3L9AX

Structure of the c-terminal domain from a streptococcus mutans hypothetical
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
MRDFFVITNSEYTFAGVHYAKGAVLHVSPTQKRAFWVIADQENFIKQVNKNIEYVEKNASPAFLQRIVEIYQVKFEGKNVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords uncharacterized protein
publication title Structure of the C-terminal domain from a Streptococcus mutans hypothetical
rcsb
source organism Streptococcus mutans
molecule tags Structural genomics, unknown function
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.350 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l9aX01
3L9AX
chains in the Genus database with same CATH superfamily
2B2WA 4C3IB 3MAQA 4ID6A 1PZKD 1YNJD 1VS0A 4IUPA 4K8JA 1I5FA 1WD1A 1D7QA 2L0CA 3NPPA 1PA6A 2K4KA 2B2TA 3CRLC 1D1IA 1S3OA 2K5QA 2F0DA 3DUZA 4EX5A 1WTVA 4G7ZC 3JAMc 5KIXA 1E22A 2R93G 1E7ZA 1MI2A 1WFQA 3SK6A 3M3YB 1PFSA 1VF5C 3GTJB 1WYDA 1OTCA 3HOWH 2HQEA 4DAVA 2XGTA 1H9SB 3HOVG 1XTCD 2L1BA 2PW7A 4RGOS 3T4AC 5IWAL 2PQEA 3U4VA 4LK1C 1T9HA 4ODGA 2ZXRA 1OXVA 2CHBD 1RODA 4CJ0B 4GOPA 2K1BA 5FO9B 5E7NA 5CBEE 2JA8B 2ZJQA 4UP8A 3A8IE 1QUQB 3HKSA 4X66Q 3I73A 3V2TA 1O78A 3PQIA 2CW0C 4JW0A 3CCLA 1L0WA 5KNCA 4JI5Q 1EIFA 4KD4A 2PI2A 3TSSA 1Z7TA 5KRUA 2NVXB 1AFPA 1TWAB 2FHTA 2E2HB 1X3QA 1WTWA 2MUYA 1LTAD 1G8ZD 2BH2A 3CCSA 1BDOA 3U4ZA 3I4NG 4DNRB 1YNNC 4OXPA 5FJ8G 5E1FA 3TN2A 1LYLA 4QCLA 1G291 3VR4A 5EQ0A 3H09A 2NYZD 2B39A 1HFNA 3A7AB 4CHTB 3PIP3 3PGZA 2HD3A 1D6EC 1V9PA 3K5NA 2IHFA 1BOSA 4B3RL 3BVGA 2BH8A 2MFIA 4CKCA 2ASBA 2JEBI 3BU2A 1PTOB 3AMUA 3R8BA 3G48A 1I94Q 2FFKB 4F88A 1BCPF 1MKHA 4UDUC 1RJTA 4P2CB 2L55A 4PMCA 4NXMQ 5C44B 3Q8DA 4LNQA 1DD2A 4R4OA 3TZDA 3PV0A 2AQ1B 2EJMA 4XQNA 1TWFH 4CDCC 3K0XA 2F0JA 5JJLA 1S5ED 4KLKA 1EZ6A 3AU7A 3AQQA 3JC66 1IBMQ 1HZCA 5LL6S 3J81c 3T53B 4RHSA 4R4TA 1Y69U 1B1ZA 1SRUA 5BR8Q 1ML0D 2F0EA 1KC8C 4X65Q 3PUVA 3CXCA 3BG3A 4EQPA 5TSSA 2I07B 1HRJA 1N32Q 4KKTA 3AYHB 4A3JB 4DXFA 1JJCB 1TY2A 5G3LF 2L15A 5IGFA 3NQIA 4MNOA 3BDOA 5IP7H 3I4LA 2B8GA 1EQQA 3S14B 4JI0L 1L1OB 3GTPB 2B2YC 4KKUA 1I6VC 1E3PA 3BZDB 1KQSA 1HNZL 2JE6I 4C2MH 1H95A 3PO3B 1AE2A 5IGBA 1EOTA 5JEAJ 1SLJA 2K5WA 1EWCA 5C4JB 4OEMB 4L5SA 1S4ZA 3OOCA 1B4OA 1C7YA 1Y8NB 2K5VA 3NBIA 1FNWA 4DV3L 3H3VC 4ABNA 1F2YA 2NVTB 3AFQA 1RTOA 3RN5A 4DV2L 3NEMA 5ELCA 1VQFA 2HIXA 4HIOA 5FLMH 4WFN3 3KFUA 3TQYA 4IFDH 1SNPA 4DV4Q 1B9NA 1WTOA 3P7JA 3DWQA 5CYUA 4B3TL 1NUCA 4ULLA 4PZ6A 3SK4A 1SFOB 3C46A 1X56A 3P75A 1FR3A 4DU9A 4R1JA 4L5RC 1WJJA 2GVBA 2I5MX 1UWVA 4NDXA 1JCKB 5JPNC 1KLUD 3HOZB 1A15A 4JC0A 4C1NI 4IPGA 4B3SL 2LSSA 5D3DA 2F0OA 2E2IB 2Q2IA 4HMIA 3WOFA 4DNTB 4LF4Q 2E2DC 2UXCQ 2E76C 4QL5A 2DN8A 5J22A 4IOCA 3M85A 5ELOA 1BNZA 1YJ9A 1SN8A 3KDFA 3Q24A 4WJWA 3VR5A 1N33Q 3KF8B 4C3HG 4ZK9B 2FINB 2Z6BA 1ZXTA 4DKAC 1CKOA 3PIOA 4A4IA 2AWNA 1LTID 5CV8A 3F1ZA 4A3KH 1CHQD 1E2ZA 2R93B 1KD1C 1O7IA 3GTLH 1HR0L 5J3BA 4B3ML 3JAML 4YHHQ 2VQEQ 5M5XB 4LJZC 1PRTD 4RGTA 3HOVB 2Z4HA 2VUMH 1EY4A 3HKZE 2EVBA 4R8NA 5IYCH 3X3NA 1B53A 3HOWG 3KYHC 4BXXH 2K04A 4FF2A 3ULJA 4Y7NB 2R92H 2A6HC 2L4NA 2B2VC 1N34L 2P5ZX 4AYBG 1TWGB 5IGEA 1BUVT 1CQFA 1YHBA 3JAMi 3F8TA 1HPCA 5IWAQ 4R4IA 2MO0A 2ICEC 2Q2TA 3NWSA 4RKBA 4X64Q 5K5PA 1G51A 1U0LA 4M1UB 4APVA 2ENBA 5FKAC 2K05A 3J80E 1IBKQ 4H13C 2B63G 1F9PA 4Y52H 3A8KE 4HSPA 3NE5B 3QWNA 4L5TA 1BR9A 1YEZA 2A74C 1SAPA 3URYA 2E74C 2TSSA 4A3CH 1D2BA 2YTYA 1E2VA 2CH4W 2K5NA 1PMRA 1HXYD 4TQUS 4A3EH 4MIUA 2RBMA 4H44C 4GKJQ 3F2CA 4V190 1A2TA 1AN8A 2MQHA 4GZYC 3FKIH 2H5XA 5J1ZA 4K6DA 1BO0A 3PCOB 2B29A 4HIMA 1KXLA 1VQEA 3W2DA 4K5WA 4S3SA 5ELDA 2RVLA 1PH3A 1YIJA 1DOLA 1GUOA 1TXYA 1H9SA 1F2ZA 3AFPA 3I72A 4R4CA 5HURA 4FF1A 1Q8KA 3CQZB 3CU7A 5LHY1 2F3IA 4DR1L 1N36Q 4JI8Q 2K03A 3ULPA 4LF9L 1EFWA 3KLWA 1QG7A 3ERSX 1PYWD 1TQOA 1SXTA 2KEDA 5GROA 5K36G 2WAQB 2CCZA 4N9PA 4LAAA 1NBWA 3I70A 5I9OA 4NPSA 4MTNA 1MJCA 3K7UC 3J81L 1EYGA 4IPCA 1CUKA 3HOUH 1EIHA 1GO3E 3SVMA 3EJIA 4UP9A 3CMAA 4LF8L 3NHHA 4HJ7A 4JPBW 4QJFA 4DFAA 3DMUA 1NR2A 1XX8A 3A74A 3BZCA 1JB7A 4JI3L 4KN7C 3W1GA 2EXZA 1VQPA 1CQVA 1NCVA 2ZM6L 4CGYB 2QDLA 1S40A 2EYLA 4RMFA 1D5XC 1MBYA 2F52A 4LUZA 1MJEA 1F2LA 1J5EQ 3J81i 1CKNB 2KQ3A 5IP7G 2EQSA 3G6JB 1R9TB 3CMEA 4IUQA 2RDFA 2YV5A 4LFAQ 3BS1A 1A0IA 4YY3L 4JI4L 3M4OH 2RHQB 1HQMC 3H3VI 4HJ9A 2WKCA 4BS9A 1IYJB 2BCOA 3M7NA 1A63A 4JI0Q 3R2TA 3G71A 3VDYA 1UNSA 1WTPA 1TVXA 1RCVD 4R9WA 1K8AC 2JA5H 1LV9A 1ASZA 2SEBD 4V0BA 1EOVA 5KEEA 4EVOA 2KCTA 4IN3A 1F9QA 1IHZA 3NK9A 3PF5A 2J0TD 3OHXC 4DK1A 4FXDA 3L7ZC 3MZ5A 3RNUA 4KMUC 3I4NH 2CWPA 5CV5A 5LMUL 3FVQA 1LT5D 5FLMG 4NXNL 3J7YW 4DV3Q 2NUCA 2OQ0A 4GN4B 3S1QB 1EEFD 4IFDG 1EWHA 1LO5D 4FVMA 4LF7L 2OTJA 3S17H 4DV2Q 4DR3L 1B50A 3RLOA 4J8QA 2QCPX 1U5KA 1EQTA 1EZ8A 3L3OC 4DUYL 2E2JH 1X54A 1LT6D 3K6OA 2Z4IA 2LXKA 1D8LA 1B2TA 1UE6A 5C4ZA 4B3TQ 2RCFA 1CSPA 5IP9H 4A3LH 1C8CA 1L1OA 2DUDA 2UXBL 2YU9B 2UUCL 4C3HB 1EU4A 1O7ZA 4KTAA 1NSNS 2Q8TA 2MHVA 1UEBA 3GP7A 4LFCL 5GQOA 3DHQA 4A3BH 3A0JA 1STAA 3FRPB 2ZTCA 1IKLA 1KNAA 1QILA 1A2UA 4A3KG 4DR5L 2B8FA 2F0SA 3ONAB 3I2ZA 4ZLTF 1EY7A 5FK9C 4P72A 2ZT9C 3HOWB 1IW7D 5KYIA 1CKMA 2K14A 4H02A 1QZHA 1Q12A 1M1KC 1W2BA 2VUMG 1SNOA 4PNYA 3TRZA 1T5XD 1F9RA 5IYCG 1HR0Q 3RZOH 4B3MQ 4AYBB 4HJAA 2EYHA 2Z0SA 1SJHD 1L0YB 4X3KA 1QVCA 2EZVA 2R92G 1EQRA 1STGA 2C5CA 2BDOA 3W1BA 2JA7B 1H9JA 1DONA 1U9RA 2AQ3B 4OWTB 1XMOL 2FJ2A 1DZ1A 3E6ZX 4DV7Q 2F0FA 4IPHA 1SNDA 1ESRA 1IYVA 2O2LD 5CV6A 4F87A 5COYA 4ZUIA 1PTOD 4BY7H 1I3QH 2WP8J 5A2QE 3D0FA 1Q1EA 2NBFA 1N34Q 2WB1G 3K0YA 3X3MA 3A5ZB 4E6IA 5JJIA 5IGCA 3PF4A 3KF8A 1Y14B 3I4MH 2ICIA 2R61A 4A3CG 1PFBA 2KECA 1A62A 1SE3A 1JR0D 3UE1A 1DCZA 4G4KA 1U4LA 3J7AF 1PH9A 2F4VL 5FLXE 5ELNA 4A3EG 1B3AA 1E1OA 1EU3A 1E24A 5JAVA 3EROA 4AQYQ 1SMYD 4PZ7A 4UPAA 3FKIG 1I6HH 1BCPC 4KJNA 3RZDH 2AHOB 5IT9E 4P75A 3STBC 1Y1VH 5EKLA 1I50H 4RHRA 1NE3A 2WIIB 2LKVA 2GN5A 3D31A 1X3GA 1SROA 1HJPA 1TWCH 1WTRA 4PZ8A 1TWFB 2KCMA 4UY8C 5ELEA 4X62L 1HUMA 4K5XA 3MXNB 2G9DA 2PMZB 3U9OA 2XWJB 3A5UA 1EY6A 2JEAI 5D14A 4DR1Q 3GTGH 3D6CA 3NTKA 3K8AA 1A8VA 1ZKOA 1BF4A 4LF9Q 3HOUG 1B8AA 2RKSA 3MHBA 2F0VA 2K28A 5JJZA 1YI2A 2ZTEA 3OW2A 1M90C 4GLXA 1QOHA 4LF6L 3AEVA 3L9AX 4QIWE 3M9BA 1IZ6A 1YNXA 4NB3A 1HZBA 2K7VA 4OL7A 4DUZL 1N8RC 3OSOA 1U4PA 2JN4A 4JG2A 2F0MA 3QIAA 4OO1H 2LXJA 4JOIC 4RCOA 5EGTA 4JI3Q 1JORA 4JI7Q 2ZM6Q 2A5HA 1FNUA 3U50C 4C2MB 5H1SE 1SDFA 4POFA 1JOQA 5EAYA 3MTSA 1U4RA 2EY2A 1M4VA 1LTGD 3J7AV 1CTMA 4XQJA 5C4XH 1VQOA 5EBCA 4YY3Q 4A3DB 5C3WA 4JI4Q 3OTOL 2JA5G 1VF7A 2B63H 2EYFA 1A3TA 1J6QA 1VQCA 2F0GA 1Z6HA 2IHEA 3K59A 3KF6B 3ZYYX 1QE6A 1NMGA 5CORA 3UDFA 2D62A 4DN4M 4LFBL 2SNMA 1PFMA 3PUXA 2MPMA 1BCPB 4KV6A 1AZQA 3MA2B 3T1HL 3KLRA 3E0EA 1XMQL 4OIJA 4OIKA 1VQ9A 4L6TB 1ZYRD 1FGBD 3SEBA 4DR7L 3ND8A 1U4MA 2I46A 1K73C 1PZJD 2B2VA 3RLNA 3CPFA 3KBGA 3CCMA 1A3UA 4A93H 2HCIA 4EGVA 2ZJPA 3ULLA 4OWWB 4NXNQ 4FNFA 2TMPA 4IUUA 3VR2A 1CKNA 3FPUB 2EXDA 2XTIA 4QMGA 1G6ZA 1LTSD 1GHJA 1K0SA 4DR3Q 2BOSA 5IE8A 5IP9G 2PQAB 4UHVA 4A3LG 1PH5A 3S1NH 4P73A 4GN3B 1TS3A 1BXTA 5C0XH 4DUYQ 1X65A 1SR3A 4C1NK 3EFXD 5K36H 2O4XA 4JI2L 3BJUA 3VYRA 4DV1L 2BA1A 2FXQA 1MGSA 4A3KB 2UXBQ 2OF1A 4FDBA 4A3BG 3GTLB 2D5DA 3EA6A 4DR4L 3K5OA 1HNXL 1O7YA 2D9UA 3BDCA 4GS3A 2UUBL 4LWCA 3KLSX 2I5LX 2JXMB 4RCNA 1R4PB 4EQ5A 4ZYSA 2VUMB 2L9HA 1WTXA 3AB9A 5ELBA 4HJ8A 4LFCQ 1EYDA 3R2IA 1X32A 2HUGA 3NTHA 4M8AA 1FVIA 3PSIA 3VYSA 1V1PB 2Z6KC 2R92B 4RWSC 5D3IB 1V1OA 2YTXA 1NNXA 5IOCA 4DR5Q 4DV0L 4LW1A 2OTLA 1ENFA 3MXUA 1BVSA 1H9MA 3KUPA 1W3SA 4JYAL 2XWBB 1VQBA 2WB1B 2J4XA 2PI2E 3MEHA 2UXDL 2LY7A 4BY7G 1X6OA 1RDPD 5C4HA 2J7ZA 4X3UA 4DK3C 2MNAA 3O13A 1XMOQ 3OWFA 2MO1A 3M3YH 5BN3A 3MVVA 3KOJA 3I4MG 1LABA 1Q46A 1K8OA 3I91A 3CHBD 4A3EB 4IFDI 4LF5L 3R3OA 1L0XB 5M9OA 3FKIB 2HCCA 1NY4A 1D5MC 2A6ED 1IYUA 3CC4A 3KBXA 1AE3A 2C9OA 3H94A 2Y0SE 2A6HD 3SK5A 4DAYA 4XT1B 3QJYA 1LTLA 3BVMA 3E5SA 3VA7A 1H9KA 1SE8A 1Y1VG 1QVGA 3GV3A 4N8FA 2F4VQ 3S16H 4KN4C 2KUMA 2L12A 2RQXA 1JMCA 1TS5A 2B2WC 5D65A 5JOBA 4HMJA 1FYCA 1B3QA 1Y1WH 4XQQA 2D0OA 2WV6D 2B2TC 3QB3A 1Y8PB 4JI6Q 3HOUB 5CBAE 2RDGA 4IFDJ 3LX0A 1RD9D 4XIGS 1GUGA 2A1AA 4FXKC 4JBJA 5C5MA 4K0KL 4X62Q 2A68C 2PZWA 3HKZG 2DJGC 1GOZA 1GUTA 5E4WC 1LTTD 1JE4A 5JPMC 2VS1A 1Z9FA 3UDGA 4BA2I 4BWGB 5LMNL 2JK8A 4DV5L 5JVH3 1KAWA 1K83H 2SNSA 1R4QB 1QNUA 3GTKH 1PFNA 1Q7YC 3D4RA 1B7YB 4LF6Q 1EIGA 1KNEA 1O80A 2KA7A 2OEOA 4OO1G 3M4OB 1GJXA 4YCWA 2HHHL 1HHVA 2XNAC 2EYMA 3CCRA 2Q2UA 4DUZQ 2O5IC 2VY3A 3FHWA 4A3IG 3VYTA 5M5WH 1WD0A 2A73B 3OPOA 2GA4B 2JA5B 2KBNA 2AQ2B 2G5DA 4MN3A 4NMZA 1TKWB 2UUAL 2RCNA 3J81j 3VR6A 5C4XG 2LFNA 3NSWA 5C6AA 1S5CD 3BYTB 4JBMA 3MXNA 4BY1H 1I4RA 3S15H 1G2TA 3VR3A 3I4NB 5NUCA 1XPUA 3I3CA 2IWHA 1HTLD 5CMDA 3UI2A 2A69C 4HCSA 3TP5A 4FP5D 2PYKA 1LUZA 2CWAA 3NELA 3OTOQ 4N8X1 2E75C 2PZUA 3UDIA 2HDLA 1AEXA 4KHVA 1QZGA 3S17B 3HS0C 1EFID 5LL6X 1FGUA 4A3MH 3GTQH 1HQRD 4YIJA 2QA4A 1B44D 3TS0A 2E2JB 2WFWA 1NTGA 3HFZB 4A3GG 3C2PA 3T1HQ 1CZWA 3SGIA 2NN6H 2JA6H 1XMQQ 5EKIA 4DAPA 4A93G 4YWLA 1EQVA 5FLXL 4YCVA 4DR7Q 2F3WA 3K58A 2N3SA 1KRTA 3K81C 3SK8A 4B3RQ 2XSCA 3UDXA 1ET9A 1MSGA 4KY5A 2K50A 5KYLA 2IT1A 5C0XG 2WKDA 1CA5A 3IKJA 4A3BB 2XN9C 2JYOA 1QUQA 4KJOA 2VNUD 1C9OA 3IAYA 3Q6SA 3CAMA 1DYQA 2ZJRA 3KF6A 1JJGA 1Q8IA 4JI2Q 3D4DA 4DV1Q 1K28A 2L5TA 1HZAA 2Q2HA 1ILQA 4R4QA 5I4DA 4EQOA 2F0WA 1SE4A 3RZOB 1HR0W 2VL6A 4DR4Q 1HNXQ 5I6YA 3GTMH 2NVYH 2ATWA 1EWIA 4N9TA 1STHA 1SYDA 4RKLA 1JB3A 1FD7D 2IPKD 5M3FH 1MHWC 3BYYB 5M3MH 5HGQA 1VCIA 2EJFC 4KHPL 1S5BD 2KCCA 1SYGA 4BY7B 1BKBA 1I3QB 4DV0Q 2X6LA 1KDCA 1Q3LA 3MXPA 4FF3A 2PQAA 5CR3A 1S72A 3OIPA 2IY5B 3OYYA 3H91A 5DM63 2Q8RE 1LACA 2VZAA 3UE0A 4ZCKA 2RSOA 3I4MB 3S2HH 2IX3A 1HNZQ 3HOXH 1KIXA 1Q81C 1LT3D 1PH7A 3CD6A 2UXDQ 3IRBA 3ER0A 1STEA 4GNXC 3D4WA 1JICA 1TR5A 3RLFA 3S2DH 1SYEA 1VDZA 2B3GA 2M2LA 3DM1A 4A3FH 3GD7A 4BBRH 1PH2A 4FYDA 2F4IA 1I6HB 2Q8IB 1ENAA 3PUZA 3RZDB 4BBSH 3J80c 1B70B 1Y1VB 1I50B 3CC2A 2QEXA 2IJ0A 1V1PA 3LWEA 3NENA 1NMFA 1PYSB 1BQQT 1TWCB 1VQJA 1HH2P 2F0TA 4I7ZC 4L5QA 4YWKA 3J7A5 3MC0B 1UE7A 1WI5A 2PNHA 3FMCA 3TEHB 1SYCA 1Y1WG 3GTGB 2LS01 3PUYA 5HGTA 1ET6A 4B9WA 2E5LL 4K14A 4OX9L 3GTOH 3G6EA 4DK6C 1SJED 1DGSA 5CC4A 3HKZB 4B3SQ 1PH8A 2EYJA 1QVFA 1X55A 4O2DA 1PRTF 3SR1A 3I56A 4G7HC 4DR2L 4KD3A 1IBML 3E9HA 3CP0A 4RFBA 1QWYA 1PYBA 4K0KQ 1EY5A 1HNWL 1BCPD 4X3SA 2BDNA 4QY7A 4CDDC 1UAPA 3JAME 3STBD 1VQIA 4PMWA 1LT4D 3FDTA 3FPPA 1Q86C 3HGBA 3G7LA 4QF4A 2BE5C 3MXGA 1OXXK 2DGYA 4HCEA 1SNQA 4DPGA 3EBEA 5LMNQ 4IJHA 4DV5Q 1WCMH 2M9VA 4H0LC 1GUNA 1TY0A 3TZUA 3F2BA 1JT8A 4IURA 4P71A 5C4XB 3Q0AA 2CQAA 5FOBB 4U68A 4GNXB 3PUWA 3S9WA 1XPOA 1Y8OB 2HHHQ 1GUSA 1BBWA 4OELB 5J39A 5JVG3 2B63B 3K7AH 4QGUA 3DLLA 3I7FA 1VQ7A 3V96A 2SDFA 5IYBH 3SDZA 2K33A 4BY1G 3KJPA 5G3LD 1I4XA 2M00A 2EIFA 4C3JH 2UUAQ 1RHPA 3E3XA 2GVAA 3ICEA 4NW2A 2Z8LA 3MEFA 1ILPA 3D3RA 1PDQA 4A3MG 3RN2A 4A93B 4O0AA 2OQKA 4ME3A 2N55A 1DOMA 4DAMA 2B2YA 2NN6G 4RGNA 4DV4L 2KENA 3I8ZA 2JA6G 1C0AA 2F1MA 3ND9A 3S1NB 2LMCB 3W3AA 2F03A 1H9RA 1X3EA 1P16A 1QCBD 1OO9B 4JV5L 2BA0A 4IO9A 4IUVA 1RKNA 1V43A 4JVZA 3S1RH 2KVMA 1K0RA 2CW0D 4DGZA 5C3EH 1A6XA 1TWHH 3MFGA 2EOTA 3DWPA 3ZJYC 3TREA 3J7ZC 2K5DA 1J8IA 4RH6A 1TS2A 1UE1A 5E4XA 2AMCB 1ICWA 1G2SA 2SOBA 5T1GA 2UXCL 5CV9A 2IX0A 1K3BC 1DOKA 2ES2A 5CV4A 1YNND 4O42A 1CK1A 1HZ9A 3C3LA 2EY6A 1N33L 3J81E 5EBDA 3M4PA 3TS2A 5IY0A 1AP0A 1MIUA 4CKEA 3N6RA 1PLFA 1EUJA 4Z9CB 5GAGC 4LF8Q 1S5DD 4OO1I 3G4SA 3CPWA 5M5YH 2VQEL 5M3FG 5M3MG 3NUCA 2X6GA 1SEBD 1JC7A 3TP7A 3OW7A 1SYFA 2KEEA 2MGSA 2F0HA 2NVQH 2R7ZH 4A3IH 2R3ZA 2ZXPA 3OIQA 3C1EA 3EIVA 4UP7A 1XTDA 4A75A 1O7LA 4PMBA 1X3FA 5E3FA 3A55A 4KHPQ 4XDXA 3GDEA 3DEOA 4JBKA 1FJGL 1VQ6A 2E8GA 3FEWX 1LTRD 2EPBA 1G91A 1IBLL 4GKKL 1SMYC 3I4OA 4U673 3HOXG 2O5JC 1J9OA 4KK7A 1NR4A 5EJWA 2I0QA 4X64L 2NTTA 1XPRA 3IL8A 4XXEA 1F9SA 2B2UC 5L37A 5KGUA 1IBKL 2F0LA 3H0GH 5C3XA 1VQMA 2EYPA 2JA7H 3HOYH 4A3FG 4BBRG 5BN5A 3J80L 4I65A 1AZPA 2AKWB 1K8MA 3NXWA 1L1OC 3T1YL 2WINB 2HT1A 4BBSG 5I2YA 4YWMA 3S16B 3CCEA 2QEJC 1L2FA 2FMMA 4A3GH 3T16A 3E0JA 1UUPA 1M8AA 4Q0FA 5LMUQ 3VYUA 1CT1D 1CSQA 1YZ6A 5IGDA 1N9WA 3B6YA 3NTIA 4GKJL 1Y1WB 1ICFB 2EYOA 1LTBD 4GLVB 4NKLA 1VMCA 4TSSA 5C0XI 4LF7Q 1YNJC 3GO5A 5FLXc 1KRSA 1MSHA 1TS4A 3J80i 2OCEA 2F0NA 4QB4A 4K6LA 2DY8A 3S1MH 4KI0A 5IT9c 1LM0A 2D0PA 1GVPA 2OXPA 1N36L 4JI8L 1GKHA 4HIDA 2WACA 3A54A 1W6JA 1DM0B 3L0OA 1PH4A 3NBHB 1EEID 1PXUA 2UUCQ 5I2XA 4Q5VA 2E5LQ 3KK7A 1WTHA 1CI3M 1STYA 4OX9Q 3CKIB 3M7GA 3T51B 2XRSD 4DF7A 2CFMA 4WJ3M 2RF4A 5EPJA 1PH1A 1K83B 2PZTA 3GTKB 3U58A 2EJGC 1PH6A 2EDGA 4IOAA 5EPLA 3PO2H 5I6WA 1CM9A 2K01A 3DEPA 5C0XJ 4PV1C 4OWXB 2H1EA 3Q23A 2I5HA 5A35A 4DR2Q 2HIVA 3A8JE 1XNRL 2WAQG 1YJWA 1VQ5A 1WTQA 2DNCA 5M5WB 1HNWQ 2CKZB 2NWGA 1VQAA 1CFMA 1PTOF 3WOEA 1WCMG 5GADC 1XNQL 4C3IH 2ZTDA 4H7BA 1J5EL 5HY6A 5KNBA 5IYDH 5JEAH 2UU9L 1RIPA 1EY9A 1RL2A 3NWTA 2WAQE 4JBWA 4LFAL 2VXWA 4BY1B 3S15B 4ZUJA 2V1CC 1ZYRC 3T13A 3C1FA 1V1QA 2R6GA 4L63B 4XYQA 3HP3A 1B9MA 2A68D 2F3VA 5IYBG 4I7AA 4C56C 3GTJH 4RAUC 2V4DA 3BVZA 4C3JG 1SMXA 1IL8A 4A3MB 3GTQB 2Y0SG 3I90A 1EIYB 4ME5A 5DLQE 3LNNA 3QOJA 1YITA 2KOLA 2RA4A 4ZAIA 2JA6B 2JA8H 2H4OA 4ZKBB 1STBA 2OWOA 1HA6A 1XWEA 1GUWA 3LGJA 5GAEC 3BZKA 4KKSA 4PG3A 4A3DH 4ALPA 1YJNA 2JP1A 2K6AA 1K9MC 2NVXH 1TWAH 1VQHA 2K32A 2E2HH 4IJLA 1EYCA 3EQLC 4XT3B 4DNIA 2ALYB 1BBUA 1KLGD 4IUTA 1XJVA 2R7DA 5C3EG 2ID0A 4QIWB 3QO2A 4GNXA 4K5VA 2VQFL 1KDAA 4JV5Q 1Q1BA 3A7LA 2QDBA 1JJ2A 2A69D 1KHIA 4LUVA 1UE5A 1ONLA 2OT2A 4HEDA 3RD4A 1VQLA 1I4GA 2A8VA 3GTMB 1GM5A 2NVYB 1OXUA 1IL2A 1PTOH 5M3FB 4G57A 4QUCA 1QB5D 4NP5A 5M3MB 4CDFC 4GOPC 3LWUA 5AFWA 4OONA 1X3PA 1OXSC 2DY7A 1E2WA 5C44H 3KJOA 1EY8A 1BBXC 4KY6A 4TRDA 1STNA 1HA5A 1TIID 1CZGA 2N88A 2RDHA 2X69A 5AJ3L 1VQNA 5I9PA 1XYIA 3GQBA 1YHQA 2R7ZG 2IL8A 4DA2A 1C48A 2N78A 2YTVA 3S2HB 2PW5A 1SSOA 3DWAA 3QG1A 4ZKCB 3HOXB 2A6EC 3CF5A 1GXDC 5DAUA 3W5OA 2IX1A 1HTPA 4DV7L 1MD2D 4X3TA 5DM73 4A3JH 4A76A 2QGQA 3S2DB 1VQKA 2DJFC 3M4YA 2KCNA 4PQXA 4A3FB 1IKMA 4BBRB 3Q22A 5A2QL 1ENCA 1FJGQ 4J15A 2AWOA 4IALA 2MP1A 3S14H 4BBSB 2QF7A 4QQBX 2F0KA 3GTPH 3OMCA 1IBLQ 3H0GG 2JA7G 4GKKQ 3HZXA 3HOYG 2IW3A 4R8IA 5FO8B 2PCFB 3DM3A 1WVLA 2HDMA 3CCUA 4AYBE 2NN6I 2G9HD 2Z1CA 4P74A 1ZEQX 4LFBQ 2EE1A 2HQLA 4DV6L 2KHIA 3PO3H 3RMHA 4G7OC 5C4JH 4POGA 4J6HA 1NJIC 1CA6A 4AQYL 2CQOA 3T1YQ 4HTHA 1SE2A 3RR5A 4XTCS 2NVTH 3GTOB 4WORA 1TU2B 1II3A 3P1HA 3KLSA 3QOLA 5T1IA 1G6PA 5IT9L 1Z47A 4FXGC 3F2UA 1VQ8A 3N52A 3QR8A 4J1MA 1DJRD 1PRTC 1E1TA 4OGQC 3CRKC 1XXGA 2CH4A 4EQNA 1C4QA 4GOPB 4JI1L 4IPDA 4RG1A 1JWUD 4FF4A 1SFOH 1CHPD 4RA8A 1PV4A 4DR6L 2RHSB 3HOZH 4QUFA 2N49A 2D2CC 4WJ4A 1KL9A 2PPBC 4AH6A 2F0PA 4DK0A 3PO2G 2F0UA 2E2IH 2UUBQ 1FNVA 1WOCA 1GD7A 3PMFA 2RSNA 4K8IA 3T56B 4JK1C 5LMNW 2Z9HA 1WCMB 3H6MA 3CCQA 3CCVA 2KHJA 1UEAB 2NZOA 5GAHC 1YHAA 2ZXOA 2XIWA 4C3IG 3HG9A 1E0BA 3SHLA 3K7AB 5IYDG 5JEAG 1XNRQ 3F2DA 2DNEA 3H15A 2NZHA 4JI7L 2R93H 2PMZE 2K5HA 4TKOB 2QILA 3VA5A 1QJOA 5M5XH 4JCVE 4CJ2C 1XNQQ 4JYAQ 2XVSA 4C3JB 3HOVH 4YCUA 2UU9Q 4X66L 1AH9A 2Y0SB 5BN4A 3A56A 1JQYD 3P20A 3GV6A 1EYAA 2MJ8A 3NBHA 4Y7NH 4JI5L 4LUOA 1OXTA 4RGMA 5IODA 1JWSD 4DXGA 1TWGH 2PNRC 5ELFA 4JOIA 2PO4A 1F77A 1X9NA 2EY5A 3K57A 3H3VH 2BE5D 2JA8G 3TMEA 4KY7A 1I4QA 1PHJA 2NB0A 4LF5Q 1VQDA 1SBBB 2VW9A 5EKKA 3S1RB 4A3DG 1LLRD 1PRTB 2F0IA 1ESFA 2QW7A 5C3EB 4TVAB 3R93A 1TWHB 3S24A 5FJ8H 3I55A 1VQGA 1D1KA 3PIO3 3CCJA 1ASYA 3NP8A 3WWVA 4B9XA 4F7XA 3WDNA 1K8GA 1GHKA 2CVRA 3CC7A 2YYZA 3D8GA 1I94L 1F2MA 2B2UA 4XYOA 5DNFA 1V8QA 3TP8A 4HIKA 4NXML 1JOOA 1EY0A 4UAIA 3SXHA 2AUJD 4HR7B 1KAAA 2VQFQ 5ISRA 2AUKA 1VQ4A 1HCZA 3TP6A 1RTNA 3K5LA 5M5YB 3CQZH 2F0QA 3U9SA 3OWEB 5BR8L 5IIFA 1KABA 4L8JA 3RUZA 5IGGA 1JWMD 2JJQA 5C44G 4X65L 2L11A 3EVQA 3SE0A 2NVQB 1N32L 2R7ZB 2C35B 4A3IB 4HN7A 5FO7B 2R7FA 4MZ9A 3PIPA 3D6WA 3IFTA 4K2LA 3CW2C 1YVCA 2NZ1D 4O1NA 1SNCA 4GLAC 3E9IA 2K75A 4HAEA 5EPKA 4IUNA 1P8LA 4IQZA 3FP9A 4HJ5A 2KJXA 4DAYB 1NAPA 4OHJA 1YBYA 3OMGA 1PVOA 1HFGA 2VB2X 5CGKA 5AJ3Q 4BXXG 1SNMA 3M4QA 1DXMA 4A3JG 1K3RA 2JA9A 2JQOA 3K80C 4K2KA 3H0GB 4F8MA 4GN5A 3HOYB 1EL0A 4CKBA 1S5FD 2Z6KA 2FMCA 4FO2A 1R9TH 4CJ1B 3HEJA 3IFDA 1QNKA 3L2PA 1JE5A 4A3GB 3BDLA 3KDFB 1FL0A 2XRQD 4LMQD 1I4HA 2NTSA 1D5ZC 3K5MA 3PO3G 5C5LA 1VMPA 4ILWA 4ZQ3A 3HRZC 3ITPA 4B08A 2WB1E 1RF2D 2A19A 4DV6Q 1KTKA 1IXRA 3S1MB 2KHSA 3EN2A 4X6AH 4IZ8A 1T5EA 3MFYA 4KHZA 4WRDA 2N8NA 1IW7C 1PZID 4BA1I 3S1QH 3MWYW 4LF4L 3DXJC 4HSVA 1KDBA 3TDQA 5DEHA 5F2DA 4CBVA 5CV7A 1I4PA 1AW7A 4JI6L 4MHEA 4ZRZA 2JSOA 2K52A 4AIMA 3PO2B 3TBIB 2QKIC 4CDEC 3ERQA 1HUNA 1W6KA 3HOZG 4MTKA 1Q90A 3NQTA 4JI1Q 5JJKA 2VB3X 1SYBA 3V05A 1Q82C 1JOKA 1A3VA 2YU9H 4DR6Q 1PTOC 4C3HH 2EY1A 5KNDA 4YHHL 1TT2A
chains in the Genus database with same CATH topology
2B2WA 4C3IB 3MAQA 4ID6A 1PZKD 1YNJD 4IUPA 4K8JA 1WD1A 2L0CA 3NPPA 2B2TA 3CRLC 1D1IA 2K5QA 2F0DA 3DUZA 1WTVA 4G7ZC 5KIXA 1MI2A 3SK6A 3M3YB 1VF5C 3GTJB 2HQEA 4DAVA 1H9SB 1XTCD 2L1BA 2PW7A 4RGOS 3T4AC 2PQEA 4LK1C 4ODGA 2ZXRA 1OXVA 2CHBD 1RODA 4CJ0B 2K1BA 5FO9B 5CBEE 2JA8B 3A8IE 3I73A 3V2TA 1O78A 2CW0C 5KNCA 4KD4A 3TSSA 1Z7TA 5KRUA 2NVXB 1AFPA 1TWAB 2FHTA 2E2HB 1X3QA 1WTWA 2MUYA 1LTAD 1G8ZD 1BDOA 4DNRB 1YNNC 5E1FA 3TN2A 4QCLA 1G291 3VR4A 5EQ0A 3H09A 2NYZD 2B39A 1HFNA 3A7AB 4CHTB 3PIP3 1D6EC 3K5NA 1BOSA 3BVGA 4CKCA 2JEBI 1PTOB 3AMUA 3R8BA 2FFKB 4F88A 1BCPF 4UDUC 1RJTA 4P2CB 2L55A 4PMCA 5C44B 1DD2A 3TZDA 3PV0A 2AQ1B 2EJMA 4XQNA 2F0JA 1S5ED 1EZ6A 3AU7A 5LL6S 3T53B 4RHSA 1Y69U 1B1ZA 1ML0D 2F0EA 3PUVA 3BG3A 4EQPA 5TSSA 2I07B 1HRJA 4KKTA 4A3JB 4DXFA 1TY2A 5G3LF 5IGFA 3NQIA 3BDOA 3I4LA 2B8GA 3S14B 3GTPB 2B2YC 4KKUA 1I6VC 3BZDB 2JE6I 3PO3B 5IGBA 1EOTA 5JEAJ 2K5WA 1EWCA 5C4JB 1S4ZA 3OOCA 1B4OA 1Y8NB 3NBIA 3H3VC 1FNWA 4ABNA 1F2YA 2NVTB 1RTOA 5ELCA 4WFN3 4IFDH 1SNPA 1B9NA 1WTOA 3P7JA 3DWQA 5CYUA 1NUCA 4ULLA 1SFOB 3SK4A 3C46A 3P75A 1FR3A 4DU9A 4NDXA 1JCKB 5JPNC 1KLUD 3HOZB 1A15A 4C1NI 5D3DA 2F0OA 2E2IB 4HMIA 3WOFA 4DNTB 2E2DC 2E76C 2DN8A 5J22A 3M85A 1BNZA 3Q24A 4WJWA 3VR5A 4C3HG 4ZK9B 2FINB 1ZXTA 2AWNA 1LTID 5CV8A 1CHQD 1E2ZA 2R93B 3JAML 5M5XB 4LJZC 1PRTD 4RGTA 3HOVB 2Z4HA 1EY4A 2EVBA 4R8NA 3X3NA 1B53A 2K04A 4FF2A 4Y7NB 2A6HC 2L4NA 2B2VC 1TWGB 5IGEA 1BUVT 1CQFA 1HPCA 2ICEC 3NWSA 4RKBA 5K5PA 4M1UB 2ENBA 5FKAC 2K05A 3J80E 4H13C 1F9PA 3A8KE 4HSPA 3NE5B 3QWNA 1BR9A 2A74C 1SAPA 3URYA 2E74C 2TSSA 1D2BA 1E2VA 1PMRA 1HXYD 4TQUS 4MIUA 2RBMA 4H44C 4V190 1A2TA 1AN8A 4GZYC 5J1ZA 4K6DA 1BO0A 3W2DA 4K5WA 4S3SA 5ELDA 2RVLA 1DOLA 1GUOA 1H9SA 1F2ZA 3I72A 5HURA 4FF1A 3CQZB 3CU7A 5LHY1 2K03A 1QG7A 1PYWD 1TQOA 1SXTA 2KEDA 5K36G 2WAQB 4N9PA 4LAAA 3I70A 5I9OA 3J81L 1EIHA 3SVMA 3EJIA 3NHHA 4DFAA 3DMUA 1NR2A 1XX8A 4KN7C 2EXZA 1CQVA 1NCVA 4CGYB 2EYLA 1D5XC 1MBYA 1F2LA 2KQ3A 3G6JB 1R9TB 4IUQA 2RDFA 3BS1A 1HQMC 2WKCA 4BS9A 2BCOA 3M7NA 3R2TA 1UNSA 1WTPA 1TVXA 1RCVD 4R9WA 1LV9A 2SEBD 4V0BA 5KEEA 4EVOA 4IN3A 1F9QA 1IHZA 3NK9A 2J0TD 3OHXC 4DK1A 4FXDA 3L7ZC 3MZ5A 4KMUC 5CV5A 3FVQA 1LT5D 3J7YW 2NUCA 3S1QB 4IFDG 1EEFD 1EWHA 1LO5D 4FVMA 1B50A 4J8QA 2QCPX 1EQTA 1EZ8A 3L3OC 1LT6D 3K6OA 2Z4IA 1B2TA 5C4ZA 1C8CA 2YU9B 4C3HB 1EU4A 1O7ZA 4KTAA 1NSNS 2Q8TA 2MHVA 3GP7A 3DHQA 1STAA 3FRPB 1IKLA 1KNAA 1QILA 1A2UA 2B8FA 2F0SA 3ONAB 4ZLTF 1EY7A 5FK9C 2ZT9C 3HOWB 1IW7D 5KYIA 1Q12A 1SNOA 4PNYA 1T5XD 1F9RA 4AYBB 2EYHA 1SJHD 1L0YB 4X3KA 2EZVA 1STGA 2C5CA 2BDOA 2JA7B 1H9JA 1DONA 1U9RA 2AQ3B 1DZ1A 2FJ2A 3E6ZX 2F0FA 1SNDA 1ESRA 1IYVA 2O2LD 5CV6A 4F87A 5COYA 4ZUIA 1PTOD 2WP8J 5A2QE 1Q1EA 2NBFA 3K0YA 3X3MA 4E6IA 5IGCA 3KF8A 2ICIA 2R61A 1PFBA 2KECA 1SE3A 1JR0D 1DCZA 4G4KA 1U4LA 3J7AF 5FLXE 1B3AA 1EU3A 5JAVA 3EROA 1SMYD 1BCPC 4KJNA 5IT9E 5EKLA 4RHRA 2WIIB 2LKVA 3D31A 1WTRA 1TWFB 5ELEA 1HUMA 4K5XA 2G9DA 2PMZB 3U9OA 2XWJB 1EY6A 2JEAI 5D14A 3D6CA 3NTKA 1ZKOA 1BF4A 2RKSA 3MHBA 2F0VA 2K28A 5JJZA 1QOHA 3L9AX 2K7VA 4OL7A 3OSOA 1U4PA 2F0MA 3QIAA 4OO1H 4RCOA 5EGTA 1JORA 2A5HA 1FNUA 4C2MB 1SDFA 1JOQA 3MTSA 1U4RA 2EY2A 1M4VA 1LTGD 3J7AV 1CTMA 4XQJA 5EBCA 4A3DB 5C3WA 1VF7A 2EYFA 1A3TA 2F0GA 1Z6HA 3K59A 3ZYYX 1QE6A 5CORA 2D62A 4DN4M 2SNMA 1PFMA 3PUXA 2MPMA 1BCPB 4KV6A 1AZQA 3MA2B 3KLRA 4OIJA 4OIKA 4L6TB 1ZYRD 1FGBD 3SEBA 3ND8A 1U4MA 2I46A 1PZJD 2B2VA 3KBGA 1A3UA 2HCIA 4EGVA 4FNFA 2TMPA 4IUUA 3VR2A 3FPUB 4QMGA 1G6ZA 1LTSD 1GHJA 2BOSA 1TS3A 1BXTA 5C0XH 4C1NK 3EFXD 5K36H 2O4XA 3VYRA 2BA1A 1MGSA 4A3KB 2OF1A 3GTLB 2D5DA 3EA6A 3K5OA 1O7YA 2D9UA 3BDCA 3KLSX 2JXMB 4RCNA 1R4PB 4ZYSA 2VUMB 2L9HA 1WTXA 3AB9A 5ELBA 1EYDA 3R2IA 1X32A 2HUGA 3NTHA 4M8AA 3VYSA 1V1PB 2R92B 4RWSC 5D3IB 1V1OA 5IOCA 1ENFA 3MXUA 1H9MA 3KUPA 2XWBB 2WB1B 2J4XA 3MEHA 2LY7A 1RDPD 5C4HA 2J7ZA 4X3UA 3O13A 3OWFA 5BN3A 3MVVA 1LABA 1K8OA 3I91A 3CHBD 4A3EB 4IFDI 3R3OA 1L0XB 5M9OA 3FKIB 2HCCA 1D5MC 2A6ED 1IYUA 3KBXA 2C9OA 3H94A 2A6HD 3SK5A 4DAYA 4XT1B 3QJYA 3BVMA 3E5SA 3VA7A 1H9KA 3GV3A 4KN4C 2KUMA 2L12A 2RQXA 1TS5A 2B2WC 5D65A 5JOBA 4HMJA 1FYCA 4XQQA 2WV6D 2B2TC 3QB3A 1Y8PB 3HOUB 5CBAE 2RDGA 4IFDJ 3LX0A 1RD9D 4XIGS 1GUGA 4FXKC 5C5MA 2A68C 2PZWA 1GOZA 1GUTA 5E4WC 1LTTD 1JE4A 5JPMC 4BA2I 4BWGB 5JVH3 2SNSA 1R4QB 1QNUA 1PFNA 3D4RA 1EIGA 1KNEA 1O80A 2KA7A 2OEOA 4OO1G 3M4OB 1GJXA 1HHVA 2XNAC 2EYMA 2O5IC 3VYTA 1WD0A 2A73B 3OPOA 2GA4B 2JA5B 2AQ2B 4MN3A 4NMZA 1TKWB 3VR6A 2LFNA 3NSWA 5C6AA 1S5CD 3BYTB 3MXNA 1G2TA 1I4RA 3VR3A 3I4NB 5NUCA 3I3CA 2IWHA 1HTLD 5CMDA 3UI2A 2A69C 4HCSA 3TP5A 4FP5D 2PYKA 2E75C 2PZUA 2HDLA 4KHVA 1AEXA 3S17B 3HS0C 1EFID 5LL6X 1HQRD 4YIJA 1B44D 2E2JB 3C2PA 1CZWA 2NN6H 5EKIA 4DAPA 1EQVA 5FLXL 2F3WA 3K58A 3SK8A 2XSCA 1ET9A 1MSGA 4KY5A 5KYLA 5C0XG 2IT1A 1CA5A 2WKDA 3IKJA 4A3BB 2XN9C 2JYOA 4KJOA 2VNUD 3IAYA 3Q6SA 1DYQA 1Q8IA 3D4DA 2L5TA 1ILQA 5I4DA 4EQOA 2F0WA 1SE4A 3RZOB 5I6YA 4N9TA 1STHA 1SYDA 4RKLA 1JB3A 1FD7D 2IPKD 3BYYB 1VCIA 2EJFC 1S5BD 2KCCA 1SYGA 4BY7B 1I3QB 2X6LA 1KDCA 1Q3LA 3MXPA 4FF3A 5CR3A 3OIPA 5DM63 3H91A 2Q8RE 1LACA 2RSOA 3I4MB 2IX3A 1LT3D 1STEA 3D4WA 1JICA 1TR5A 3RLFA 1SYEA 1VDZA 2M2LA 3DM1A 4FYDA 3GD7A 2F4IA 1I6HB 2Q8IB 1ENAA 3PUZA 3RZDB 1Y1VB 1I50B 2IJ0A 1V1PA 3LWEA 1BQQT 1TWCB 2F0TA 4I7ZC 3MC0B 3FMCA 1SYCA 3GTGB 2LS01 3PUYA 5HGTA 1ET6A 4B9WA 4K14A 1SJED 5CC4A 3HKZB 2EYJA 1PRTF 3SR1A 4G7HC 4KD3A 4RFBA 1QWYA 1EY5A 1BCPD 4X3SA 2BDNA 1UAPA 3JAME 4PMWA 1LT4D 3FDTA 3FPPA 3HGBA 3G7LA 4QF4A 2BE5C 3MXGA 1OXXK 4HCEA 1SNQA 2M9VA 4H0LC 1GUNA 1TY0A 3TZUA 4IURA 5C4XB 3Q0AA 2CQAA 5FOBB 4U68A 3PUWA 3S9WA 1Y8OB 1GUSA 5J39A 5JVG3 2B63B 3V96A 2SDFA 3SDZA 2K33A 5G3LD 1I4XA 2M00A 1RHPA 4NW2A 2Z8LA 1ILPA 3D3RA 1PDQA 4A93B 2N55A 1DOMA 2B2YA 2NN6G 4RGNA 3I8ZA 2F1MA 3ND9A 3S1NB 2LMCB 3W3AA 2F03A 1H9RA 1QCBD 1OO9B 2BA0A 4IUVA 1RKNA 1V43A 2KVMA 2CW0D 4DGZA 1A6XA 3MFGA 2EOTA 3DWPA 2K5DA 1J8IA 4RH6A 1TS2A 5E4XA 5T1GA 1ICWA 1G2SA 2SOBA 5CV9A 2IX0A 1DOKA 5CV4A 1YNND 4O42A 1CK1A 3C3LA 2EY6A 3J81E 5EBDA 1AP0A 4CKEA 3N6RA 1PLFA 4Z9CB 1S5DD 4OO1I 3NUCA 2X6GA 1SEBD 1JC7A 3TP7A 3OW7A 1SYFA 2KEEA 2MGSA 2F0HA 2R3ZA 2ZXPA 3OIQA 3C1EA 1O7LA 4PMBA 5E3FA 3A55A 4XDXA 3DEOA 3FEWX 1LTRD 2EPBA 1G91A 1SMYC 4U673 2O5JC 1J9OA 4KK7A 1NR4A 5EJWA 2NTTA 3IL8A 4XXEA 1F9SA 2B2UC 5KGUA 2F0LA 5C3XA 2EYPA 5BN5A 3J80L 4I65A 1AZPA 1K8MA 3NXWA 2WINB 5I2YA 3S16B 2QEJC 2FMMA 3T16A 3E0JA 1UUPA 1M8AA 4Q0FA 3VYUA 1CT1D 5IGDA 3NTIA 1Y1WB 2EYOA 1LTBD 4NKLA 4TSSA 1VMCA 5C0XI 1YNJC 3GO5A 1MSHA 1TS4A 2F0NA 4QB4A 4K6LA 2DY8A 4KI0A 2OXPA 2WACA 3A54A 1W6JA 1DM0B 1EEID 1PXUA 5I2XA 4Q5VA 3KK7A 1CI3M 1STYA 3CKIB 3M7GA 3T51B 2XRSD 4DF7A 5EPJA 1K83B 2PZTA 3GTKB 2EJGC 2EDGA 5EPLA 5I6WA 1CM9A 2K01A 3DEPA 5C0XJ 4PV1C 2H1EA 3Q23A 5A35A 3A8JE 1WTQA 2DNCA 5M5WB 2NWGA 1CFMA 1PTOF 3WOEA 4H7BA 5KNBA 5JEAH 1EY9A 3NWTA 4JBWA 2VXWA 4BY1B 3S15B 4ZUJA 1ZYRC 3T13A 3C1FA 2R6GA 4L63B 4XYQA 3HP3A 1B9MA 2A68D 2F3VA 4C56C 4RAUC 2V4DA 3BVZA 4C3JG 1IL8A 4A3MB 3GTQB 3I90A 4ME5A 3LNNA 3QOJA 2KOLA 2RA4A 4ZAIA 2JA6B 2H4OA 4ZKBB 1STBA 1HA6A 1XWEA 1GUWA 4KKSA 2JP1A 2K6AA 2K32A 1EYCA 3EQLC 4XT3B 1KLGD 4IUTA 2ID0A 4QIWB 3QO2A 4K5VA 1KDAA 1Q1BA 3A7LA 2QDBA 2A69D 1ONLA 2OT2A 4HEDA 3RD4A 1I4GA 3GTMB 2NVYB 1OXUA 1PTOH 5M3FB 4G57A 4QUCA 1QB5D 4NP5A 5M3MB 3LWUA 5AFWA 1X3PA 1OXSC 2DY7A 1E2WA 1EY8A 1BBXC 4KY6A 4TRDA 1STNA 1HA5A 1TIID 1CZGA 2N88A 2RDHA 2X69A 5I9PA 1XYIA 3GQBA 2IL8A 4DA2A 1C48A 3S2HB 2PW5A 1SSOA 3DWAA 3QG1A 4ZKCB 3HOXB 2A6EC 1GXDC 5DAUA 2IX1A 1HTPA 1MD2D 4X3TA 5DM73 3S2DB 3M4YA 2KCNA 4PQXA 4A3FB 1IKMA 4BBRB 3Q22A 5A2QL 1ENCA 2AWOA 4IALA 2MP1A 4BBSB 2QF7A 2F0KA 3OMCA 3HZXA 2IW3A 4R8IA 5FO8B 2PCFB 1WVLA 2HDMA 2NN6I 2G9HD 2Z1CA 1ZEQX 2EE1A 3RMHA 4G7OC 4J6HA 1CA6A 4HTHA 1SE2A 4XTCS 3GTOB 4WORA 1TU2B 1II3A 3P1HA 3KLSA 3QOLA 5T1IA 5IT9L 1Z47A 4FXGC 3F2UA 3N52A 4J1MA 1DJRD 1PRTC 4OGQC 3CRKC 1XXGA 4EQNA 1C4QA 1JWUD 4FF4A 1CHPD 4RA8A 4QUFA 2D2CC 2PPBC 2F0PA 4DK0A 2F0UA 1FNVA 3PMFA 2RSNA 4K8IA 3T56B 4JK1C 1WCMB 3H6MA 1UEAB 2ZXOA 2XIWA 4C3IG 3HG9A 1E0BA 3SHLA 3K7AB 5JEAG 2DNEA 4TKOB 2QILA 3VA5A 1QJOA 4CJ2C 2XVSA 4C3JB 2Y0SB 5BN4A 3A56A 1JQYD 3P20A 3GV6A 1EYAA 2MJ8A 3NBHA 1OXTA 4RGMA 5IODA 1JWSD 4DXGA 2PNRC 5ELFA 2PO4A 1F77A 2EY5A 3K57A 2BE5D 3TMEA 4KY7A 1I4QA 2NB0A 1SBBB 5EKKA 3S1RB 1LLRD 1PRTB 2F0IA 1ESFA 5C3EB 3R93A 1TWHB 1D1KA 3PIO3 3NP8A 4B9XA 4F7XA 3WDNA 1GHKA 2CVRA 2YYZA 3D8GA 1F2MA 2B2UA 4XYOA 5DNFA 1V8QA 3TP8A 1JOOA 1EY0A 4UAIA 3SXHA 2AUJD 4HR7B 1KAAA 5ISRA 2AUKA 1HCZA 3TP6A 1RTNA 3K5LA 5M5YB 2F0QA 3U9SA 3OWEB 5IIFA 1KABA 4L8JA 3RUZA 5IGGA 1JWMD 2L11A 3EVQA 3SE0A 2NVQB 2R7ZB 4A3IB 4HN7A 5FO7B 3D6WA 3IFTA 4K2LA 2NZ1D 4O1NA 1SNCA 4HAEA 5EPKA 4IUNA 4IQZA 2KJXA 1NAPA 4OHJA 3OMGA 1HFGA 2VB2X 5CGKA 1SNMA 1DXMA 4K2KA 3H0GB 4F8MA 3HOYB 1EL0A 4CKBA 1S5FD 2FMCA 4FO2A 4CJ1B 3HEJA 3IFDA 1QNKA 4A3GB 3BDLA 2XRQD 4LMQD 1I4HA 2NTSA 1D5ZC 3K5MA 5C5LA 1VMPA 4ILWA 4ZQ3A 3HRZC 3ITPA 4B08A 1RF2D 1KTKA 3S1MB 2KHSA 4IZ8A 1T5EA 3MFYA 4KHZA 4WRDA 1IW7C 1PZID 4BA1I 3MWYW 3DXJC 4HSVA 1KDBA 3TDQA 5DEHA 5F2DA 4CBVA 5CV7A 1I4PA 1AW7A 4MHEA 4ZRZA 2JSOA 3PO2B 3TBIB 2QKIC 3ERQA 1HUNA 1W6KA 1Q90A 3NQTA 2VB3X 1SYBA 3V05A 1JOKA 1A3VA 1PTOC 2EY1A 5KNDA 1TT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9A X; 
#chains in the Genus database with same CATH topology
 2B2W A;  4C3I B;  3MAQ A;  4ID6 A;  1PZK D;  1YNJ D;  1VS0 A;  4IUP A;  4K8J A;  1I5F A;  1WD1 A;  1D7Q A;  2L0C A;  3NPP A;  1PA6 A;  2K4K A;  2B2T A;  3CRL C;  1D1I A;  1S3O A;  2K5Q A;  2F0D A;  3DUZ A;  4EX5 A;  1WTV A;  4G7Z C;  3JAM c;  5KIX A;  1E22 A;  2R93 G;  1E7Z A;  1MI2 A;  1WFQ A;  3SK6 A;  3M3Y B;  1PFS A;  1VF5 C;  3GTJ B;  1WYD A;  1OTC A;  3HOW H;  2HQE A;  4DAV A;  2XGT A;  1H9S B;  3HOV G;  1XTC D;  2L1B A;  2PW7 A;  4RGO S;  3T4A C;  5IWA L;  2PQE A;  3U4V A;  4LK1 C;  1T9H A;  4ODG A;  2ZXR A;  1OXV A;  2CHB D;  1ROD A;  4CJ0 B;  4GOP A;  2K1B A;  5FO9 B;  5E7N A;  5CBE E;  2JA8 B;  2ZJQ A;  4UP8 A;  3A8I E;  1QUQ B;  3HKS A;  4X66 Q;  3I73 A;  3V2T A;  1O78 A;  3PQI A;  2CW0 C;  4JW0 A;  3CCL A;  1L0W A;  5KNC A;  4JI5 Q;  1EIF A;  4KD4 A;  2PI2 A;  3TSS A;  1Z7T A;  5KRU A;  2NVX B;  1AFP A;  1TWA B;  2FHT A;  2E2H B;  1X3Q A;  1WTW A;  2MUY A;  1LTA D;  1G8Z D;  2BH2 A;  3CCS A;  1BDO A;  3U4Z A;  3I4N G;  4DNR B;  1YNN C;  4OXP A;  5FJ8 G;  5E1F A;  3TN2 A;  1LYL A;  4QCL A;  1G29 1;  3VR4 A;  5EQ0 A;  3H09 A;  2NYZ D;  2B39 A;  1HFN A;  3A7A B;  4CHT B;  3PIP 3;  3PGZ A;  2HD3 A;  1D6E C;  1V9P A;  3K5N A;  2IHF A;  1BOS A;  4B3R L;  3BVG A;  2BH8 A;  2MFI A;  4CKC A;  2ASB A;  2JEB I;  3BU2 A;  1PTO B;  3AMU A;  3R8B A;  3G48 A;  1I94 Q;  2FFK B;  4F88 A;  1BCP F;  1MKH A;  4UDU C;  1RJT A;  4P2C B;  2L55 A;  4PMC A;  4NXM Q;  5C44 B;  3Q8D A;  4LNQ A;  1DD2 A;  4R4O A;  3TZD A;  3PV0 A;  2AQ1 B;  2EJM A;  4XQN A;  1TWF H;  4CDC C;  3K0X A;  2F0J A;  5JJL A;  1S5E D;  4KLK A;  1EZ6 A;  3AU7 A;  3AQQ A;  3JC6 6;  1IBM Q;  1HZC A;  5LL6 S;  3J81 c;  3T53 B;  4RHS A;  4R4T A;  1Y69 U;  1B1Z A;  1SRU A;  5BR8 Q;  1ML0 D;  2F0E A;  1KC8 C;  4X65 Q;  3PUV A;  3CXC A;  3BG3 A;  4EQP A;  5TSS A;  2I07 B;  1HRJ A;  1N32 Q;  4KKT A;  3AYH B;  4A3J B;  4DXF A;  1JJC B;  1TY2 A;  5G3L F;  2L15 A;  5IGF A;  3NQI A;  4MNO A;  3BDO A;  5IP7 H;  3I4L A;  2B8G A;  1EQQ A;  3S14 B;  4JI0 L;  1L1O B;  3GTP B;  2B2Y C;  4KKU A;  1I6V C;  1E3P A;  3BZD B;  1KQS A;  1HNZ L;  2JE6 I;  4C2M H;  1H95 A;  3PO3 B;  1AE2 A;  5IGB A;  1EOT A;  5JEA J;  1SLJ A;  2K5W A;  1EWC A;  5C4J B;  4OEM B;  4L5S A;  1S4Z A;  3OOC A;  1B4O A;  1C7Y A;  1Y8N B;  2K5V A;  3NBI A;  1FNW A;  4DV3 L;  3H3V C;  4ABN A;  1F2Y A;  2NVT B;  3AFQ A;  1RTO A;  3RN5 A;  4DV2 L;  3NEM A;  5ELC A;  1VQF A;  2HIX A;  4HIO A;  5FLM H;  4WFN 3;  3KFU A;  3TQY A;  4IFD H;  1SNP A;  4DV4 Q;  1B9N A;  1WTO A;  3P7J A;  3DWQ A;  5CYU A;  4B3T L;  1NUC A;  4ULL A;  4PZ6 A;  3SK4 A;  1SFO B;  3C46 A;  1X56 A;  3P75 A;  1FR3 A;  4DU9 A;  4R1J A;  4L5R C;  1WJJ A;  2GVB A;  2I5M X;  1UWV A;  4NDX A;  1JCK B;  5JPN C;  1KLU D;  3HOZ B;  1A15 A;  4JC0 A;  4C1N I;  4IPG A;  4B3S L;  2LSS A;  5D3D A;  2F0O A;  2E2I B;  2Q2I A;  4HMI A;  3WOF A;  4DNT B;  4LF4 Q;  2E2D C;  2UXC Q;  2E76 C;  4QL5 A;  2DN8 A;  5J22 A;  4IOC A;  3M85 A;  5ELO A;  1BNZ A;  1YJ9 A;  1SN8 A;  3KDF A;  3Q24 A;  4WJW A;  3VR5 A;  1N33 Q;  3KF8 B;  4C3H G;  4ZK9 B;  2FIN B;  2Z6B A;  1ZXT A;  4DKA C;  1CKO A;  3PIO A;  4A4I A;  2AWN A;  1LTI D;  5CV8 A;  3F1Z A;  4A3K H;  1CHQ D;  1E2Z A;  2R93 B;  1KD1 C;  1O7I A;  3GTL H;  1HR0 L;  5J3B A;  4B3M L;  3JAM L;  4YHH Q;  2VQE Q;  5M5X B;  4LJZ C;  1PRT D;  4RGT A;  3HOV B;  2Z4H A;  2VUM H;  1EY4 A;  3HKZ E;  2EVB A;  4R8N A;  5IYC H;  3X3N A;  1B53 A;  3HOW G;  3KYH C;  4BXX H;  2K04 A;  4FF2 A;  3ULJ A;  4Y7N B;  2R92 H;  2A6H C;  2L4N A;  2B2V C;  1N34 L;  2P5Z X;  4AYB G;  1TWG B;  5IGE A;  1BUV T;  1CQF A;  1YHB A;  3JAM i;  3F8T A;  1HPC A;  5IWA Q;  4R4I A;  2MO0 A;  2ICE C;  2Q2T A;  3NWS A;  4RKB A;  4X64 Q;  5K5P A;  1G51 A;  1U0L A;  4M1U B;  4APV A;  2ENB A;  5FKA C;  2K05 A;  3J80 E;  1IBK Q;  4H13 C;  2B63 G;  1F9P A;  4Y52 H;  3A8K E;  4HSP A;  3NE5 B;  3QWN A;  4L5T A;  1BR9 A;  1YEZ A;  2A74 C;  1SAP A;  3URY A;  2E74 C;  2TSS A;  4A3C H;  1D2B A;  2YTY A;  1E2V A;  2CH4 W;  2K5N A;  1PMR A;  1HXY D;  4TQU S;  4A3E H;  4MIU A;  2RBM A;  4H44 C;  4GKJ Q;  3F2C A;  4V19 0;  1A2T A;  1AN8 A;  2MQH A;  4GZY C;  3FKI H;  2H5X A;  5J1Z A;  4K6D A;  1BO0 A;  3PCO B;  2B29 A;  4HIM A;  1KXL A;  1VQE A;  3W2D A;  4K5W A;  4S3S A;  5ELD A;  2RVL A;  1PH3 A;  1YIJ A;  1DOL A;  1GUO A;  1TXY A;  1H9S A;  1F2Z A;  3AFP A;  3I72 A;  4R4C A;  5HUR A;  4FF1 A;  1Q8K A;  3CQZ B;  3CU7 A;  5LHY 1;  2F3I A;  4DR1 L;  1N36 Q;  4JI8 Q;  2K03 A;  3ULP A;  4LF9 L;  1EFW A;  3KLW A;  1QG7 A;  3ERS X;  1PYW D;  1TQO A;  1SXT A;  2KED A;  5GRO A;  5K36 G;  2WAQ B;  2CCZ A;  4N9P A;  4LAA A;  1NBW A;  3I70 A;  5I9O A;  4NPS A;  4MTN A;  1MJC A;  3K7U C;  3J81 L;  1EYG A;  4IPC A;  1CUK A;  3HOU H;  1EIH A;  1GO3 E;  3SVM A;  3EJI A;  4UP9 A;  3CMA A;  4LF8 L;  3NHH A;  4HJ7 A;  4JPB W;  4QJF A;  4DFA A;  3DMU A;  1NR2 A;  1XX8 A;  3A74 A;  3BZC A;  1JB7 A;  4JI3 L;  4KN7 C;  3W1G A;  2EXZ A;  1VQP A;  1CQV A;  1NCV A;  2ZM6 L;  4CGY B;  2QDL A;  1S40 A;  2EYL A;  4RMF A;  1D5X C;  1MBY A;  2F52 A;  4LUZ A;  1MJE A;  1F2L A;  1J5E Q;  3J81 i;  1CKN B;  2KQ3 A;  5IP7 G;  2EQS A;  3G6J B;  1R9T B;  3CME A;  4IUQ A;  2RDF A;  2YV5 A;  4LFA Q;  3BS1 A;  1A0I A;  4YY3 L;  4JI4 L;  3M4O H;  2RHQ B;  1HQM C;  3H3V I;  4HJ9 A;  2WKC A;  4BS9 A;  1IYJ B;  2BCO A;  3M7N A;  1A63 A;  4JI0 Q;  3R2T A;  3G71 A;  3VDY A;  1UNS A;  1WTP A;  1TVX A;  1RCV D;  4R9W A;  1K8A C;  2JA5 H;  1LV9 A;  1ASZ A;  2SEB D;  4V0B A;  1EOV A;  5KEE A;  4EVO A;  2KCT A;  4IN3 A;  1F9Q A;  1IHZ A;  3NK9 A;  3PF5 A;  2J0T D;  3OHX C;  4DK1 A;  4FXD A;  3L7Z C;  3MZ5 A;  3RNU A;  4KMU C;  3I4N H;  2CWP A;  5CV5 A;  5LMU L;  3FVQ A;  1LT5 D;  5FLM G;  4NXN L;  3J7Y W;  4DV3 Q;  2NUC A;  2OQ0 A;  4GN4 B;  3S1Q B;  1EEF D;  4IFD G;  1EWH A;  1LO5 D;  4FVM A;  4LF7 L;  2OTJ A;  3S17 H;  4DV2 Q;  4DR3 L;  1B50 A;  3RLO A;  4J8Q A;  2QCP X;  1U5K A;  1EQT A;  1EZ8 A;  3L3O C;  4DUY L;  2E2J H;  1X54 A;  1LT6 D;  3K6O A;  2Z4I A;  2LXK A;  1D8L A;  1B2T A;  1UE6 A;  5C4Z A;  4B3T Q;  2RCF A;  1CSP A;  5IP9 H;  4A3L H;  1C8C A;  1L1O A;  2DUD A;  2UXB L;  2YU9 B;  2UUC L;  4C3H B;  1EU4 A;  1O7Z A;  4KTA A;  1NSN S;  2Q8T A;  2MHV A;  1UEB A;  3GP7 A;  4LFC L;  5GQO A;  3DHQ A;  4A3B H;  3A0J A;  1STA A;  3FRP B;  2ZTC A;  1IKL A;  1KNA A;  1QIL A;  1A2U A;  4A3K G;  4DR5 L;  2B8F A;  2F0S A;  3ONA B;  3I2Z A;  4ZLT F;  1EY7 A;  5FK9 C;  4P72 A;  2ZT9 C;  3HOW B;  1IW7 D;  5KYI A;  1CKM A;  2K14 A;  4H02 A;  1QZH A;  1Q12 A;  1M1K C;  1W2B A;  2VUM G;  1SNO A;  4PNY A;  3TRZ A;  1T5X D;  1F9R A;  5IYC G;  1HR0 Q;  3RZO H;  4B3M Q;  4AYB B;  4HJA A;  2EYH A;  2Z0S A;  1SJH D;  1L0Y B;  4X3K A;  1QVC A;  2EZV A;  2R92 G;  1EQR A;  1STG A;  2C5C A;  2BDO A;  3W1B A;  2JA7 B;  1H9J A;  1DON A;  1U9R A;  2AQ3 B;  4OWT B;  1XMO L;  2FJ2 A;  1DZ1 A;  3E6Z X;  4DV7 Q;  2F0F A;  4IPH A;  1SND A;  1ESR A;  1IYV A;  2O2L D;  5CV6 A;  4F87 A;  5COY A;  4ZUI A;  1PTO D;  4BY7 H;  1I3Q H;  2WP8 J;  5A2Q E;  3D0F A;  1Q1E A;  2NBF A;  1N34 Q;  2WB1 G;  3K0Y A;  3X3M A;  3A5Z B;  4E6I A;  5JJI A;  5IGC A;  3PF4 A;  3KF8 A;  1Y14 B;  3I4M H;  2ICI A;  2R61 A;  4A3C G;  1PFB A;  2KEC A;  1A62 A;  1SE3 A;  1JR0 D;  3UE1 A;  1DCZ A;  4G4K A;  1U4L A;  3J7A F;  1PH9 A;  2F4V L;  5FLX E;  5ELN A;  4A3E G;  1B3A A;  1E1O A;  1EU3 A;  1E24 A;  5JAV A;  3ERO A;  4AQY Q;  1SMY D;  4PZ7 A;  4UPA A;  3FKI G;  1I6H H;  1BCP C;  4KJN A;  3RZD H;  2AHO B;  5IT9 E;  4P75 A;  3STB C;  1Y1V H;  5EKL A;  1I50 H;  4RHR A;  1NE3 A;  2WII B;  2LKV A;  2GN5 A;  3D31 A;  1X3G A;  1SRO A;  1HJP A;  1TWC H;  1WTR A;  4PZ8 A;  1TWF B;  2KCM A;  4UY8 C;  5ELE A;  4X62 L;  1HUM A;  4K5X A;  3MXN B;  2G9D A;  2PMZ B;  3U9O A;  2XWJ B;  3A5U A;  1EY6 A;  2JEA I;  5D14 A;  4DR1 Q;  3GTG H;  3D6C A;  3NTK A;  3K8A A;  1A8V A;  1ZKO A;  1BF4 A;  4LF9 Q;  3HOU G;  1B8A A;  2RKS A;  3MHB A;  2F0V A;  2K28 A;  5JJZ A;  1YI2 A;  2ZTE A;  3OW2 A;  1M90 C;  4GLX A;  1QOH A;  4LF6 L;  3AEV A;  3L9A X;  4QIW E;  3M9B A;  1IZ6 A;  1YNX A;  4NB3 A;  1HZB A;  2K7V A;  4OL7 A;  4DUZ L;  1N8R C;  3OSO A;  1U4P A;  2JN4 A;  4JG2 A;  2F0M A;  3QIA A;  4OO1 H;  2LXJ A;  4JOI C;  4RCO A;  5EGT A;  4JI3 Q;  1JOR A;  4JI7 Q;  2ZM6 Q;  2A5H A;  1FNU A;  3U50 C;  4C2M B;  5H1S E;  1SDF A;  4POF A;  1JOQ A;  5EAY A;  3MTS A;  1U4R A;  2EY2 A;  1M4V A;  1LTG D;  3J7A V;  1CTM A;  4XQJ A;  5C4X H;  1VQO A;  5EBC A;  4YY3 Q;  4A3D B;  5C3W A;  4JI4 Q;  3OTO L;  2JA5 G;  1VF7 A;  2B63 H;  2EYF A;  1A3T A;  1J6Q A;  1VQC A;  2F0G A;  1Z6H A;  2IHE A;  3K59 A;  3KF6 B;  3ZYY X;  1QE6 A;  1NMG A;  5COR A;  3UDF A;  2D62 A;  4DN4 M;  4LFB L;  2SNM A;  1PFM A;  3PUX A;  2MPM A;  1BCP B;  4KV6 A;  1AZQ A;  3MA2 B;  3T1H L;  3KLR A;  3E0E A;  1XMQ L;  4OIJ A;  4OIK A;  1VQ9 A;  4L6T B;  1ZYR D;  1FGB D;  3SEB A;  4DR7 L;  3ND8 A;  1U4M A;  2I46 A;  1K73 C;  1PZJ D;  2B2V A;  3RLN A;  3CPF A;  3KBG A;  3CCM A;  1A3U A;  4A93 H;  2HCI A;  4EGV A;  2ZJP A;  3ULL A;  4OWW B;  4NXN Q;  4FNF A;  2TMP A;  4IUU A;  3VR2 A;  1CKN A;  3FPU B;  2EXD A;  2XTI A;  4QMG A;  1G6Z A;  1LTS D;  1GHJ A;  1K0S A;  4DR3 Q;  2BOS A;  5IE8 A;  5IP9 G;  2PQA B;  4UHV A;  4A3L G;  1PH5 A;  3S1N H;  4P73 A;  4GN3 B;  1TS3 A;  1BXT A;  5C0X H;  4DUY Q;  1X65 A;  1SR3 A;  4C1N K;  3EFX D;  5K36 H;  2O4X A;  4JI2 L;  3BJU A;  3VYR A;  4DV1 L;  2BA1 A;  2FXQ A;  1MGS A;  4A3K B;  2UXB Q;  2OF1 A;  4FDB A;  4A3B G;  3GTL B;  2D5D A;  3EA6 A;  4DR4 L;  3K5O A;  1HNX L;  1O7Y A;  2D9U A;  3BDC A;  4GS3 A;  2UUB L;  4LWC A;  3KLS X;  2I5L X;  2JXM B;  4RCN A;  1R4P B;  4EQ5 A;  4ZYS A;  2VUM B;  2L9H A;  1WTX A;  3AB9 A;  5ELB A;  4HJ8 A;  4LFC Q;  1EYD A;  3R2I A;  1X32 A;  2HUG A;  3NTH A;  4M8A A;  1FVI A;  3PSI A;  3VYS A;  1V1P B;  2Z6K C;  2R92 B;  4RWS C;  5D3I B;  1V1O A;  2YTX A;  1NNX A;  5IOC A;  4DR5 Q;  4DV0 L;  4LW1 A;  2OTL A;  1ENF A;  3MXU A;  1BVS A;  1H9M A;  3KUP A;  1W3S A;  4JYA L;  2XWB B;  1VQB A;  2WB1 B;  2J4X A;  2PI2 E;  3MEH A;  2UXD L;  2LY7 A;  4BY7 G;  1X6O A;  1RDP D;  5C4H A;  2J7Z A;  4X3U A;  4DK3 C;  2MNA A;  3O13 A;  1XMO Q;  3OWF A;  2MO1 A;  3M3Y H;  5BN3 A;  3MVV A;  3KOJ A;  3I4M G;  1LAB A;  1Q46 A;  1K8O A;  3I91 A;  3CHB D;  4A3E B;  4IFD I;  4LF5 L;  3R3O A;  1L0X B;  5M9O A;  3FKI B;  2HCC A;  1NY4 A;  1D5M C;  2A6E D;  1IYU A;  3CC4 A;  3KBX A;  1AE3 A;  2C9O A;  3H94 A;  2Y0S E;  2A6H D;  3SK5 A;  4DAY A;  4XT1 B;  3QJY A;  1LTL A;  3BVM A;  3E5S A;  3VA7 A;  1H9K A;  1SE8 A;  1Y1V G;  1QVG A;  3GV3 A;  4N8F A;  2F4V Q;  3S16 H;  4KN4 C;  2KUM A;  2L12 A;  2RQX A;  1JMC A;  1TS5 A;  2B2W C;  5D65 A;  5JOB A;  4HMJ A;  1FYC A;  1B3Q A;  1Y1W H;  4XQQ A;  2D0O A;  2WV6 D;  2B2T C;  3QB3 A;  1Y8P B;  4JI6 Q;  3HOU B;  5CBA E;  2RDG A;  4IFD J;  3LX0 A;  1RD9 D;  4XIG S;  1GUG A;  2A1A A;  4FXK C;  4JBJ A;  5C5M A;  4K0K L;  4X62 Q;  2A68 C;  2PZW A;  3HKZ G;  2DJG C;  1GOZ A;  1GUT A;  5E4W C;  1LTT D;  1JE4 A;  5JPM C;  2VS1 A;  1Z9F A;  3UDG A;  4BA2 I;  4BWG B;  5LMN L;  2JK8 A;  4DV5 L;  5JVH 3;  1KAW A;  1K83 H;  2SNS A;  1R4Q B;  1QNU A;  3GTK H;  1PFN A;  1Q7Y C;  3D4R A;  1B7Y B;  4LF6 Q;  1EIG A;  1KNE A;  1O80 A;  2KA7 A;  2OEO A;  4OO1 G;  3M4O B;  1GJX A;  4YCW A;  2HHH L;  1HHV A;  2XNA C;  2EYM A;  3CCR A;  2Q2U A;  4DUZ Q;  2O5I C;  2VY3 A;  3FHW A;  4A3I G;  3VYT A;  5M5W H;  1WD0 A;  2A73 B;  3OPO A;  2GA4 B;  2JA5 B;  2KBN A;  2AQ2 B;  2G5D A;  4MN3 A;  4NMZ A;  1TKW B;  2UUA L;  2RCN A;  3J81 j;  3VR6 A;  5C4X G;  2LFN A;  3NSW A;  5C6A A;  1S5C D;  3BYT B;  4JBM A;  3MXN A;  4BY1 H;  1I4R A;  3S15 H;  1G2T A;  3VR3 A;  3I4N B;  5NUC A;  1XPU A;  3I3C A;  2IWH A;  1HTL D;  5CMD A;  3UI2 A;  2A69 C;  4HCS A;  3TP5 A;  4FP5 D;  2PYK A;  1LUZ A;  2CWA A;  3NEL A;  3OTO Q;  4N8X 1;  2E75 C;  2PZU A;  3UDI A;  2HDL A;  1AEX A;  4KHV A;  1QZG A;  3S17 B;  3HS0 C;  1EFI D;  5LL6 X;  1FGU A;  4A3M H;  3GTQ H;  1HQR D;  4YIJ A;  2QA4 A;  1B44 D;  3TS0 A;  2E2J B;  2WFW A;  1NTG A;  3HFZ B;  4A3G G;  3C2P A;  3T1H Q;  1CZW A;  3SGI A;  2NN6 H;  2JA6 H;  1XMQ Q;  5EKI A;  4DAP A;  4A93 G;  4YWL A;  1EQV A;  5FLX L;  4YCV A;  4DR7 Q;  2F3W A;  3K58 A;  2N3S A;  1KRT A;  3K81 C;  3SK8 A;  4B3R Q;  2XSC A;  3UDX A;  1ET9 A;  1MSG A;  4KY5 A;  2K50 A;  5KYL A;  2IT1 A;  5C0X G;  2WKD A;  1CA5 A;  3IKJ A;  4A3B B;  2XN9 C;  2JYO A;  1QUQ A;  4KJO A;  2VNU D;  1C9O A;  3IAY A;  3Q6S A;  3CAM A;  1DYQ A;  2ZJR A;  3KF6 A;  1JJG A;  1Q8I A;  4JI2 Q;  3D4D A;  4DV1 Q;  1K28 A;  2L5T A;  1HZA A;  2Q2H A;  1ILQ A;  4R4Q A;  5I4D A;  4EQO A;  2F0W A;  1SE4 A;  3RZO B;  1HR0 W;  2VL6 A;  4DR4 Q;  1HNX Q;  5I6Y A;  3GTM H;  2NVY H;  2ATW A;  1EWI A;  4N9T A;  1STH A;  1SYD A;  4RKL A;  1JB3 A;  1FD7 D;  2IPK D;  5M3F H;  1MHW C;  3BYY B;  5M3M H;  5HGQ A;  1VCI A;  2EJF C;  4KHP L;  1S5B D;  2KCC A;  1SYG A;  4BY7 B;  1BKB A;  1I3Q B;  4DV0 Q;  2X6L A;  1KDC A;  1Q3L A;  3MXP A;  4FF3 A;  2PQA A;  5CR3 A;  1S72 A;  3OIP A;  2IY5 B;  3OYY A;  3H91 A;  5DM6 3;  2Q8R E;  1LAC A;  2VZA A;  3UE0 A;  4ZCK A;  2RSO A;  3I4M B;  3S2H H;  2IX3 A;  1HNZ Q;  3HOX H;  1KIX A;  1Q81 C;  1LT3 D;  1PH7 A;  3CD6 A;  2UXD Q;  3IRB A;  3ER0 A;  1STE A;  4GNX C;  3D4W A;  1JIC A;  1TR5 A;  3RLF A;  3S2D H;  1SYE A;  1VDZ A;  2B3G A;  2M2L A;  3DM1 A;  4A3F H;  3GD7 A;  4BBR H;  1PH2 A;  4FYD A;  2F4I A;  1I6H B;  2Q8I B;  1ENA A;  3PUZ A;  3RZD B;  4BBS H;  3J80 c;  1B70 B;  1Y1V B;  1I50 B;  3CC2 A;  2QEX A;  2IJ0 A;  1V1P A;  3LWE A;  3NEN A;  1NMF A;  1PYS B;  1BQQ T;  1TWC B;  1VQJ A;  1HH2 P;  2F0T A;  4I7Z C;  4L5Q A;  4YWK A;  3J7A 5;  3MC0 B;  1UE7 A;  1WI5 A;  2PNH A;  3FMC A;  3TEH B;  1SYC A;  1Y1W G;  3GTG B;  2LS0 1;  3PUY A;  5HGT A;  1ET6 A;  4B9W A;  2E5L L;  4K14 A;  4OX9 L;  3GTO H;  3G6E A;  4DK6 C;  1SJE D;  1DGS A;  5CC4 A;  3HKZ B;  4B3S Q;  1PH8 A;  2EYJ A;  1QVF A;  1X55 A;  4O2D A;  1PRT F;  3SR1 A;  3I56 A;  4G7H C;  4DR2 L;  4KD3 A;  1IBM L;  3E9H A;  3CP0 A;  4RFB A;  1QWY A;  1PYB A;  4K0K Q;  1EY5 A;  1HNW L;  1BCP D;  4X3S A;  2BDN A;  4QY7 A;  4CDD C;  1UAP A;  3JAM E;  3STB D;  1VQI A;  4PMW A;  1LT4 D;  3FDT A;  3FPP A;  1Q86 C;  3HGB A;  3G7L A;  4QF4 A;  2BE5 C;  3MXG A;  1OXX K;  2DGY A;  4HCE A;  1SNQ A;  4DPG A;  3EBE A;  5LMN Q;  4IJH A;  4DV5 Q;  1WCM H;  2M9V A;  4H0L C;  1GUN A;  1TY0 A;  3TZU A;  3F2B A;  1JT8 A;  4IUR A;  4P71 A;  5C4X B;  3Q0A A;  2CQA A;  5FOB B;  4U68 A;  4GNX B;  3PUW A;  3S9W A;  1XPO A;  1Y8O B;  2HHH Q;  1GUS A;  1BBW A;  4OEL B;  5J39 A;  5JVG 3;  2B63 B;  3K7A H;  4QGU A;  3DLL A;  3I7F A;  1VQ7 A;  3V96 A;  2SDF A;  5IYB H;  3SDZ A;  2K33 A;  4BY1 G;  3KJP A;  5G3L D;  1I4X A;  2M00 A;  2EIF A;  4C3J H;  2UUA Q;  1RHP A;  3E3X A;  2GVA A;  3ICE A;  4NW2 A;  2Z8L A;  3MEF A;  1ILP A;  3D3R A;  1PDQ A;  4A3M G;  3RN2 A;  4A93 B;  4O0A A;  2OQK A;  4ME3 A;  2N55 A;  1DOM A;  4DAM A;  2B2Y A;  2NN6 G;  4RGN A;  4DV4 L;  2KEN A;  3I8Z A;  2JA6 G;  1C0A A;  2F1M A;  3ND9 A;  3S1N B;  2LMC B;  3W3A A;  2F03 A;  1H9R A;  1X3E A;  1P16 A;  1QCB D;  1OO9 B;  4JV5 L;  2BA0 A;  4IO9 A;  4IUV A;  1RKN A;  1V43 A;  4JVZ A;  3S1R H;  2KVM A;  1K0R A;  2CW0 D;  4DGZ A;  5C3E H;  1A6X A;  1TWH H;  3MFG A;  2EOT A;  3DWP A;  3ZJY C;  3TRE A;  3J7Z C;  2K5D A;  1J8I A;  4RH6 A;  1TS2 A;  1UE1 A;  5E4X A;  2AMC B;  1ICW A;  1G2S A;  2SOB A;  5T1G A;  2UXC L;  5CV9 A;  2IX0 A;  1K3B C;  1DOK A;  2ES2 A;  5CV4 A;  1YNN D;  4O42 A;  1CK1 A;  1HZ9 A;  3C3L A;  2EY6 A;  1N33 L;  3J81 E;  5EBD A;  3M4P A;  3TS2 A;  5IY0 A;  1AP0 A;  1MIU A;  4CKE A;  3N6R A;  1PLF A;  1EUJ A;  4Z9C B;  5GAG C;  4LF8 Q;  1S5D D;  4OO1 I;  3G4S A;  3CPW A;  5M5Y H;  2VQE L;  5M3F G;  5M3M G;  3NUC A;  2X6G A;  1SEB D;  1JC7 A;  3TP7 A;  3OW7 A;  1SYF A;  2KEE A;  2MGS A;  2F0H A;  2NVQ H;  2R7Z H;  4A3I H;  2R3Z A;  2ZXP A;  3OIQ A;  3C1E A;  3EIV A;  4UP7 A;  1XTD A;  4A75 A;  1O7L A;  4PMB A;  1X3F A;  5E3F A;  3A55 A;  4KHP Q;  4XDX A;  3GDE A;  3DEO A;  4JBK A;  1FJG L;  1VQ6 A;  2E8G A;  3FEW X;  1LTR D;  2EPB A;  1G91 A;  1IBL L;  4GKK L;  1SMY C;  3I4O A;  4U67 3;  3HOX G;  2O5J C;  1J9O A;  4KK7 A;  1NR4 A;  5EJW A;  2I0Q A;  4X64 L;  2NTT A;  1XPR A;  3IL8 A;  4XXE A;  1F9S A;  2B2U C;  5L37 A;  5KGU A;  1IBK L;  2F0L A;  3H0G H;  5C3X A;  1VQM A;  2EYP A;  2JA7 H;  3HOY H;  4A3F G;  4BBR G;  5BN5 A;  3J80 L;  4I65 A;  1AZP A;  2AKW B;  1K8M A;  3NXW A;  1L1O C;  3T1Y L;  2WIN B;  2HT1 A;  4BBS G;  5I2Y A;  4YWM A;  3S16 B;  3CCE A;  2QEJ C;  1L2F A;  2FMM A;  4A3G H;  3T16 A;  3E0J A;  1UUP A;  1M8A A;  4Q0F A;  5LMU Q;  3VYU A;  1CT1 D;  1CSQ A;  1YZ6 A;  5IGD A;  1N9W A;  3B6Y A;  3NTI A;  4GKJ L;  1Y1W B;  1ICF B;  2EYO A;  1LTB D;  4GLV B;  4NKL A;  1VMC A;  4TSS A;  5C0X I;  4LF7 Q;  1YNJ C;  3GO5 A;  5FLX c;  1KRS A;  1MSH A;  1TS4 A;  3J80 i;  2OCE A;  2F0N A;  4QB4 A;  4K6L A;  2DY8 A;  3S1M H;  4KI0 A;  5IT9 c;  1LM0 A;  2D0P A;  1GVP A;  2OXP A;  1N36 L;  4JI8 L;  1GKH A;  4HID A;  2WAC A;  3A54 A;  1W6J A;  1DM0 B;  3L0O A;  1PH4 A;  3NBH B;  1EEI D;  1PXU A;  2UUC Q;  5I2X A;  4Q5V A;  2E5L Q;  3KK7 A;  1WTH A;  1CI3 M;  1STY A;  4OX9 Q;  3CKI B;  3M7G A;  3T51 B;  2XRS D;  4DF7 A;  2CFM A;  4WJ3 M;  2RF4 A;  5EPJ A;  1PH1 A;  1K83 B;  2PZT A;  3GTK B;  3U58 A;  2EJG C;  1PH6 A;  2EDG A;  4IOA A;  5EPL A;  3PO2 H;  5I6W A;  1CM9 A;  2K01 A;  3DEP A;  5C0X J;  4PV1 C;  4OWX B;  2H1E A;  3Q23 A;  2I5H A;  5A35 A;  4DR2 Q;  2HIV A;  3A8J E;  1XNR L;  2WAQ G;  1YJW A;  1VQ5 A;  1WTQ A;  2DNC A;  5M5W B;  1HNW Q;  2CKZ B;  2NWG A;  1VQA A;  1CFM A;  1PTO F;  3WOE A;  1WCM G;  5GAD C;  1XNQ L;  4C3I H;  2ZTD A;  4H7B A;  1J5E L;  5HY6 A;  5KNB A;  5IYD H;  5JEA H;  2UU9 L;  1RIP A;  1EY9 A;  1RL2 A;  3NWT A;  2WAQ E;  4JBW A;  4LFA L;  2VXW A;  4BY1 B;  3S15 B;  4ZUJ A;  2V1C C;  1ZYR C;  3T13 A;  3C1F A;  1V1Q A;  2R6G A;  4L63 B;  4XYQ A;  3HP3 A;  1B9M A;  2A68 D;  2F3V A;  5IYB G;  4I7A A;  4C56 C;  3GTJ H;  4RAU C;  2V4D A;  3BVZ A;  4C3J G;  1SMX A;  1IL8 A;  4A3M B;  3GTQ B;  2Y0S G;  3I90 A;  1EIY B;  4ME5 A;  5DLQ E;  3LNN A;  3QOJ A;  1YIT A;  2KOL A;  2RA4 A;  4ZAI A;  2JA6 B;  2JA8 H;  2H4O A;  4ZKB B;  1STB A;  2OWO A;  1HA6 A;  1XWE A;  1GUW A;  3LGJ A;  5GAE C;  3BZK A;  4KKS A;  4PG3 A;  4A3D H;  4ALP A;  1YJN A;  2JP1 A;  2K6A A;  1K9M C;  2NVX H;  1TWA H;  1VQH A;  2K32 A;  2E2H H;  4IJL A;  1EYC A;  3EQL C;  4XT3 B;  4DNI A;  2ALY B;  1BBU A;  1KLG D;  4IUT A;  1XJV A;  2R7D A;  5C3E G;  2ID0 A;  4QIW B;  3QO2 A;  4GNX A;  4K5V A;  2VQF L;  1KDA A;  4JV5 Q;  1Q1B A;  3A7L A;  2QDB A;  1JJ2 A;  2A69 D;  1KHI A;  4LUV A;  1UE5 A;  1ONL A;  2OT2 A;  4HED A;  3RD4 A;  1VQL A;  1I4G A;  2A8V A;  3GTM B;  1GM5 A;  2NVY B;  1OXU A;  1IL2 A;  1PTO H;  5M3F B;  4G57 A;  4QUC A;  1QB5 D;  4NP5 A;  5M3M B;  4CDF C;  4GOP C;  3LWU A;  5AFW A;  4OON A;  1X3P A;  1OXS C;  2DY7 A;  1E2W A;  5C44 H;  3KJO A;  1EY8 A;  1BBX C;  4KY6 A;  4TRD A;  1STN A;  1HA5 A;  1TII D;  1CZG A;  2N88 A;  2RDH A;  2X69 A;  5AJ3 L;  1VQN A;  5I9P A;  1XYI A;  3GQB A;  1YHQ A;  2R7Z G;  2IL8 A;  4DA2 A;  1C48 A;  2N78 A;  2YTV A;  3S2H B;  2PW5 A;  1SSO A;  3DWA A;  3QG1 A;  4ZKC B;  3HOX B;  2A6E C;  3CF5 A;  1GXD C;  5DAU A;  3W5O A;  2IX1 A;  1HTP A;  4DV7 L;  1MD2 D;  4X3T A;  5DM7 3;  4A3J H;  4A76 A;  2QGQ A;  3S2D B;  1VQK A;  2DJF C;  3M4Y A;  2KCN A;  4PQX A;  4A3F B;  1IKM A;  4BBR B;  3Q22 A;  5A2Q L;  1ENC A;  1FJG Q;  4J15 A;  2AWO A;  4IAL A;  2MP1 A;  3S14 H;  4BBS B;  2QF7 A;  4QQB X;  2F0K A;  3GTP H;  3OMC A;  1IBL Q;  3H0G G;  2JA7 G;  4GKK Q;  3HZX A;  3HOY G;  2IW3 A;  4R8I A;  5FO8 B;  2PCF B;  3DM3 A;  1WVL A;  2HDM A;  3CCU A;  4AYB E;  2NN6 I;  2G9H D;  2Z1C A;  4P74 A;  1ZEQ X;  4LFB Q;  2EE1 A;  2HQL A;  4DV6 L;  2KHI A;  3PO3 H;  3RMH A;  4G7O C;  5C4J H;  4POG A;  4J6H A;  1NJI C;  1CA6 A;  4AQY L;  2CQO A;  3T1Y Q;  4HTH A;  1SE2 A;  3RR5 A;  4XTC S;  2NVT H;  3GTO B;  4WOR A;  1TU2 B;  1II3 A;  3P1H A;  3KLS A;  3QOL A;  5T1I A;  1G6P A;  5IT9 L;  1Z47 A;  4FXG C;  3F2U A;  1VQ8 A;  3N52 A;  3QR8 A;  4J1M A;  1DJR D;  1PRT C;  1E1T A;  4OGQ C;  3CRK C;  1XXG A;  2CH4 A;  4EQN A;  1C4Q A;  4GOP B;  4JI1 L;  4IPD A;  4RG1 A;  1JWU D;  4FF4 A;  1SFO H;  1CHP D;  4RA8 A;  1PV4 A;  4DR6 L;  2RHS B;  3HOZ H;  4QUF A;  2N49 A;  2D2C C;  4WJ4 A;  1KL9 A;  2PPB C;  4AH6 A;  2F0P A;  4DK0 A;  3PO2 G;  2F0U A;  2E2I H;  2UUB Q;  1FNV A;  1WOC A;  1GD7 A;  3PMF A;  2RSN A;  4K8I A;  3T56 B;  4JK1 C;  5LMN W;  2Z9H A;  1WCM B;  3H6M A;  3CCQ A;  3CCV A;  2KHJ A;  1UEA B;  2NZO A;  5GAH C;  1YHA A;  2ZXO A;  2XIW A;  4C3I G;  3HG9 A;  1E0B A;  3SHL A;  3K7A B;  5IYD G;  5JEA G;  1XNR Q;  3F2D A;  2DNE A;  3H15 A;  2NZH A;  4JI7 L;  2R93 H;  2PMZ E;  2K5H A;  4TKO B;  2QIL A;  3VA5 A;  1QJO A;  5M5X H;  4JCV E;  4CJ2 C;  1XNQ Q;  4JYA Q;  2XVS A;  4C3J B;  3HOV H;  4YCU A;  2UU9 Q;  4X66 L;  1AH9 A;  2Y0S B;  5BN4 A;  3A56 A;  1JQY D;  3P20 A;  3GV6 A;  1EYA A;  2MJ8 A;  3NBH A;  4Y7N H;  4JI5 L;  4LUO A;  1OXT A;  4RGM A;  5IOD A;  1JWS D;  4DXG A;  1TWG H;  2PNR C;  5ELF A;  4JOI A;  2PO4 A;  1F77 A;  1X9N A;  2EY5 A;  3K57 A;  3H3V H;  2BE5 D;  2JA8 G;  3TME A;  4KY7 A;  1I4Q A;  1PHJ A;  2NB0 A;  4LF5 Q;  1VQD A;  1SBB B;  2VW9 A;  5EKK A;  3S1R B;  4A3D G;  1LLR D;  1PRT B;  2F0I A;  1ESF A;  2QW7 A;  5C3E B;  4TVA B;  3R93 A;  1TWH B;  3S24 A;  5FJ8 H;  3I55 A;  1VQG A;  1D1K A;  3PIO 3;  3CCJ A;  1ASY A;  3NP8 A;  3WWV A;  4B9X A;  4F7X A;  3WDN A;  1K8G A;  1GHK A;  2CVR A;  3CC7 A;  2YYZ A;  3D8G A;  1I94 L;  1F2M A;  2B2U A;  4XYO A;  5DNF A;  1V8Q A;  3TP8 A;  4HIK A;  4NXM L;  1JOO A;  1EY0 A;  4UAI A;  3SXH A;  2AUJ D;  4HR7 B;  1KAA A;  2VQF Q;  5ISR A;  2AUK A;  1VQ4 A;  1HCZ A;  3TP6 A;  1RTN A;  3K5L A;  5M5Y B;  3CQZ H;  2F0Q A;  3U9S A;  3OWE B;  5BR8 L;  5IIF A;  1KAB A;  4L8J A;  3RUZ A;  5IGG A;  1JWM D;  2JJQ A;  5C44 G;  4X65 L;  2L11 A;  3EVQ A;  3SE0 A;  2NVQ B;  1N32 L;  2R7Z B;  2C35 B;  4A3I B;  4HN7 A;  5FO7 B;  2R7F A;  4MZ9 A;  3PIP A;  3D6W A;  3IFT A;  4K2L A;  3CW2 C;  1YVC A;  2NZ1 D;  4O1N A;  1SNC A;  4GLA C;  3E9I A;  2K75 A;  4HAE A;  5EPK A;  4IUN A;  1P8L A;  4IQZ A;  3FP9 A;  4HJ5 A;  2KJX A;  4DAY B;  1NAP A;  4OHJ A;  1YBY A;  3OMG A;  1PVO A;  1HFG A;  2VB2 X;  5CGK A;  5AJ3 Q;  4BXX G;  1SNM A;  3M4Q A;  1DXM A;  4A3J G;  1K3R A;  2JA9 A;  2JQO A;  3K80 C;  4K2K A;  3H0G B;  4F8M A;  4GN5 A;  3HOY B;  1EL0 A;  4CKB A;  1S5F D;  2Z6K A;  2FMC A;  4FO2 A;  1R9T H;  4CJ1 B;  3HEJ A;  3IFD A;  1QNK A;  3L2P A;  1JE5 A;  4A3G B;  3BDL A;  3KDF B;  1FL0 A;  2XRQ D;  4LMQ D;  1I4H A;  2NTS A;  1D5Z C;  3K5M A;  3PO3 G;  5C5L A;  1VMP A;  4ILW A;  4ZQ3 A;  3HRZ C;  3ITP A;  4B08 A;  2WB1 E;  1RF2 D;  2A19 A;  4DV6 Q;  1KTK A;  1IXR A;  3S1M B;  2KHS A;  3EN2 A;  4X6A H;  4IZ8 A;  1T5E A;  3MFY A;  4KHZ A;  4WRD A;  2N8N A;  1IW7 C;  1PZI D;  4BA1 I;  3S1Q H;  3MWY W;  4LF4 L;  3DXJ C;  4HSV A;  1KDB A;  3TDQ A;  5DEH A;  5F2D A;  4CBV A;  5CV7 A;  1I4P A;  1AW7 A;  4JI6 L;  4MHE A;  4ZRZ A;  2JSO A;  2K52 A;  4AIM A;  3PO2 B;  3TBI B;  2QKI C;  4CDE C;  3ERQ A;  1HUN A;  1W6K A;  3HOZ G;  4MTK A;  1Q90 A;  3NQT A;  4JI1 Q;  5JJK A;  2VB3 X;  1SYB A;  3V05 A;  1Q82 C;  1JOK A;  1A3V A;  2YU9 H;  4DR6 Q;  1PTO C;  4C3H H;  2EY1 A;  5KND A;  4YHH L;  1TT2 A; 
#chains in the Genus database with same CATH homology
 2B2W A;  4C3I B;  3MAQ A;  4ID6 A;  1PZK D;  1YNJ D;  4IUP A;  4K8J A;  1WD1 A;  2L0C A;  3NPP A;  2B2T A;  3CRL C;  1D1I A;  2K5Q A;  2F0D A;  3DUZ A;  1WTV A;  4G7Z C;  5KIX A;  1MI2 A;  3SK6 A;  3M3Y B;  1VF5 C;  3GTJ B;  2HQE A;  4DAV A;  1H9S B;  1XTC D;  2L1B A;  2PW7 A;  4RGO S;  3T4A C;  2PQE A;  4LK1 C;  4ODG A;  2ZXR A;  1OXV A;  2CHB D;  1ROD A;  4CJ0 B;  2K1B A;  5FO9 B;  5CBE E;  2JA8 B;  3A8I E;  3I73 A;  3V2T A;  1O78 A;  2CW0 C;  5KNC A;  4KD4 A;  3TSS A;  1Z7T A;  5KRU A;  2NVX B;  1AFP A;  1TWA B;  2FHT A;  2E2H B;  1X3Q A;  1WTW A;  2MUY A;  1LTA D;  1G8Z D;  1BDO A;  4DNR B;  1YNN C;  5E1F A;  3TN2 A;  4QCL A;  1G29 1;  3VR4 A;  5EQ0 A;  3H09 A;  2NYZ D;  2B39 A;  1HFN A;  3A7A B;  4CHT B;  3PIP 3;  1D6E C;  3K5N A;  1BOS A;  3BVG A;  4CKC A;  2JEB I;  1PTO B;  3AMU A;  3R8B A;  2FFK B;  4F88 A;  1BCP F;  4UDU C;  1RJT A;  4P2C B;  2L55 A;  4PMC A;  5C44 B;  1DD2 A;  3TZD A;  3PV0 A;  2AQ1 B;  2EJM A;  4XQN A;  2F0J A;  1S5E D;  1EZ6 A;  3AU7 A;  5LL6 S;  3T53 B;  4RHS A;  1Y69 U;  1B1Z A;  1ML0 D;  2F0E A;  3PUV A;  3BG3 A;  4EQP A;  5TSS A;  2I07 B;  1HRJ A;  4KKT A;  4A3J B;  4DXF A;  1TY2 A;  5G3L F;  5IGF A;  3NQI A;  3BDO A;  3I4L A;  2B8G A;  3S14 B;  3GTP B;  2B2Y C;  4KKU A;  1I6V C;  3BZD B;  2JE6 I;  3PO3 B;  5IGB A;  1EOT A;  5JEA J;  2K5W A;  1EWC A;  5C4J B;  1S4Z A;  3OOC A;  1B4O A;  1Y8N B;  3NBI A;  3H3V C;  1FNW A;  4ABN A;  1F2Y A;  2NVT B;  1RTO A;  5ELC A;  4WFN 3;  4IFD H;  1SNP A;  1B9N A;  1WTO A;  3P7J A;  3DWQ A;  5CYU A;  1NUC A;  4ULL A;  1SFO B;  3SK4 A;  3C46 A;  3P75 A;  1FR3 A;  4DU9 A;  4NDX A;  1JCK B;  5JPN C;  1KLU D;  3HOZ B;  1A15 A;  4C1N I;  5D3D A;  2F0O A;  2E2I B;  4HMI A;  3WOF A;  4DNT B;  2E2D C;  2E76 C;  2DN8 A;  5J22 A;  3M85 A;  1BNZ A;  3Q24 A;  4WJW A;  3VR5 A;  4C3H G;  4ZK9 B;  2FIN B;  1ZXT A;  2AWN A;  1LTI D;  5CV8 A;  1CHQ D;  1E2Z A;  2R93 B;  3JAM L;  5M5X B;  4LJZ C;  1PRT D;  4RGT A;  3HOV B;  2Z4H A;  1EY4 A;  2EVB A;  4R8N A;  3X3N A;  1B53 A;  2K04 A;  4FF2 A;  4Y7N B;  2A6H C;  2L4N A;  2B2V C;  1TWG B;  5IGE A;  1BUV T;  1CQF A;  1HPC A;  2ICE C;  3NWS A;  4RKB A;  5K5P A;  4M1U B;  2ENB A;  5FKA C;  2K05 A;  3J80 E;  4H13 C;  1F9P A;  3A8K E;  4HSP A;  3NE5 B;  3QWN A;  1BR9 A;  2A74 C;  1SAP A;  3URY A;  2E74 C;  2TSS A;  1D2B A;  1E2V A;  1PMR A;  1HXY D;  4TQU S;  4MIU A;  2RBM A;  4H44 C;  4V19 0;  1A2T A;  1AN8 A;  4GZY C;  5J1Z A;  4K6D A;  1BO0 A;  3W2D A;  4K5W A;  4S3S A;  5ELD A;  2RVL A;  1DOL A;  1GUO A;  1H9S A;  1F2Z A;  3I72 A;  5HUR A;  4FF1 A;  3CQZ B;  3CU7 A;  5LHY 1;  2K03 A;  1QG7 A;  1PYW D;  1TQO A;  1SXT A;  2KED A;  5K36 G;  2WAQ B;  4N9P A;  4LAA A;  3I70 A;  5I9O A;  3J81 L;  1EIH A;  3SVM A;  3EJI A;  3NHH A;  4DFA A;  3DMU A;  1NR2 A;  1XX8 A;  4KN7 C;  2EXZ A;  1CQV A;  1NCV A;  4CGY B;  2EYL A;  1D5X C;  1MBY A;  1F2L A;  2KQ3 A;  3G6J B;  1R9T B;  4IUQ A;  2RDF A;  3BS1 A;  1HQM C;  2WKC A;  4BS9 A;  2BCO A;  3M7N A;  3R2T A;  1UNS A;  1WTP A;  1TVX A;  1RCV D;  4R9W A;  1LV9 A;  2SEB D;  4V0B A;  5KEE A;  4EVO A;  4IN3 A;  1F9Q A;  1IHZ A;  3NK9 A;  2J0T D;  3OHX C;  4DK1 A;  4FXD A;  3L7Z C;  3MZ5 A;  4KMU C;  5CV5 A;  3FVQ A;  1LT5 D;  3J7Y W;  2NUC A;  3S1Q B;  4IFD G;  1EEF D;  1EWH A;  1LO5 D;  4FVM A;  1B50 A;  4J8Q A;  2QCP X;  1EQT A;  1EZ8 A;  3L3O C;  1LT6 D;  3K6O A;  2Z4I A;  1B2T A;  5C4Z A;  1C8C A;  2YU9 B;  4C3H B;  1EU4 A;  1O7Z A;  4KTA A;  1NSN S;  2Q8T A;  2MHV A;  3GP7 A;  3DHQ A;  1STA A;  3FRP B;  1IKL A;  1KNA A;  1QIL A;  1A2U A;  2B8F A;  2F0S A;  3ONA B;  4ZLT F;  1EY7 A;  5FK9 C;  2ZT9 C;  3HOW B;  1IW7 D;  5KYI A;  1Q12 A;  1SNO A;  4PNY A;  1T5X D;  1F9R A;  4AYB B;  2EYH A;  1SJH D;  1L0Y B;  4X3K A;  2EZV A;  1STG A;  2C5C A;  2BDO A;  2JA7 B;  1H9J A;  1DON A;  1U9R A;  2AQ3 B;  1DZ1 A;  2FJ2 A;  3E6Z X;  2F0F A;  1SND A;  1ESR A;  1IYV A;  2O2L D;  5CV6 A;  4F87 A;  5COY A;  4ZUI A;  1PTO D;  2WP8 J;  5A2Q E;  1Q1E A;  2NBF A;  3K0Y A;  3X3M A;  4E6I A;  5IGC A;  3KF8 A;  2ICI A;  2R61 A;  1PFB A;  2KEC A;  1SE3 A;  1JR0 D;  1DCZ A;  4G4K A;  1U4L A;  3J7A F;  5FLX E;  1B3A A;  1EU3 A;  5JAV A;  3ERO A;  1SMY D;  1BCP C;  4KJN A;  5IT9 E;  5EKL A;  4RHR A;  2WII B;  2LKV A;  3D31 A;  1WTR A;  1TWF B;  5ELE A;  1HUM A;  4K5X A;  2G9D A;  2PMZ B;  3U9O A;  2XWJ B;  1EY6 A;  2JEA I;  5D14 A;  3D6C A;  3NTK A;  1ZKO A;  1BF4 A;  2RKS A;  3MHB A;  2F0V A;  2K28 A;  5JJZ A;  1QOH A;  3L9A X;  2K7V A;  4OL7 A;  3OSO A;  1U4P A;  2F0M A;  3QIA A;  4OO1 H;  4RCO A;  5EGT A;  1JOR A;  2A5H A;  1FNU A;  4C2M B;  1SDF A;  1JOQ A;  3MTS A;  1U4R A;  2EY2 A;  1M4V A;  1LTG D;  3J7A V;  1CTM A;  4XQJ A;  5EBC A;  4A3D B;  5C3W A;  1VF7 A;  2EYF A;  1A3T A;  2F0G A;  1Z6H A;  3K59 A;  3ZYY X;  1QE6 A;  5COR A;  2D62 A;  4DN4 M;  2SNM A;  1PFM A;  3PUX A;  2MPM A;  1BCP B;  4KV6 A;  1AZQ A;  3MA2 B;  3KLR A;  4OIJ A;  4OIK A;  4L6T B;  1ZYR D;  1FGB D;  3SEB A;  3ND8 A;  1U4M A;  2I46 A;  1PZJ D;  2B2V A;  3KBG A;  1A3U A;  2HCI A;  4EGV A;  4FNF A;  2TMP A;  4IUU A;  3VR2 A;  3FPU B;  4QMG A;  1G6Z A;  1LTS D;  1GHJ A;  2BOS A;  1TS3 A;  1BXT A;  5C0X H;  4C1N K;  3EFX D;  5K36 H;  2O4X A;  3VYR A;  2BA1 A;  1MGS A;  4A3K B;  2OF1 A;  3GTL B;  2D5D A;  3EA6 A;  3K5O A;  1O7Y A;  2D9U A;  3BDC A;  3KLS X;  2JXM B;  4RCN A;  1R4P B;  4ZYS A;  2VUM B;  2L9H A;  1WTX A;  3AB9 A;  5ELB A;  1EYD A;  3R2I A;  1X32 A;  2HUG A;  3NTH A;  4M8A A;  3VYS A;  1V1P B;  2R92 B;  4RWS C;  5D3I B;  1V1O A;  5IOC A;  1ENF A;  3MXU A;  1H9M A;  3KUP A;  2XWB B;  2WB1 B;  2J4X A;  3MEH A;  2LY7 A;  1RDP D;  5C4H A;  2J7Z A;  4X3U A;  3O13 A;  3OWF A;  5BN3 A;  3MVV A;  1LAB A;  1K8O A;  3I91 A;  3CHB D;  4A3E B;  4IFD I;  3R3O A;  1L0X B;  5M9O A;  3FKI B;  2HCC A;  1D5M C;  2A6E D;  1IYU A;  3KBX A;  2C9O A;  3H94 A;  2A6H D;  3SK5 A;  4DAY A;  4XT1 B;  3QJY A;  3BVM A;  3E5S A;  3VA7 A;  1H9K A;  3GV3 A;  4KN4 C;  2KUM A;  2L12 A;  2RQX A;  1TS5 A;  2B2W C;  5D65 A;  5JOB A;  4HMJ A;  1FYC A;  4XQQ A;  2WV6 D;  2B2T C;  3QB3 A;  1Y8P B;  3HOU B;  5CBA E;  2RDG A;  4IFD J;  3LX0 A;  1RD9 D;  4XIG S;  1GUG A;  4FXK C;  5C5M A;  2A68 C;  2PZW A;  1GOZ A;  1GUT A;  5E4W C;  1LTT D;  1JE4 A;  5JPM C;  4BA2 I;  4BWG B;  5JVH 3;  2SNS A;  1R4Q B;  1QNU A;  1PFN A;  3D4R A;  1EIG A;  1KNE A;  1O80 A;  2KA7 A;  2OEO A;  4OO1 G;  3M4O B;  1GJX A;  1HHV A;  2XNA C;  2EYM A;  2O5I C;  3VYT A;  1WD0 A;  2A73 B;  3OPO A;  2GA4 B;  2JA5 B;  2AQ2 B;  4MN3 A;  4NMZ A;  1TKW B;  3VR6 A;  2LFN A;  3NSW A;  5C6A A;  1S5C D;  3BYT B;  3MXN A;  1G2T A;  1I4R A;  3VR3 A;  3I4N B;  5NUC A;  3I3C A;  2IWH A;  1HTL D;  5CMD A;  3UI2 A;  2A69 C;  4HCS A;  3TP5 A;  4FP5 D;  2PYK A;  2E75 C;  2PZU A;  2HDL A;  4KHV A;  1AEX A;  3S17 B;  3HS0 C;  1EFI D;  5LL6 X;  1HQR D;  4YIJ A;  1B44 D;  2E2J B;  3C2P A;  1CZW A;  2NN6 H;  5EKI A;  4DAP A;  1EQV A;  5FLX L;  2F3W A;  3K58 A;  3SK8 A;  2XSC A;  1ET9 A;  1MSG A;  4KY5 A;  5KYL A;  5C0X G;  2IT1 A;  1CA5 A;  2WKD A;  3IKJ A;  4A3B B;  2XN9 C;  2JYO A;  4KJO A;  2VNU D;  3IAY A;  3Q6S A;  1DYQ A;  1Q8I A;  3D4D A;  2L5T A;  1ILQ A;  5I4D A;  4EQO A;  2F0W A;  1SE4 A;  3RZO B;  5I6Y A;  4N9T A;  1STH A;  1SYD A;  4RKL A;  1JB3 A;  1FD7 D;  2IPK D;  3BYY B;  1VCI A;  2EJF C;  1S5B D;  2KCC A;  1SYG A;  4BY7 B;  1I3Q B;  2X6L A;  1KDC A;  1Q3L A;  3MXP A;  4FF3 A;  5CR3 A;  3OIP A;  5DM6 3;  3H91 A;  2Q8R E;  1LAC A;  2RSO A;  3I4M B;  2IX3 A;  1LT3 D;  1STE A;  3D4W A;  1JIC A;  1TR5 A;  3RLF A;  1SYE A;  1VDZ A;  2M2L A;  3DM1 A;  4FYD A;  3GD7 A;  2F4I A;  1I6H B;  2Q8I B;  1ENA A;  3PUZ A;  3RZD B;  1Y1V B;  1I50 B;  2IJ0 A;  1V1P A;  3LWE A;  1BQQ T;  1TWC B;  2F0T A;  4I7Z C;  3MC0 B;  3FMC A;  1SYC A;  3GTG B;  2LS0 1;  3PUY A;  5HGT A;  1ET6 A;  4B9W A;  4K14 A;  1SJE D;  5CC4 A;  3HKZ B;  2EYJ A;  1PRT F;  3SR1 A;  4G7H C;  4KD3 A;  4RFB A;  1QWY A;  1EY5 A;  1BCP D;  4X3S A;  2BDN A;  1UAP A;  3JAM E;  4PMW A;  1LT4 D;  3FDT A;  3FPP A;  3HGB A;  3G7L A;  4QF4 A;  2BE5 C;  3MXG A;  1OXX K;  4HCE A;  1SNQ A;  2M9V A;  4H0L C;  1GUN A;  1TY0 A;  3TZU A;  4IUR A;  5C4X B;  3Q0A A;  2CQA A;  5FOB B;  4U68 A;  3PUW A;  3S9W A;  1Y8O B;  1GUS A;  5J39 A;  5JVG 3;  2B63 B;  3V96 A;  2SDF A;  3SDZ A;  2K33 A;  5G3L D;  1I4X A;  2M00 A;  1RHP A;  4NW2 A;  2Z8L A;  1ILP A;  3D3R A;  1PDQ A;  4A93 B;  2N55 A;  1DOM A;  2B2Y A;  2NN6 G;  4RGN A;  3I8Z A;  2F1M A;  3ND9 A;  3S1N B;  2LMC B;  3W3A A;  2F03 A;  1H9R A;  1QCB D;  1OO9 B;  2BA0 A;  4IUV A;  1RKN A;  1V43 A;  2KVM A;  2CW0 D;  4DGZ A;  1A6X A;  3MFG A;  2EOT A;  3DWP A;  2K5D A;  1J8I A;  4RH6 A;  1TS2 A;  5E4X A;  5T1G A;  1ICW A;  1G2S A;  2SOB A;  5CV9 A;  2IX0 A;  1DOK A;  5CV4 A;  1YNN D;  4O42 A;  1CK1 A;  3C3L A;  2EY6 A;  3J81 E;  5EBD A;  1AP0 A;  4CKE A;  3N6R A;  1PLF A;  4Z9C B;  1S5D D;  4OO1 I;  3NUC A;  2X6G A;  1SEB D;  1JC7 A;  3TP7 A;  3OW7 A;  1SYF A;  2KEE A;  2MGS A;  2F0H A;  2R3Z A;  2ZXP A;  3OIQ A;  3C1E A;  1O7L A;  4PMB A;  5E3F A;  3A55 A;  4XDX A;  3DEO A;  3FEW X;  1LTR D;  2EPB A;  1G91 A;  1SMY C;  4U67 3;  2O5J C;  1J9O A;  4KK7 A;  1NR4 A;  5EJW A;  2NTT A;  3IL8 A;  4XXE A;  1F9S A;  2B2U C;  5KGU A;  2F0L A;  5C3X A;  2EYP A;  5BN5 A;  3J80 L;  4I65 A;  1AZP A;  1K8M A;  3NXW A;  2WIN B;  5I2Y A;  3S16 B;  2QEJ C;  2FMM A;  3T16 A;  3E0J A;  1UUP A;  1M8A A;  4Q0F A;  3VYU A;  1CT1 D;  5IGD A;  3NTI A;  1Y1W B;  2EYO A;  1LTB D;  4NKL A;  4TSS A;  1VMC A;  5C0X I;  1YNJ C;  3GO5 A;  1MSH A;  1TS4 A;  2F0N A;  4QB4 A;  4K6L A;  2DY8 A;  4KI0 A;  2OXP A;  2WAC A;  3A54 A;  1W6J A;  1DM0 B;  1EEI D;  1PXU A;  5I2X A;  4Q5V A;  3KK7 A;  1CI3 M;  1STY A;  3CKI B;  3M7G A;  3T51 B;  2XRS D;  4DF7 A;  5EPJ A;  1K83 B;  2PZT A;  3GTK B;  2EJG C;  2EDG A;  5EPL A;  5I6W A;  1CM9 A;  2K01 A;  3DEP A;  5C0X J;  4PV1 C;  2H1E A;  3Q23 A;  5A35 A;  3A8J E;  1WTQ A;  2DNC A;  5M5W B;  2NWG A;  1CFM A;  1PTO F;  3WOE A;  4H7B A;  5KNB A;  5JEA H;  1EY9 A;  3NWT A;  4JBW A;  2VXW A;  4BY1 B;  3S15 B;  4ZUJ A;  1ZYR C;  3T13 A;  3C1F A;  2R6G A;  4L63 B;  4XYQ A;  3HP3 A;  1B9M A;  2A68 D;  2F3V A;  4C56 C;  4RAU C;  2V4D A;  3BVZ A;  4C3J G;  1IL8 A;  4A3M B;  3GTQ B;  3I90 A;  4ME5 A;  3LNN A;  3QOJ A;  2KOL A;  2RA4 A;  4ZAI A;  2JA6 B;  2H4O A;  4ZKB B;  1STB A;  1HA6 A;  1XWE A;  1GUW A;  4KKS A;  2JP1 A;  2K6A A;  2K32 A;  1EYC A;  3EQL C;  4XT3 B;  1KLG D;  4IUT A;  2ID0 A;  4QIW B;  3QO2 A;  4K5V A;  1KDA A;  1Q1B A;  3A7L A;  2QDB A;  2A69 D;  1ONL A;  2OT2 A;  4HED A;  3RD4 A;  1I4G A;  3GTM B;  2NVY B;  1OXU A;  1PTO H;  5M3F B;  4G57 A;  4QUC A;  1QB5 D;  4NP5 A;  5M3M B;  3LWU A;  5AFW A;  1X3P A;  1OXS C;  2DY7 A;  1E2W A;  1EY8 A;  1BBX C;  4KY6 A;  4TRD A;  1STN A;  1HA5 A;  1TII D;  1CZG A;  2N88 A;  2RDH A;  2X69 A;  5I9P A;  1XYI A;  3GQB A;  2IL8 A;  4DA2 A;  1C48 A;  3S2H B;  2PW5 A;  1SSO A;  3DWA A;  3QG1 A;  4ZKC B;  3HOX B;  2A6E C;  1GXD C;  5DAU A;  2IX1 A;  1HTP A;  1MD2 D;  4X3T A;  5DM7 3;  3S2D B;  3M4Y A;  2KCN A;  4PQX A;  4A3F B;  1IKM A;  4BBR B;  3Q22 A;  5A2Q L;  1ENC A;  2AWO A;  4IAL A;  2MP1 A;  4BBS B;  2QF7 A;  2F0K A;  3OMC A;  3HZX A;  2IW3 A;  4R8I A;  5FO8 B;  2PCF B;  1WVL A;  2HDM A;  2NN6 I;  2G9H D;  2Z1C A;  1ZEQ X;  2EE1 A;  3RMH A;  4G7O C;  4J6H A;  1CA6 A;  4HTH A;  1SE2 A;  4XTC S;  3GTO B;  4WOR A;  1TU2 B;  1II3 A;  3P1H A;  3KLS A;  3QOL A;  5T1I A;  5IT9 L;  1Z47 A;  4FXG C;  3F2U A;  3N52 A;  4J1M A;  1DJR D;  1PRT C;  4OGQ C;  3CRK C;  1XXG A;  4EQN A;  1C4Q A;  1JWU D;  4FF4 A;  1CHP D;  4RA8 A;  4QUF A;  2D2C C;  2PPB C;  2F0P A;  4DK0 A;  2F0U A;  1FNV A;  3PMF A;  2RSN A;  4K8I A;  3T56 B;  4JK1 C;  1WCM B;  3H6M A;  1UEA B;  2ZXO A;  2XIW A;  4C3I G;  3HG9 A;  1E0B A;  3SHL A;  3K7A B;  5JEA G;  2DNE A;  4TKO B;  2QIL A;  3VA5 A;  1QJO A;  4CJ2 C;  2XVS A;  4C3J B;  2Y0S B;  5BN4 A;  3A56 A;  1JQY D;  3P20 A;  3GV6 A;  1EYA A;  2MJ8 A;  3NBH A;  1OXT A;  4RGM A;  5IOD A;  1JWS D;  4DXG A;  2PNR C;  5ELF A;  2PO4 A;  1F77 A;  2EY5 A;  3K57 A;  2BE5 D;  3TME A;  4KY7 A;  1I4Q A;  2NB0 A;  1SBB B;  5EKK A;  3S1R B;  1LLR D;  1PRT B;  2F0I A;  1ESF A;  5C3E B;  3R93 A;  1TWH B;  1D1K A;  3PIO 3;  3NP8 A;  4B9X A;  4F7X A;  3WDN A;  1GHK A;  2CVR A;  2YYZ A;  3D8G A;  1F2M A;  2B2U A;  4XYO A;  5DNF A;  1V8Q A;  3TP8 A;  1JOO A;  1EY0 A;  4UAI A;  3SXH A;  2AUJ D;  4HR7 B;  1KAA A;  5ISR A;  2AUK A;  1HCZ A;  3TP6 A;  1RTN A;  3K5L A;  5M5Y B;  2F0Q A;  3U9S A;  3OWE B;  5IIF A;  1KAB A;  4L8J A;  3RUZ A;  5IGG A;  1JWM D;  2L11 A;  3EVQ A;  3SE0 A;  2NVQ B;  2R7Z B;  4A3I B;  4HN7 A;  5FO7 B;  3D6W A;  3IFT A;  4K2L A;  2NZ1 D;  4O1N A;  1SNC A;  4HAE A;  5EPK A;  4IUN A;  4IQZ A;  2KJX A;  1NAP A;  4OHJ A;  3OMG A;  1HFG A;  2VB2 X;  5CGK A;  1SNM A;  1DXM A;  4K2K A;  3H0G B;  4F8M A;  3HOY B;  1EL0 A;  4CKB A;  1S5F D;  2FMC A;  4FO2 A;  4CJ1 B;  3HEJ A;  3IFD A;  1QNK A;  4A3G B;  3BDL A;  2XRQ D;  4LMQ D;  1I4H A;  2NTS A;  1D5Z C;  3K5M A;  5C5L A;  1VMP A;  4ILW A;  4ZQ3 A;  3HRZ C;  3ITP A;  4B08 A;  1RF2 D;  1KTK A;  3S1M B;  2KHS A;  4IZ8 A;  1T5E A;  3MFY A;  4KHZ A;  4WRD A;  1IW7 C;  1PZI D;  4BA1 I;  3MWY W;  3DXJ C;  4HSV A;  1KDB A;  3TDQ A;  5DEH A;  5F2D A;  4CBV A;  5CV7 A;  1I4P A;  1AW7 A;  4MHE A;  4ZRZ A;  2JSO A;  3PO2 B;  3TBI B;  2QKI C;  3ERQ A;  1HUN A;  1W6K A;  1Q90 A;  3NQT A;  2VB3 X;  1SYB A;  3V05 A;  1JOK A;  1A3V A;  1PTO C;  2EY1 A;  5KND A;  1TT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...