3L92A

Phosphopantetheine adenylyltransferase from yersinia pestis complexed with coenzyme a.
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
159
structure length
159
Chain Sequence
b'MITKAIYPGTFDPITNGHLDLVTRASAMFSHVILAIADSSSKKPMFTLDERVALAKKVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLANMNRHLMPKLESVFLIPSEKWSFISSSLVKEVARHGGDITPFLPKPVTKALLAKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis.
rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 58
structure length 159
sequence length 159
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3l92A00
4K03A 1OWNA 5DEOA 1JECA 2NSYA 4DLPA 1RQGA 2D5BA 2VTBB 2TS1A 4GRIA 1O96B 1ULHA 3COZA 1LI7A 3C8ZA 3OP1A 4OJMX 5HUHA 3CVVA 2J4DA 1R6XA 1H3NA 2GM3A 1JEEA 5TEWA 2DEUA 1NZJA 1N78A 3GMIA 1QTQA 2CV1A 1D2RA 4NX2A 1J21A 3PNYA 1FYDA 1TYDE 3ISJA 5H7XA 1M8FA 1VLHA 3P0HA 1CT9A 1F9AA 2PFSA 3N2YA 3I05A 2J07A 2H29A 1KAMA 1O0CA 4MWCA 3Q10A 1MAUA 1J1UA 4XSVA 2A1UB 2D13A 1OWLA 2E21A 1WQ4A 3KT0A 5FO1A 5KHAA 4ZCPA 2YWCA 1IQRA 2XRZA 5FO0A 2YWBA 1N2EA 1OWPA 4YBRA 3AFHA 1N77A 1N2OA 1H1TA 1M8GA 1QJCA 1KAQA 3K32A 3QTTA 3CLUD 1XNHA 1IQUA 2QUIA 1EXDA 1TYAE 4ZCSA 2WQ7A 4EG6A 1O95D 3MXTA 3FDXA 1F7UA 2RD2A 3CLTC 5KCMA 1Q15A 1PFVA 1ZH6A 2JANA 2A1TR 3ZXSA 3CVWA 3IVGA 1N2GA 1N3LA 1X8XA 4ZCRA 2OV4A 1EUYA 4JZYA 5LM3A 2AKEA 1U3DA 2ZP1A 2CV2A 4U63A 2DUMA 3QTBA 3N9IA 3CLSD 4YMIA 2BTEA 4WNYA 4Q16A 4MVYA 1YIDA 1M1ZA 1IH8A 3AG6A 3SDBA 3COVA 2QJTA 4MWDA 3TNJA 5J59A 3CVXA 4CT0A 1QU3A 4TS1A 3NBAA 2DPLA 1N1DA 3HL4A 5K0SA 1WOYA 4QBTA 2RE8A 4JXXA 1PFWA 4MUNA 4PBSA 3ZUGA 3F3MA 3MMXA 1NYLA 4PBRA 1JGTA 3D6UA 3COWA 2A1TS 3MLAA 4AS1A 3H97A 1QQTA 4JFAA 4XFDA 3ZJUA 1YUNA 3PNVA 1NP7A 3LOQA 3FHJA 5EKDA 1OWMA 1WY5A 1O6BA 3FWKA 1BS2A 2R5WA 5DK4A 3E27A 1PG0A 3A05A 4MW5A 3AIIA 1NUQA 2XRYA 4MUEA 2NZ2A 3TZEA 2C5SA 1QRTA 1TYCA 1U7XA 2JAXA 4NAHA 1OBHA 4ARCA 1M8JA 4R0NA 1JHDA 4AQ7A 1QU2A 4HJRA 1NUUA 1GTRA 1NUTA 3CLUC 3RJZA 4ZCTA 2GKSA 4E1AA 1FFYA 3NBKA 4XFJA 1N75A 1ZH0A 2WQ6A 1O95C 1PG2A 1K4KA 1GTSA 3AKZA 2DXIA 1NURA 1O94D 1KP2A 2BYTA 1YI8A 1R6TA 3UY4A 1U7DA 1WXIA 1WQ3A 2X1LA 3INNA 3RBAA 2HGZA 1G8HA 3CVYA 4NATA 4F3RA 3ND5A 1N2HA 4MW2A 2DLCX 1MJHA 4ZT7A 4EG5A 4I6GA 2A1UA 3H9CA 2A7XA 2IELA 4MW6A 4UZEA 3LCJA 3MLBA 2DETA 3HMQA 5F23A 1COZA 3LE8A 3IOCA 1M83A 4DNXA 1OWOA 4DJAA 3CLSC 4I6JA 1K92A 1JIKA 3GUZA 1Q77A 2O5RA 1H3EA 5BNZA 1JEDA 3ZGZA 4EG7A 1JILA 3HV0A 4KR6A 1UFVA 3TZLA 4MUJA 3KT3A 4MWEA 1ZJWA 4JXZA 3UOWA 1K97A 4PBTA 1Q19A 3Q4GA 4BWVA 3IVCA 1MAWA 4P2BA 1I6LA 3FY4A 2IP1A 4EG1A 5HUJA 1G8FA 2CYAA 4KPUB 4MW9A 1QRUA 4UZFA 4EFKA 4MW7A 1YULA 5HG0A 4MUKA 2D54A 3BL5A 5TS2A 3N8HA 2E0IA 2EJCA 4ZT3A 1IFXA 4OUDB 4G5YA 4QRDA 1KP3A 4FZJA 4R2MA 4H3SA 4Q93A 5AHWA 1SURA 1T6ZA 2CV0A 3AL0C 1IHOA 3P52A 3TQIA 4EF6A 1MB9A 1WXEA 3A4IA 2PG3A 3DV2A 4KR9A 2V0CA 3G59A 1EFVA 2H2AA 4ZT5A 4U8HA 4ARIA 2ZUEA 1GN8A 1QRSA 3HZRA 1J1ZA 3ND6A 4HK4A 4CDMA 4ZT4A 1WXHA 3DLAA 4NDAA 1EFVB 3SYTA 3SZGA 1DNPA 1EJ2A 1O0BA 3PXUA 1MC1A 4HJXA 1YUMA 1O97D 2YXNA 2QTNA 1I2DA 4MVWA 3X1JA 4L2IB 3SP1A 1EUQA 1O5TA 2VXOA 1VBKA 1MOPA 4MVXA 3FIUA 3GLVA 2E89A 4MW1A 4MW0A 1EFPB 4DDMA 3X1MA 3HGMA 2QTRA 1JIJA 2OQ2A 2PZAA 5IHXA 3KFLA 1TFUA 2QJFA 4MW4A 3KT8A 3DO8A 4EGAA 1KORA 3RK0A 1XNJA 4GU5A 1U3CA 3G6KA 1TEZA 1KH1A 3VGJA 1NUSA 3RK1A 3FETA 1JIIA 1V8FA 4X0EA 1H3FA 3MUEA 3VRHA 2QJOA 2CYCA 2CYBA 3CLTD 1T9GR 1KQNA 5TEVA 3IODA 4EG3A 4J76A 5H16A 4J75A 4YP5A 3CVUA 1X6VA 1B6TA 3DPIA 4HPWA 3IOBA 3PNBA 1PFYA 3OTWA 1GZUA 4DDHA 4MUHA 3TS1A 2J08A 4MAFA 1K4MA 4MUFA 2EL7A 4G5FA 3X1KA 3ZJTA 4S1OA 1TYBE 1PFUA 4QREA 2AZXA 3L93A 4R2LA 1KQOA 1A8HA 2A88A 2E18A 5DB4A 3IDFA 1NI5A 1WXGA 3P0JA 1HYBA 1IVSA 3AG5A 2ZUFA 1WKBA 3FOCA 3H9BA 2PXHA 1VBNA 2AG6A 4U7JA 5JBNA 1F7VA 4CQNA 1G8GA 4ZT6A 1N2IA 2A86A 3ELBA 4MWBA 5K0TA 2J5BA 4G6ZA 2QUKA 2V0GA 3CA8A 4JYZA 3ZXIA 1T9GS 4EG8A 1EE1A 3CLRD 4K0RA 4YP7A 3SEQA 3H05A 3IMGA 2CUZA 2WSIA 3D6VA 3N05A 4KPUA 1I6KA 2WB2A 1O97C 2QUHA 1WXFA 4MULA 1KQPA 1KH3A 1N2JA 1WJGA 1GLNA 4KKVA 2B7LA 3RHSA 1KR2A 1I6MA 2IJGX 4OUDA 3P0IA 1KH2A 2A84A 1KKUA 3SZ3A 4NAUA 1J20A 2HMAA 1S4MA 3A2KA 1YIAA 1J09A 2PIDA 3CR8A 2G36A 3UK2A 3FH0A 3PRHA 1TQ8A 2YY5A 3JXEA 3IUBA 4MVCA 3S3TA 3ILVA 1T6XA 3IH5A 3VU8A 1T6YA 1GAXA 3M5WA 4YP6A 5KWVA 3NV7A 4F4HA 1MRZA 3IMEA 1P7PA 1VL2A 3UMVA 1Q11A 4ZT2A 4ZCQA 3FNRA 2HZ7A 1WZ2A 1VBMA 2GOYA 4MUGA 2DERA 4EG4A 3IUEA 4RUKA 1NSYA 3TQOA 1JZSA 4L2IA 2QTMA 2QUJA 2Z3VA 5DASA 4ND7A 1MBZA 3HFJA 4MLPA 1IQ0A 2X3FA 1R6UA 3H99A 2A4MA 1JMVA 1MB2A 1O94C 3IMCA 3IVXA 1J70A 3KT6A 1ZUNA 1EFPA 1Y42X 4I6EA 5IJXA 2X0KA 2O8VA 4ND6A 1OBCA 4MQ6A 3COYA 3ND7A 2PZ8A 1ILEA 1U0BB 3RFFA 5FNZA 1N2BA 1V47A 1LW7A 2Z09A 4DE5A 2DR2A 1XNGA 1LI5A 3ZIUA 4PY2A 5J5AA 3QE4A 3FG9A 5TGTA 2Z08A 3L92A 2I1LA 2CT8A 3U1VA 3ZJVA 5LLTA 2J09A 1OD6A 3CLRC 4A91A 4KR7A 2X1MA 1JZQA 1M8PA 2CSXA 4DDKA 3FI0A 1M8KA 4NZPA 1F4LA 3Q12A 1GPMA 1G59A 3A04A 4MUIA 4WSOA 5LFAA 2JA2A 3IOEA 2PZBA 3K9WA 2CFOA 4CDNA 2VTBA 1IRXA 3SEZA 1QNFA 3UC5A 1XJQA 3G5AA 1O96A 1NUPA 4RPIA 5J58A
chains in the Genus database with same CATH superfamily
4O2AB 3WJ7A 1JLSA 3V1YA 2G1AA 4ZYYA 1TTPB 4URHA 1GZ6A 1XZFA 2X3YA 4Z2YA 5IVKA 1LWOA 2AW3A 2BMJA 3T94A 1DT5A 1CQZA 1M34A 4B6PA 4DGSA 2P69A 5K3OA 4LOHA 5LQAA 3WDLA 4A6XA 2DWOA 1QZXA 3DTVA 2R65A 4LI3X 2RH4A 1YBMA 5AJYA 3VSCA 2DULA 5I9NA 3FVTA 4GC5A 1GM5A 1F5SA 4GLLA 4GP6A 4UVDA 5SY4A 1ELOA 4K6KA 1ABEA 4CKBB 3K0EA 3S5UA 5L40A 4BMZA 3UMMA 1GZHB 1SVKA 3ON5A 4AZSA 2H59A 4PNEA 1PZXA 2P3SA 5CLJA 1Y7TA 3UXYA 1KC3A 3TLJA 2CV1A 3FPSA 2BTQB 2P2SA 2P75A 3HXMA 1J21A 2ZUTA 5I4BA 2R8PA 4FYWA 3OF2A 4JBNA 4JEMA 2GB4A 5KINB 2IOFA 4JHLA 2VDLB 4GGOA 3RTEA 4OB7A 4UMDA 3DFMA 3H86A 5CR9A 1OI3A 3MWKA 5F1KA 4HH1A 4AB1A 4JLVA 4A8PA 4XASA 4ZAVA 5FUWA 1NHGA 2AOWA 1N8NA 4YLYA 1SOVA 5B58C 3MHTA 4KSCA 4UHFA 1RABA 1S1CA 3QUAA 4HWKA 3S2YA 2GTHA 1VKJA 1XP8A 2JBWA 3B6MA 5FO1A 4DDUA 2XRZA 2R9VA 1V5WA 3OIUA 5FI3A 3RIGA 4YBRA 1DEHA 5MN5A 1Z37A 4DOMA 3SMVA 2D1YA 3RIYA 4K1LA 3T1QA 3WAGA 1I9GA 4HQOA 3OQNA 4ZJYA 821PA 1WIWA 4A0RA 4XJSA 3D6FA 3PVCA 3I1FA 4QE3A 1CR6A 4RS4A 521PA 3VPSA 4CQLB 1Q74A 4LMAA 4A73A 4B4DA 4D9MA 4RPCA 4RO0A 1N6KA 1Y3CE 2IBMA 2OEPA 3QLTA 1E89A 2E4YA 2GEVA 2WW8A 3Q41A 4IQGA 4MV9A 4N9WA 3ROXA 3CLTC 5KTPA 3L07A 2FMIA 1IU9A 1SEPA 4QFDA 4QXQA 5IF3A 1Q15A 4QGBA 1TVKA 3EXHB 5FOVA 2ADFA 2HLNA 4CIVA 5A5EA 4QBFA 1MMFB 3HCRA 1EWTA 3O8RA 3AK4A 3G0DA 2VF2A 2WM9B 3K2QA 3B70A 1U9IC 1MNQA 1NR7A 3IPYA 3KB1A 2OHVA 5E7IA 5EY5B 3LCUA 3GIDA 3IRVA 2G9QA 5LB4A 3MELA 3P2OA 2WIGA 4FDTA 5EESA 1E7YA 2BHSA 2LBPA 2O2XA 4RD1A 3MGCA 4IILA 5DEIA 5I9BA 2H52A 4I81A 3OY7A 3SS7X 5CK4A 1L8LA 1E2MA 1FJHA 1US8A 2PX8A 3KJNA 2WWVD 1PU2A 4ENVA 3B60A 3BMQA 3N6XA 2VPIA 4RJTA 3KWFA 5DGXA 1XLTC 1PT6A 5EKUA 1E1RD 1Q3KA 4HEA1 3Q3VA 2A5LA 2GF0A 4XQ9A 3AG6A 1G8SA 3W9UA 1WZEA 2OGUA 3FDFA 2NV2B 2O8CA 2Q8PA 3BMQB 1NWCA 1QIMA 5B36A 5HR5A 2VCEA 1SBQA 3QY0A 1S7GA 1F8UA 4K6CA 2WNHA 4UM8B 4QUGA 1ZK4A 2ECKA 3ZOZA 5A9RA 3NBAA 1JQ3A 1CJCA 2H1IA 1H93A 2W0MA 4A3SA 3MOIA 2QRVA 3KEGA 2XMSA 3FW1A 1QHFA 1JFTA 3PBKA 4U02A 2X8BA 5FLYA 5HTKA 1NYLA 1ODSA 2IYVA 2VT7A 1ECLA 3FHCB 4A26A 3FROA 2DSNA 3AJAA 3P9YA 3KOWA 5MF6A 4JLNA 1P44A 3CW8X 3TMAA 3ANSA 5K7SA 1SWWA 3OZFA 3RJTA 5KHOC 4FHDA 4IIYA 1CE8A 4DV5B 1RXWA 3GYBA 1T1RA 3B38A 1FTSA 3VO9A 1EGMB 1PGPA 4FFNA 4EMBA 3ZW8A 4LJRA 1UC9A 3L8YA 3VMFA 2JZOA 1OYOA 3N7UA 3DQZA 5J2UA 4H7PA 1DAHA 4DW8A 1XTIA 4HZUA 2J3LA 4FGSA 4Q02A 5C35A 1CE8B 2P5SA 4TMVA 4AFNA 2NZ2A 1YB4A 2AOUA 1DRVA 3H8JA 3RVKA 3SQMA 3BMCA 1QHYA 3OBIA 3EG5A 1THZA 2DY0A 4MQUA 5AICA 4WLEA 3ELUA 3WGYA 5B30A 4ARCA 4G0XA 2EX0A 4FSDA 4XGKA 4CUJA 5HRUA 4AQ7A 4HZUB 5AW0A 2P2YA 1IB0A 3WWPA 4EHIA 3ILHA 1N2CE 4XI9A 2WFMA 4UEJA 4EVRA 2V8BA 2VJCA 3BMCB 5B3LA 3W4IA 5L3SB 1FFYA 1U8AA 1KSJA 3TUZC 2ZR7A 2COUA 1EVKA 3Q7TA 3H2JA 4F6RB 3AKZA 4S05A 1CVRA 1MAVA 1QKJA 5GY7A 1KYQA 2XVMA 3DMDA 5JCPA 1XRPA 3S44A 3ZNNA 3CPHA 3C3DA 1ZN7A 2C92A 2XGMA 1NYTA 3NT5A 1P4JA 3I83A 3RT1A 3VR3A 3QSYA 2FP4B 2G1UA 3IT1A 1D4ZA 4G1FA 4WEOA 3M3DA 1GTJ1 3CRZA 4BC0A 2C20A 3ZBTA 2DZDA 6REQA 1GGJA 1JIXA 1LTKA 2W6CX 3LDFA 3LM8A 4QO8A 1B0AA 4CMHA 4EG5A 2A1UA 1BYIA 2RBKA 1ORHA 3A1SA 4LXHA 5E9WA 4ENPA 1GNRA 1OKKD 1XMXA 3RARA 2H08A 3L6DA 3LT2A 2I6SA 3IPCA 4FEYA 4TUYA 2W43A 6REQB 1FFHA 1LVGA 4Q24A 4DNXA 2D59A 3AM5A 4YCNA 1PO7A 3QWFA 3C3PA 1YVDA 2OB1A 4RF3A 2FX2A 4X00A 2C3MA 5AUPB 2QAJA 3HKBB 4NR0A 5I7EA 2YOHA 2ORWA 2O5RA 3ILYA 4V03A 4K26A 3CW2A 4A6EA 3Q5EA 5JAMA 4R1NA 3JASA 4I1PA 2BJHA 4TTAA 2WKSA 2B6NA 1YJBA 3OA2A 4RPHA 4WOKA 1JG6A 4X1IA 3KT3A 2O3TA 2X5XA 4NS1A 5KVQA 1KC1A 1KE1A 5LU8A 1ZSYA 2WJ3A 2VP9A 1ZVKA 2ZOSA 5CB6A 5FEUA 3ZWBA 3QQPA 4TSRA 4QQFA 3KKKA 4YP9A 3IVCA 5EWMB 4DR6B 4BMNA 4X1IB 4ZEOA 4R8LA 3DGFC 2D2IA 4YJ3A 2X58A 4FB4A 3HC7A 3IIIA 1KOFA 3TAUA 2B7CA 2GDJA 1O0SA 3HNRA 3CGGA 3HJHA 3ND9A 1Y8RB 2JH8A 5B1DA 1RRMA 1SZPA 4MGIR 3CO5A 1IJFA 1E6WA 2AD1A 1GCIA 3N39C 4QX6A 2J8ZA 4TLDA 2CB0A 4YJ3B 3PS9A 4NECA 5IEBA 4AJOA 4H1VA 1E8DA 1FNCA 4LJKA 2CMFA 3P9ZA 4EX6A 5B6PA 1QLWA 4HH4A 5JBQA 3R8FA 4KVGA 5LNK1 2CV0A 3ZV4A 1D09A 2PWPA 3ONEA 3BK7A 4CV1A 4B4UA 3MS2A 4URVR 2Z2JA 4ZDKA 3OOSA 5CLIA 1F06A 1S2DA 2UUCB 4OVKA 2CJWA 5HJ5A 1GN8A 1W6RA 2HHJA 1VMAA 5JRDS 3L4BA 3W5CA 4TS9A 4F2DA 5FJJA 1A77A 5AQ1A 4PS1A 3GPCA 2VPWA 2YNMA 4HX5A 1ZA1A 4KQEA 1D2HA 3V48A 4YJGA 1ZIYA 4IVNA 3DUWA 3F6RA 4NDAA 4UXHA 2CEKA 3ISVA 5T3YA 1BOFA 1QQBA 5KYUA 4AF8A 4AKEA 4AKSA 1CUAA 3NVKI 1L4LA 1F12A 2GPYA 3BCUA 3H3JA 3MXOA 5D1HA 1QGUA 6CHYA 2ZUCA 4UAUA 4PHHA 3RSOA 4NICA 3QE9Y 3EIHA 3EQZA 4FMDF 3ZCXA 4P5PA 5KYUB 1OJ7A 5GOZA 1YVPA 2ANCA 1BHO1 1DU4A 2XNCA 4X66B 2RG7A 4PANA 1E3WB 3UYLA 2EFHB 3NEYA 1EVIA 1ZUNB 2Q3LA 4LDJA 4UULA 1RP7A 4PG6A 3IDOA 3R7AA 4J3FA 1VJCA 1ID8A 2R4TA 3BHIA 1JIJA 3UWKA 4FM9A 1AK9A 2BFOA 3NEPX 2W00A 3EUWA 2C07A 1VLZA 1ZWKA 4INPA 5FI0B 2R5FA 3TIXB 3TR5A 4E22A 2XECA 5TJHA 1YAJA 2IXFA 1U3CA 2Q3BA 3BFVA 4A5SA 4C0LA 1Q2UA 2QEQA 4A23A 5KTNA 4TZ6A 2ZYHA 2CK3D 2CWWA 1PLLA 2ZRLA 3T5MA 4OQMA 4PSVA 1WCIB 2JASA 4HPJB 5F35A 1I4EB 3UHPA 1UBUS 4PPGA 2PUWA 3A06A 2RGNA 2GH1A 5D3ZA 1LBHA 3PHLA 5EPEA 5JWRA 1AX9A 3T4EA 3N2ZB 1Q50A 3CB4A 4AT1A 1J8VA 1DKMA 2IDZA 1FYEA 1X1AA 2WUDA 4I1UA 1QFSA 4JP1A 1NBIA 2FUEA 4FJ1A 1YZNA 4WBXC 4KZKA 1UZUA 2ZIWB 5FHRA 2J7PD 1TQ6A 3C6YA 4X61A 3L1UA 3UGJA 4WTOA 1EK2A 4I2VA 1J22A 1K4MA 3G8AA 4UHDA 1T5DX 4NF2A 4DWVA 4YDRA 1CRPA 4GRAA 2O0MA 2C4MA 1JKXA 1R0BA 2VYVD 2WF8A 3RRXA 4F6CA 5MGBA 5F2KA 3VPGA 6YASA 4JI3B 3VA7A 2WMDA 2IUEA 2X8AA 3DOJA 2BMWA 4JVSB 3S2ZA 8ATCA 4V0MA 4NBTA 2GR9A 2OCAA 2VXYA 3UAZA 4KAJA 1BCSA 3M6VA 2BSAA 4GQAA 3ZD8A 1U0OC 3OTGA 3RUPA 1XR3A 5IJ9A 4UBMA 4YT5A 5DVZA 1OPXA 2WLSA 3HU2A 3RVNA 2QRKA 3HU5A 4Q9JA 2XZLA 2J5BA 2Q7XA 3BAZA 4P35A 5LQDA 4DCOA 2F90A 2Q4RA 3AF0A 3CT6A 1J0DA 2NG1A 1JYEA 2JGLA 2VZ0A 4QASA 3LG2A 5DISB 1G8KA 3BK2A 3QPDA 2JGMA 3UYKA 5EUBA 1MX3A 1N3YA 2YIMA 3RHFA 3IMGA 2VDKB 2CUZA 5IAKA 5H81A 3ECSA 3QRWA 4KPUA 2HSEA 1O97C 4BKPA 1UIMA 2OM2A 5E3IA 3W1EA 1H1LA 1WXFA 1G20B 4MA5A 1U1FA 5KJ6A 1Q0LA 5TJ9A 1GLNA 2ZG6A 3FDZA 1XA0A 3BHMA 16PKA 4G0PA 1I6MA 1A5BB 3ERCA 5CBKA 3OEYA 3HHPA 1SEVA 2W6JD 4LGMA 1H2XA 2RGXA 2PBRA 3A7DA 4L9SA 3I37X 3CX3A 1DRJA 3PUXA 4PXAA 2FEPA 4HL6A 1SUFA 4YXWA 3FYCA 3VR0A 3OH8A 5BMVB 4R51A 5FUQA 1D5CA 1MW9X 2YFKA 3IVAA 4JJFA 4RHTA 3M2PA 4OFBA 3ZZTA 3KX2A 4N7RA 1XIVA 3L8GA 4JX9A 1GZ3A 2BL4A 1QWSA 3FCCA 1PBNA 1X7ZA 5LIRA 1AZTA 4EHKA 2J9FB 4OSPA 2KMLA 2J5RA 4ZAWA 8AT1A 4ZPJA 4IX9A 2H1FA 4AZWA 1NU6A 1QAOA 3HFRA 1MKYA 3DEAA 1KE2A 2UYHA 2YJNA 2YMPA 3GCWA 3VYWA 2I4MA 1MT3A 2JK1A 1N3BA 3ID6C 1Y1KE 1UWVA 2I03A 1H22A 1X7ZB 2C00A 3IMEA 2AKYA 2P1DA 4PYQA 2IU3A 4XD2A 4EA6A 3KUCA 4QXRA 2GERA 3CU5A 3SF8B 4YCCA 5AVQA 3FNGA 1VBMA 2IEZA 2ZYDA 3EA5A 4ZEVA 2Q1YA 4EH1A 3OE1A 1E1CB 3H5NA 4RNCA 5DN6D 4D3XA 1ADGA 1XXLA 2M32A 4F92B 1H2YA 1KBZA 3E3AA 1M0EA 2ZJAA 4Q4HB 2GUGA 3T1TA 4XIJA 1KNQA 2IEBA 3HR8A 2GNAA 4HDCA 4M37A 1QLJA 2AJTA 3L8ZA 4L16A 3CWCA 3KXIA 1KEPA 4RJ2A 1XXHE 3O8LA 2QX6A 1NLMA 5LQCA 4IIDA 1O9HA 1W88A 3ASZA 3PV0A 3EH1A 4PZ9A 1IZ9A 3VNRA 5FPQA 3OU2A 4BVEA 4WZ6A 1L6RA 4K9QA 4XIFA 2XHZA 1B74A 3AY3A 2WA2A 3OKPA 2C99A 4UTNA 3IQDB 4U7DA 2FP3A 2ONZA 5FP0A 5FWXA 1BXZA 4YR7A 3OKFA 1ENZA 5IUJC 3DZ8A 2VT3A 3BDIA 1O58A 1GKYA 4BFXA 2D7JA 2PT7A 3EIEA 3WGHA 3K0AA 4HQLA 2PXXA 2CNWA 3FMFA 3PC7A 3QBDA 2GHQA 4PY2A 2QLNA 1X7YB 4Q4DA 3IR5A 5AKZA 5LA6A 2HA4A 2FN4A 2I2CA 4IUBS 4XOIA 1WVMA 1W35A 3KVOA 3IBCA 5B3JC 4K9NA 4TTIA 1QH0A 1S8AA 4KNWA 4D4IA 4EZIA 1ZKDA 5IM4A 4PPQA 4JI4B 1WP4A 5D3QA 2X1MA 3FI9A 3L18A 2AH5A 1G21A 1OLXA 4FUTA 1DC5A 1L1QA 2NSJA 2XQVA 2OGZA 1YFLA 2ZJ3A 2FZ4A 5JW6A 1XWFA 3LF2A 5ECDA 1EVYA 3OC0A 1W2GA 1X9GA 1ZJYA 1IJBA 1HT0A 2LKDA 3QJYA 2JHGA 4MUIA 4PZLA 2G5PA 3USES 4RKRA 3ENNA 3HWRA 2ASVA 3H65A 3ZUPA 4ZTUB 1C3LA 1QOPB 3AR5A 1L7RA 1RXEA 2AN3A 3MZ0A 2PRSA 1V4VA 1R3UA 1SHJA 2Y1WA 3MS7A 2POQX 1QVWA 1K7SN 3NNDA 4HUQA 2Q2QA 3SEZA 1ADJA 4DCGA 3U6KA 4RPIA 5AK4A 5F9FA 2JJYA 5BUZA 5EG5A 3HRKA 1OYWA 2X6QA 3OLYA 2IODA 3SNHA 4BDSA 1CERA 1I30A 1JPNA 1P2UA 4FCWA 4M8NE 4R0VA 1SBHA 5ESRA 3MQ4A 1OLUA 2QPTA 5T67A 2AYYA 3ZCPA 5ICGA 2JLVA 2FV8A 4F93B 1G2PA 4X7BA 1OB5A 4MYUA 2EF1A 3A6LA 4ALMA 5JI3E 2FETA 2VJNA 3UPUA 2Q1UA 2EFJA 1XMPA 3DTNA 3NNSA 4M6WB 10MHA 3LQ2A 2EJWA 1UXHA 2W2OA 2X41A 4YX9A 3GFBA 2XE8A 5HFAA 3FFTA 1L5GB 2X4DA 1IZYA 3ETHA 3ASYA 4LXUA 1GPNA 1NQAO 1OU4A 2EZ9A 2GEJA 2HJGA 2O52A 4NE9A 1DI0A 3QXJA 1B2LA 2FJUA 4GX0A 1II0A 4QEKA 4DQUA 4B17A 1F20A 1KI6B 2ATXA 3QBEA 4TSFD 3ZW7A 1J49A 2O8DB 3M5DA 2IYUA 1CT9A 3FB4A 2EW2A 5CVDA 2H1OA 3CXUA 1QFMA 5CRIA 1CV2A 4MIOA 4WL0A 4LQCA 4ZAGA 1YDFA 5BPFA 5SYMA 3GEPA 3MF4A 1L7AA 2D74A 1EA7A 2VAVA 4NE2A 3D5EA 4X1KA 3VR4A 1ATIA 3OJXA 4EHDA 4YCMA 4A8HA 4WD3A 2GZHA 2J6BA 4MWOA 4NJEB 5JATA 7REQB 4OL9A 3QU2A 2IVZA 1IQRA 3JYQA 3PR2B 4U9HS 4X1KB 2PRJA 2IA5A 3DM9B 3TR6A 3W5VA 2HIAA 3LA6A 2VHEA 4YHBA 5HYVA 1YL6A 2OL4A 3K72B 4XFKA 4G84A 4QUEA 4B76A 1BVUA 1M5UA 4RJJA 3BXXA 2O8NA 3LC1O 4BX9A 1IN1A 1QIKA 4TRJA 5AO9A 2FQYA 4ZOLB 3PXGA 1CUWA 1DAKA 1EBFA 1GGNA 1UBOS 2CMDA 2HU8A 3CTMA 3JU3A 4UM7A 1T8TA 3MAGA 4ON9A 4ZCSA 4HVLA 2TMYA 1J8MF 1DZ3A 2NN3C 1NW9B 1C1XA 2PS9A 1Z6TA 2ZIXA 3DR3A 5IDXA 5JJBA 2FF7A 3DQQA 2RD2A 1G8JA 5CFMA 2P2ZA 3L0YA 1MZVA 3B1FA 3B1ZA 5KCMA 5L4NA 2VAXA 4IJ5A 3JQCA 1U1CA 1UKCA 4JOSA 1NJGA 4UUPA 4MV3A 1UMCA 2WU3A 3ZDEA 3IVGA 5KVVA 3KSZO 1GSOA 1N2GA 1Q17A 2JIMA 3DLCA 4FYMA 3R8CA 3WLPA 3PUIA 3OT5A 4BQPA 1CP3A 3R0QA 4RK0A 4QZVA 5U9CA 1A7KA 2C42A 1NI4A 3URMA 2YUTA 2Z6UA 1VXOA 3HPRA 4YI3A 4YV7A 1UMCB 3I4FA 2A5DA 3RH0A 4X6UA 1VTKA 2JGFA 1NRIA 4L0QA 1DV1A 1O08A 2A9PA 4H1HA 3TGWA 2Q6KA 1NI4B 3KETA 4YO7A 4EFMA 4JBXA 1M7BA 1ZCAA 4G4JA 4ND5A 4O63O 3FTPA 4S24A 3CEPB 3RNOA 1E92A 3JQRA 5CEFA 5HK8A 2V7XA 3HU1A 1P0MA 3NQ41 1ILWA 3MTGA 3PXDA 4B33A 5ED4A 3ONVA 2PZEA 5LQRA 5CVVA 1VHDA 4OXXA 1WMSA 2B99A 3EAGA 4JVLA 5DBGA 5I9SA 1TMGE 3LXRA 4Y2PA 4C7JA 2PX0A 4JWKA 1T2CA 5EUCA 2HYIC 5K0SA 2PCLA 3EMDA 4F4DA 4XWWA 4JXXA 1PFWA 4NZYA 3AOGA 5CCXA 1EGHA 3W6UA 4C07A 3AF1A 1SCUA 3JYPA 3WLHA 3LQ1A 3H97A 2WAAA 2NZUG 3HO6A 4D8YA 5LOVB 4BQIA 2HWKA 4FFSA 1XZPA 5JAIA 1Z4IA 1F9EA 5SY6A 1GVHA 4OI4A 4DCTA 3IO3A 4C5CA 4L73A 3NONA 3CZAA 3TSYA 3HDTA 4B2IA 2VQDA 3PC2A 3LZ6A 5ESWA 2XUOA 3O4HA 3IT2A 1YL5A 2OHGA 4X71A 1E58A 4IJ6A 1RKBA 3D8BA 4D26A 1TCVA 3K9FC 1S0UA 1YA6A 2VNIA 3QLVA 3PU6A 2EKZA 4DA7A 5DGTA 1SCKA 1THTA 3IS3A 1UDWA 2VAMA 1YBFA 4W9NC 1L8XA 3ZCUA 4MVJA 5KZMB 2CVQA 4GNRA 5JS1A 4KDRA 3AVXA 4OQNA 3LZCA 1KZ9A 4XFJA 1H05A 4LZLA 4YIKA 3TQFA 1Q7TA 4BO4A 1AGNA 1FNDA 3RBVA 1O94D 3DBRB 2GCOA 2X15A 3G0HA 4PN3A 2FWPA 1EZZA 4CCAA 4D9CA 4I3FA 3IE1A 1E5QA 2BYTA 4RMHA 4ZVQA 4NARA 3R3UA 3ZTYA 1IJKA 2CNDA 4PYKA 2QZSA 3Q3CA 4M86A 1Q1QA 4TL6A 4J0KA 1VXRA 5KTMA 1FBTA 1KMHB 2G6TA 2GCOB 3ND5A 4D0GA 4B7UA 1V8DA 4KXXA 4QDKA 4UAVA 2AOTA 4OF4A 1U2EA 2NV0A 1GVNB 1VL1A 4MDYA 3RVOA 1W34A 2ZI6A 4I6JA 3OQHA 1OJLA 2OK8A 5L4LA 2XJ4A 4V24A 3NM5A 4ZANA 4G5RA 1E1YA 2AOTB 3E4DA 1ZI9A 3OZIA 1IM2A 1T4GA 2V7BA 2XUJA 3DCIA 3F6BX 2VDNB 2Y0DA 3SG0A 1QAMA 4PHFA 1JHOA 1N8KA 4WASA 5AKHA 2GWRA 1R5NA 3LBAA 1QP0A 1O6ZA 3N70A 5HKLA 1UOPA 3NANA 1FTWA 4Y2TA 5K1ZA 4LJAA 3NHRA 4RVHA 1D04A 4U2CA 1GL3A 3HEAA 3W8FA 2J30A 4XRGA 3QOFA 3DL4A 1ZJWA 3PLAE 1PJBA 5HCUA 1YF3A 3OIGA 3RYCB 1UZAA 2V7WA 2ZJ5A 2ZYUX 1P5HA 3SM3A 2CLFB 1YK1A 1NXOA 3EJWA 3PWSA 2AS0A 2I7DA 2J32A 2BHNA 2KM1A 4JJ4A 4FFVA 1L4GA 1PD0A 1O8CA 1WE2A 4JDPA 2V58A 3L8EA 3WO0A 3D0OA 3H83A 2ZIVB 1ECCA 3M5PA 4C4SA 1YULA 3BMOB 5K8LA 3ZWAA 2QTWB 4BIMA 4OA8A 2VYND 2GBFA 1CP2A 3NG1A 4NZNA 4U2DA 3W1VA 5C8VA 7YASA 2E1RA 4D4JA 1AGYA 2HXSA 1PW5A 2OO7A 2R6HA 1UAYA 4X6XA 1Z4LA 1YE3A 1GAJA 1QC5B 2CUTA 3EIXA 1IL0A 3GAAA 1YQEA 4G5QA 1MVNA 1JKIA 4HUJA 4FZ3A 4BJHB 5K0BA 5C8YF 4PSDA 3GJ5A 4BU0A 1PNVA 2C2OA 5DMHA 5IK2D 4MHSA 5M34A 1AA9A 1T9AA 1KAHA 1XTPA 1EFVA 2XMPA 2H2HA 4JKIA 4YEDA 4EHFA 1Z4QA 5C7YA 4X20B 4K9DA 3UK1A 3FUTA 1J1ZA 4WVFA 3HKCA 4MS1A 3W34A 2BM0A 2QVYX 1YI1A 1AZWA 2J3MA 4O2RA 1WXHA 3PPWA 5HJ7A 3F6YA 3AFGA 1EFVB 3SYTA 1C7ZA 3BORA 4QTZA 5JY1A 2PSJA 3LPNA 4HDOB 2O3SA 2PQ0A 5T4BA 3Q0IA 4O4JB 3DE6X 4MS1B 3QX7A 1U4OA 1U3WA 1MQ9A 2WSSA 1RC0A 3DAYA 4I19A 4FT4A 2X0DA 4AP9A 5K0ZA 1Q16A 4LDZA 3NDPA 2QTVB 3IDAA 1RCTE 1YONA 5ALIA 2BKAA 3SGLA 4RHYA 4J1SA 3ZU2A 1U81A 5LYJA 2OVBA 2ZRNA 3VTZA 3SHTA 2G71A 3F8SA 1ZM3A 4IXTA 1RRVA 5C8XA 1PJTA 3TD2A 2P9JA 2F9FA 3K94A 2YXLA 2C9ZA 1I24A 2OKCA 1TU4A 3VM6A 1U2DA 5LYJB 3LTNC 3NDIA 3E3OA 4FNMA 3LO5A 3QK7A 1UBMS 4CDGA 4WOCA 3ZWXA 3VGJA 1XDSA 1VYHA 4AP5A 1RPAA 4E3WA 3STVA 4X0EA 3IBTA 1H3FA 4L8YA 4D9FA 1XAIA 2WSMA 4XLTA 4YRSA 2OUKA 3HN7A 3RJ9A 1BKSB 1Z0UA 2ECFA 4QT4A 4EG3A 3QFSA 5EEHA 1SOMA 2AI3A 1P29A 2Y9MB 4RVCA 4BFYA 3DSRA 5KUTA 2P4SA 3EWAA 4CMEC 1Z16A 1GRVA 3FNFA 3O47A 1JE1A 4FFPA 1GJRA 1X1BA 4PG4A 4PPFA 2GYVA 3IR6A 4MSUA 1PFYA 4OA5A 5CAEA 1QP4A 3KYCB 5IBCA 3IL2A 4JYCA 3B13B 3RTBA 2LDXA 3E3LA 3Q8WA 5KX5B 4ZRDA 4DKJA 1YJXA 3T3OA 1PJLA 3TAHA 4QNMA 4BRUA 1BX1A 1F5NA 2VATA 3AV0B 2WTMA 3WTBA 3LWZA 1XMOB 4EW2A 1KVSA 2I6FA 4NHOA 3KXLA 1PZGA 2CNNA 3MTDA 4WCVA 2Q3FA 1VPVA 4XX1A 2ZBQA 2PBZA 4A6DA 4KQGA 3EVNA 1I01A 3NTQA 1QK3A 3ZR4B 3GJSA 4JNKA 2X4IA 4U7JA 1F7VA 4XYEA 1YKFA 4QULA 3AI1A 2BGMA 4PLCA 3RFTA 5CFOA 2ZSDA 3LWBA 1RYBA 4BCCA 1A04A 2CZCA 2VSNA 1U8YA 5FYDA 1XBTA 4RSMA 3FVQA 1HV8A 3DAFA 4S1TA 4RBNA 3RYIB 5AJTA 3EEBA 3QEMA 5DRTA 3D1LA 4UBIA 4JJAA 2V0NA 4WACA 1UXGA 3OQMA 1XVAA 1PLKA 1IWPB 2O3UA 4DIUA 2ZDGA 4F8JA 1UQTA 1E8NA 4G9EA 3FZNA 4RTNA 3S2SA 1I6KA 4B32A 2VNKA 2WC1A 3F9CA 3SS8A 4PO1A 4U7HA 1TT5B 1R8JA 1X1TA 2V7UA 2F17A 3AR6A 3GJQA 1K8QA 2E6UX 3D54D 3MJFA 4LJ7A 4AY2A 2NTNA 4KXWA 4DIMA 1WUTA 3NAQA 2JFQA 2JLAA 1BQEA 5IG2A 5EXPA 3BPSA 2Y27A 3SZ3A 5CXSA 4PGHA 5ANRB 4K87A 4B6SA 2I8LA 1MXHA 2FF5A 3QKRB 1AK1A 3UFXA 1U2SA 1WMAA 5AXAA 4I8XA 2XE4A 4ZMSA 4GHWA 2FXVA 3CX4A 3HXKA 1WDLA 3K35A 4JVNA 1HPLA 4G1UC 4Y2UA 4V0RA 1B76A 1EM8B 3A70A 4D3SA 1I2BA 4BX8A 3UFXB 2GCNA 3K9BA 2JHCA 5A6SA 4BFUA 1GQFA 1WULS 1Z56C 1ZBQA 4YMVA 4PAWA 3RLFA 2KX7A 3L1JA 5CT5A 4WK6A 1R0RE 2DLNA 5K8IA 4GZMA 1TC2A 2WFZA 3PC6A 1M6EX 2GYYA 4FOOA 3LBNA 4HLNA 2DWCA 2VDQB 4UM9B 1UPCA 4EKEA 3SN6A 3DHVA 3KQQA 3LH5A 1N34B 5HUQA 4B3JA 3R9KA 5ENZA 3L01A 1DC6A 4MVJM 3FYTA 2QUJA 3DDWA 4H0FA 5KNDD 4TTTS 3HFJA 4LDPA 4JI5B 1R6UA 4Y2QA 1TTTA 2AYXA 3CN9A 4I1IA 4OYHA 1AN0A 1PGQA 2VZEA 2H4JA 1SOAA 2DRIA 2IL1A 1KTVA 3E81A 3IKVA 3IMCA 3JVIA 4P5EA 2VRWA 3U4DA 3C3KA 1YS2X 3WB2A 4ALLA 4F8YA 1A27A 2FPMA 3C8UA 3KPVA 4AZ0A 1K6IA 4LZWA 1UDXA 4D9BA 1C29B 5AW3A 4P3KA 2OXCA 4D80A 3COYA 2CNLA 4CQJA 1ZUHA 4Y9RA 1XDDA 3K09A 2AUMA 2QJWA 3P45A 5FA6A 3NP9A 1E1QD 2ZWVA 3BD7A 4KUGA 2HPVA 4Z0HO 3A8TA 3F74A 1PNTA 4S1NA 5A4IS 3QOXA 5GJCA 2ODAA 2YV5A 3KBOA 2Q41A 3QNWA 4GXQA 3THSA 2Z08A 3V00A 2BBSA 3WMEA 4V1CA 4LY9A 1W0JA 2AFRA 4OQPA 3EQ2A 3BQMB 3C7CB 2PBLA 2YVKA 1A1VA 4PO3X 1MAHA 2E4UA 2F43A 2WD9A 3ABOB 4RL4A 4CQMD 4W5WA 2BMDA 1OXVA 3KZ1E 1T9ZA 3R0VA 3A7EA 1MGPA 4TUYF 2DUUA 5AW5A 3OWHA 4L9RA 5EVCA 3M6LA 1W73A 3Q12A 5C9ZA 1F8FA 2H11A 4LHSA 2QD3A 4N8SA 2WOOA 3HCPA 4R5HA 3RGWS 5G40A 2PYIA 4MI6A 2OR3A 6ABPA 1M2OA 3G2IA 1XVTA 4FPXA 5EP2A 3ZQKA 3HZHA 5AOBA 1IRXA 1NMSA 4CETA 3FUVA 5LMUB 4RDHA 1XQWA 3FUUA 2F4VB 5GIOE 2NYUA 3EN0A 4YGYA 4F21A 3T34A 2NSYA 3Q40A 4EGCB 4LJ6A 2GRJA 4RZXA 2JLBA 3TLZA 4HRXA 2DH5A 4URFA 3QEBZ 4MDHA 1Y6FA 1XHFA 1GFSA 2FQ1A 5FXMA 4YJ3F 3ADKA 5ALFA 2QBYA 3JYOA 1Q2XA 3ETCA 4M1EA 4ZZ1A 1COWA 5K9ZA 5T6BA 1DADA 4CFZA 1YB5A 2QNIA 4PXYA 1WV1A 2XXBA 4FI3F 2NVUB 3BH7A 4FYPA 4CKEA 2PU7A 4E33A 3PEUA 3KE8A 4LA4A 3AEUA 1SM4A 1T5TA 2FZEA 2GHIA 1XZNA 3F9RA 3IUNA 3KKLA 1XTRA 3FUXA 2C7BA 4OLHA 3PHHA 2NPOA 1R10A 1OXTA 1WKCA 4NCJA 4LSGA 1GNVA 3M6WA 4B3CA 4G63A 4CKEB 2GJ4A 5LYYA 5HP4A 4A0GA 2EHJA 3M1LA 1NPTO 4Q4LA 4YJDA 3KELA 4M8KA 5JS2A 4YRZA 1ZSNA 2P79A 3AM4A 5EOVA 3BHNA 4DV6B 4YAEA 2AN4A 4U0JA 3I05A 3FOBA 4Y9DA 1T1EA 3B7PA 3FVRA 4XR4A 1O03A 1V7CA 2DP4E 4D3YA 5ADUS 5BOSB 2W4MA 2W9XA 5DKFA 3KBBA 5EHIA 1MAUA 2XUKA 2BM9A 2R1UA 4E4RA 1QMPA 2BEVA 2H63A 3R76A 4NONA 4WXHA 4LFAB 2WVAA 1PR9A 2C0PA 4LE1A 3SZMA 4CMBA 4QVKA 5ICCA 3M4ZA 1A5ZA 1VCIA 1L4KA 2ZUDA 1VJ1A 2C4KA 3ADBA 3WV5A 5NULA 2XWPA 4NPHA 4P3YA 4DGQA 1P7VA 1SKAA 2YQZA 5ALVA 4JXZA 4BNVA 4K9SA 2PQ6A 1SUIA 2VJAA 3J7TA 2IRWA 3SOZA 1NW7A 1IQUA 3CUSA 3PX3A 4BNIA 4DJTA 2R60A 4GECA 2ZR9A 1TYAE 2WMOB 1K0FA 1IOLA 2YH2A 4WNCA 4EG6A 2O14A 1NW6A 3C97A 4G1VA 3TW0A 1CPYA 2GEFA 4QG7A 1T0JB 1N6RA 4C4ZA 2L17A 5H0IA 4AJEA 2OBMA 4YV0A 5CJ2A 5D01A 1PL7A 1XF9A 3B85A 3WL8A 1V35A 2OV4A 4EPVA 3H19A 4LYAA 2GRUA 2CF5A 2ODNA 4BZZA 3EXIA 1RPTA 3TJMA 4BU1A 1JNXX 5BQFA 3I28A 4OM7A 1TJ3A 4AN1A 2HTFA 2IS6A 1NKSA 4O2BB 1QG4A 3FYSA 4YJ2A 4R2XA 1CUBA 3B1JA 3GRPA 3QTBA 1UMKA 4WLVA 2GTPA 3FOAA 1C9NA 3EXIB 3W2HA 5ERGB 2GBGA 3RYHA 2X7XA 3G5TA 4LEIA 3KD3A 5JZVA 2KBFA 5C3UA 1IBMB 3EXHC 1M1ZA 5IS2A 1ODJA 3HP4A 2VG8A 4YJ2B 4ZOEA 3CFYA 3GPLA 4KFCA 5ARBA 2DQZA 3OCXA 4N47A 5HW0A 2NO6A 1PHRA 2C4WA 3EGEA 3ZS8A 3KB8A 1KJ8A 3N86A 1XZEA 3B3QA 3CT4A 4JGBA 3K70D 3QPUA 4P0TA 3AI2A 4UTZA 1I33A 3HSSA 4HGZA 2QI9F 4A03A 2E5LB 5GAJA 3MMXA 3AONB 3ZWCA 4NOJA 3X1ZA 2A1TS 2J31A 2ZCUA 1PJ3A 3ELDA 4U1RA 1PQPA 3FJ1A 3G0CA 2O54A 2P9TA 2IPOA 3QELA 2ZJ0A 3KKPA 3FXAA 3ITEA 5I4CA 5FUBA 1DAMA 1X9HA 4G0NA 2B98A 2QD5A 4TTVA 2OE2A 5FIUA 3EAFA 5JAHA 4L3WA 1AS2A 4RPGA 4Z9AA 1Q57A 1QTIA 4RJLA 2BBOA 2H18A 4QDOA 2R5WA 5JYCA 5KIAA 2BUAA 4AY5A 4MK4A 2C9CA 3PDIA 4KI7A 3H5IA 2HQRA 4KODA 4DTCA 5BT9A 4KSBA 5DYNA 3T9CA 3TGLA 4KOAA 2FPGA 2JCBA 1NUQA 3WGTA 3OJOA 1V3UA 4ENUA 1QZTA 4W9MC 4QM7A 3GUHA 4EB6A 5TPZD 3G89A 4QECA 1DJOA 1PVDA 2A57A 4XQEA 3V7UA 4UE6A 4C7KA 4LYEA 4QVGA 1TVEA 3BIXA 2FPGB 3KTAB 3V1TC 3RKSA 1GU0A 3V46A 4YRKA 5DTRA 2CBXA 4QYMA 2FMFA 2GKSA 1P9NA 3M6AA 3NC0C 4EB6B 1DX6A 1N75A 2XB6A 3IUQA 3W6NA 4YUZA 2AJBA 5C1DA 4H2DA 1YJCA 3DM5A 3NBFA 2FR8C 1L4FA 4C22A 1HL3A 2G72A 4BN5A 3WMFA 1T2VA 3QW4B 3D2LA 3TXXA 2HA5A 4KXQA 4UTOA 4B3SB 3UJBA 3V4LA 1WF6A 1CWUA 1HQYE 4PYNA 1EE9A 2PEZA 2L42A 4EKNB 4NENA 1LBQA 3V4OA 5EE3A 1FFEA 1TAQA 1DIBA 2R62A 4MW2A 5CPFA 2BZSA 5JRZA 3IQHX 1XCGB 3BCSA 2IEIA 2RHMA 2VVTA 4QGFA 4RA9A 1Z8FA 3MWLA 4TWIA 1RHRA 1VRWA 2AE1A 2XKJE 3O2SB 3U0VA 4H1WA 2IKQA 3K9LA 1YZHA 1LSSA 1GRNA 3MRSA 3FKQA 1A2QA 1OT5A 1TUGA 4QJ4A 2VWQA 1MABA 2UZ3A 2WBLC 3FCSB 1UJNA 3TZ6A 3V8VA 2XVYA 3GCGA 1RD4A 2XAUA 2UXDB 4N6OA 1RM0A 1T2DA 1QX4A 2YBEA 2FMUA 3R3SA 4R54A 2AVNA 5IEJA 4ZDJA 3N6VA 4AL4A 2C5FA 2CBZA 2OCIA 4CGZA 2PWZA 3VPCA 3R7FA 4QG3A 1NRWA 5CM8B 5CCDA 5DLQC 4B0PA 4DEXA 4U00A 2FUKA 1IHDA 4I4IA 4YWHA 4CEHA 2RGYA 1LFAA 3S1LA 1XRJA 2YJ6A 1TUBB 5JISA 3PT9A 5JU6A 4HFJA 4IIHA 2ECOA 1ZN8A 1FDWA 2RAVA 3B1YA 3DFFA 3G8YA 2IV2X 4JXJA 3TCNA 4AIRA 4YRNA 4EYKA 1G8FA 2FZWA 5K51A 4H4EA 1FU8A 4JMPA 1I8TA 3SC4A 2ZBRA 4IDPA 1LA2A 4CEHB 4ZVNA 5K4GA 1X80A 4YBZA 1PUJA 4QLAA 2VDPB 1JL3A 5LA6F 5DNAA 5SZIA 3UJ8A 4ZRMA 1KFBB 1TK3A 3I39X 3F5MA 3KQOA 4IO0A 3B12A 1OVMA 2EJCA 3E22A 3EGVA 3N8HA 2EKDA 2FPRA 1SXGA 1DBRA 1W5TA 3K0FB 3MWGA 4KLZA 1WZUA 1RSZA 4IEIA 5LKAA 1JLLA 4ZJUA 5IM4F 1X7XA 5LWQA 3U3RA 3BXGA 1XNQB 3EY9A 4H3HB 3W2GA 4EF6A 2IOHA 4RTPA 1MB9A 3E22B 1P0FA 2GFQA 4ZU6X 5FUYA 4A15A 2IE0A 3GT0A 2PG3A 5AW6A 3T3GA 4E12A 5FAKA 1EFUA 4KXMA 3T1VA 3K5IA 1AHIA 1JHQA 3NBYC 3E23A 1QYRA 4NDZA 3ZGOA 4BLWA 1YKGA 2R97A 2GZ2A 4OMDA 3WZLA 2HIMA 2Q1TA 1V7ZA 3B36A 1M66A 5ICEA 1RYYA 3SYKA 3PYMA 4DLAA 1G291 2ICAA 4XSHA 4Q1EA 4OLJA 1E9DA 1ZVVA 4QA9A 1WM1A 5ENVA 4H17A 4ZZ2A 3SD7A 2G1PA 3CMMA 4EQ6B 2C1EA 5IVIA 3C3MA 3GF4A 3KJFA 4FK8A 2OHIA 1N6LA 5EIHA 1YJAA 2CDAA 1ZPDA 2KPOA 4CEJA 4Z2AA 1XZJA 2PBFA 3OTQA 1TYEB 3WAJA 4QWMA 3TQRA 1O95A 1W48A 5FNVA 4YAUA 1E79A 2WFLB 5DNYB 2EWWA 4FOPA 5IANA 4PX3A 2ZKLA 4EHJA 3ZHBA 3HCEA 4GSLA 1J97A 1HEUA 2QHXA 2QZ4A 4MW4A 1Z4MA 1T0IA 2QLJA 1A9SA 1BOOA 3BM5A 1XNJA 5FNVB 4MDFA 3S55A 3L4BC 3WLQA 2YJ3A 3FCXA 3L0BA 4JIGA 3F67A 1JR3A 1KH1A 2YNMC 3DEZA 2H00A 4I4TB 1UANA 1YQGA 4O1HA 3G8CA 3SMQA 3WBFA 3SQWA 3MUEA 1HDEA 1M33A 3LQ4A 3ZNOA 3WGGA 2VQEB 2WV9A 3B5IA 4BVLA 1ESMA 1AIPA 3CLTD 2GAIA 1KQNA 3I2GA 1XJ0A 2IDKA 1ZVQA 3N8IA 1E60A 2XVAA 3IUPA 5I48A 1WW3A 4B3GA 1YS7A 3RWMB 2RHJA 1PUIA 3STWA 4EJSA 5EXEA 2WYWA 2GQ0A 5YASA 3RI3A 1RPZA 2VDVE 5JWHA 3VYSB 1D1SA 5SY9A 5IZCC 2W2PA 5BWLA 2UUAB 3WWYA 1GZUA 1QR2A 4YQYA 5BV7A 1SXPA 4NPCA 2PMDA 1YVRA 2F2TA 3LPCA 1XLVA 4H6PA 3WB0A 1SXIA 4ZOLF 1LTQA 2GZ3A 1KAEA 1VIDA 1RKVA 4X95A 2EL7A 4AN0A 4ZGBA 4Z8YA 3BIWA 3UT6A 4G0ZA 4F4CA 2NYVA 3CV3A 3SFZA 2OWDA 1U7HA 1WABA 4F46A 3QEJA 2E55A 5CVUA 1A8HA 2A88A 3FOWA 1MRSA 4Q66C 1KYZA 3IDFA 3P0JA 3PUVA 3W06A 1HYBA 3NJ8A 1PQUA 4JT9A 5KAPA 1ADCA 2E1PA 1WKBA 2QN8A 3QWBA 1JKJB 1SG9A 1TI7A 4YDQA 2Q99A 4M1KA 2QXUA 5DI3A 2B4KA 5JSHA 1N5DA 2UXCB 4OSOA 5C7LO 1QHHA 3BTSA 3KAKA 3RAJA 2ZYGA 3F90A 3CSUA 1KI7A 2AG5A 2ZVJA 4FT2A 3AJ9A 3DVRX 1WSDA 3IO5A 4UDXX 4CKYA 3ZQUA 4DXAA 2A94A 2I1QA 3ZBUA 1GPYA 1V7QA 3KR1A 3ZDYB 1POWA 3ZE1B 1QHHB 1E9AA 3P4UA 2ZR0A 4MYDA 4DLLA 2FMHA 5BW8A 4C2BA 1KY4A 1YU9A 4J91A 2WU0A 3QOYA 3OIYA 1NXVA 1L1RA 2VSXA 4L85A 4M0FA 2O8FB 1YRWA 5J47A 4BXOA 1N9KA 4AJ1A 2P6PA 3KSAC 2OC4A 3T7CA 2TECE 3FVWA 4RX1A 1P2SA 3KQWA 5DYWA 3LUJA 5FV4A 3PYLA 4XZ3A 2E82A 4MULA 5A3SA 4KG7A 2QE7A 1G3MA 4D82A 2JJ1A 3RHSA 4PLGA 1JF8A 4X8HA 1H5UA 2IJGX 1LQTA 2QS9A 2RHRA 3DMTA 2QI9C 3KKEA 3KYJB 4X64B 1QE3A 1UFRA 3MCUA 3R0JA 4QU5A 4OXNA 3E0QA 1U0NA 3K7EA 5GJVC 4HWSA 2UVDA 2B1GA 2C97A 2Q1XA 1RE0A 4RHUA 4EOGA 3A36A 4KPFC 4LFCB 3M6FA 2Y2UA 1LRLA 1LDBA 2N0SA 3CR8A 4GM1A 5DHRA 4YLGA 2REBA 1EWVA 2EKLA 2VUSA 3UMRA 2BV3A 1IXSB 1GEGA 5INTA 3U3OA 1KYIA 1P1RA 2UKDA 4MVCA 3GFRA 1DIHA 1X7GA 1PK9A 3R7BA 4RHEA 1CUVA 3IAM1 1EK1A 1T1IA 1V5IA 4R7ZA 3ROEA 1FSZA 2D3WA 2XTAA 3MMPA 4KP7A 1X7DA 3SHQA 5GZ3A 1G2IA 2JC3A 4HDMA 1CQWA 2C4TA 4MV0A 1AKVA 1J5PA 3ORQA 3THRA 4O5OA 3UGTA 5EGSA 4LFBB 3RSGA 1Q11A 3ELWA 4DR4B 4HTFA 4HAOA 5A5VA 4XGNA 3U3XA 1WZ2A 2HJVA 2GOYA 2XEXA 1C1HA 2WIKA 1DIRA 5DTIA 5AFSA 3U13A 4JB2A 4ND2A 1UBEA 1ZRHA 2O19A 3K30A 3M9WA 3MERA 4DB2A 2LUOA 1E3MA 4XJXA 4XYBA 3WKEA 1TRKA 1BJKA 1LLCA 1ZFNA 3EHDA 5KBYA 1GNSA 2I6QA 3A37A 4EUHA 2RDMA 1I5OA 2H8GA 1ENYA 4US2R 4DIOA 1ZM7A 2VK1A 4MUXA 4X94A 4QM6A 3D64A 1TQ2A 5F2EA 1KSFX 2BKXA 3NASA 3V2GA 1UDRA 4MVJF 3M89A 3NGLA 3DULA 1C9DB 3V5NA 5BSUA 1RBYA 2J1LA 3Q7RA 4GOKA 2PGJA 3MSCA 2HHLA 4HGOA 1U0BB 2CN1A 1N2BA 2Z09A 4RL6A 1DS6A 3GV0A 2R2GA 2XBUA 1BMQA 1ZK1A 2BDUA 3AETA 3DZIA 2IYQA 3EMKA 3O8BA 4OJTA 1LS1A 2XB9A 2IHVA 4K9OA 3EVCA 3U61B 3ODPA 1TF7A 2A5GA 2HT6A 2YMMA 1T1JA 1LS6A 4H08A 2IYZA 4N7JA 3RTCA 5JT1A 4JYPA 4KO3S 1I3OA 5FBHA 2QMQA 5TF4A 2J46A 3H4VA 2AV6A 1IXZA 1TIPA 4IDFA 4MRMB 1R1DA 3SHFA 3RSFA 4ZYUA 1SBTA 2D8AA 4PX9A 1ZIDA 5TQ2A 5BORA 3A6EA 1L7XA 3U9TA 5K0GA 5AW2A 5LLTA 4KUHA 4NBUA 2ISCA 1NBME 1XFAA 2UZAA 4W8OA 3UKDA 4EYQA 2CSXA 4WDQA 2DC1A 2M6SA 2QQ0A 4FJ0A 4FKZA 1CQPA 2E87A 5M7EA 3KWLA 3PEWA 2KE5A 1E66A 3I76A 4HVCA 3LO8A 4WSOA 3V9PA 4F2WA 2JA2A 2HA3A 1I2AA 1E6MA 4PCUA 3SVLA 5LXTB 4ZXPA 2P0EA 4EHAA 4WGGA 1TEXA 3VDMA 1YZYA 2ZJ4A 3GDGA 4WKGA 1N2CA 4Y9UA 1NQOA 1OZAA 5J58A 2AMVA 2G4LA 4LRSB 1D2MA 2YV3A 1P91A 3D4LA 4ZI7A 1C4XA 1IN7A 1VFPA 1WD5A 2D5BA 4QSHA 2ZVQX 4A0QA 1ULHA 3JATA 1ESDA 2BKLA 2W2TA 3NOVA 4GDFA 1GTG1 1QE0A 3EZNA 4LZPA 2ZRDA 2EHDA 2LR0A 5AVRA 2Q5IA 3TE6A 1EXMA 2JIZD 4O2LA 3DMRA 4QXAA 3AF3A 4I55A 4XQCA 4HR7A 3KSRA 4RVUA 3WWDA 3LQRA 1BD3A 5K6RA 1EUCB 2CC2A 4I50B 4N0QA 3CKKA 3ROGA 4D6XA 5HPYB 2X6TA 4LGVA 3AEQB 1U31A 5FKJA 3QVWA 2WWWA 2FEMA 2VZLA 1SBZA 2X22A 5I9TA 3GXBA 1S96A 4R3UC 4DM4A 4AW9A 4DV2B 2QN7A 5H7XA 1VZ3A 3UB4A 3DT6A 3PSHA 4KU4A 1RYMA 2O7RA 2MHCA 4K46A 4MV4A 2ZRFA 7MDHA 1NN0A 3T7JA 1M2JA 3ER8A 2IDMA 2ZIEA 3MMSA 1E2FA 3WB1A 3ASUA 5B12A 1CF9A 5EYPA 3SYRA 2JEYA 4O4JF 4OHWA 4LHZA 4QLBA 2BHLA 4LECA 4Z8XA 4G2NA 3D7MA 2DBVO 5HX7A 3BJEA 2ZT5A 2GAAA 2YS7A 4AIIA 4B6QA 3HUFA 4ZCMA 1BGXT 1IUKA 1NRJB 4BYMA 1DLIA 1T6BY 1HFWA 3SX0A 5JCZA 1FFAA 3TRJA 1ORRA 1ZJZA 2F67A 3BA1A 3OG9A 4UNPA 4AYTA 4DNQA 3N2KA 4BWGA 3BSWA 4RAQA 1FDTA 5H3HA 3HA3A 2LVBA 1KAQA 3TEFA 3CEAA 4YT4A 4X8LA 2IC5A 1WDMA 3PJGA 2PX4A 3N53A 5LYJF 4L4SA 2IIBA 2BH2A 3GD7A 2DPGA 1QG0A 1FP4B 3N2KB 2R6JA 3LYHA 1ZG3A 2X23A 3M6UA 2GD0A 1PEYA 3I2KA 3S70A 1NL3A 5DX1A 4CGYA 1E2IA 2L18A 2JIQA 1QKIA 2XH8A 1E3TA 4L6CA 3GLIE 1ZH6A 1HNWB 1GILA 3THYB 1ZJ5A 4N4AA 1XZHA 3HU3A 3N1UA 3SBXA 3CKLA 3I9V6 4I1OA 2HLPA 3BWXA 5TXGA 4UVIA 4C6HA 3SSNA 1OU0A 1RQ2A 4FFBA 4P31A 2QLTA 3AHJA 3EHEA 3OQIA 5GM1A 1UZNA 4IVPA 3HB9A 2PX5A 4KV9A 1QV6A 3WBKA 5FWYA 3DS8A 5ILOA 3FZQA 2HPHA 2Y77A 1RJ9A 3OLXA 1IYZA 2YVLA 3OQIB 4WT7A 1U4SA 2NWQA 2YXBA 3V7WA 3JQ7B 4Z0PA 2B2NA 4BNYA 1UBLS 4IDQA 4ZIRA 5LMZA 2R84A 1TE2A 1NF3A 2F3SA 1HQKA 4Z53A 2OCLA 1VKNA 2I2XB 3GRFA 2C2HA 3NATA 4GAEA 2XXJA 4H7IA 3AY6A 3WHKA 3QKUA 3NXSA 4R81A 3WRWA 3HADA 3N2GA 3E3NA 1M2NA 1SGWA 3VAYA 1GZ4A 4HVTA 5H80A 1U5BB 2GZDA 1KEKA 3CVXA 4OKNA 3V2HA 4F7WA 3B6JA 1DO0A 4GS5A 2WHYA 1WCXA 5B2ZA 3Q1KA 4MRSA 2XCTB 1Y7HA 1F8YA 3PYXA 3U4CA 2VHZA 1OB2A 1QB8A 4E6EA 5CCEA 5E6RA 1G4HA 4BP8A 1HDXA 3REFA 2YC2C 1NM5C 3UAOA 5A62A 5I5EA 2ZJBA 3JQAD 1V4NA 3I9OA 1B4DA 3MD0A 4B85A 4F72A 2XA2A 2G3YA 2NTVA 4UD6A 1QQTA 1HETA 3OMXA 4JFAA 3LXMA 4LNUA 4UU7A 2JLRA 4M76B 3UAWA 4BV3A 4TVSA 2O2DA 5I01A 3GH3A 3KSUA 4NNJA 3MCWA 4RLHA 1OWMA 4EY4A 4V3BA 3U7HB 3WYFA 2OVFA 2QLFA 3A9TA 1M1YE 2F3RA 4MLCA 1XAJA 1FS5A 2D0DA 3ZXUB 4TV8A 3ADDA 3ACDA 2PAAA 4N01A 2BMAA 2UDPA 5IU6A 1H9AA 1O3YA 1UEXC 2O57A 2QMHA 4G9BA 5DTMA 5HM6A 3MGKA 1U7XA 3REOA 2ORVA 2XT6A 3BZBA 4F6LA 4ZICA 1MPTA 1VSQA 1R88A 4TV8B 4TPKA 5FJIA 3PG5A 2HJWA 4JEUA 4L50A 4BNXA 3ZDFA 1GG9A 1QU2A 5J5CA 1NUUA 4R1UA 3QBTA 1GTRA 3RJZA 3TPCA 5C1IA 3WLIA 3SZOA 4PRYA 1B26A 1TDJA 1Z0FA 1KSHA 4Z9FA 4DADA 3HYSA 2X8JB 1IHUA 1C0IA 1YU6A 1Z45A 2WQ6A 2O5VA 1E98A 1EFDN 1SG6A 1LD3A 3HCOA 1GTSA 3QYFA 4LBVA 4BMPB 4BBZA 3O31A 3ICCA 3LGXA 4AX8A 3IQXA 1A9OA 3G0OA 4LE2A 5TQVA 2BSQA 1UODA 2JCYA 4PAOA 4XLLA 4EPWA 1OAOA 1ZK0A 1G4UR 4RH1A 5CT8A 3Q9LA 1YGPA 2DCMA 3OJEA 3TW4A 4DCVA 3PJDA 3MAAC 1QBKC 1U0LA 2NXJA 3RROA 1F14A 4AJPA 3T9DA 3PUZA 4F5EA 1F2DA 1HE2A 1VG8A 3D2BA 2IELA 2ATEA 3QSGA 1FP6A 5IAJA 5TLSA 4HGQA 4IEFB 1A2BA 1WOMA 2F1KA 1D7OA 4P4SB 2O7VA 2BHRA 1BMFA 3PPYA 3KHTA 2ZM6B 1WB6A 4FNAA 4X7RA 1SU4A 1I4OA 1KYWA 1VE7A 4JLAA 4NK4A 4Q9KA 3HYCA 2NU6A 4MXDA 4PHGA 3UZUA 1J99A 4P7KA 2Y1EA 3ITKA 4TV9A 3O38A 4YUAA 1H69A 1V11A 5K01A 3X3HA 3ZGZA 2YV4A 3E15A 2W6OA 3KZOA 2QX9A 1JILA 4M7PA 1PV4A 3GK3A 2FRDA 5JQGF 1R0YA 4N18A 3D4OA 4Q9HA 5LMCA 1C14A 2IOQA 1JWAB 4MWEA 5IH3A 5BW4A 2OM6A 2VNHA 3IP6A 2HF8A 4B75A 5FWNA 4KVZA 4EL0A 4DUGA 1RXUA 4BWVA 2OCPA 3A1FA 4TWJA 1J24A 2R96A 1AG9A 4X45A 4CXMA 1J7JA 3FY4A 5FR1A 3OWXA 4KRGA 3LIPA 2G80A 5C4GB 1TF5A 3WA6A 1PS8A 2ZIUB 4JB8A 1JHVA 3TR0A 5H3CA 4P80A 1GTL1 4WDRA 4PLPA 3DOCA 5AMXA 4BB0A 2IZ1A 2JPDA 4JB0A 5TS2A 2ZTHA 1L5OA 5DBEX 3UJ6A 5ALRA 3ELYA 5LP6B 2ISSD 1M7GA 1CETA 2DUNA 4MYRA 1OYYA 2PWYA 3WNBA 3WK4A 3B7WA 3OX4A 5J4YA 5ESXA 3EQ6A 1XQYA 2JIPA 3V1KA 1BH2A 4B7XA 4KR3A 3LUFA 4DCNA 2Y76A 4DCPA 3EGWA 1RJFA 1RACA 1HLDA 3GN1A 3I6MA 1C3JA 1PTKA 1J0AA 1W1IA 4N5MA 3AGQA 3UJ9A 5FTLA 3T4UA 4GIBA 5C7IO 2JARA 1CFJA 2H2AA 4ZT5A 1KZ6A 2VCHA 1VCMA 4YREA 3DL2A 4EEZA 2JA1A 2IS2A 1MFPA 3C48A 1XXHA 4J1QA 4JNCA 5CJJA 1ZRNA 2BGLA 5DZSA 2QIPA 5LSAA 1N1MA 2PR7A 1LPNA 1ZH4A 2GLUA 3ZTTA 4CDMA 4FDMA 3CMCO 3V8EA 1BCRA 1FUYB 1M2WA 1VGQA 4FFDA 2RJOA 5ALQA 5EA2A 2A0YA 1CUJA 3L1HA 1OMOA 1NHWA 5E7JA 3IYLW 1SC6A 3QLUA 1YCHA 3HCAA 1I2DA 3OCCA 1LI4A 4C0QC 5LZ4A 3VSBA 3C85A 5E7MA 2ODPA 2ZIGA 3K6KA 2H1LA 1XTBA 1XSEA 4YV2A 2NUBA 2C2MA 3DEJA 3PKZA 2C4UA 5DF1A 1BRMA 4MVXA 4ANFA 2HTEA 3F2IA 1K6JA 3SZLA 3U17A 2E89A 1L3CA 2NQ2C 2Z9DA 2B2CA 2OFPA 4TS3A 4KPYA 1JQDA 3C70A 4XYMA 3JV7A 4HXGA 1E2GA 5CFZA 1TFUA 3T7TA 3GLUA 3VR5A 1MH9A 5JAZA 5KNCD 1WB9A 2IBSA 4Y9SA 4OHCA 1Y33E 4V2IA 4DMMA 5DM1A 5AQEA 3T7SA 2QDKA 1VMDA 5CGZA 3WMWA 3AOEA 5BSFA 2H6EA 3P2KA 2OBXA 5IMBA 3VMMA 4XJTA 1PJ2A 3CNOA 1PZNA 3G2QA 3I9FA 4YCLA 2EARA 4RY8A 1H2WA 4FZRA 3O0TA 4CCSA 4MX8A 3I04A 2R00C 3KIPA 4GUDA 4Q48A 4RZIA 5IASA 2GPSA 3T52A 1NJ8A 3L5OA 3CCFA 3JTEA 4QODA 4C3OB 1E0JA 5HF6A 2O8EB 2C03A 3WWZA 3KYDA 3FCOA 1CXZA 1T9HA 4AJLA 4ENRA 3I6IA 1BE1A 2WF6A 2JKYA 2YRWA 3I8OA 5EUQB 4Z4EA 1IBLB 3CC8A 1KBOA 3F5SA 3PVZA 1NC1A 4M1WA 3S29A 4EGQA 6GPBA 3WB9A 4I5DA 4OFXA 4WZZA 2V7VA 2VPZA 3UAXA 1YE5A 1IUNA 5KMGA 2XNDD 4MUFA 4U6SA 4W9RA 6PFKA 1WXXA 3KPWA 2JJ8A 2DFTA 1U2DC 2WTNA 3KCNA 2Q4BA 2VHJA 4B87A 2I8CA 2I7XA 1NIPA 2ZITA 3C3EA 4CMKA 1D0VA 2VHUA 2H7XA 1CY2A 5AH0A 4BGUA 4JLWA 3M1YA 4GRDA 1M6VA 3I23A 1RC1A 3FRHA 5KMGB 2D7DA 2BFCA 1IVNA 5IXJA 2OC9A 4E1VA 4KGDA 5JBNA 2J0EA 3O1LA 5AUOB 1L5WA 1GRQA 1DKQA 3MWJA 5A5DA 1M6VB 3HZOA 4MWBA 4JASB 1CVIA 2CXRA 5HBGA 4CI0B 5C5CA 5K0TA 5LJIA 3KO8A 5MGNA 3PGVA 3SR3A 1NRXA 2ZBUA 4IHAA 3D4NA 4O2BF 4XVQA 4QU8A 5KPJA 3JYLA 1BGWA 2GFIA 5EJAA 2IOFK 1T9GS 4DLTA 4M83A 5CEEA 5EIBC 1F8XA 1IHYA 2PUVA 5JOQA 3M3PA 3U56A 3KOYA 2R8OA 5AK0A 4YJ2F 5E9AA 4HRYA 2HXGA 1OI4A 5ALWA 3VU0A 2CW5A 5CTJA 5DNUA 1MC8A 3AY7A 4UNIA 3RU2A 1JDVA 4JELA 3O4RA 4MRNA 4BZQA 2V7GA 4DLXA 4OK6A 1EX1A 1CEXA 1FFGA 2FZLA 4KWCA 4BFLA 4RTQA 3BS4A 4M60A 4FFRA 2FUCA 2IWRA 4Y1FA 1I4TD 3AW8A 4RD6A 2G36A 2HU5A 1CHNA 1UAGA 2F4NA 4Q4JB 5BN4B 3VNQA 1Y1TA 3FDJA 5D2CA 4IXNA 4KBFA 3VU8A 3ZE0B 5FBRB 5AVVA 1QK4A 3OSZA 3W78A 4ZCLA 4MIKA 3WFJA 4DG5A 2QGNA 1K8YB 2VIIA 3LD9A 1EZ1A 3K1AA 2C58A 1A9YA 3EE6A 3B1WA 2B78A 5ALEA 3WIVA 1TGVA 1TU0A 3SX4A 3UC9A 3JQ8A 3NT2A 5EMMA 2P2CA 1C1YA 1K0UA 3UGQA 1G8PA 2RK6A 3OLZA 4BNDA 3JALA 2O0HA 4OIMA 1GNPA 2VDOB 1FL9A 3BSSA 4L2IA 4L78A 1Y0BA 1YUBA 1ZS9A 2F9LA 2I65A 1U99A 1BJTA 5HBRA 3JD1A 4CTMA 3FTFA 2CD7A 2FW8A 4KQMA 1MB2A 2BUCA 3R3JA 1G8YA 4OHOA 1U02A 5TT1A 4BNDB 3NP7A 1U3TA 2NZ8A 2Q21A 3PGJA 4WKBA 4ZYVA 4Q6BA 4FLEA 4WY2A 3ROZA 3WA7A 1ISFA 2EFDB 1WDKA 1UXIA 1EFCA 5AHKA 4E3ZA 4JGGA 2BLLA 2QUZA 1L4UA 1QAQA 3G23A 2CJFA 4LJYA 1G8MA 2LDBA 4ATNA 421PA 3E7WA 3UENA 2I3BA 2WG1A 3ZHSA 5J5AA 3VOSA 2B4TO 4DLVA 1YOVB 3AM1A 4H3VA 2GAJA 3DLPX 2IUFA 2KQUA 4KCGA 3UMGA 4RHCA 2VO1A 1AS0A 1REQB 4KKXB 4RKWA 2ZYWX 3CZPA 3ZJVA 4MV6A 1AUVA 4C4YA 4IIVA 4RCZA 2F3PA 2H7VA 3IIMA 3FLEA 1X9IA 1KDYA 1OLOA 4OXYA 4E13A 2AVDA 3RG8A 1AXGA 3VU1A 3I2JA 3MJDA 3NHJA 3UNXA 4EPYA 1A9PA 1RM4A 3RU7A 1NJSA 5A1TA 3ZE6A 1CUIA 1FFWA 2N42A 4CDNA 1NF8A 3DOOA 2AE2A 4JCCA 3V3KA 3PJFA 1XG5A 3MINA 1V16A 1NUPA 5SZHB 3GEHA 3D7SA 2W11A 1ZJ6A 1ICEA 3D8TA 1JG1A 2W8BA 1JT9A 5C31A 1V39A 3TX6A 4O3MA 4QYXA 3CNLA 4LF4B 2O05A 4TMYA 3Q3JB 1UOOA 2DFLA 4O33A 5FV7A 1P9WA 1STOA 1K2VN 1V16B 3CH5A 3RYFB 1GUZA 1HOXA 3NX4A 3CRVA 3CVVA 1RI2A 3CURA 4BMOB 3OE7D 3ZBQA 4XDZA 3RQSA 1OBVA 1O5IA 5KAMA 2AR0A 5TPWA 2Y0PA 2ZRGA 2ZDQA 2NXWA 4D9IA 4UTVA 3VKGA 3NHKA 4H31A 3U5TA 1CJKC 2VDUE 1T5SA 2XKKA 2XBMA 4Z1MA 1KK1A 1SKQA 1YASA 2NT3A 2PZKA 2YXDA 5DK6A 5JVDA 3GMIA 3VR6H 1KQGA 5TDHA 3ZDCA 3UH1A 2B5OA 3PNYA 3TKLA 4QFCA 2ZYRA 1DKOA 5M29A 4GI5A 1JU9A 1BS9A 1Z0SA 2FDXA 4F04A 2QMOA 4IMRA 1W76A 2OOKA 4G5GA 5JVDB 2H2FA 4HB4A 4R3NA 4U2BA 4E15A 4UW9A 1N36B 3FRIA 2G82A 1MZPA 1XFDA 1U6KA 3TCXB 3L7YA 1SNYA 4IDCA 5DYTA 4DLZA 1QRRA 3BE8A 3OIDA 1Z6YA 3IKLA 4LMRA 3NVAA 3O1HB 5K0FA 5K03A 2ZQ5A 3RSQA 3AESB 3DDZX 2M1XA 1I7NA 3O93A 5DM4A 4P3XA 5IAAA 2K4MA 1EM6A 1GTZA 1R0KA 2AJDA 2GARA 2HCRA 2JEOA 4QUKA 1MDFA 4KN9S 3L40A 1X3LA 4CRWB 4D45A 4ESVA 4TRNA 3LIIA 2NQ8A 5EKXA 1I1NA 3RRMA 1D1TA 4M4SA 4D9HA 4L22A 2RAFA 4IRMA 2JAUA 1B6GA 4P54A 2XMBA 4TWZA 3D59A 2EWMA 2B92A 4ZEXA 1X1EA 4A27A 3A0RB 3MOGA 3P9NA 5TNXA 1LX6A 2QUIA 4FHZA 4R6XA 1T0UA 1C7EA 2H1SA 1MA3A 2RARA 5FNVF 2X0EA 3RLIA 4DBLC 2VLIA 2J0UA 4UKDA 4ALKA 3M5CA 3DWFA 1XQ9A 3L7KA 1N4AA 2C57A 5E4FA 2A35A 4OLFA 2Q7DA 4K9RA 2PA0A 5C3MA 3H8VA 1KS2A 2Y1FA 3H04A 3ZHOA 2M98A 5BWBA 4DMCA 1DFIA 2J0UB 2DF8A 2PJZA 3ANYB 1XPUA 4EK9A 3T7KA 4G3XA 4TQGA 3LQYA 4G23A 4US1R 1V0JA 3EOBI 1NVGA 2H0RA 2QB5A 3ZC3A 2XQFA 4NMHA 1DUVG 4YDHB 4Z7QB 2CV2A 5HIMA 4L1KA 2DPMA 4M1OA 2PUFA 4HN4B 2DUMA 2N3ZA 5ITZA 4J7CA 3CLSD 4NTZA 5IBPA 1W94A 3UXHA 4YUYA 1NXPA 2ZPAA 1DMRA 2BOVA 3LVFO 3NOXA 3G9QA 2UVPB 4F12A 3UOGA 3RS9A 4N5NA 3AJDA 3O90A 2ZWAA 1Z34A 1UIRA 4HDKA 3ZYCA 5KJ1A 3HRHA 1K2WA 1LNQA 1R6BX 1RI1A 2QD2A 4JS0A 1J00A 5D5HA 5EJ2A 5IUKC 5I7VA 2DLDA 5J59A 1ZINA 1YQTA 1A9XA 1JV2B 4E07A 1ZAYA 1EDOA 4IVRA 3A9VA 3QXSA 3I32A 1Z5WA 2R1TB 1KIMA 4HLUA 3DNMA 3L8CA 2D62A 4PV7A 2WAOA 1ST2A 4WLNA 1FJXA 1DTWB 1SD5A 2Z9BA 1A9XB 2PH7A 1X7WA 1ZQ9A 1HLPA 1YE8A 4IV8A 4LF5B 1FJGB 2XOKD 2COKA 4YRGA 3K1JA 5DDIP 1F48A 2B0CA 5GJBA 1HKHA 1NMXA 3PQEA 4UFNA 1YZTA 3KR9A 2EKBA 4QXPA 3ZVMA 3CKMA 4N5DA 1XD2A 1NDHA 4HRVA 1YUNA 1GITA 2FFJA 5FAXA 4DMKA 3SWWA 1NP7A 2VBCA 3JS5A 1PEKE 5EKDA 2XMQA 4IEEA 2ZBVA 5LLDA 1HE5A 1GCGA 3TPZA 4AK9A 2F8TA 3SQXA 1N5JA 2DVMA 2MSKA 4MLZA 2ZSKA 4WJKB 4EY5A 5MN4A 1D7AA 3LYLA 1SJ9A 3H9UA 1Z6PA 1KFKB 1PG0A 2BKEA 1XD2B 1KVUA 1ISSA 2XDQA 3A6DA 4MW5A 1XMVA 2YWRA 3F6EX 3R6LA 5JSKA 2VPPA 4XVHA 3P9CA 4YASA 3P26A 3HJFA 2JD0A 4NCHA 1X1DA 2VDMB 3P9SA 4WADA 2GVZC 3IDZA 4B44A 4DSZA 3HL0A 4MYHA 4D0RA 5HIKA 1P2DA 2RI6A 5J63A 3K8YA 2VF4X 2XXAA 1AHNA 4N3CA 1E2BA 1R8YA 1CY4A 3OOHA 3REQA 2RKBA 1MNAA 4F0JA 3PQDA 3R23A 2AW5A 1UKYA 1L4YA 1CVLA 3L77A 2FR1A 4NPAA 4XD7A 1QMGA 4J0FA 5FPKA 4RVOA 4IW3B 4MV7A 4BVHA 2YRFA 4NJMA 4QYIA 5EWJA 3REQB 4AD8A 4DBZA 4LX8A 1JLRA 2P9QA 1RVV1 3ABRB 2KS6A 2X0IA 3DDCA 4MWSA 5JH7A 5HXAA 4NBRA 3CVYA 1IAVA 4JLOA 2JRCA 1I7LA 3PFBA 1MJHA 4WK2B 3NV9A 5EXDA 5B1HA 1W9MA 2Q29A 3ONWA 5EWJB 4EW3A 4KR2A 3U7JA 4FN5A 2LP4Y 3Q6NA 4OPMA 4BQQA 4KQIA 1BDIA 1WR8A 2ZAMA 2BGTA 3OT1B 3WLSA 4UOZA 2BR4A 1RR6A 2X6RA 1CR0A 2RHBA 3F7TA 5EN4A 3CBGA 2LNDA 2PXCA 3O8QA 3TZCA 5EJEA 4P38A 1OROA 5HMMA 4IFIA 5A9TA 3ZZ0A 3UPTA 1LGYA 3HP7A 5BNZA 5CCBA 4YI5A 1OH8A 1CCWA 3Q0EA 4P7JA 1AGPA 3HV0A 2OPBA 3C7KA 3GP3A 4W8HA 5EHNA 1QGED 3O8QB 4NG4A 4DSAA 5ADWA 1V5GA 2WT8A 3E6AA 2BONA 5KVSA 4YUWA 4RNDB 3UQYS 1NJ5A 5HCNA 2WQZA 2PUGA 4MKXA 2YYSA 3DT8A 2CXQA 3A1TA 4MIEA 4PBTA 5F3RA 2NXEA 1NI3A 2HA7A 5K3SA 4P2BA 4FWTA 4WUTA 1FLDA 1I6LA 1MPXA 3GOHA 3AXSA 5JQGA 1VL8A 1KI9A 5JDIC 2REQA 2P3LA 4X44A 1J6UA 721PA 1QRUA 1X13A 3TBKA 3TM4A 4B6JA 3GFVA 1D5WA 1Z47A 5AT1A 2E0IA 2VUHB 4ZHQB 1FF9A 3L7MA 4XVRA 5TMEA 4AF6A 4BN0A 4LDRA 4GLFA 1L5RA 1AUPA 1SCJA 4IHKA 1QORA 121PA 1QZUA 1FOEB 2HV9A 4JP3A 1N7GA 3M70A 5ECGC 3ZV5A 1P2GA 3WQQA 2F1JA 2ZATA 5KNBA 3ZE7A 1FFBA 1URPA 3P52A 5DHAA 1E94E 5JFTA 1KDTA 1NQWA 4UFOA 4W8GA 1G98A 3ANXA 5LXTF 3SR0A 5A5GA 3KHKA 4Q01A 2Z2XA 2H4YA 2W6ZA 3L6RA 2GN4A 3IGFA 3LX4A 4RPJA 4XGQA 4DA6A 2M2IA 1LQUA 2PY6A 2C7GA 2YR0A 4UBOA 5E1BA 1Z2DA 3C98A 3B78A 3TOSA 3G0IA 3G2PA 3OOJA 1U1GA 3ZLBA 4BO2A 5B2FA 3TIFA 5JSUA 4W5HA 4KMOA 3ZDDA 1Z8HA 3JQ9C 1M1NA 2FOLA 2GJ8A 3VKFA 5IULC 5KYYA 1MT0A 3EFOA 4E32A 1HT1E 1P1JA 3CUVA 3VDQA 1KMQA 5EJMA 3EDQA 2PGNA 3ZCRA 2NP7A 2P9ZA 2C2GA 3PUKA 4ZI7F 3HLYA 3D3KA 5AM3A 4B74A 2V96A 1ZR4A 4O1IA 4BO7A 3A11A 1YQ9A 3M4JA 3UA3A 5KYYB 4M89A 3HVHA 1JDNA 1LNSA 1JG2A 2VXOA 5E6UB 1CULC 1E77A 1MOPA 1SXJE 2WIBA 3F8WA 4I50F 4KJXA 3DTVD 4C7MA 3UJHA 3PEFA 4DDMA 3VZSA 1HA3A 1PS0A 3QBJA 1TNDA 4MJ3A 2QTRA 3KAQA 2ZZNA 4C0AC 1NMYA 2QQEA 3QWHA 4I55F 1JJAA 3VBCA 3BRQA 4H4DA 2FWBA 3RVBA 2XCOA 3WIBA 2CF6A 1CQIA 1T4CA 1Z88A 2I2DA 2IUTA 3RC8A 3HFGA 3UMFA 3RK0A 1FYWA 2H0AA 4HQRA 2V4MA 2G88A 5H5JA 3UJ3X 2JDIA 3GA5A 3PE4A 3UWPA 3ZHYA 1ZK3A 1QRAA 4OI2A 1NUSA 4L8GA 3BWVA 3CLVA 1JIIA 2B69A 2B8WA 3U1BA 1CQIB 1ADBA 1T4CB 1VPTA 3BERA 3M33A 1T1SA 1R8QA 4YTEA 3T1YB 2M6LA 2SKDA 4LQ4A 5AVZA 3AFIA 1I7DA 3BB3A 5TEVA 2NPFA 3ZWKA 4YRIA 5B1YA 2WJIA 1IM8A 3M1IA 4BVBA 1IUPA 3NM6B 2VA8A 2XDWA 3PL5A 4FFOA 3EVBA 4GP7A 2YHIA 5BUCA 2NUTA 4HPWA 1F4PA 1DELA 1JHYA 1IG0A 1TADA 2Q27A 3A31A 3SAJA 4EF4A 1J0BA 3OTWA 1P19A 4QQ8A 3AF2A 5GONA 4LDNA 1N8TA 4BE4A 5A06A 1G0OA 3AR7A 3LBHA 1LCIA 1WETA 1BXGA 4FHFA 1RZRA 2FHPA 1GTVA 1AQ6A 4G5FA 3TL6A 1C3OA 1ZZEA 1TYBE 3U3KA 2O9JA 2O2ZA 1GZ5A 1Z4PX 3UANA 4E6PA 3BWDD 2GVNA 2IEYA 4TL8A 2AZXA 1WZNA 1APBA 1S2NA 3MOSA 1KQFA 3U7IA 1GU1A 1NF2A 1KU6A 2B8EA 1YVUA 2WP8J 3PFIA 5F2OA 3ZJ4A 3H9BA 2PXHA 4JI8B 1FUKA 1UP4A 1KI4A 4M53A 2ZI9A 3GAMA 4ZT6A 1PEAA 1CDZA 3EBOA 3VUFA 4WLFA 4GLJA 3SFTA 3U48A 1K6XA 3S2EA 3D31A 2NO5A 1ZM4A 1UBHS 3PHBE 2NTJA