3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Otoferlin
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
4G11A 2WXPA 1RH8A 2WXMA 1YRKA 3L08A 4IHBA 3HIZA 3S2AA 1WFJA 2WXNA 1WFMA 2WXGA 1HE8A 2FJUB 3FBKA 3L9BA 2WXQA 4FJYA 4GNKB 1RLWA 4XX5A 4DNLA 2CHXA 4PS7A 4LCVA 2Y3AA 2NSQA 4XZ4A 2ENQA 4URKA 4AJWA 3HHMA 3PS6A 4OVVA 4Y1SA 3ZIMA 4BFRA 3ENEA 4PS8A 4ANXA 2WXRA 4FULA 2CHWA 3QR1A 4L1BA 3ZW3A 2DMHA 1DJWA 3QK0A 4FHJA 4FJZA 3KWTA 4OVUA 4KITB 3KWUA 2A4ZA 4NP9A 3QARA 2JQZA 3N5AA 1UGKA 1E90A 5G55A 4J6IA 4JPSA 4EZLA 4WWNA 3F00A 3HN8A 3OHMB 3QR0A 4EZKA 2QZQA 3OAWA 4TS6A 1QATA 2A5UA 1GMIA 2WXFA 4FHKA 1RSYA 1BDYA 4WEEA 4QJ4B 1DJHA 4ICXA 2YRBA 3IBEA 1DSYA 2WXKA 4ICWA 3MJWA 2CM6A 1W15A 3W57A 2WXOA 3W56A 5CCGE 4LDCA 3L54A 3RDJA 1QASA 3CSFA 2CHDA 4KZCA 2YOAA 2B3RA 1BYNA 3L4CA 2K45A 3APFA 5EDSA 3L13A 4F91B 5H4ZA 3L16A 1A25A 3P2BA 4F1SA 3JZYA 3IM1A 4HLEA 3F05A 2RD0A 1E8YA 4WAFA 4DK5A 4WWPA 2N1TE 2CJSA 3APDA 2ENJA 4LT7A 1E8ZA 2K8MA 4F93B 2Z0UA 4EZJA 2QZ5A 2V4LA 1UOWA 3T8MA 3PYCA 1DJXA 2ENPA 3PFQA 3FDWA 2DMGA 2EP6A 4QJ5B 5JHBA 5JHAA 3APCA 2WXHA 3DPDA 3QJZA 4TV3A 2CHZA 3ML9A 2NQ3A 3GPEA 3NSJA 3NZUA 3QAQA 4L2YA 1V27A 4NPJA 3B7YA 4NS0A 4V11A 5H4YA 4PS3A 2R83A 4BGDA 2Q3XA 4QJ3B 4AOFA 2CM5A 2FK9A 3DBSA 2NCEA 1E7UA 3F01A 4L1LA 2ISDA 3R7QA 4ANUA 4L23A 1K5WA 4IQHA 2CJTA 3SD5A 5KJ7E 3LJ3A 2K3HA 2WXIA 3ZVVA 3M7FB 2Q0ZX 5T8IA 3RPBA 1DJYA 1DJIA 3NZSA 4ANWA 1E8XA 2WXLA 2D8KA 1W16A 4ANVA 4HVBA 2LHAA 1TJXA 2K4AA 4FLHA 1TJMA 1BCIA 4QAMB 2KI6A 2ZKMX 3PRZA 4XE0A 5CCHE 1CJYA 3R7RA 4FA6A 4FADA 4WWOA 1DJZA 1DQVA 1E7VA 4GB9A 5CCJA 1UOVA 2BWQA 3TL5A 1E8WA 3L17A 3PREA 1DJGA 4KZ0A 3TWYA 5G2NA 3ML8A 4F92B 2X38A 4Y1TA 3F04A 3TJPA 4MJJA 2WXJA 4NPKA 2UZPA 4TUUA 4A55A 3CSTA
chains in the Genus database with same CATH superfamily
4EN2A 4Q0XH 3V10A 3V9FA 2V3DA 4P5TC 4X4KA 4P3WA 2BP0B 3Q8BA 4FJYA 4OV6F 1QSFA 3CZNA 4QRPA 1F90L 1LE9A 4OZHE 5E5MB 2LW3A 3KMDA 4OTXL 1YO4A 5D9SA 1QR4A 5CEZH 1U3ZA 2COQA 3G6JB 1MNNA 4O2FB 4OSUH 4RSVA 3N50A 4RMRA 5CJOL 4F1ZA 5KVGL 5J1SC 5DD3L 4PS8A 3VXPB 2P5EA 4N2MA 1NC2B 2IDQA 3TT3H 3VXUE 3GPSA 3TN0C 3P3YA 4M03A 5MEND 2VDNB 5EPMB 1OGTA 2CLZA 1KXTA 3EYFB 1HKFA 3EOAB 3LS5H 1A8JH 2ZQKA 4N5EC 5CEZL 3Q8AA 2BWDA 5DLMH 3ILDA 4HUWA 1TZHB 3TC9A 5IJVA 3MJWA 3NTCH 3WE6A 1QSEB 5F7HA 3NPSC 2WNKA 1W15A 5JDSA 1ND0A 2CUAA 3WJJC 1DSFH 3NIDF 1IU1A 3TT3L 5IFJA 3OWRA 1TQUA 4KUZH 1JE6A 4U1GC 2B3IA 1DVZA 4XNZB 3VCLA 1GCYA 3QIWC 3H56A 1EWHA 4ZSOE 4V1DD 5JPNB 1B4JH 3LS5L 2XICA 1WCQA 4YSOA 4F8NA 5A1AA 5DLML 4UM8A 4KI5C 3UYPA 3S4SG 4JGUA 1G9ML 4OGXH 2V7NA 4UQBA 2XBZA 3BP5A 1BD2A 2PETA 4AT6A 5T3ZE 1KTDA 3TJHC 1H5BA 1NDTA 2DMGA 4WIQA 4P5TD 4IRJC 3UAJA 4PJ8C 5EU3B 1TTBA 2J6EH 3VWJA 1JXFA 1DVFC 4NZTH 4DP2X 3N06B 5JLZA 4DF9A 3H9HA 4PGDA 1A2YA 2BERA 1KJMB 1P7KA 3HB3C 2BVPB 1A6TB 1HI6A 2K0RA 4HAGA 3RBGA 3IMBA 2VISA 3W11D 1AKJD 3RWCB 4CU7A 3HN5A 1UQSB 4PRDB 4W9EC 4OKVA 1TXKA 4AYID 2A6JA 2X4TA 3D3VD 3EO1B 4TTDC 1IE5A 3TBYA 4FNTA 3K6IA 1U3HB 1HHIA 3C5JB 4PIRF 4FA6A 2J6EL 3FXIC 5E0QA 3MJ6A 1PVHA 5AW9B 1CUOA 2DS4A 4IRSD 1GMEA 4N5ED 3MRLA 4KY2A 3WFCL 3T65A 3NIDB 5DHDA 5BZZA 1KJ2L 4NYLA 1D7FA 3RY4A 1QAWA 4IGBC 4UMGA 1K3ZA 5DEGB 5ACZB 4Z7VF 3C60B 3BVTA 1RLWA 2GSGA 4KDWA 5GRZA 4L9DA 3QIWD 1R17A 4BFNA 4PRBA 3EW3B 5BVJA 4MNQB 4X8GA 2D73A 1I85C 4JKMA 3BAJA 4KI5D 4L1DA 4DZBB 3QC5X 1CMOA 4NJ9L 3UO8B 2R69A 4ZAKB 5E56A 1HNGA 1TEYA 4TVSa 2BW5A 4H2AA 4JN1H 3NQKA 3TJHD 3GJFA 3UJIH 1MAKA 4RRPM 4JFFE 1JYWA 1KLFA 3TBBA 4ONOA 4G8GB 3SHSA 4IRJD 1PL3A 3X11A 4PJ8D 4Y9FA 3QR0A 4BYHA 5FECA 3LQAL 1DVFD 4OGYH 2RFXA 3EIFA 3S97C 1OK0A 1EIBA 3TA4D 2XC8A 3UTZA 3HBQA 2W60A 3D7PA 4EOWH 1TQCB 1L7TH 3P11L 3WHE0 2ZG3A 3MRIB 3HB3D 1IAMA 1JVLA 4H8HA 2WMPB 4F3FB 5FS5A 1GZHC 3K74B 4GUCA 4E41B 1NC4A 3WLBB 4PI2A 4YX2H 3AM8A 1OQXA 2FHCA 4JN1L 2CR3A 4GUPA 4UZSA 3VGFA 4KZCA 5AYQA 1CFQA 2ZJSH 4M6ML 2QVKA 4TTDD 1MCPH 4YWGH 5ILTL 4F7CA 4Q14A 5EBWB 4YLCA 4NO2B 4YDLB 3RX9A 3F05A 3GKWH 4TNWK 1UXMA 3LEXA 2O93L 2J8OA 3RNKB 4R5TA 1DE4B 4EOWL 4KXZI 5D1ZA 1NCCH 1L7TL 2G0LA 2BMKB 3X12A 3R1GH 2YWYA 2NOYA 4Z7VB 3V0JA 4HIPA 4X5XA 3NJKA 4YH6A 5GSVA 2F58H 4ZX6A 5K9QI 4TVPD 1KIPA 1YNKH 3VMNA 2TSBA 3FC8A 4JHVA 5DQJA 1MCPL 3GSRB 4ZXBD 3RWEB 4L8CA 3U46A 1YEHH 2ZPKL 4L9LB 4NO5B 2OX5A 2WWNA 1OGAA 3CDGA 2NY1C 3MI6A 4MAYD 3VFMB 2OTWA 1V3MA 5CP7B 3CZFA 1MIMH 2YKLH 1QG3A 3BO8B 3QHZH 3R1GL 5FWRA 1KCVH 1JN6A 2VJ8A 4OIFA 4EKXA 5JW5A 3IYLW 4UILL 2NNAA 2WK2A 2WCSA 4ODWA 2Q7YB 4XBPA 1OE1A 3JWNH 1MZZA 1WIPA 3S5LB 4AVIA 2KKQA 3U48A 1ASPA 1MCQA 2BFGA 1YEHL 3JUYA 3KH4A 5I6XC 4TNWF 5CEYB 4UDTA 1A1MA 3H4HA 1Q4NX 3L7EB 5CP3A 3KDMB 3OJVC 1NCOA 3CSYA 4K7PL 2IEPA 4X9GA 3AUVA 3OL2A 1KCVL 2B8OT 2WWMC 3A6OA 4IBVA 3O4LE 3R0MA 4WZ9A 2FLMA 1F3DJ 1JK9B 5TD4A 5DK0A 3TV8A 3VH8B 2WTOA 4MZIA 3WKQA 1VCAA 4OBSA 3KE0A 3S37H 3MLUH 5FCSH 4BFJA 1U8IB 3SKOB 5DQ9B 1FZOB 2ENQA 5J6HA 4LSUH 4N2OA 3VW3H 3LXCA 3H9ZA 1H8NA 4HZAA 4MJIE 5DO8A 1M6OA 1UUSA 4APXB 5B8CA 2CHWA 5MEOB 3NJLA 3W38A 3DA0A 3GHBH 5C0DA 1E30A 4MDIA 2OMXA 1NLBH 1F1AA 4ZNEE 1Y07A 4GSRA 3Q6FA 2IBGA 5I26A 2W0PA 4AQAB 5C6PB 3GIVA 2FJFB 4U6XB 3F00A 4JM2A 3HZMA 2N4IA 1RURL 1WGVA 1QATA 2JIXB 3CVHA 3FH8A 2EE0A 5T3ZD 5CCKH 4LSUL 5ANMB 7TAAA 2H0FA 2NY1D 4HUMB 4WUUB 3PV6A 5DJ2B 5DJ8A 4ALAH 1NFAA 5EWIH 4ODSH 2BSED 1QHPA 2GFBA 4ODTH 5I6KA 3M1BB 4N8UA 2NZIA 5CN1A 3GHBL 1TLMA 4ES9A 3L1FA 4ZMOA 3U36A 1CFSB 3FT9A 4PSRA 2A6KB 2H26A 3H9YA 3SQRA 1VFAA 2QKIB 1F4WL 5BS0E 5AZEL 2E0PA 1RUMH 5CCKL 1SVBA 2NY6C 2YRPA 4PJIA 1NCAL 4ALAL 4IBZA 4RCAA 4YSPA 3R8BB 2DQFA 4NQCE 3CFDB 4GW4A 1UZGA 1K5NB 3BEVB 3WAJA 2H0EA 1D5MB 3K0YA 5DUMH 5G4MA 4K73A 3DJSA 1F6LL 1NGZA 3RVXC 4H1LG 2XN1A 2NTSP 5K59F 1BQHA 1ONQA 5F97E 3FCSB 5B1AB 4ELKA 2UWEF 3GK8L 4F58H 2V7HA 1KPRA 4QHMA 3WOVA 2VERA 4Q4EA 3RA7H 2KH2B 3MJ9A 2DEYX 3DBXB 3BP7A 3I3DA 4IKKA 4HIJB 2JE8A 5ALBH 1ZRUA 4HJJH 1U93B 3A4FA 2C1PB 1NDGA 1RIHL 2OR9H 2OL3A 1I3VA 1HH6B 2UZIL 4K15A 4Q9QH 4JFFD 4F58L 4KFZC 1KJVB 4FQ1H 3QWOA 3RA7L 4QKTA 1JVOA 5FO8B 3U6RA 2HJLA 3QS2A 4GXVH 5AOZA 4MMZB 1D5ZB 4HJJL 1HE7A 2KYIA 3ABZA 2YPKA 4R4FL 4TLUA 3V5KB 3PAVA 4NN5B 4AJYV 5ADPH 5BW7A 1YEGL 3KLLA 3C8DA 3O0RL 1IQWH 3E7JA 2VQ4A 1ZLUH 1XIWA 3EBAA 4Y1SA 3ZIMA 3FS9A 1CE1L 3OAYK 4X4XB 4FQ1L 1TQBB 2ATPB 1CF8H 4GQZA 3ES6B 1Q0XL 3N55A 4GXVL 5J1AA 4EZLA 1I8IA 3LRSB 5EHFA 2UWEB 3I2CL 1T0MB 1UM5L 4FHKA 1IBGL 1TMQA 3IBEA 4KROB 4POYA 1DQDH 3MPCA 3MRPB 1KZQA 2BNQE 4PTUB 2J88H 3QBTB 5SWSA 3CUPA 1QBLL 4W6YB 2ZONA 5DZJA 3RJOA 3O6FA 1I1CA 2NRDA 1CF8L 3GIZH 5ESVB 4YSAA 3II2A 5AYUH 2ROYA 2VMDA 4UIKL 1RPQA 1DQLH 5FV1L 2XYBA 1YSOA 3BPNB 3HI5L 4YUEH 7PCYA 4FFZH 3QQDA 4BQBA 3CPLB 1DQDL 3P77A 2X05A 1KWGA 2IAMC 3F7VB 4HGWA 4I4WA 2J88L 3U9UA 5J9PA 5KBDA 2P24B 2Z8VC 3RL2A 2ZOKA 4R9HA 5LGJB 5TH2B 3NCYP 1SXZA 4FC3E 1ZCRA 3H8NA 5ABDE 2IQAA 2FR4A 3QAQA 2XG4B 3QCVH 5AVXB 3X14A 5HDLA 4Y4KB 3QUYB 2IG2L 4HIQA 2NW3A 5IB1B 4B7IA 1V5JA 5EA0L 4FFZL 4KAQL 5DD5H 3O4LD 1WFNA 1TJHH 3K71B 1BPVA 4M1CC 1HCFX 2H1PL 1CTNA 4LSPL 3PWNB 4RIRA 1I8KA 1TZ8A 3QI9A 4U0RB 3T09A 2BVOB 3KPNA 4Y5VA 5T5FL 2EE2A 2H32B 2NXZC 5SWQA 5AVUB 3QCVL 4OZFB 4MJID 5EZIL 2EIEA 4MKMA 4XPHH 3Q9PA 3HAEG 2BWQA 2JB6A 2ADFH 1T2QH 3FQ4A 2ED9A 3QFJD 4C57C 2PW1A 5CU5A 1FYTE 1L9OA 1TJHL 3S2AA 2DWTA 4LPTA 3HRZB 4FGMA 3W37A 3CH1A 4BZYA 4CILA 4L18A 1Z9OA 4LPYA 3AQYA 2D4FA 3PGDA 4MA3A 3C2AH 5CSZA 1VFMA 4Y16B 4PJBA 4M7KH 4MYPA 1EFXD 4GAYB 3HBGA 1LL1A 1SHWA 4NBXB 4XPHL 5KZCD 3MBWB 4XN1A 3VFTB 2ADFL 5FLUA 4EI5D 3WU1A 5BV7L 1QPKA 1RJCA 1NPUA 3DTDA 3FSOA 3SDAA 2QFPA 2IH9A 4OUOA 3M88A 4QR7A 3ZDXE 3C2AL 4WENB 3FOMB 3MBXH 1AD0B 2JNZA 3FT3B 3RL1B 4ZUSA 4A6YL 3VAEA 2HMIC 1GMIA 4NQCD 5EEWA 4AXWA 5KYYB 2R56H 2R9HD 2ILLA 3ATAA 5CJXA 4K4KA 1E0OB 2NZ1A 4M1CD 1XTMA 2RBLA 4FABH 4HU2A 5KOMC 3KLQA 1JZIA 4AUUA 5JOFB 5E1GA 2BCKA 2NXZD 3C5XA 2VDOH 2MNJB 1S7WA 3D08A 1ZT7B 3DLQR 3QIBD 4U7SA 2RH0A 5ISZB 3RVTD 1FE8H 1HYSC 1CBVL 2DRUA 5DWUH 3I6LE 2EYRB 4Z77A 1IC1A 1S3RA 5DVOA 5I1LA 2R56L 3MLPA 1OAZH 4ANKA 4PJ7E 1S9VB 2GIXA 4KO5A 5I8KH 4WDIA 2HJKB 4N2GA 2C1OA 4FABL 1IBHA 4KXDA 1U6AH 4DZ8A 3QJXA 2DMCA 1NGYA 4KXZH 4PS4H 5CU9A 2DKMA 4KKRA 4L1TA 4OT1L 4X4YB 3BZEB 2EDDA 3BAKA 5HGAA 4AE1A 3C09B 4HUUB 2WLYA 4DJMA 3KXFB 1S8DA 1OAZL 4P2QA 4IMKA 3B3IA 3FO2A 5I8KL 4P5KA 5EU6B 3MNVB 1QFWI 2GBTA 4JANB 1U6AL 2HLFD 2WYHA 3DX8A 5DJZA 2VXVL 1FNHA 4PGEB 1E6JL 2NY2D 2V37A 2BIOA 2DKUA 3WD5H 3E6HB 4HIEB 3T1FB 3H1ZA 4JFDE 4EVNA 2XKNB 4XP6H 2HMID 4YVNA 4PGCB 4FN0A 4NCDA 1XXFC 1X9UA 3OC5A 4L5FL 2GCYA 3CSTA 4U2ZA 3HZYA 5I8OH 3HNVH 4DOHE 1WFJA 2AK4D 4AZ8A 5H35A 1A5FL 5ADOH 2A4EA 2CMRL 3EDDA 3EJSA 2BNQD 3JBG7 2UY6A 4BSVA 2C9VA 4B9JA 5KVFH 3WD5L 2C3GA 4OD2B 4XP6L 4XMTA 2VRAA 4MCZA 4UT9A 1KF9B 2DYSB 4OVVA 5F3HA 2NNCA 1MHHB 3M1OA 5E1IA 2IC2A 3QXAB 4QRTA 5DA0B 3ZOAA 1S7VA 1G9NC 1MCDA 1R33A 5I8OL 4Z78B 4R3SB 3QYNA 2JTYA 3AWFA 1UWEL 4JDZB 4AQEA 5DRZA 4AJVA 3FQNB 3FU5A 4H40A 1XGYH 3IMRA 1UCTA 4JL1A 3DURB 4JREC 3DVFA 3FUNA 5D5MF 5HPMB 1FUNA 5DJAA 1VA9A 3EKCA 3LMJH 3THMH 3BFWA 3NP3A 1CFTA 3N41F 1AQDA 3MRFA 1JHTB 4Z7OE 1VEOA 2R59A 4HHWA 1U8NA 3UJJL 2MJWA 1B0RB 3IDYB 3QE5A 1WEJL 1UB6B 3ABLB 3V4VA 2CO7A 4MX7A 1XGYL 2EUVA 1VKXB 1GKOA 2WZPD 2UXVA 4MS8C 5DYFA 4PPTA 2Z34A 3PWJB 3VVWA 3THML 1OAYH 4BSWB 4NENB 4AIZB 3STZA 3C9NA 1WG3A 4O2EB 4IBQA 1KDJA 1B6UA 2VDRH 3T8MA 4DAGH 3T0WA 3AGWA 1JVKA 4QTIL 4MNGA 3WTTA 2F8IA 2C26A 4R4NC 4WF7A 1FYTD 2LQRA 5SX5H 4LCCA 1YQVH 1XL6A 2P42B 2B5IC 3DBSA 1HINH 1A9BB 3AG4B 3DNKA 4M4PA 3O41A 3EJYC 2B2XH 1W6LA 4OFIA 1YUHA 1JF1B 3DRTA 5KAQF 3EAKA 3PJNA 4Y5XC 3SKMB 4AYMC 2O61A 2DI7A 2H6UA 2WXLA 3JYBA 4KU1A 4ANVA 4QOKE 1IILE 2IFFL 3DI2B 4JY6B 5D8JH 4KKBC 2VITB 1R3LA 4OY9A 1L9RA 1Q9WB 3G08B 3IRZA 3V0HA 3S48A 4WWOA 1ZVYA 4TLSA 2FJGA 4NUMA 3N41B 1E43A 1HINL 3CDZA 4L4VE 2VQ1B 3T4YB 1IAOA 4MRCA 4Z0BH 2IQ9L 5EOCJ 1T7VA 3T3ME 3OF6A 4XTRC 1J0HA 1D9KC 4AW7A 2B2XL 4W9JC 5FYJH 1RZ8A 2O30A 3J2PA 3C5ZB 1RVFH 1N0XL 1KB9J 2OTPA 4XVSL 4NEHB 1B0WA 3BWAA 3DYPA 1NGPH 4AG4H 4O9HH 3O3EA 2RACA 3DIVA 1UKQA 5ERWB 5F1NB 1I82A 5BOJA 2YGQA 5JIPA 1BZEA 4XO5A 1IM9B 2BSTB 2BY3A 2EYTA 1JNHA 3QQ3B 5FFLA 5I2IB 1MHPL 2D7QA 4DGVH 4EDWH 4H25A 4JBSA 1IC0A 3LHAA 5T3XL 4MHHG 4L1BA 5FYJL 3U6XA 1AAJA 1L9NA 5FOBA 5IHWA 2XN9E 3BDYL 3QEQA 1UTDA 5IJCC 2Y5TA 2DJUA 3I6LD 1EEZA 5CHNA 4O9HL 3MOAH 2X4QB 4AG4L 4B97A 3MV9B 1MW1A 4TSAL 1ETZA 2APXA 4NFBA 4R4ND 4V2BA 4XPTH 1DN2A 1SMOA 4LCYB 4MB4A 1LE5A 3FO0L 3D2UB 2J6EA 3JVGC 1IVTA 3Q3GA 1O6SA 4P9HL 1EUUA 4X6BA 3D39E 4DGVL 3ULVF 1EV2E 4PP1C 2G4EA 2GI0A 3EJYD 4WV1A 4E9TA 1P4IH 3UZVA 5CCGE 1TYJA 1JV2A 1NCGA 3AG3B 5HJ3A 1JHLH 3QDMB 4LLVA 4GI6A 3AXLB 1MNUH 4QF1B 2HYMA 1GZPB 1W0WA 3MOAL 1M57B 2UXTA 4KKBD 5IW6A 5TFSH 3ORJA 4G6FB 4L8DB 1RULL 2BRQA 4QKXB 1JWUA 5JW3H 4FXGC 3ZR6A 2OJZH 3BSZH 4JMNA 3HI1B 5E5UB 1OAKL 3Q8CA 1CFNA 2DBLL 3VG0H 4AQ1A 1D9KD 5A16B 3P4MA 1QI3A 3AREA 4X7EC 3HE7A 2EYSB 2I26N 3FDWA 1PKQB 3OKMB 4G3YL 1SDYA 5IEKA 4JFDD 5JHBA 5TQ0L 2NYKA 3OKOB 5T1KA 1AKJB 1ZT1B 2ICEC 2ATKA 3BZFA 4TXVB 3D4CA 2E56A 3O9WD 3UTPE 1ZDQA 3TN0B 3AQDA 3NVQA 4LSVH 3HG1B 2EUWA 3OM3B 4ZX4A 3ESOA 1BF5A 5JW3L 1AZCA 4MZ3A 2OJZL 2EDJA 4B0MB 3UACA 1F00I 4M1DL 1MHCA 4GG6E 4S0HA 2BOCB 4N1CA 3VFWB 3IXAA 1DJIA 3ZL1A 3ET9F 1FGNH 1G7PB 3NCXA 4ORGB 1QYGH 1W0VB 1S7XB 4Z95H 3ME0B 5CXPA 3I6KB 5I66A 2GYSA 2HX9A 1XX9C 4UBDC 4LSVL 1T20A 4ZO8A 1WUZA 2P5PA 2A99A 4MQ7B 3HE6C 4HAFA 5C08B 3TEXA 5DZVA 1C12B 3HUJE 5EIIG 4PP1D 3SE3C 4U0QB 4XPBL 3NESA 5F7LB 2EZ0C 3AU1B 3EYSL 3IFOB 2E46A 2AJUH 1QYGL 3GJEB 5G4OA 1MFUA 4JUSA 3FT1A 3O45A 4Z95L 4OU3A 3M7OA 3RB5A 5EUOB 4RAUB 3OC8A 2HRLA 1IGMH 3DHJA 1H9DA 2YPLA 1P7HL 3ZKND 1IUZA 1JGEA 1LTXA 2AZUA 4XO3A 4RMWA 5GSRB 1U30A 1DO5A 4XMUA 1K6QL 3RUGF 3OX8B 4LARH 5FGSA 1XGQB 5BZDA 1H3UA 1HCZA 1U8OA 3ARFD 1YEJH 5IVXA 4I18C 4JFYB 5DHVH 4P57A 4G8EB 4XGZB 1QW8A 5DO2C 1RUPH 2R2EA 4ZZKA 1IGML 4W6WB 1UWYA 2ARJA 2VC2B 4CUCA 5L2KE 5IQLA 2ZOWA 4ZMQA 3CSBA 2AMGA 3KJ4C 5B3NA 4J4PC 4QRRE 3ZXAC 1PAZA 3GMMA 4NQSA 1KEGH 3LOWA 3PWPA 4G43B 2F53E 1FC2D 5D7LB 4EUPH 5I73B 2YOAA 3O3BA 2FL5B 3ZUCA 2C34A 1YMME 3APFA 4ZMXA 2JI3A 4PJ5A 4IGBB 3MX0B 2DY2A 2CKBB 4LASH 5HBBA 4QOKD 4LVHC 4RNRB 3HE6D 5KSBA 1PIGA 1S7RA 2K70A 1SLUA 3IU4L 1ZVSB 1WCBB 3KWXA 4XPFL 1Q0EA 5GPRA 2GK2A 4D9LH 1W72L 4I0PB 4JJOA 2EZ0D 4WNQA 2E7MA 2YOCA 3CZKA 3EZ8A 3GMPA 1K8DA 1BOGA 1UD6A 3OHXB 4EDXB 3EYOB 2F54A 1XR8A 2L0DA 4MXVE 3UTQA 3TPUB 3V0GA 1WIUA 3RUGB 5KSVA 2JLPA 1AKPA 4M3KB 3QUXA 2EKSA 1ACYH 1A4CA 5F9OH 3T6ZA 3ZT6A 3VXUB 1R24B 3JWOL 4OB5H 1F0LA 1OTUC 5E0FA 5LAXB 2PW2B 1WAEA 3AT8A 4D9LL 1CU4H 4RFEB 1L4IA 4ZO6A 3WCYA 2XG5A 5ESQA 3ATDA 3QPQD 3QQ4A 4WO4B 2X89D 4CU6A 2QSQA 1OGPA 1JFHA 4Q9BA 2FNBA 5DO2D 4UAOC 3UTZB 3HHSA 4JQXC 3WGVB 2L7EA 5J57B 1QFWH 2KZBA 2XN9D 1JAEA 2XA8H 5CBAB 3AFLA 2APVA 4WHCA 5IMKA 1ACYL 3ZZLA 4FX5A 5F9OL 3PUCA 7FABH 3KM1A 3DX6A 4ZUUA 3IKKA 3L4UA 2LU5A 4JN2B 1T5XA 2Z31A 3W0WE 1VDGA 1CU4L 1AGFA 4ZMYA 4GNKB 5CUSL 4LVNB 3D39D 2Y24A 4V33A 3BSHA 3DGDA 5D1XB 2QEJA 1NEZA 1MIEH 2XIIA 1HEZA 1TQVA 4FL4B 3QDJB 3HBPA 2UZXB 3MODL 3BJ91 4XMLL 3UL4A 1DCLA 4XI5C 2XZAH 3ZTJG 4JB9L 3BMVA 1KJ3L 5B7FA 4AL8L 1CGUA 3DUUA 4TSBH 1QLEH 2WYTA 4YE4H 1O6TA 3K6DA 5IKCA 2ZX7A 4N3TA 3QZLA 2ESVA 2CALA 2X1OA 2E9GA 1KLUA 4F8LA 4Q6KA 5HD8C 1HEHC 3PXHA 2WKOA 4XMZA 1A1NB 5ENWA 1S5IH 1JXJA 1S7TB 5DUPL 2P5WB 1G43A 4PB9H 1AQ8A 3QEGH 4HZ1A 2YFOA 4BK5A 1R47A 2N56A 5DD6A 2XZAL 1KYFA 1YNLL 1GGBL 3TEUA 4JL2A 3UTPD 3H9SA 3HW7A 4P4RA 2CR6A 3FFCD 4YXHH 1OTUD 2GC7C 3EXLA 5DD0H 2YGVA 4KKPA 1G9MC 1KC5L 1U21A 4LO9A 4N9GB 4WW2A 2R0KH 3VFRA 3IFPA 1S5IL 5F3FA 4H8UA 3JSSA 4UQ9A 1DBAH 1VLXA 2NSXA 3QEGL 6TAAA 1J5HA 3V4UH 4KGJA 3UTTD 1XB3A 3BX7C 1WWCA 5C0IB 4QWWD 4Z76A 3DMMA 1OSZA 4EZJA 2VR4A 3DJ9A 2RTTA 1HZHH 3IDJB 2XDHA 1F6AB 4J39A 4X5PA 1L9SA 3JWDH 4KI1A 1A3LH 2J1XA 1P7BA 1AD9A 5TJWK 4FA7B 3MCLH 2CO1A 3AWEA 1FDLL 2IOIA 4NS0A 5E94A 4BH7B 3LX9A 4PWEA 4AOFA 3MJ8B 3FN0H 1M7DB 3CHQA 4F8TA 2QVMA 1XCWA 2IALB 1ID5I 1ZHNB 3CHPA 3JT2A 4R96A 4CMMB 1UWXH 4XI5D 1CT8A 3TCLA 1NCJA 2NR6C 1A6VL 3GTNA 3M7FB 4LCWB 4WI2A 3RPBA 4NO0B 1Z9SA 1IZKA 1QUNA 3WS3A 5TDOA 4P2YA 1BOYA 3PDOB 3RWIA 3L5IA 4GRLA 1FFQA 3US9A 3LIZL 3MCLL 3VQ2C 3X1EA 1S7SB 5HD8D 3HC0A 4BQCA 3IRCA 4YDJB 2G60H 3DXAE 4XWGH 3FN0L 4KUCF 1IJNA 1J11A 4Z8FH 5LG1A 1ZLWH 5IHUL 3ABKB 3HI6L 5IHZA 4PUBL 2BPBA 4HUXB 5HHQB 4KZDL 4QRPB 1MAJA 1S3KH 2NY6B 2YD8A 4BDVB 5CFAA 5L2KD 5D9SB 1P84K 1QNIA 4GO8A 3CDCA 1HX0A 4QRRD 1ESOA 4X7DC 4XWGL 3WE1A 3W5MA 2W07A 3AB0C 2IGLA 4Z8FL 4N85A 1SJHB 3IEAA 1FSKC 4HX1B 4PJDA 1YMMD 1KXVA 1OGTB 2L4OA 1M4KA 3BVUA 4FFZA 4R7DA 4TM9A 4XN4A 5LO7A 2I60H 1EZLA 3HZKA 2CLZB 3GJFK 1S3KL 2IVFC 4PBWD 1OSPL 3SY0B 3NOIA 1YJDH 1J1XL 1CG9B 5E6IC 4BGLA 1WWAX 5HHVH 3OXRB 3OAWA 3CFJA 4Y1AE 5J13C 2NY7H 1UURA 5EO0B 3SKJL 4XH2A 3H7BB 1QR1B 2YKKA 2JELH 3AS1A 1ND0B 3NCWA 5BMFL 3BVWA 2XXGA 5IFJB 5DDHA 1SYSA 4AJ0A 1N9PA 1XV8A 2NR6D 3VCLB 2VDMH 4WU7B 1A6ZB 4JO2H 1T04A 5FDYA 5IHLB 1SXBA 2CDFA 1PPIA 3KLKA 4UM8B 3ZU8A 3EF7A 3GM0A 5HHVL 5IREA 2FWLB 3VA2C 4GQQA 3WAKA 2XWRA 5A2KH 4IIQC 2VABA 4WFGD 1IVLA 1WO2A 1F45A 1UA7A 3KEHA 4H5SB 4PJXA 1OO2A 1DJXA 3O4LB 2NTFB 4WSKA 3BSGA 3CN4A 3TNNA 3VMOA 3QJZA 4LLWA 2NY0C 2AEPL 2G3MA 3MRGA 5F7BA 5JLZB 1A2YB 5MEPA 5I74C 2Z4QA 5GXBB 1R0AH 4JDEA 1OP5H 4GSDH 1S2EA 1CIDA 2ISDA 5C0CE 5TDNB 2IJ0C 3W0WD 4CRPA 2BOBA 3SD5A 3HG0A 3CC1A 3R06B 1URLA 3SE6A 4OKVB 2OMBA 5GGUB 3RX8A 4HCFA 2H45A 1I1RA 2D3JA 2FEDC 1AOHA 5EF2A 3OLIA 5K39A 2FATL 4JM4H 5M7QA 1EAOA 1OT2A 2GITA 1D6VL 1DUZB 4G59C 4GSDL 4EN3A 12E8L 3QVAA 1UXWA 1Z3GH 3ML8A 5JZ7D 4EKJA 1E5BA 4NM8H 5BOPA 2QV4A 3O6LH 2WLLA 2VZUA 1MFVA 3G9AB 2K6ZA 4KV5E 4XNBA 5F93C 2B4CH 4QO1B 5SWZE 2GSGB 2ITFA 2JKSA 1JV5A 3G7TA 3ULUF 2WWOA 2IAMB 5BVJB 2IO5A 5BS0B 2Z4TA 2C7FA 3IDNB 4JM4L 3FRUB 1JZEA 3OKNB 3P4OA 4NIYE 1Q94B 1SJMA 3MV8E 4FNRA 4JFPB 1EA9C 1GGUA 2J44A 3US0A 3CIQA 3C87A 5CN3A 3CVIL 3O6LL 1RK1A 4JE4B 1KLFB 3F84A 2D7NA 1RZKL 4JHZA 4YZFE 3ETTA 4NP9A 5FECB 3PP3K 1UGKA 5IOPA 1B88A 2NY0D 2W60B 3QIUC 5C0NC 2NUTB 1YY9D 4JY4A 2PXYD 3F7YA 4LLAA 3WKNA 3QWNA 2WO3B 5CZXC 3FO9A 3SDCA 1NC4B 4R2GC 3GBMH 4YDKH 2P46B 1QVOA 4GUPB 4GOSA 1FZKB 4UM9A 1KCBA 3S3PA 5DZNA 3GTTA 1NSNH 2FEDD 1VEPA 2ALWA 3LEXB 4XNUL 2WWKO 1KIUA 4KK6C 4GRWH 2RHEA 3TA3A 1X3DA 1ZA3B 1AYRA 4HH9A 5GSVB 1A14H 1I3GH 4YDKL 1DTUA 1X5ZA 1F1DA 3A21A 5F1SA 1SUHA 3WKML 1N8ZA 5AB0A 3Q1SL 2JFCA 3QXVA 1M6UA 3DXAD 2YN3A 1TG8A 2DWSA 2CBMA 3U46B 3GSNH 2PWEA 1ZTXE 1A1OB 3E8UH 4JPWH 1OGAB 4MASA 3QJHA 4XO9A 4JM2F 3AT0A 4WGVB 3V4PH 3RTQC 2OTWB 4OCLC 3D4YA 1MSPA 1K2DA 1ZGLM 1G5GA 5KYUA 5JW5B 1INDL 3RPIA 4OLEA 1EAPA 4Y2DD 1CZ8L 1I3GL 4JO4L 4XBPB 4A2DA 4AENA 1FFPB 2X1QA 2D7MA 3ARUA 2A9BA 4FQIH 1BIIB 1JHKL 2B20A 4RRPG 4Z7UE 1BQHG 5AYTA 1MJ7H 1WZ1L 4FQQA 3MU3A 4RWYL 4JPWL 3E8UL 3PRZA 3DPBA 4LOUC 1T1XA 5HYSG 4UDTB 1OANA 2VZTA 1DZ0A 1X7QB 3QIUD 5C0ND 4RQQA 1A6AB 4Q8BA 3IWVA 4ZMTA 3VFOB 4MJJA 3N5AA 4R2GD 3S36X 3RWJA 1R1CA 5EBMB 4IOIA 1YRKA 1IJ9A 2L8AA 3ARBA 1N4XL 3D9AL 4IHBA 5HHOA 3TO4C 3QO1A 2AF2A 1MJ7L 2VKXA 3B9KA 3BE1L 4LBEB 5I1EL 4BFEA 4L0YA 4HMEA 2VN6A 4PVNA 1F8TH 3AJ7A 4KK6D 5B39A 4NGHH 1M6OB 4OM0L 5B8CB 5LWYL 2HFEA 5C3IA 1UFGA 2HPOA 1H3TA 3S36H 3GQFA 4MDIB 2OMXB 43CAA 2WO2B 1WFIA 3GXNA 3LQZA 3Q6FB 5FHBL 3UJTH 3UOAB 1R5IA 3FQWB 1IV8A 3GIVB 3WFBH 5IB5B 3VI3A 2EUXA 4JM2B 3HZMB 1I3RA 1JXDA 1UCBH 4HKZB 3BZ5A 4JZJC 3QDHA 5DJYA 4ZS7H 1RP9A 2CE6A 3IVKB 1MI5E 1HHJA 1XGRA 1TKWA 2G5BB 1E50A 1CD1B 2WBWB 3DGCR 2OZ4H 3ESVF 3PV6B 1F8TL 2APFA 4KOBA 4Y4FC 5F8QC 3P69A 3BVDB 5IY5B 4J3OF 2GFBB 3O3AB 2VIRA 4X0NA 3S36L 1ZTMA 2E9WA 4N0YL 4NSKA 3KBHE 3L3HB 3EUUA 3WIFB 1KCUH 5BRZE 3U36B 1X5YA 2FIRT 2H26B 3ZHKA 1SXSA 4A67A 4G5AA 2RCSH 1VFAB 5M95B 5C0CD 1NIBA 2QQNH 5HGDB 1TCRA 2WHVA 4YO0B 4K8RH 4LOUD 3LDBC 5F7MC 3TBVA 3UCRA 4R84A 4WVRA 5F7AA 2E9BA 2YSTA 1E8ZA 5FYKD 1HZKA 4GW4B 2Z0UA 2YS4A 4N0UB 5F9JA 1B3JA 5IMMA 2AC0A 3LV3A 4TPRH 4QTHA 1CR9L 2ITDB 3V0IA 3TO4D 4JLRA 4F9LC 5HHXH 1CGSL 3KW8A 4J5VA 4AIEA 3RAJH 4KTDH 4ELKB 3L6FA 1ZJBA 1JI1A 4PRAB 1KPRB 2FYYA 2HVKA 4W9IC 4MMXC 4KZEL 4NQEE 1OTTC 3FKUS 2B08A 3U25A 5CKGA 3IKCB 3WV0A 4PJ9A 4JREB 3WEXA 3K4DA 1EZVX 1T89C 3QDGA 1QRNA 4H8WC 4TPRL 3MV8D 5K9OA 2WTRA 3RWHA 3VXOA 2DQJL 2HT2C 4B9ZA 2ZKXA 3GLZA 1PCSA 5EDXA 3T2LA 5CCJA 4RGNB 4KTDL 4NZFA 3H7LA 5AVTB 4Z9KB 3L17A 4U6HA 1TLKA 1VESA 1RMFH 1KCRH 2WV3A 3KLAB 3QWOB 1U8QA 1VCBC 3QQNA 4MLSA 1GHFH 2HA1A 2B7DT 4LRIC 4XNMA 2XVLA 1BXAA 1QEWA 5IFHL 2HJLB 3OKYA 2WXMA 2PYEA 2BS8A 3JV5A 4QD2E 3ZE0F 1YPZF 3K1KC 3PCYA 2XWJA 4H8QA 4BWWA 5BV7C 1SNRA 1T22A 4BZ1L 4NZUL 1ZHLA 3K1DA 3ZSTA 4C58B 1NLDH 1KCRL 1ZPLA 1JNNL 4BKSC 2PPCA 1E4JA 1E5UI 1LEGA 1M56B 2A3TA 3BSZA 2ZCKH 2B5IB 4YBHA 3UAEA 1B2WH 4ONHA 4G8IA 1I8IB 2EDKA 3K8LA 3G5VA 2WN3A 4E5XB 1GTNA 1G6VK 3FRPA 3O0LA 2A5UA 5IMOB 1YN6B 1U8PA 3HKZA 3MLSH 1ZLSH 1G1OA 2QLVB 2VDNH 1FL3A 3MUGA 2FWUA 1MXDA 4L0PB 2ICWJ 1X5LA 3VX0A 4QYAA 5MHSD 4Z7OF 3ECBA 3UBFA 4IHOB 5TK4A 4CVZA 4N1EA 2R0LH 4MRBA 4C56E 4PJBF 4I2XE 5E6RB 1TETH 2HT2D 1BD2E 4KK5C 4WK0B 2X0WA 3OAUH 3P77B 5AW4B 3D2TA 1AXTH 3LH2L 4I4WB 3MNMA 3RL2B 4DP9X 2ZOKB 3F3HA 4OLUL 1DCEA 3ZTNH 5E4OA 1YPZB 1Z7JA 2IQAB 3H4FA 2I85A 2WW8A 3OKDB 3X14B 2EP6A 1J9QA 3DPDA 4U1KA 4ILDA 3KPTA 5I6PA 1J05A 2W65A 3FH7A 2AKRB 3KCPB 4XRCA 1OPOA 1DR9A 4MD0A 2F7IA 2XZCH 3OAUL 4IKIA 1LWRA 4YHPB 3C12A 1RUKL 1THAA 1J8HE 1DYZA 4HD9A 4F2MA 4HLJA 1Q9LA 5J6GA 1DVYA 1BZ7B 1ID2A 2P8MA 3QI9B 4LEEA 1MZYA 2HUHA 5ETUB 2MCMA 4IDJL 1Y1DA 1OF2B 3KPSA 1TJXA 4LIQH 2GTZA 3CZJA 2YBRA 1PZ2A 5MEQA 3DDFA 4TKWA 1T7XA 3QGVA 4ETQB 5IK3B 1OL0A 2RGSA 5DHVA 2AQ1A 2Y9RT 4PLNC 3HPJA 3CH1B 1A7BA 4QLRA 4A55A 5E6SB 3BKYH 4Z7OB 3T3MF 2YD2A 1LP9E 1CICB 2VLJA 4YDIH 1MI5D 1W8NA 2G75A 4FXGB 3WY1A 5T3XE 5B7MA 4N0FA 4PJBB 5E95B 5LVEA 2BH0A 1MFBL 2YMXH 3HS9A 2COVD 4F7PB 4LAQH 4F9PA 1XR9A 4QMEA 2LGNA 4CC1A 1ZANL 3E9UA 3OPZH 4EPSA 4EUPA 5JW4M 3O11A 1OVZA 3FNKA 4LKXA 2B14A 2K7PA 4RAHA 4U6VL 5TTRA 2ICEB 3QG6A 3IGLA 4BFIB 3LNEA 4TNVF 3NBNA 3KAAA 3BKYL 1DVQA 2WUBL 1BVNP 1CLOH 4I48B 4YDIL 3RPKA 4IJTA 1A6PA 2YMXL 5B1JA 2R2BB 2GHZA 2NY3B 3BRGC 4MCYB 2B0SH 2AQNA 2OPCA 5CZVL 1OSEA 2DW5A 2IH3A 4AXWB 1XT5A 1ZT4A 4FXKA 1IEHA 3HNTH 2A9AA 4FQCH 4YIQA 6CGTA 4DETA 4XXWA 1WC7A 2Q5BA 5DQDH 1N18A 1XCQA 2AJSH 4J3WA 5DZ9A 5LCVH 1KB5B 3BVNB 4RMTA 2H47C 1PS3A 1L0PA 1XSIA 1CLOL 2OYKA 1NAMB 3NP4A 3MRCB 1WZMA 2W9EL 2Z91B 2B0SL 4NQED 3FSAA 3PWUA 4FMVA 4KRPD 5IJKC 3JZYA 4L4VB 3HS0C 5D93C 3WFZA 1JXGA 3X1NA 3HNTL 4XN2A 4GI8A 2XV2A 3T3MB 3VXNA 4ZOAA 3V0FA 3VXMA 4WDIB 2K6WA 2C1OB 1DQMH 4OZIE 5IMLB 4GQ9L 4YLQT 4QY8B 1I7RB 4LFHD 5LCVL 4YL4A 3U4BH 1YEDA 4UQIM 1U91A 4PW4A 5JHAA 2GQHA 4U2YA 2OSLB 1T83A 2X6CA 4XHJC 5KBMA 1QSFD 5TE7L 3VWJC 3LKPA 1RHFA 4RA0C 1A9EB 1C5CH 3K6NA 4DEUA 3UC0H 4P2QB 2O72A 3QCUL 4K9EH 2WBJB 3QUHA 4IYKA 4LOVA 4P5KB 1DQML 5E4EB 4N0CC 3PAZA 1U2HA 4J12A 2P5ED 5DJZB 1P6AB 4GAJH 1E65A 1ED3A 1H8OA 3MUZ1 3KJ4B 3FH5A 3RJDA 1INQA 4L8BA 1YNTF 4EVNB 1UZ6F 2EO7A 1SMAA 3WUWG 3WDHA 4E42A 5T33L 1UATA 1T2XA 1ORQA 1JPTL 3UC0L 2X38A 1X5MA 2Q8AH 1E6OH 5I1KH 4YPGB 1OWRM 3ILPA 2DB8A 4BCZA 3UTSE 3HUJF 1IKNA 2R51A 1U8KA 3Q5YA 3B83A 3PL6A 2AFNA 4ATTA 1AQMA 3LN5A 1OZTG 3IE9A 3DX2A 4HSCX 3RURA 1SY6H 3SYPA 5FM8A 4F8PA 1YECL 4PS7A 3QORA 5I9QC 1HJCA 1J10A 1FV1A 3BZDA 3X1BA 2P45B 2D3VA 1CS6A 3KPRA 4TVUA 1SN0A 4LLYA 5C2BH 4P23A 4FQJH 4YVUA 2JJTC 3VD0A 1ZA6B 2DYRB 1KPUA 5I1KL 1XWVA 3WN5A 3IPEA 3P02A 1Z2KA 5DRZB 2BSCA 3B2VL 1MN4A 1BD2D 1KULA 2YQGA 4ZFFB 5HGHA 5KANI 1OAXH 3Q8EA 2KPNA 1G7HA 3VD4A 3GS4A 1XFPA 4XHJD 3RLSA 1SBSH 4IMLB 3VWJD 1MWAL 4M62L 1CFTB 2VTFA 5A6MA 3MRFB 2QELA 3MV7A 4FQJL 3ILQC 3O2VL 4N0CD 4PJEA 4U4IA 1AY1L 4PRHE 1R5VA 3HA0A 1G7MB 2FD6L 2PKDA 1YNTB 1RZIA 4N9OB 4HUNB 4LB8A 3X3GH 1Q72H 5IG7A 1BPLB 1MCSA 4DK3A 3HJ0A 4AEHL 4LLUB 4KDVA 1FNGB 1GA2A 1ET8A 2ITCA 3SPVA 2Y22A 5IWLA 2X0VA 3ZR5A 1AHWA 1URIA 3STZB 3HUJB 1GIGH 4WKZA 1MFDH 4ZW7A 4XBMA 1WBZB 1UOLA 4PR5A 3L4TA 3S98A 2QZ5A 4JPKH 2YSSA 4F7MA 3HLAB 5AUMB 4LCCB 3DC0A 3WNLA 1KGCE 1Q72L 4QDGA 1JPSL 3FW6A 2ZUYA 1TEGA 3LKRB 3X2QB 5LQBL 3IFNH 1S4IA 5D70H 4NQUA 1NIAA 3LPOA 1J1OL 3DRTB 4UF7C 3V7MA 4LLQA 2O61B 2EIMB 2UYLB 3A6BH 3EHBC 4Z5RB 1N2RB 2GTWA 3NZSA 1SJVA 3RDTA 4U33A 3V8OA 1K8IB 3IU3B 3CQFA 3BYYA 2FJGB 1MRCL 5DEJA 1Y0LA 3CDZB 1OKEA 4KNUA 3RI5F 5L9DL 2EIJB 4AGMA 4HPHA 1N5YL 2YD9A 2D3LA 1RZ8B 1QBMH 4CC0A 3EJCA 3ILQD 2MQCA 1BEYH 2FECI 2O6PA 3RY6C 3PQYA 3BWAB 1DVTA 2F5BH 2F53B 3O3EB 2MSPA 4CSZA 3FTVA 4H0HB 3LH8A 3RVWC 5F6HI 3ABMB 2EYTB 3B9AA 3BQUA 5C09A 4KQ0A 1MOEA 5DVMA 2R0ZH 2AQ2A 4H25B 4YSDA 3VSQA 1CXEA 1N68A 1VPOH 3QUML 4WI4A 4ZFOL 2X3BA 4HDIB 1QBML 4OCNC 2JTDA 1ZIAA 4WI3A 5FOBB 2FSEA 4Z7WA 3QEQB 4AX3A 3S3DB 1B9ZA 3MRKA 4XZUB 2DICA 2Y5TB 5CHNB 3ZW3A 3VTTA 2FQEA 4G71B 5HDQL 3AQXA 1EJ6A 2JVUA 1AS8A 1ETZB 2Q1EA 4PEEA 2X9XA 2Y36H 4RX4D 2X6VA 2XV3A 4LPWA 4MJ6A 5E8EB 5KYNA 4FQXC 1AH1A 1XH3A 1QSVA 2D7TH 3Q3GB 1O6SB 3C6LA 1DFXA 2R0ZL 4X6BB 1VPOL 3DWTA 4QCIA 3TTYA 2WXKA 1F56A 1WAAA 3UZVB 1JMZA 1WFOA 1JV2B 1KJ2B 2VL5A 1A47A 5HJ3B 4HMDA 4LLVB 2BNRB 4LDCA 5K9JL 2FX8H 2MQ3A 4KC3B 3MR9B 3BEWA 2Y36L 4GMSL 3GSOA 3S88H 3DX9A 2ADJA 4TN9A 1F3JB 1HKLH 2ZF8A 5H4ZA 4Q4IA 2D7TL 1E4XL 3S8WA 4R0LA 5FO7A 5TE4H 3EDEA 3MXWH 1B4RA 1NCDH 4E9QA 1JWSA 4YDMA 3P4MB 5EFIB 2WB7A 2X1PA 1T5KA 3AREB 4XPAL 3HE7B 5LUMA 5ID1A 4X2UA 3TIEA 4ZTOL 5T1KB 3WXVH 2FX8L 3BZFB 2ATKB 3JWNG 4G1MA 1PYWB 5J56B 5D2NA 3ETBJ 3TIDA 2VLRA 3ML9A 4RA3A 3S88L 4NHUB 2FGWH 2VDQL 4ZOBA 4QXUH 3MYZA 5L4FA 3UTSD 2HSIA 3JWOC 1BECA 1USZA 5TE4L 4PJFF 1JDCA 1NCDL 5T5NF 2KBGA 3M8OH 5DVKA 1V7MH 4KPHH 5E6IB 1PG7W 2OZNA 1G0YR 4MXWL 1LK2B 3KLSA 2AJVL 3V55A 2WJ5A 1E8XA 3WXVL 3BLKA 1A3RH 3P2DA 5I66B 2YZ1A 3H42L 4LCUB 4S1DC 1BVZA 1A4KA 4XAKE 5C0AE 1T20B 2VL4A 5FAAA 4F80A 1KT2B 4TNFA 5HP5A 1SYVA 1AR1C 1DJZA 4FQXD 1DN0B 4CC4A 3S96B 3PREA 1G4RA 4I3RH 4NAMA 1MDTA 3M8OL 4JY5L 1V7ML 2HVBA 2KLTA 5AENA 5HI5C 2H1LM 1I8MA 2J8UA 2FLRT 2DIJA 1HL5A 2DWEB 2ZWZA 3BW9A 4G9FE 5F1IA 3ZBMA 3BT0A 4A2HA 3O45B 1G1CA 4OZFH 1J8SA 3PHQA 4PCYA 4EI6B 1QO3B 1Y18A 4YXLH 5BXFB 4AC4A 4WSJA 2P8PA 4IIQB 3WENA 4LSRL 1F3RB 4PJAF 2YD1A 2FAUA 1CLYH 3OKLA 3HNSH 5BW7C 2NY4B 1LO2H 3FN3A 4XNQB 5A2JH 1G6RL 4PRHD 5B7EA 1IIKA 2R29H 1N3NA 4I3RL 1KG0B 1YY8B 3G6DH 3T77A 1J8RA 2CRZA 1GKEA 2DMKA 4OKDA 2DQDL 4ZS6C 5IW1A 3UBXG 4P57B 3FB8A 5KBNC 4M7LT 5FFGA 2R2EB 4OFYD 2ARJB 1HC1A 4TNGA 4PJFB 2QZQA 4NQQA 5CO1A 2DQIL 3UPCA 3GSNA 4N4YB 3TZVB 3V4PA 4QYOB 1YHPA 4NQSB 4OLVH 3DV6B 1ZEAH 1FN4A 1KGCD 1TFHA 3WFHB 4BFGA 1BV8A 1S9WB 2WLIA 4TL4A 3MDJA 3O3BB 3O6FC 3WNNA 3L54A 2W88A 2QHLA 1WD8A 3MGOA 2AERT 4AEIL 1UKSA 3FU8A 3QISA 4YDVA 2Y1VA 4J6RH 5CMAA 1J9RA 3DXAB 2Y1AA 1AR1D 5DMIL 2L04A 2K3TA 3GLAA 5EG6C 2UY7B 4PQXA 1PZ5B 4XMKL 5IESH 4OLVL 3JTTA 5HI5D 4EIZC 5IF0B 3OR6B 2VXQH 4TLTA 43C9A 1IC5H 4YHOH 1PW3A 3CZGA 3DRQA 4G7VL 4PJAB 3PYCA 2FIKB 3RIKA 4ABWA 1BOGB 1KIRA 4M02A 3QCTH 4I89A 5AAPA 5KVDE 4NUPA 1XAUA 4NZRH 3GPEA 2F54B 1Q9OA 1XR8B 2WKOF 1EJOH 3ARWA 4Z3FA 3EOTH 2AHIA 3QJOA 1LDPL 4C4BA 3OKKA 4HOWA 5IEHB 5AAMC 5KSVB 3DHMA 1U3NA 4X8JB 3ZY7A 4KK8C 1LO4H 4IU3A 1U8LB 3OSVA 4LVEA 4R26H 1XIWD 3VRJA 4ERSH 1PFOA 4KRLB 4U1IB 3ISYA 5AKTA 4WLCA 2VXQL 5IFAL 1IC5L 1U8JA 4JO3H 4YHOL 3REWA 2XG5B 5ESQB 2D2CC 1JYVA 1DBKL 3D0LA 5D1QA 2P4AB 3C5SA 4LPUA 4ZS6D 1JJUA 3ZZQA 1KDIA 1HNYA 1X9QA 2O5YL 4N5UA 3STBA 4JFSA 4LNRB 3ARGC 1DO6A 3HHSB 4Y1AB 1EJOL 1FCGA 5IHBA 2K8QA 1AC0A 2I07B 2AQQA 3QO0A 4CW1B 4O4YL 2VLKE 4LEXL 4K5NA 3J7HA 4ERSL 5HVHC 4R26L 2OZ4A 2OMWB 1XL4A 1T5XB 1OGSA 2Z31B 4HKBA 5SWSD 2CO3A 4I1RA 2WSPA 1OP3H 1ROCA 3O6FD 4HIIA 3T2NH 3X1FA 3QPXH 2X2YA 3PGFL 4DGIH 4GUQA 3UYRH 4OF0A 1HEZB 5D4HA 1X6LA 4UQDA 4H26A 4LL4A 4K5PA 1IIIA 3LKNA 1KLGA 2XZQH 1EEYB 3LEVH 4HETA 4IBSA 5D6DC 5AZ2L 4G5ZH 1KN4H 2QTEA 4EBQH 3AU0A 1EZVY 4NQXB 5CLWA 3DGGA 4BSJA 3C08L 4WNJA 4RMSA 2GJJA 2WN2A 3ARDC 5ENWB 3GD1C 4DGIL 2N7AA 2H8PA 1P4LA 3P3UA 4UANA 5LXGH 4WWNA 3I3EA 4HUKB 3H3PH 5CIPB 3VFVA 2OJEA 2V2WB 4KHTH 4XCYB 3V52L 3CIAA 2FH8A 4ICWA 4N68A 15C8L 3H9SB 4JCLA 2XZQL 1E40A 1ZHBB 2BHUA 3GWJA 3QAZB 4EE2A 1HHHB 4G5ZL 3VX1A 3KGUA 5DJXB 1XAKA 3QZWA 2DV6A 5D7IE 4ADGA 3NRFA 1DBBH 5KG9A 3MZGB 2Y7LA 4KHTL 2MCG1 4WAFA 3DMMB 2FEEI 3ALPA 5TDPA 2A83B 2EKJA 5GGQH 4N6RB 2VSDA 2CLRB 3OV6A 3WLWC 4XAKD 2GT9A 5C0AD 3FQ1A 4F93B 2BY2A 5SWZB 4YGVB 1QEXA 2R1WB 4LCIH 4P8QA 4G9FD 4YHKH 3RWFB 4WI7A 2PF6A 4OCXH 1KCSH 4WFHE 1FVCA 3JZ7A 3TCLB 1PZ3A 3IJSA 3WS3B 5GGQL 1ZE3H 1F4XH 4BCXA 2BW4A 1S46A 5FYLH 4NWTH 2BP0A 5KOVC 3SDAD 2F08A 2LHAA 2ZX5A 3HC0B 3HMWH 4LCIL 2XX1A 2X9YA 5E5MA 3VO0A 3NJJA 4Q6IB 2A9DA 3D85A 2VXUH 4TF4A 4DW2H 3G6JA 4YHKL 5I1JH 4O2FA 1E8WA 4LPVA 1J0ZA 1JNLH 2UX6A 3MV11 3GSXA 4KKAC 2K78A 5IHZB 3NSDA 3LS4H 3U4KA 1F4XL 5CINH 5I0ZA 5MERA 3BPCB 5EPMA 5FYLL 1AXIB 4KDTA 1DFBH 3HMWL 3ZO9A 1KGWA 3A47A 3EOAA 5F7WC 5JQIB 3MJGX 3MROB 3QQ9C 4NRXA 4KVCH 2W07B 3T0EB 1AYOA 2VXUL 3FUEA 5I1JL 4OCRH 3WTVA 5D7JC 1JNLL 3NA4A 3VFUB 1RZKC 1QSEA 3MO1A 4R7DB 4FCHA 3GDCA 1D6EA 2K1MA 5CLYA 3ENEA 2J25A 5CINL 2HG5A 2OULB 4BHUA 4ZPVB 3MLZH 3HC4L 1DFBL 3DROB 4XH2B 3ZHFA 2FECL 4D9QE 3UYOD 3B7RL 4G6KH 5AVYB 5EEUA 2JV6A 4OCRL 3RIFF 4WJKB 5C7XL 2AV1B 3UX9B 5KSAC 2W81C 3QJFB 2JWYA 4ZOCA 1ILSA 2FO8A 2W0KA 3LKSA 3NJFA 4Y8AA 3SO3C 3FPYA 5EU3A 3MLZL 4GO9A 4JVWA 2CHNA 5T1DH 2Z35B 4DSYA 3S35H 2VKWA 2QQLH 5EDSA 4MNHA 4YSEA 1JF6A 3L16A 5D7SH 2HN7B 2A74C 4G6KL 2FBJL 4RGOL 3SOTA 3GGWB 1UJTA 1EHXA 4N87A 4KKAD 1A6TA 5BV7B 5B1KA 3UMNA 3RWCA 2QSCH 1RIUH 3TNNB 4PRDA 2NMSA 4LLWB 4NKDB 5EOCL 4HWZB 4W70A 3EO1A 2PO6A 5MEPB 3DX3A 2NY5L 1U3HA 2X6AA 3C5JA 2CUHA 3NGBC 3RKDC 4JDEB 1ZY9A 2VLKD 1NWOA 2VZ1A 2QQLL 1S78C 2BOBB 3QQ9D 4A6YB 1JZGA 4CDGC 2ZCHL 4H4NA 2MIZA 2VDLL 2F1AA 1O7DE 5D7JD 3I74A 1KELH 1AVAA 4I0CC 4A63A 3NN8B 2D0GA 2WZ5A 4U1JA 2EDBA 4XVOA 4LF3A 5K39B 5EO9B 5DEGA 4DN3H 5L8KB 5KYXA 3C60A 3EJZC 5TQ2H 4L3CA 2GITB 3ZTCC 4EN3B 1XZ0A 5DT1H 4LKCA 3TASA 1PX8A 3UZEC 1TQWA 1UXWB 1W0YT 1JYXA 2WAQA 4IRZH 3KL3A 1MLCA 5HDBF 4JFUA 4FAAB 1IT9L 2HAZA 3GLDA 4RMUA 4ZAKA 3ULAB 5DJCA 5B38B 5BRZB 2F1BA 3N6YA 2C4FU 4DKTA 1JV5B 1HILA 3DOSA 4R8WH 5PAZA 3P2TA 5LCVA 4F5CE 4G8GA 1FAIH 1E4KA 4X50A 2HKFL 4PU2A 1QRKA 1RK0A 2WQXA 4IU2B 2G0KA 5DT1L 1PDKA 4GIAA 4PIBA 4D0CB 3EXJA 4ZFQA 3MRIA 1RK1B 4YK4C 4F3FA 4E41A 2P8LB 3B2MA 3VSTA 5CGYC 3RGBA 5IOPB 2YHGA 3EH2A 2R39A 1KUMA 4R8WL 1EK3A 4OVUA 3WNOA 1QD0A 1GAFL 2KDGA 1FAIL 4PJHA 3BJLA 5EBWA 2OI9C 3F7YB 4NO2A 1NOAA 3KL0A 4FNLH 2MPVA 1BBDL 2R23B 3LB6C 5GGRB 3TONA 3TESA 3SDCB 4KTYA 1KENL 3MFFA 5SX5K 4AM0A 1QVOB 3W39A 2BMKA 4KO9A 1JD9A 4FG6D 2DJMA 4UM9B 3LEYH 4G2AA 1QHQA 2Z8SA 4Z7VA 1E5AA 3CWGA 5F9WB 3JWNE 4PBXA 3K0WA 2VC2H 1KIUB 4X7SH 2KS0A 4TSCH 1BFTA 3RFZB 4OI7A 3VTAA 3EJZD 3GSRA 5HDBB 4L9LA 2IANE 4NO5A 1JGLL 5GRJH 1FFNB 5EO1B 5L8JB 3VFMA 4NKMB 1WQVT 5DURB 4G6AC 1KYDA 2B1HH 2J2ZB 3BO8A 5L4JA 1N8ZB 3DOIA 3VDCA 3V6OE 2J1KA 1RP8A 4M00A 4R5VA 4ZMWA 3VI3F 1J9SA 3QJHB 2ZP8A 4OZGF 3LKQA 3LZFL 2VC2L 3S5LA 4X7SL 3EH3B 4U3SB 2PCFB 3KWWA 2LLNA 1HN1A 3DX4A 4JQVA 5DRXB 2V8MA 3PXLA 3HLKA 4N8VB 5KYUB 2FNWA 4I87A 4KY1H 4L1LA 3RPIB 1SY6A 4HSQA 5A40E 3B3BA 3EGXB 3KDMA 3UIYA 4RZCA 5C0FB 2B1HL 1JG9A 3V79C 1I3UA 1LVEA 1UZ8B 3VXQB 1CFVL 2YGNA 3ZIYA 2X4SB 1XZWA 4I3SL 5CGYD 4Z1PA 1T1XB 4A39A 4TVPL 1I8LA 1O7DC 3AS3A 4CMHC 1OB1A 4RQQB 1LK3L 3SKOA 5DQ9A 1FZOA 4GP5B 4U1LB 1GPOL 3LVEA 4KY1L 1VGKB 3B6SB 5DVNA 3RWJB 5KJ4A 4IOIB 3OB0H 4BBWA 3ARBB 3SN6N 5MEOA 3REVA 5CJ5A 5KSUA 3HS0B 3MACH 4WSGA 4R97C 3B9KB 3CN1A 4NKIL 5D93B 4D9QD 4HOZA 1SFDA 1LP9F 3HIZA 4C56B 2FJFA 1AMXA 4I2XB 2EO9A 1SVCP 4XX5A 3EYVA 5B39B 1EAQA 1U8MA 2JIXA 5HHME 4PG9B 4MDRA 2C9QA 1F2QA 5JIMA 3NSXA 2WJ7A 2Z93A 1S9KC 2XVGA 2ESVE 3CFCL 4L37A 1A4BA 4WUUA 3LQZB 4I85A 1A7OL 3TO2A 4JX0A 4PWFA 4Z23A 3I9IA 4G6AD 4BZ2L 3VI3B 4X80H 3VG9C 4OZGB 1I3RB 4GFXA 1DJWA 3M86A 4P46A 1MCNA 3L1OH 3K2MC 4QHUB 4I9WE 3WUZA 3FT2B 4AQZA 4WEBL 1CFSA 2IPTH 2A6KA 3NJNA 1XGRB 3QARA 5L2JA 1FNLA 2QKIA 2OYLA 4JPSA 1WWBX 1TJIH 4H8PA 5FCUL 3SOBH 3J27A 3Q44A 4N8CH 4EZMA 5T3ZH 4CSPA 3OLDA 5AW2B 5I8CA 2HFFA 4YDZA 1DL7H 1J8HB 2W0LA 4JK0D 1BM3H 4O02H 4RFOH 3KCWA 4QIRA 3WHE1 4XCNB 4AH2B 1QTPA 2VM9A 3DDGA 2EC9U 3QG7L 3CFDA 4ODUB 1K5NA 2APWA 3BEVA 2VO5A 4D9RE 1D5MA 3SKNA 4JVPA 4CSSA 2FX7H 3CFBB 4M7ZC 1RJYB 1A25A 4U1MB 2EVGA 4N8CL 4D7BA 3JWNC 4JHAH 5E9AA 2DAVA 3FHAA 4LNVA 5F9JB 3CX5J 3SGDI 2YEVB 4O02L 4UI2A 5DWPA 5K1VA 4LAJH 5F44A 2PLTA 3N1GC 3TBSA 2ODHA 1LP9B 3WN6A 3WHXB 3WFDL 1HHGA 4OZIF 3UGUA 4XPGH 1FA4A 3DBXA 3ZPDA 3VTMA 2ENPA 1MJUH 2BP8A 4HIJA 1SXNA 5I15H 3UTOA 3F8UB 1IFRA 3L6FB 2F74A 3V6OC 2DLTA 4XCFL 4P4KC 5AVWB 4XXCA 2HVKB 1I1YA 5LGHL 2GJ6E 2R4RH 4JHAL 3SDDB 4PJGA 4KX9A 4PJ9B 3M46A 4OLYH 4APQC 4NO3B 5K9OB 2Q76B 1MFEL 2QQQA 2HFTA 2YD7A 4ZO7A 4LESA 3VXOB 5JQ6H 4E2OA 5GZNA 5FO8A 3GMQA 1MJUL 4XP1L 4MBRA 1D5ZA 2RJMA 1NCBL 3V5KA 2FEEL 1GYVA 4NP4H 4HEMA 1EGJH 4U6HB 5IROA 1LE9B 2DI9A 4NQDE 2PWFA 1XXDC 4J8RA 2R4RL 1JI2A 2AJYL 5F7KC 1ETB1 1QEWB 2FJHA 2PWGA 1WTLA 1OF0A 5D72H 1AR2A 4B60A 2ATPA 4N0RA 5EC1A 5JQ6L 2XWDA 1CE6A 2XWJB 3O6KH 1T22B 1ZHLB 1YEKL 2UWEA 1T0MA 3UG4A 3IN0A 5DRWA 4PJ5D 3G3LA 3BIKA 3MRPA 4QXWA 4HJGA 4OZIB 1I1AC 2AXFB 2VWEE 1I7TB 4PTUA 3B56A 4G8IB 3OVUB 1NTDA 4C4UA 4NJAH 4UOZA 2E8YA 2IAND 3DV4B 1IGFL 5ESVA 3MLYH 2D0HA 2GBAA 4K3EH 3G5VB 1O9VA 4RGMC 4LPCA 3CU1A 3LNIA 3A6CL 3FRPB 4JPQA 3GRWL 3TBWA 4Q9RH 3EHBB 4Q89A 5HGBB 4Q97A 4TTGA 4P4KD 1FL3B 3IDXH 5FDWB 2C4FT 3CPLA 2Q87A 2JKWA 4GO6B 4JQIL 4PB0H 3CQQA 4Q58C 3F7VA 2ZUXA 1ETA1 2EIBA 1GY1A 2EDTA 3X3FH 2P24A 3FONB 3QUXD 4MD5B 3OZKA 1FG2B 1OP9A 4AQ8A 1NFDE 3L3DA 2YXVA 4HEPA 3NFNA 5E00A 4BQ6A 4OLWL 4AUJA 4B5EA 4Q9RL 2XG4A 3P9WB 3QZPA 3CXHJ 1H0DA 4Y4KA 5IB1A 1LXMA 4OF5A 1TPXC 3K72B 4PJXE 2WVVB 1T4WA 3U83A 4I77H 4PI0A 3IDXL 4X4ME 1CCZA 4HJ1A 4HQQH 4PB0L 3K71A 3B2UC 3BLBA 1CTMA 1CDUA 5GS1C 1AJ7H 1AIZA 3GBLA 1J05B 2BVOA 4XRCB 5GISH 2YAEA 2GHWB 2WXHA 3PPSA 4ZPTA 1XSKA 4MD0B 4OZFA 3FTUA 2I7SA 1JZ2A 4XT1C 4R4BA 4UV4H 1T7YA 3TZVA 4S1RL 1A7NH 2WCPA 1FHGA 1E7UA 3T2OA 4F2MB 5IT2L 4XC1L 1Q9LB 5J6GB 2ZUQC 4HQQL 1KXQE 1I1AD 1UD2A 2L7QA 3X13B 4GP8B 3POCA 2EE6A 1VB9A 2R29A 4NM4L 3KPSB 1WVZA 2YUXA 2X0UA 1AJ7L 5HHMD 2IPKB 3GXFA 3ULSB 2EEDA 1DEEB 2GTZB 3P3TA 4FFYH 5GISL 2YBRB 4EIUA 1CD9B 2ESVD 4S10A 5C0RH 4GRLC 3BPLC 5AZUA 3SPIA 4GAYA 3MA9H 3R7RA 4ZFZA 4HOXA 5DS8A 3MLWL 1E7VA 3T3PE 1E9PB 1R19A 3MBWA 1A7NL 3VFTA 4CBZA 1IC7L 5D4QA 5D4IA 4I9WD 2VLJB 5L6YL 5I5JA 4XXDB 5EIQA 3CFEB 4L0ZA 3SDYL 4WWKA 5CKAA 5F6IC 2ROXA 3UXFA 1W72B 4ZBJA 5C0RL 3KPLA 4EUPB 3FOMA 3LN9A 1TZOA 4N2NA 3FT3A 3RL1A 3MA9L 1CDJA 4X6FB 3QG6B 2VM3A 3QUZB 5KYYA 2E4FA 2IAAC 4PTTB 4D9RD 1HQRB 3IN2A 1IB5A 2UXFA 3B2UD 1TU2B 4POZC 1MDAA 3P54A 2YQ2A 5JOFA 1OWWA 3KWTA 4R7VA 4Q7DA 4AGLA 2VWEC 2VXQA 3CZLA 3RZWA 3T8VA 5HYSB 5AG8A 5I30H 3IWUA 1ZT7A 3CG8A 4WKXA 5ISZA 1BZOA 5F0LB 4FEIA 2EYRA 3K5RA 3NDZE 3R4RA 5DC2A 5E8DH 3B9EA 3VWKC 4PJCE 1S9VA 5DHYB 1G94A 2EIZA 2WXOA 1HFUA 3EYUH 1UWXK 2GJ6D 1E2VA 1MCBA 3GZOA 3A4AA 2NQDA 5E2VH 4M61B 4GRLD 4DO6A 4UT7H 4KX7A 3VXNB 3VXMB 4ABVA 1QABA 1BVKB 4PRPE 5DZAA 1AFVH 5AOKA 1RU9H 2FE0A 2CA4A 2DYPB 5E2TH 3QDAA 5E8DL 3KXFA 4H0GA 1YEDB 3TVMC 3ZZSA 3VU1A 5C1MB 1Y6KR 3N40P 5EU6A 1ZLWK 4JANA 4J3UA 4NQDD 4PRIA 1BYPA 4PY7B 4X7FC 2IBZX 5J9PB 4G70B 4K3HA 5ABZA 3S8FB 4PGEA 3U7YH 2VYRE 2ZXAA 5E2VL 3V0DA 5AVZB 4OZ4A 1XHHA 1SUJA 2IPUK 3SJVE 4DPBX 3CFNA 3E6HA 4HIEA 3T1FA 3FUMA 2EC9T 4M29A 4PN6A 1AFVL 2VXTL 3DUSB 4PGCA 1RU9L 2VB5A 3IAPA 2XJKA 5E2TL 3VRLE 1H3PH 5FKPB 1ZGLA 4ZW3A 5I19L 1U8HB 2C3WA 1P69B 3CBJB 4MSWB 3KBPA 4PJEF 5CF3A 4POZD 5I6NA 1KV7A 1R5WB 4YQXL 5C3TA 3SYCA 2MRYA 1INQB 3ARVA 1J9TA 2EH8H 3IAQA 4E42B 5TF1H 3WDJA 1ORQB 1RI8A 4OD2A 4HCIA 2O5XH 3WTXA 1NGXB 2OCCB 5K1JA 3ILPB 3WJLC 1MHHA 3KR3H 1NCHA 2F1EA 2Y72A 1H3PL 1UHVA 3LPPA 3QXAA 1BAGA 3VWKD 2E6JA 3VXSA 2VCOA 4Z78A 4R3SA 4ENED 3LN5B 4PD4K 3KVDD 2YK1L 4JDZA 5AD0B 1RFDH 1ERNA 2EJ1A 3ZKXC 3FQNA 1FV1B 2B77A 2KL6A 4P3CH 4K94C 2EH8L 3DJZA 5T1LD 4BUQA 5KTEL 3KPRB 3IMTA 3DURA 1GYAA 4QXGL 1KPUB 3IGFA 4UTCA 1TYRA 2FSDA 3KJ6L 4PLOB 4W9CC 3OB8A 1A0QL 3KR3L 4FA8A 4Q2ZB 5DUJA 4AMKL 1UKTA 3GMOB 1NBYA 3TVMD 1JYNA 3UP6A 1AS6A 4XOAA 1B0RA 1A7RL 1UB6A 5E1AB 1WP6A 2QADD 1R3IL 4HC1H 2JQZA 4DVBB 2YN5A 4P3CL 4XVJH 3ZE1E 4CU8A 2WQWA 1EO8L 1ADQL 1E9OB 2VW4A 3BWZA 3MV7B 5B22A 5C07E 1J5DA 1FLTX 1O5PA 4JG1L 4S2SB 4YPJA 2OMUB 4O5LL 4PJEB 3QZMA 1Y7VA 2YMTA 3G5ZB 4QRFA 3ARGB 4AIZA 4O2EA 5I6OA 3MXVL 1J0IA 4G6MH 3BIAX 2ED6A 1D5IH 5IG7B 3I9GH 5HVHB 4G83A 2P44B 5KG9B 2WUCL 4P3DA 4B9YA 1C5BH 5DEZA 2ITCB 1IM3B 2ERJC 1K3IA 5E8OA 4OV5A 1PMYA 4X9IA 1WDAA 4WKZB 2VDPH 5CEXA 4KQ3H 1UJ3C 5IQOA 3RB7A 5BUGA 2H3XC 2YSSB 1VZIA 3KS0J 2CRYA 3SKMA 4Z7WF 4UOQA 2PPDA 2YEZB 3CDFA 4JY6A 2G4GA 1DBMH 2VITA 3WIIL 3I9GL 4N8PA 1Q9WA 4YHML 1LO3H 3IJHB 3SGDH 2HVJA 5FK9B 3U0WL 3UEQA 5EF0A 4Z7AA 1HU8A 2VDPL 2VQ1A 3QDGE 3HFML 3ARDB 1SOSA 1K5WA 5L88H 4QRUA 4BD4A 1FH2A 1X5XA 3MBEC 3IT8D 3C5ZA 2A1WH 2XY2A 2PABA 1HT6A 3G04A 3CAFA 3U6XS 5B4MC 1DJYA 1GJWA 4K2UH 1G9NH 1SM3H 5K93A 4RWHA 1Y0LB 1VFUA 3A5VA 2VSKB 3FUDA 5F7EL 1G7IB 3OKEB 3PF2A 2FBOJ 2JQAA 1U41A 5MENA 5FIEA 1OM9A 3CC5B 4X7CC 1WH0A 3QQ3A 1RV6X 3VVVA 5I2IA 5INDB 3PQYB 3NCCB 2IADA 3LZPA 2EDOA 3BH4A 3BT2H 4JCWA 4ZTPH 1SXAA 3EO9L 1NBZB 5LB1A 5IUSA 3DIFB 2BDNH 4K2UL 1G9NL 4IJ3C 5C09B 2X4QA 5ECGA 3MV9A 3L3OC 3W2DL 3GI8H 2A7BA 5LHDA 3WXWL 3DK0A 3D2UA 1F4YL 2WIIB 2UUDK 2X2JA 5GRVK 4M7LL 4FYRA 1KB3A 3TA3D 3MRKB 3PWLB 3BT2L 2OLDA 3GO1L 1RZGB 1YYMH 2B1AH 2F19H 3GF8A 1ZPUA 1MPAH 3QDMA 4FHJA 4OJFH 1KFGA 3AXLA 1XD0A 4QF1A 5E2JA 1GZPA 1LO5B 2ZX9A 1XVSA 1FRGL 4QCIB 1QA9A 2NW2A 3GI8L 4P2OC 1ZWIB 1P7QB 5F7YC 2NUPB 3HI1A 2A9NH 3IF1B 2GBVA 5DYOB 1WIOA 3JV6B 2XWBB 4X8CA 2Q10A 1A9VA 2DH3A 3U2SA 3BEWB 3SJVD 4PV1C 2EYSA 3OKMA 1PKQA 3OZ9H 1BMGA 1MPAL 2ADJB 1RZPA 3DX9B 4M6OL 5B4MD 9PCYA 1AKJA 4W9FC 4DQAA 4B27A 4LDEB 2W91A 1GGYA 5GJTH 3TN0A 2CCVA 4TUJB 5D7IF 1WA2X 4MJHA 2A9NL 3BP6A 1V54B 4IRZA 4L3EB 2QQKL 3EGSB 1BQ5A 2VLRB 1G7PA 1ASOA 1YN7B 2IV8A 4LL1A 4G7QB 1JFQL 1W0VA 4F33B 5CN2A 5HHOD 3FT4A 3ME0A 5JHLH 2LU7A 2DQGL 3I6KA 1FG9C 1I7UA 4X6CE 1AGCB 4F2EA 3PXJA 5GJTL 3NIGE 4DP0X 1J86A 4KTEH 4XB7A 5GS0C 5C08A 1DVUA 2XQYA 2Y4SA 3PJSA 5C6TH 3IFLH 4K55A 3T9WA 3QIWA 1C12A 1QHOA 1MCCA 3O2DL 5GGVL 1DQTA 3CXDH 3K6FA 1O75A 2OP4L 3CJJA 3AU1A 1T1ZA 1RUAH 2MKWA 4XCCH 5D7KD 4GI9A 3VU2A 4XN9A 5KBLA 2IWFA 5JHLL 3SGJC 5EUOA 2IBBA 3QWQB 4MWFA 3VGGA 3UG5A 5JTWA 3RWGA 5KSAB 3FN9A 2OMZB 1WK0A 1I8MB 1QBBA 3BW9B 5C6TL 5DK3A 1DVFA 2ADIA 4Y4HC 4YHZH 5JOPE 1J1PH 1Y18B 3ZQWA 4OAWB 2DLFH 2A74B 2P8PB 1QP1A 5C07D 3F2LA 3B5HA 3RBSA 1K4DB 5D7IB 4YHYC 2DM2A 2LVCA 4G8EA 1I31A 4N86A 1JXKA 1FL5B 2DPKA 4XZ4A 2DJ4A 4UOW0 2WAHA 2F5AL 3EH4B 3WG7B 3MRRA 5IW1B 4YHZL 1J1PL 2I24N 5H37G 1WT5C 4WGWB 3VYPA 4ZMLA 1AOZA 2HRPH 1UYWH 2FL5A 4YGAB 3CNKA 3WUWB 4AWJC 4E9VA 1NL0H 4KJWC 3PPEA 4ZQKB 3KYOB 4IGBA 1NCUA 3MX0A 5GS0D 4OFVA 1FN4B 3FQUB 4AV4A 3MLXH 2WLIB 4P99A 3CLEL 3MLRH 3EYQC 2OXGB 2O6CA 5E9DE 3QJTB 1HK6A 1Z32X 3MGOB 4GKSB 3O4OB 3HMXH 1I85A 2DIAA 2J72A 2E47A 3ZO0A 1ASQA 2YC1B 2ADGB 3QDGD 3SCMC 4JO1H 3RHWK 4FLSA 4OZHA 4X6EB 3OHXA 3V0EA 4DO5A 1A7QH 5FGBA 3K6OA 3UPRB 4UINH 1NL0L 1TTAA 1MRDH 2YUZA 3GXDA 5I71C 2CGYA 3TPUA 3HCVA 1KB5H 3QZWG 1P9MC 1NAMH 2J8HA 3RGVC 1MG3C 3MLXL 3DRQB 2ENJA 4R6UA 3VXUA 1BJMA 3MLRL 4JFZH 1KIRB 5MI0B 1GR7A 4LHUG 5LAXA 2UXGA 2PW2A 4GBXC 1VFOA 2PYED 4RFEA 2OV0A 3BRFA 5ICXB 4AMXA 2X6BA 2ZTBA 2HWZH 4YK4B 3MOQA 3OKKB 1SGKA 1GZHA 5EOTA 4UINL 2MCAA 4WI5A 1MRDL 4KJPC 4IU3B 4WGKA 2BP5M 4HJ0C 3RNQB 3RWDB 1JSYA 1T1YB 5CBAA 1BJ1H 2OI9B 4HHAA 4MVBC 5JPMC 1T80A 3U7WH 2E3VA 2E75C 4JN2A 1TF4A 4ANWA 3IPFA 1F6FB 4M4RA 3EOYG 5I75B 3EGDB 2IXQB 4BQ9A 2HWZL 3ISRA 5D1XA 5I1GH 3QDJA 4KJWD 2GIMA 2PR4L 2UZXA 3MA7A 5KVMC 3WS6C 2HCZX 4Y2LA 5FWQA 2IDTA 2WQAA 3FB7B 3EYQD 1OXYA 3U7WL 4O02A 3SDXE 2G5RA 4YAQB 2H1XA 2PP7A 1NUGA 2BSEA 3SCMD 1VGEH 1A1NA 5BCAA 1YZZA 2YWZA 4Y4FD 5E99H 3JXAA 5I1GL 1OCCB 2ICCA 2HFGL 3ZYOA 1W80A 4MCNA 4RFNC 5KEZA 3QC6X 3GXTA 3UDWC 1BF8A 5F88B 3DGGB 3KHOA 5TPWL 3RGVD 3U1SL 5F0MB 2ZICA 3QNYB 3SGKC 4WI9A 5CLZA 4ADJA 1BQSA 2XV6B 1UGNA 3O6ML 4H1LH 2H8PB 4GBXD 5EZPA 4P59H 4KXBA 3VFVB 4UYQA 1M2OA 2G9HB 3U79A 4TULH 3OHMB 3U4AA 5FHAL 3EUDA 3N43F 4KJPD 2VE6A 4HJ0D 2AQ3A 5JHDE 2WTPA 4CMHB 4NPYB 2ZKHL 4FNPA 4OI8A 3Q2WA 1ODAA 3FSWA 4HLZH 4MVBD 3IDJA 3O81A 1F6AA 3PIQB 1MREH 2Q8BL 1BZQK 1HYRC 1PTZA 1RUQH 3BWUC 4H2CA 3U0TB 2LTQC 3CFQA 2FQFA 2XV0A 4AIOA 4P59L 3MCKB 4BH7A 3NAAH 3SE9H 4TULL 4XMPL 1H6FA 2ZCLH 4R97B 5JYLA 5KS9E 1N6QH 5TDPB 5FV2A 1M7DA 4DWHA 2IALA 2Q3ZA 3L5HA 1RPUA 4U1NB 4CMMA 1EGJA 3JTBA 1C8QA 3KH3A 1YA5A 4NLHA 2NY5C 4FYSA 4F27A 3MOBL 4MHHI 4NO0A 1E3ZA 1SN2A 2J1WA 1MREL 1G7JB 4G72B 4JFFA 2VN7A 2HG0A 1RUQL 3PFQA 5I1DB 1NM4A 2EDQA 3P73B 2AGJH 4KKCC 1MFAL 1S7SA 3QXDB 2YXWA 1EHKB 3SE9L 1CXHA 3ZQ9A 4YDJA 1AGDA 5JOPD 3N44F 3GRWA 2GJPA 4LOFA 4L23A 1N8OE 2QTVA 2MOVA 3APMA 4NI6A 4N26A 4CVXA 4HUXA 5HHQA 4P2CG 2JKIS 1WS7A 4BDVA 4WFED 4PV9B 3D85B 4YBLC 3RG1C 3N43B 3ZDYF 2AGJL 2O5ZL 5F96L 4HYTB 4I3GA 4Y9EA 2LU4A 3GSXB 1G5AA 2XVKA 3W11C 5I28A 1U4FA 2X5PA 3HR6A 2GW5A 2H2PD 5MERB 1SJHA 1TVHA 4HX1A 4M7ZB 4X5LA 1T6WA 3BKML 1G7LB 5HYJE 3JTSA 2XA3A 2BS9A 2WLHA 3Q48A 1BLNB 4NRXB 3EFDH 3SY0A 4IRSC 4X6DE 1ILUA 3GMLA 5AL8A 1CG9A 1SDDB 3OXRA 1G9MH 5E9DD 4AC2A 5EO0A 1OM3L 3MVSA 2AK1L 3MO1B 2AS5M 1RJLA 3H7BA 1D6EB 1QR1A 4URKA 1MHEB 2P47B 1I7ZA 3BGAA 4YS4A 3HHMA 2AQSA 2BOLA 2HG5B 2N0KA 4P2RE 1JWMB 3WN5C 2X6UA 2J7LA 1IKFL 2BVQA 4WU7A 2XPYA 1A6ZA 3GHEL 1G9HA 3EFDL 3N44B 5ECJE 5D4JA 4APQB 4KKCD 3FB6B 1QUPA 4JFHE 32C2B 3N1FC 1X7TA 4UUJB 4WI8A 3F12A 5ACMA 3L5XH 4J1UB 3LKSB 2ZUTA 4H5SA 3O4LA 4ZD3H 2NTFA 3HAEH 1FPTL 3ZDYB 3HPLA 3KL5A 4GMTL 4MNHB 4MA8L 5EU4B 4P06A 1BYNA 3WFCH 2JCWA 4XMVA 4FFYA 2PNDA 4AK1A 2A6DA 1KJ2H 2I69A 4M5ZH 5TDNA 1Z5HA 3IDIB 4PRNA 4UTBH 3HVNA 4MCMA 5D96C 3R06A 4AIXA 1IRAY 1YLBB 4LT7A 5SX4I 2ARJQ 4TQEL 2R2CA 3L5XL 5GGUA 2AVFA 4CN1A 3VUAA 2PO6B 2KZKA 3UBXB 4QHLB 4ZD3L 4HS3B 4G7RB 4XHQA 2R2HB 4NUJB 5E8NA 4WEMB 2ZOOA 4PJHF 5TGBA 4V11A 4FFVD 3QORD 1DUZA 4NJ9H 5I6MA 4M5ZL 1ODUA 4W4NA 5FA3B 3ZUNC 2MOGA 2M1KA 2Z1KA 4JG0L 4P23D 3E6FB 4U1JB 4UTBL 3SZKC 5IQ9B 5KJ7E 4LF3B 1AO7B 4PW9A 1HZLA 4M93C 5DI8A 4ZZFA 5KYXB 1JS4A 3DVGA 4QO1A 4ZXBC 3U2IA 1Z3RA 4L3CB 3NCEB 1XZ0B 3LQAH 4HVBA 4LKCB 2IAMA 1MEXH 5BS0A 1NPJA 4MAYC 4IBWA 3IDNA 1UA6H 2QLYA 3FRUA 3OLGA 1MLCB 2PCYA 3OKNA 3P11H 1OB0A 1Q94A 4PP2B 1ECYA 1NKOA 4JFPA 2VW7A 5DJCB 1UT2A 4H88L 3D12B 3VH8G 2DM4A 3F58H 3ZHLA 1HILB 1K4CA 3DOSB 4UNVA 4Y19E 1GZQB 1EXGA 4M6MH 2E6QA 4P07A 5ILTH 2V17L 1RK0B 2HH0L 2Y6SC 2L3BA 2IBZY 3V95A 5JHDD 1MEXL 4FLQA 3NZHL 4GRWE 4P9ML 5F7NC