DV9A 4LE0A 1W94A 4DM3A 3E2PA 4OGFA 4B6FA 5DHSA 1DOAA 5DEOA 4OU5A 4DJJA 2IXFA 4E30A 4ZYXA 2ZTVA 1UR5A 3OY2A 3MTEA 2WT9A 3EVBA 1BD3A 3SF0A 3T3MB 1R7RA 2CVHA 3SX2A 3ITDA 4HH3C 1KJWA 1DC5A 1AVTA 4S1NA 4CQJA 2PKCA 4FLEA 3CGGA 1XOIA 4X84A 4DYVA 5FLKA 4HUTA 4WGGA 4YPFA 4GKJB 4HDNB 1J7KA 5GIPE 2ZJ8A 1T10A 4KU4A 4Y18A 3V8BA 4L51A 3DT6A 1G1MA 4NEGA 2GASA 5HIIA 2JFGA 2A9JA 2EG9A 4OXYA 1XDWA 2IY7A 3VR6A 4W5OA 2X0IA 3PT5A 5HXAA 4YJKA 4JX9A 4A0QA 4MQ5A 2AMYA 2H1SA 3E1SA 3NT5A 6LDHA 3BMQB 4JLOA 3R3ZA 3QVLA 1AKVA 3V7FA 2BFCB 3KKKA 1NR5A 3SDSA 2I2WA 2GWRA 5HR5A 2DERA 3N0TA 1EJ6A 2XWSA 1GKYA 1T6YA 3MXOA 3B1YA 1V5IA 3ZJ4A 1XDSA 1EU1A 1RPNA 2Q2OA 3ESDA 4YAWA 1SRQA 3KSAC 1MQ8B 1G63A 5JCOA 2IITA 5B7GA 1M2KA 1NIPA 1VPTA 4DQUA 1ECPA 2QDXA 2D3TA 4IQFA 3ZQKA 4BNMA 3PWTA 4CM9A 1T1GA 1BKDR 1VC2A 4CIAA 4YP5A 1QRRA 1U02A 3G89A 4YMHA 1G5RA 1SGWA 4JP3A 1T5SA 3NHLA 1FLNA 1JT2A 3QSGA 4FS8A 3ERCA 3BCUA 3R6LA 3ZJ5A 1V3QE 4HXFB 4GS5A 1BGWA 2QN8A 3OQ1A 2QU8A 1V1JA 1YNSA 3FI9A 3ETGA 4KN6A 2VUSA 1FNDA 3OF3A 3L02A 4YRNA 3O94A 2MWMA 5BMOA 1XGKA 1XZCA 3M9XA 4M0UA 4K5QA 1YZVA 5T6BA 5IUNC 3CNEA 2CV1A 3I2FA 4IO1A 2SECE 3N05A 3PGKA 5G0SA 4AO6A 5BUCA 5JRZA 3G5AA 5K0CA 4DR4B 5G0WA 2NO0A 4X45A 1KQPA 2G63A 3WRWA 5BRAA 2CBZA 1VYHA 2HI0A 1PZNA 1HSOA 2WHPB 5FH9A 2CT8A 4IJ6A 5DYWA 4YRQA 1IIBA 4K3VA 1PZGA 3IEUA 4P34A 5AJUA 2YWFA 4DG5A 5J4LA 5JO0A 4W8OA 5HIAA 4DAOA 1T35A 2Z08A 3AV0B 1QG4A 5FJIA 2CYAA 5EUQB 1NXVA 3NNSA 2FDXA 2PM8A 4RTNA 1AUVA 3FF4A 4NWIA 4LWOA 4RDCA 3LPLA 3GRYA 3JAWB 1SXJB 4X1OA 1E79A 2PMBA 2ODTX 2VPXA 2AN3A 1PNVA 5JDCA 2V59A 3CC8A 4L4ZA 3D3EA 1NQ5A 1Y6ZA 1IN6A 2HHAA 2AG8A 2Q50A 3LH5A 5BT8A 4XWTA 3D0OA 2HTFA 2HIGA 3QHQA 4XEUA 3SQDA 2R44A 1WSDA 3DC2A 3LECA 2NSLA 3OUUA 4AY3A 2X6TA 2J9RA 4C4SA 4C29A 2HW8A 3MTJA 2P9FA 5CBPA 1K7YA 3K9NA 2YRFA 3D8NA 2DGDA 4N3AA 1L5OA 5FFNA 1RLIA 4C6HA 2D00A 5JAHA 2WA2A 3ADPA 5LLDA 2HN9A 1AMUA 3KPWA 3X2SA 5K0SA 3LP8A 3OCJA 2P4SA 2GMWA 3VH1A 3ZE9A 3O82A 1E5TA 1YR7A 3CG0A 3HVHA 5IT0A 4NENA 3VTZA 2O0HA 1JEEA 2OL4A 3JYHA 3MCUA 4M7WA 4DY6A 4ARIA 3BEOA 2BBOA 4ZXPA 1I9CA 5IUJC 4OQNA 3QE9Y 2JLQA 4GGPA 4OPMA 3RS5A 3PJRA 4I55A 1FMTA 1W7AA 4NCAA 2QBYB 4GM4A 4LYYA 1LA2A 3A7EA 3UOGA 3WJAA 1PAUA 5HNKA 1LBIA 5H80A 2Q46A 5LUAA 3HEBA 4BOYA 3HJBA 3U4GA 3EEFA 1UJ2A 3N5KA 3TZQA 4YNBA 1C81A 4R5HA 3I0MA 3MIIA 2YW9A 5H68A 3FSJX 4U7GA 3GZNA 3DBRB 4DLSA 1AY0A 2QRNA 3IT2A 2NPIA 3H3JA 4S35A 4EGFA 2B9EA 4DCCA 3NAZA 3J81k 3KE8A 1FNSA 1H1DA 2WFZA 1UT8A 1TYDE 4TMTA 1L7MA 1PG2A 4YH1A 5KC9A 3GLHB 3OQMA 2IODA 5CYPA 3AL2A 1KJ9A 2FSFA 1NMZA 1CJBA 2YWRA 3CX7A 5J2UA 4RM3A 4QO7A 4DWOA 5BVGB 3INRA 1DAOA 4JL8A 3W8DA 3WRXA 2VSYA 2WB4A 1T43A 4W8HA 5CVCA 3V2IA 1IZZA 3U7FB 2CFCA 4O1MA 1Y3CE 1FQJA 1RIIA 3EUWA 3DE4X 3GEGA 4FE4A 4R8KA 4HC4A 1SWWA 5AO9A 5EFOA 5FLEX 2X77A 3FZYA 1P3Y1 4U2KA 3TSOA 5F7OA 1TF5A 3WB2A 5IT9A 1CG6A 2PVPA 5CCBA 4CV1A 2A1IA 3D7LA 1YWGO 4JBIA 1U0JA 5KQMA 4MB6A 5IDQA 4G81A 4RQUA 4HBGA 3NETA 4UZEA 3TCNA 5F3RA 1YA8A 4UFOA 2O8FA 2J5KA 3N6XA 2E4XA 3UAZA 4IH1A 2DLCX 1T5TA 3W77A 1FYDA 3FNRA 1AHPA 2O6LA 4G1MB 1ESNA 3UVEA 1GQFA 1U5BB 2C9CA 4MRMA 4MYTA 4YJ3B 3C3JA 3P9QA 4QYWA 1GNSA 2OQIA 1S4QA 2IVZA 1K0FA 5E8RA 5ECWA 1XTVA 3SBOA 3FNHA 4K86A 4YS6A 3BWXA 3NJRA 3KZNA 3BXXA 1W0CA 4K46A 4J0GA 3O8CA 2Y1XA 1VBMA 4D0GA 1N0IA 4JQOA 4JI4B 1X7ZB 3DZKA 4NFHA 2XUZA 2BGLA 1TTTA 1JAYA 4M86A 3ZIUA 2XB9A 2OK7A 4DT1A 1LSSA 1UAYA 4GP7A 1MB2A 3QHPA 3PXDA 1KY4A 1NA5A 4CIDA 4UNRA 4OB6A 4QJ5A 3SN6A 3E5NA 1L5YA 4CFYA 4OHBA 2FW7A 3OJLA 3ZHXA 1E6MA 2LUOA 4CT5A 3DBOB 4LHYA 3F6YA 4LHXA 3WNZA 1KGSA 4DGSA 3UHAA 4OHCA 1ZH0A 1XXHA 4LJKA 5SY4A 2FG5A 1KYTA 3EH1A 4YRMA 4BWVA 1L1QA 2YY7A 4WJLA 2TSYB 5KNBD 3KJNA 4Z7JA 2UYCA 2EKBA 2V6JA 4FYYA 4RQBA 3OF2A 4N3BA 3QU7A 2RSLA 1NP3A 2JDID 1U2RA 3D0KA 4JLBA 3V7NA 1GITA 1OWMA 1FX1A 1SUWA 1KBOA 1U90A 2GZ3A 3OPYI 3S2EA 1SULA 3V3KA 4E5YA 5K99A 3IV9A 1QPGA 2JIDA 5JAUA 1Z33A 2C84A 5DO9A 3W5VA 2JLUA 3LHFA 4NICA 1QZZA 4ZVTA 2OK8A 1NBIA 1I30A 4Z1MA 5AHOA 2ZJ7A 4TS9A 2J5RA 3LUFA 4Y1RB 2PXAA 3TQIA 1XB2A 5G4LA 3RTGA 5HJ5A 4LOAA 3LQFA 1J21A 3QPAA 2O57A 1Z5NA 3B8EA 1C8VB 3AJDA 3LD9A 4M8NE 3VH2A 2UUCB 2QLJA 1L4GA 1TYZA 3HHPA 3A58B 3U4CA 1WIWA 2XZPA 4OAOA 3TNFA 4BTLA 2HIMA 5AIBA 5GJBA 3WLEA 1I9GA 3VPSA 4EM6A 3IR7A 2WVAA 2Z4TA 1G8PA 1YJQA 2ZR8A 1U8FO 3NWPA 2PGLA 3KKOA 4FN4A 5EMMA 2IWHA 3WYAA 4D96A 4G1EB 2HRQA 2HWKA 1JPVA 4L4UA 2QXUA 5BOVA 5BN5B 5JZBA 1Z8HA 4YI5A 1OXMA 1XKLA 4N6OA 3PBKA 4R6WA 5AESA 3PF8A 1VDMA 5GV8A 4CHGA 1AUOA 2ZRMA 5HVNA 4BJ1A 2QRZA 1PDVA 2YJ5A 5SICE 3HADA 4GQBA 4AC9A 2WSIA 4OI0A 4TS3A 1N5DA 3FR8A 4DKXA 3TPZA 4FOLA 4ZI7A 1AQIA 2ODPA 5KIAA 2BFOA 4MPPA 3LTNC 3JWGA 4AECA 2FX3A 1AKRA 4NBNA 2RHCA 3AU9A 1YSCA 2I7DA 4HNSA 3VVMA 4MHTA 5B2EA 2BR4A 3OTQA 2ZIZA 3UB4A 2VNJA 1Z5UA 4H1UA 4ZT4A 3GLGA 1N34B 3U44A 1HT1E 3ONWA 4IDOA 4JWTA 4PG4A 4JXXA 4GLLA 3B1FA 1HDXA 3QV2A 3GLQA 4ZARA 1NMXA 3TIGA 1GZ6A 2ARKA 5DJ5A 1NDQA 4ZAWA 1L5HA 3C5VA 1G4UR 5CEEA 5ED4A 2RGCA 3ZUPA 2PKQP 4F6LA 1K5PA 2NTYC 2BFDB 5HJ2A 1OZGA 2PH1A 3IKJA 4J6FA 1JFVA 3A7DA 1FFXB 5CNKA 4BUZA 3BVPA 2OM6A 3MWFA 1W4RA 821PA 2O23A 3W6OA 2VZEA 1LJUA 4UTOA 2QDKA 3VKHA 3T1YB 1RHKA 1VKJA 1YA4A 2ZKIA 4UM9B 4EG6A 1Y8ZA 4DS3A 2VK1A 4BMPB 5AJXA 1QX4A 2HREA 2XVXA 3O8OA 4G5OA 2AKYA 3QW2A 4HNTA 4X63A 4C0LA 3MJTA 2DHQA 1PEAA 4DA6A 3LS2A 4KI7A 1E3IA 2W6ZA 4Y3UA 2VFAA 4TWJA 4B48A 4RTJA 2W6IA 4PAOA 3TRDA 1VPLA 2Q0XA 4MLCA 3UH0A 5ENVA 1UFVA 4X64B 1XHLA 4DHEA 3F4LA 4GPEA 2OBXA 1Z47A 3K8OE 3K20A 5FO1A 2JHFA 4GKAA 5F9HA 3A6DA 1M1YE 1AN0A 1PVDA 4EITA 1KMCA 5DLPA 1SOUA 1A9OA 4JLAA 1E2LA 1P0CA 1GTL1 4I19A 3G82C 4YRRA 4CL3A 3DEHA 4YRBA 2A1TR 2D1TA 3GO4A 2X9QA 3QXCA 4IIJB 3CVJA 1GPDG 2OBFA 1EQUA 2WZCA 2Z9BA 1FFHA 1VKZA 3CNLA 3QBEA 4CN9A 1CRWG 2CVZA 4G41A 4AP5A 3H1TA 4I5DA 3GD5A 5DKFA 4FILA 3IQFA 4IZIA 1EG7A 4P3YA 2SHKA 1Z0ZA 4B2IA 4ZCQA 4MDEA 2VZ8A 5JE8A 1EE9A 2PG3A 16PKA 1CNMA 5D3QA 2IKSA 1VZ3A 1D7OA 2PUAA 4RHTA 4E09A 3PQ7A 1BHO1 3SOZA 4QUHA 3B36A 3LRTA 3TNDA 5JFGA 2H2GA 1M1ZA 2ZCUA 3T38A 3VDNB 3VC1A 1DCMA 3KHKA 4TLAA 4MW1A 5HZKA 4K0KB 1Y81A 2VHXA 3H4TA 1XQVA 2AUMA 2GEDA 4C7JA 3QE2A 2E4WA 3ECSA 3U60B 1Y9DA 2QPLA 1IQPA 5BQ3A 3UUWA 2ZIXB 2E2WA 4HDRB 4L28A 4OFXA 1SU4A 4O4IA 4OK6A 3UKOA 2AEEA 2SKEA 3WO1A 4K05A 2A6PA 3MJRA 3TQFA 1N0VC 1I0IA 3MWKA 1LDYA 4L16A 3ZV6A 5JAMA 4ZAXA 3W3AA 4WCDA 1G21A 5GV7A 4EL5A 1Y48E 2C4KA 4RVNA 2WWHA 4QVIA 3K70C 5E9QA 3UO8B 3V97A 1E9BA 2XAUA 4RX1A 1R8XA 2Q99A 2X3FA 4WOPA 1E6CA 4ZOLB 1K7CA 5EERA 3BMOA 5AT1A 5LBTA 3LCRA 1E58A 2DWOA 4WZBB 5BSVA 3D31A 5JD6A 3PXUA 4CIXA 4IJKA 3C6ZA 5JNWA 2NU8B 1N7HA 2JIZA 3OHMA 1E2UA 3NDJA 1XF1A 1W4LA 2E6UX 4P86A 3ZV3A 3EASA 2IFTA 1Y7IA 3DDSA 3VZPA 4TVKA 3FTCA 2MSWA 2VCEA 3IAFA 2BJWA 4K87A 1DO8A 1AZTA 3RADC 4F2GA 1K3FA 1L7AA 1U7HA 2IEDA 2LIVA 4HLUA 3OZVA 3IO5A 4HTAA 4LSWA 4NCHA 5D1NA 4ZKDA 4CL8A 4FJ0A 1HM5A 5EP2A 1X3LA 2F43B 4RADA 2BGGA 1USUA 3OCZA 2HLPA 2W48A 3R0QA 3C87A 3L07A 2AX3A 3W5BA 3KAPA 3PVSA 3U1VA 3SGLA 1XZBA 3O8LA 3ZZ0A 5KREA 3MJ4A 5IHPA 1RJ9A 4Q1DA 4D9GA 4L4RA 4KJZA 3V8QA 3R5SA 4Z4QA 2G0AA 2Z58A 2D5IA 3NC0C 5FDFA 1YJAA 3IPRA 3OM8A 1SG9A 1AO3A 4BNNA 2VHJA 5ERXA 1IN5A 2GZRA 4TLEA 3HEMA 3EBLA 3MLAA 1URPA 4NH4A 5C4IA 2OPBA 3GGJA 2ZUDA 4HDSB 4XSHA 1DPGA 3NUQA 5DZSA 4X6XA 2PFKA 3RVDA 4Z6KA 5K05A 3RIEA 1KZ7B 3G2HA 5B7QA 1I2DA 5IHXA 2ZZKA 5ICSA 3FDZB 4INAA 4ZQCB 2EEPA 5HBRA 4G1VA 1WCXA 2K6GA 4MB0A 1NF9A 1XVVA 3L84A 4U7PB 4UARA 5BSRA 5IRCD 5FUXA 1E7RA 2O8CB 3PV0A 1D0VA 2CHEA 2DOKA 3GH3A 4UJ5A 3QU9A 4PG8A 3A6PC 1A4UA 4YV0A 5K0NA 1L5KA 5B58C 2ZSJA 3PPIA 4P3KA 2XF2A 4OXNA 1W75A 2OBNA 2ZSBA 4QQNA 4JX8A 3UAVA 4GOMD 5TMBA 3TCKA 5AW2A 3A32A 3ICEA 3OLCX 3W2TA 4U3JB 2E85A 2D0IA 1RBQA 3PFWO 2FETA 4P5DA 3THWB 3NTVA 4CNBA 1JVBA 3E4CA 3ZCQA 4EHKA 2IF2A 4ROTA 3L7AA 2D1SA 4MUGA 1SD2A 1G1AA 4LXQA 2X7HA 4DXHA 3QOWA 3TI9A 3ZLJA 1NUAA 1UMKA 2BHNA 1G98A 3IBCA 3O7MA 1IE3A 4MVXA 3TTSA 2DHCA 2YNMD 1UK6A 1RS0A 4B4WA 3OLYA 3RYIA 1ZEMA 3RBXA 1LNSA 5MN6A 4BJ6A 3AVQA 3PL5A 1Z0FA 1WHTA 3GAZA 4F7WA 3O3NB 3LPAA 4OQFA 5EAIA 2PUBA 1IBLB 2OLEA 4HLCA 1YB2A 4AVYA 3PXGA 1FB5A 4I14A 4JB2A 3F3MA 5PGMA 4I4NA 1RHUA 4JLSA 4DY4A 5JLJA 3IMKA 1Q7BA 2ORED 1XP8A 4AJ2A 3DVRX 1NNEA 1LPOA 4DAEA 1XT6A 1KERA 2AD1A 1C0IA 2BISA 1ZIYA 3DKVA 2QVGA 4R0NA 3MXTA 4ZGBA 5JPIA 1W34A 5THKA 3E22B 2PMCA 2OHJA 3RFCA 4EKIA 4AKEA 5IYZA 2RGGA 1X1CA 2HRZA 1YIOA 2YC2C 3EQZA 3MA0A 3A6LA 3RTAA 1AV7A 5TQ0B 2O7NA 2BI4A 3GJZA 3L6DA 4CHTA 2J87A 5F78A 2CEKA 2DECA 2XB8A 1A4XA 2GYVA 2YICA 4TTVA 2C8JA 4PYNA 1JN0A 2PXCA 2FEWB 4M8IA 1JR3A 3NHPA 2GS9A 5F64A 5B37A 4WZAB 2QORA 4K9DA 5H9VA 4JBLA 1HBJA 2OCYC 2JJ2A 3FYCA 3KYJB 3W90A 5EHXA 3X1JA 3BWEA 1QS0A 2A0FA 3WIVA 2TMKA 1ZCZA 3WYGA 1SQFA 4ZEMA 1J8QA 3QU4A 4J1TC 2OGUA 1U0OC 3JQ9A 4Y2QA 1P2UA 5HF6A 3RHFA 2VTEA 4BMSA 5M34A 1GTSA 4UE3S 1MJNA 1Y9ZA 3TVYA 3D4NA 4PZEA 1S8NA 1SOMA 5IJ0B 2R96A 3MJVA 1NLUA 1R4ZA 3QYJA 4O4HA 3QTBA 3RSOA 3I92A 3ZBQA 4K6MA 4MPDA 1NASA 4L0QA 3LKVA 2FNAA 1M8GA 2PKQO 3LZ6A 4HNAA 2PV7A 3FMPB 3FHOA 4FBLA 3G7UA 2ZUTA 3C3MA 3KZ1E 5DT9A 4DE5A 5JEDA 1M2WA 1QB8A 4F97A 3IAS1 3H3XA 4G26A 3OFKA 4E51A 4BLOA 5BNWA 2KB0A 4G8BA 4BRSA 3PDIB 3FFWA 1L4HA 3MT8A 4XYGA 5KVQA 5HRAA 2P4EA 2RB5A 3I9MA 4RF2A 5JVDA 2M6RA 3ZX4A 4CMJA 1NW4A 1MBZA 1IXRC 1FS4A 3LVQE 4N3CA 4Y2VA 2JASA 1IATA 1Z0DA 5KAPA 2EX0A 3AHGA 2FAXA 4JP5A 1E2FA 4TM7A 2YMMA 4F1WA 1WKBA 2WMNB 3ZZTA 2YXNA 5A04A 5MF6A 1K4MA 4BEJA 5GADl 2NTJA 2F1KA 5KYWB 4Q7EA 1QE5A 4KE6A 1L3BA 4IHJF 4V1CB 4GPD1 4NCIA 3KQMA 5H9WA 2FPXA 1O0BA 3T12A 1CXZA 4GPBA 2Y1OA 4M1SA 2WIAA 4IDNA 5J3JA 1JP7A 1KY5A 1YE8A 3KO8A 3OEED 4TKZA 4IGKA 2XZDA 4MV1A 3OFSA 5B3JA 4FQ5A 1T6XA 3V8EA 1X7YA 1XZFA 2XVZA 3EVTA 2WKSA 3CR7A 4MVJA 3O90A 2CLSA 3R9XA 1QGED 4KXLA 4EYKA 2Q2QA 2ZDQA 2HU5A 4RHYA 5LUBA 4CF7A 3AHIA 2IHTA 1E20A 1SRRA 1T4MA 1K75A 1OBCA 2QLFA 2FZ5A 1YBHA 4DLUA 4LXTA 3TOSA 1ZM4A 3TTTA 5BW8A 2GM5A 3TXYA 4B1FA 3CW8X 1YJCA 5KSOA 2G25A 2DRIA 3HA5A 1KOJA 2ZTHA 3ZK8A 4AIIA 2PLWA 3LBYA 2W8ZA 4GL4A 4E2ZA 1B2LA 1QH8B 4BKMA 3PUJA 4LSGA 2IF0A 1B1AA 1AGYA 2QGNA 5EJ7A 1ISHA 2VNSA 1P7VA 4YP1A 2PL5A 4X3CA 5DBEX 3IHLA 4P7GA 3K09C 1KYVA 3NT4A 2EJTA 1JDTA 1JLRA 3GJ0A 3LQ4A 3USCS 5IZ4A 4BCCA 1EM8A 1LTQA 3CLVA 5FBLB 5EQJB 3TMYA 4QXMA 3L7IA 2O6HA 5F77A 2CKDA 1ODKA 1VIYA 1SXJE 4O4JA 1KVQA 4UEJA 2J3LA 3JQ8B 3DMGA 5LYYA 4YAJA 4KDFA 4S0ZA 4YMGA 2AYYA 4Y0AA 2ZE8A 1YT5A 5TPWB 2W6ID 1U8AA 3DUWA 3K0FB 3GU3A 3TN7A 5IM4A 1FK8A 1EUDA 2IE0A 2ILTA 2E21A 2B6NA 3IQDB 3PDJA 3R44A 1WMSA 1OI3A 2H4FA 1WSWA 1WVIA 4NJOA 2VKTA 1PEYA 1L6RA 4JJEA 2K4MA 3Q1LA 1U63A 1P39A 4RMHA 1KZ1A 4B4VA 4CMEA 4YR7A 5IP5A 2REQB 3NIWA 4IFEA 3JW8A 5ALMA 1E0JA 1XEWY 2HUPA 3BXZA 5FR1A 1B1CA 2P77A 3IYLW 4ALLA 2W90A 3G8AA 4REQA 4PLPA 1TO2E 2JLSA 1GLNA 1U31A 1W0JD 4ENTA 5K0JA 1KK0A 5EJ6A 3HM9A 1R0CA 4XQ9A 2ZSKA 4OBBA 1T8UA 4Q7MB 4BNIA 3DE1X 1HTTA 1YKGA 1LBSA 2ZBGA 1ZM9A 1PS0A 9ABPA 4KYVA 4P6VF 5EJ8A 4RY2A 3G13A 1I1HA 2GJ8A 3GFVA 1ISFA 2WWVD 3WYCA 3KUKA 3R6WA 1LX6A 2ZGVA 1RADA 5E4FA 1J25A 2WYUA 3FDFA 1TYBE 1T8PA 2ZAMA 3FPCA 3R6GA 1RJDA 4JUBA 1FZQA 2XSZA 4B6EA 4F06A 2RJ3A 2ZKLA 3U16A 3L41A 2C57A 1QE0A 2I4IA 3A4LA 4HAWA 1ZJJA 5ED0A 1F7UA 4UM7A 4HUJA 4OMCA 3N8IA 4WTOA 1XDBA 4UC0A 3M6MD 1MV5A 3ABIA 4K9SA 2VTKA 5C3MA 3A4TA 4PM4A