3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Otoferlin
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
2CJTA 4WWOA 1E8XA 2X38A 2YRBA 3APCA 3QAQA 3PREA 4LDCA 4FULA 3JZYA 1BCIA 4EZKA 3PS6A 4FHKA 4NPJA 2BWQA 4KZCA 2A4ZA 4JPSA 2WXLA 2D8KA 4XZ4A 3L9BA 2NQ3A 1QASA 2UZPA 4NS0A 4F92B 2DMGA 2CHXA 2WXPA 2EP6A 3DBSA 3P2BA 4HVBA 3NSJA 2WXOA 2WXGA 4F93B 1DJXA 3L13A 4G11A 2WXRA 4NPKA 4TUUA 3S2AA 3CSFA 5CCJA 3ENEA 1DJWA 2ENQA 2A5UA 3F01A 4V11A 2JQZA 1RSYA 2B3RA 2K3HA 1TJMA 3T8MA 2CM5A 3QR1A 4EZJA 1DJIA 3HIZA 4FLHA 4LT7A 4AOFA 4GB9A 1E7VA 4DNLA 4L1BA 1A25A 3HHMA 3L4CA 4FJYA 3W56A 3NZUA 4DK5A 1K5WA 5G55A 3RDJA 2CJSA 2WXNA 4IHBA 3KWUA 3PFQA 4ANUA 1RLWA 3SD5A 3PRZA 2RD0A 3F05A 4FADA 3B7YA 3QR0A 4HLEA 4Y1SA 4WWPA 2WXIA 4OVUA 3F04A 4BFRA 2CM6A 3QARA 4ICXA 2KI6A 3ML9A 4KITB 3N5AA 5CCHE 2K45A 2CHZA 2FJUB 3DPDA 3R7QA 4L23A 2ZKMX 4A55A 1UOVA 2WXKA 2K8MA 3L54A 4L1LA 4MJJA 2LHAA 4TS6A 3TJPA 2WXFA 4BGDA 2WXHA 3LJ3A 1UOWA 1W15A 2K4AA 2R83A 5T8IA 2QZ5A 1RH8A 3OHMB 1DJYA 1DJZA 3HN8A 3MJWA 3QJZA 5KJ7E 3L08A 1DSYA 2WXMA 3FBKA 1E8YA 3QK0A 3ZVVA 1W16A 5H4ZA 2QZQA 1DJHA 3IBEA 4F91B 3ZIMA 4QJ5B 5CCGE 3M7FB 3ZW3A 4F1SA 1E8WA 3GPEA 4QAMB 4WEEA 4URKA 4WWNA 2FK9A 4IQHA 1CJYA 3R7RA 4OVVA 4ANVA 5EDSA 1BYNA 5JHBA 3L17A 4XE0A 4AJWA 2CHWA 4PS7A 4FA6A 5G2NA 2V4LA 2Y3AA 5JHAA 4EZLA 1BDYA 3OAWA 4GNKB 3L16A 3APFA 1GMIA 3KWTA 1WFMA 1TJXA 4PS8A 3TL5A 1DQVA 1E8ZA 3APDA 1UGKA 4L2YA 1V27A 4FHJA 2ISDA 1E90A 4J6IA 4NP9A 3F00A 2ENPA 1QATA 3IM1A 2DMHA 3ML8A 3PYCA 4LCVA 4QJ3B 4XX5A 4QJ4B 2Z0UA 3CSTA 3TWYA 2NCEA 1DJGA 3NZSA 3RPBA 3W57A 2N1TE 3FDWA 2Q0ZX 2Q3XA 4KZ0A 4TV3A 2CHDA 5H4YA 4PS3A 4ANXA 1YRKA 2NSQA 4ANWA 2WXQA 4Y1TA 1HE8A 4FJZA 1WFJA 2YOAA 4WAFA 2ENJA 4ICWA 2WXJA 1E7UA
chains in the Genus database with same CATH superfamily
5DMKA 5F72S 1YEGL 2CWRA 3ZZ1A 4PRAA 1NCDH 2VLRE 5SWZB 4ZO6A 3LNIA 4ZW6A 5GZNA 3QRGH 4H1LB 5EOTA 4R7XA 3Q5OA 1XL4A 1NBZA 4OCRL 2GT9B 3PF2A 3PQYE 5LO7A 5C70A 5MI0C 3G08A 1NOLA 1AR2A 1AS8A 4Q58C 1ACYH 1NPUA 1CE6A 1S46A 2GUYA 5AOLA 3U0PB 4U1MB 5I8EB 5L4JA 1NMCB 4MDIB 1BOYA 1G7IB 2YKKA 3WFBL 4BXVA 3EJZD 4HC1A 4OGXH 3VSQA 3EYFA 3F12A 1FL6B 2B2XL 3KGUA 4QTHA 2L04A 5B22A 3HHMA 1J8HD 2LTQB 1P9MA 1G7QA 2J8UE 4PRBA 4NQTA 2DD8H 2X0UA 4JRXA 3S0PA 4HOXA 1UXSA 2DD8L 2PW2B 3RVXD 3UYOD 5C86A 4OZHF 3STZB 4CDHA 1W8EA 2N56A 1U30A 4Y4HA 5F9JB 2APBA 2YC1A 4LVHB 1CBVL 2N0KA 4K5LA 4P5TB 4PJ8D 3N9GL 4HKZA 5E8DH 3OR6B 4NZUL 5ICUA 1UH2A 3ZIYA 4H88H 4ZUTB 1SJHB 4JW3A 1N8ZB 4WI7A 5IW1B 5B4MD 1ZANH 1CFBA 3RZCB 3VXRD 3CU7A 3OHMB 4ISVB 4GW1B 2YWZA 4Z7QF 1OL0A 4GXUN 3RTQA 4LIQL 5DEGA 3ZHKA 4NJAL 4QRRE 4LHUD 3GK8H 5JMOC 1FO0H 2OR9L 5JW5B 3DX6B 2LFEA 3A4EA 1BVNP 1BOGA 5CP7A 3WJJA 5I17A 3EJTA 1RULH 4DT2A 2IBGA 1N68A 3RVTC 1DE4B 2VIRB 3Q9PA 3T0AA 4C8XA 5INDB 4X5XA 4NNPH 4P9MH 2P8MA 1AZUA 1AOHA 2GCYB 3UTZA 2XWTB 2MPAH 3FRUA 4YZWA 3CHXA 4PV8A 3IAQA 3U1SH 5HGBA 5IJKC 1UB5A 2EXWD 4WEUD 2QHLA 1YUHA 2AJZB 2XNAA 5EEXA 2ORBH 5F1NB 1IBFA 1QQDB 5C71A 5TK4A 2EIJB 4CC4A 3IXTA 5KSBF 1GYAA 3IEAA 3BKML 3CBJB 3V4PH 2Z64C 3Q1SH 4X6DE 3ZDXF 4OD1L 2BSTB 1E5BA 4WSKA 5ICXA 5C3LD 3FTYA 5FUZL 1U9KA 4JZOB 3MTXA 1UWEL 5FF6A 1KSRA 1UKQA 1XH3A 1F97A 5GS0C 5JXEC 3RJOA 3WN6A 2VOTA 3KPOB 5EU6E 1WJ3A 3F7LA 1AXIB 1A8ZA 1UWXK 3ASNB 4GFXA 4PJ5B 4R7LA 2EACA 3KWXA 1XF3B 2NXYD 3OMIB 4R4BA 4FULA 5GRWA 1BCIA 1M7DA 2L7JA 5FFOA 5GGSB 1KWGA 4O5LH 2EEFA 1G9NC 4OZFB 35C8L 2Y1VA 4JRWA 4F92B 5DD6A 2FIRT 3B34A 5BW7C 3S2AA 3KGSA 3D69B 3KE0A 4H8UA 4JDTH 4WY7L 4ZQTA 4PJDF 3ATAA 4OJYA 5FGCB 3RL1A 1FYTE 3SDAA 4Z9KB 1IKOP 2CGYA 4IHOB 5BUGA 4NO0A 3OJDA 1NAML 2PF6A 3ARYA 4LOUC 4APQB 1HDMB 1HHGA 1HL4A 1MCQA 1NFIB 1KJ2H 4JHAH 4MAYB 3MROB 4P3CL 1ITBB 5IG7B 5EG6C 2OMVA 4CNIB 1DBML 1P7QA 4Q7DA 1NGWB 3CDFA 4DEWA 3WIIH 3EH1A 4TVUA 4OB5H 1CD9B 2GI7A 3CVCA 2H0EA 3KPRE 3ARRA 3U82B 3VRLE 1A0QH 1MCPH 4FXKA 5T5NF 1FPTH 5KZCD 1AQDA 5L2KE 4M7JL 4XR8C 4K2UH 4TUJA 2ITCA 3IFPA 3NSCA 4NUJB 1E4HA 1GY1A 1MY5A 2A6DB 4HSQA 3SPVB 1NC4D 3UCQA 1VFAB 1A7NL 1P53A 2CDFA 1W15A 4XBEH 3FZUD 3ZTNH 2UVEA 3QXDA 2WP3O 4ABVA 3TYGH 4AM0A 4U7KA 3IJSA 5CJOH 3TIEB 1X9UA 5HGAB 3I6GA 3MREA 3H0TB 3L2LA 3BQVA 3B7RL 3ARUA 3V4VA 3G5ZB 3RY4A 1JXJA 4V1DB 4YLBA 3EADA 3GEFA 5DFWH 2VM4A 3GM0A 3FT9A 2EYSA 3L3OC 4PJCE 4WUKL 1HAUA 4GAGL 5T5NG 4AGLA 2ICEC 4KMTL 2EZ0D 5FYLL 1BMGA 4NQSA 4Y5YB 4BQ6A 5EPMB 3A23A 3GTNA 4M61A 5C6TL 3GMRB 5K9OB 3PJSB 3OAWA 4P2CG 3PV6B 4HWZB 3VFTA 2DQDL 1CLZL 2J1KA 3UTSD 1MAMH 4L3CA 2XA3A 1EFXA 3ZU8A 2FLBT 3B9KB 2APWA 2I5YL 4M7LT 2VDML 2XIIA 3DKHA 3GXFA 3L48A 4I1RA 1JL8A 4WJ5A 2AHIA 3K7UA 5DT1H 3EFDH 4G8IB 1DANU 1SMAA 3IDIB 3GXTA 4TTGA 3MV9E 2DBJA 3JQOB 1A4JB 3U4BL 1JCKA 2OSYA 4GEJA 4W81A 4GMSH 4NC2B 4LPTA 2AQNA 4EUPH 3BGMB 3M86A 1TJHL 1BM3L 3HPJB 4PJGB 2XPYA 3SCMB 3B8SA 2NZ1A 4KGJA 1VPOH 3QAQA 4ZUVB 4YIQA 5KJRL 2L4OA 4UQ2A 2EE9A 3K8KA 5GS2H 4I1PA 5EBGA 1U8CB 1IGYA 4HAFA 2ITDA 4OCSL 2F19L 5IF0B 3QI9C 4Z3FA 1LDPH 2VXUL 2HKFH 3DROA 1TSHA 4NBXB 4R5VA 2ICWI 4MQ7A 3RVTD 3TO2A 3ES6A 1E6OL 2DB8A 5TDPB 1I7ZB 2C9XA 4OCWL 2BWDA 5I75B 1R1CA 2BS9A 5F70A 3MLTA 1KUMA 4XC3L 4Y5XC 3T0WA 3UAFA 4IRSA 1SMDA 3QDGB 4OSUL 1KCRL 2ADJA 15C8H 1FZKA 3KL3A 3HI6H 3PJNA 4G59C 4M62L 1GCFA 4ZMYA 4ZTEA 3B6SA 4U7SA 2VAAB 4YO0B 2F6AA 2EH8H 2IH3A 5KBDA 4ISVA 1UWGH 3KHOA 2XICA 2C9AA 3QS3A 4TN9A 4WSJA 4EI0A 3UGXA 4P59H 5DUJA 4DTGH 1RVFL 3MRMA 2IALB 4YPGA 5I6KA 5L0QB 2CLVB 4J1UA 3HCVA 3IN0A 4QHNB 2NXYC 5CP7B 4LEXH 1ZS2A 3T0EB 4QLRA 1KB9K 2MKWA 4HIIB 4MNGB 3FFCE 3L3GA 4FFZH 4LRNL 4J3BA 4JCMA 4F9PA 4UBDC 1DBMH 1RIVL 3M1CA 5H2BB 1JVOA 4H8VA 3RG1C 2JKNA 4GQRA 5E9AA 1W6LA 4OF3A 3VYNA 1DSFL 4NUPA 5IV2B 1MCJA 4I0PB 2VLLA 4ZXBA 5DUML 3U4EA 2HKFL 5DHVB 1KJVB 3LKRA 2I7OA 4TLTA 4W9KC 2KLTA 1GZPA 2UUDH 2VZUA 4KJPD 1Z1WA 4ONHB 5GGTH 1LMKA 4X6DB 2IH9A 2WNKA 3G5WA 1B0WA 1F13A 2CO6B 4OFIA 3SO3B 4XMUA 5D93C 3HZKA 4YHMH 4X99B 3MRIB 1W6WA 1H6EA 4GW5B 1MPAL 4QD2E 3WJLA 3TCXA 5IB3A 1Q9WA 2W91A 3HG5A 2EO7A 3M17A 4MVBC 5LVEA 5AD0A 4I85A 1KFAL 1BBJA 5D93B 4PCKA 3C60C 2VSKB 4G1MB 4BM7A 2D73A 3ULVE 3SYOA 4AENA 3AROA 3MGTB 1KTDA 5GGUA 4B3EA 4S1DD 2Z92B 2HSIA 4NQDA 3VE0B 3VG9B 2XPZA 4YDIH 4JO1L 3L5XH 4ZOCA 3H6AA 3RL1B 1MAML 4ZZKA 4P4KC 1B3JA 4K3EL 1BFVH 5I9QB 1R6VA 4ALAL 4ENED 4HOMA 2F8VA 1S7SB 4U05A 3QXTA 5AYUL 2WUBH 3GM8A 3U0PA 3CFEB 3QIWA 4BWUA 3HAEH 2XBTA 1OT4A 1OCZB 1SYSB 1DN2A 4J7RA 5EF1A 3MV9B 3VXQB 4UUJB 2WKOA 1WD8A 2UY6A 4Z1PA 5I76B 3GMLB 4L8CA 1FCGA 5DHVH 5JIHA 4PJCF 4WEBL 2O26U 4Y4FB 3QYCA 5EU4A 4BZYA 3F62A 3GMMB 4Z7WB 4YHML 5HYFA 2IJ0C 1NEUA 2GC4C 5GZOA 3ARPA 2CG9X 2CR6A 3OSKA 1A7NH 3MJ8A 1N8OE 4EZJA 2JH2A 3BT2H 1A1OA 2X09A 2Y07L 4XAKD 4PIBA 1H5BB 1I9JH 1PF3A 2Y9RT 2R8SL 1OZTG 5CLYA 1FL5A 2XWJB 4NZUH 4RBPH 1CFMA 5D1XE 1KG0B 2CGZA 3NIFF 3AY4A 3SKUD 3NOIA 1JJUA 5IBUB 2VDPH 4JVWA 5JIPA 1MCEA 2ARWA 2YD4A 4HS3B 1A7PL 4ODSL 1RK0B 4LCCB 3MUJA 3FTXA 1CE1H 5ESAA 3BHBB 5D1ZA 4MJ6A 4W4NA 3ZMNA 5F7WC 1KLGB 4OF5A 1KC5L 1BIIB 4EVNB 1I31A 1CDJA 1QVOA 1NJ9B 5K1VA 5LGJA 1JHLL 1RIUL 3BVDB 1R17A 1OK8A 5E08L 2C26A 1DFXA 1MFUA 1T66C 2FHFA 3IDNB 3VO0A 5J13C 4BFJA 1FAIH 1XGYH 5F88A 1AKJA 2H3NB 4HHAB 3WNPA 5DS1A 3HFFA 5AD0B 4A2HA 2ZKHL 2AJXH 1ZTMA 4GP4B 1BAWA 3RI5K 3QRGL 5HHNB 3UPAA 3DX2A 4WI3A 3BUQA 3I3BA 3MV7E 3OKDA 1MCNA 4OLZH 1HSAA 4IS6B 5HGHA 4IMLB 2F7IA 1FLRL 1QPXA 3A6CL 4LEXL 4AEIL 4P2QE 1QRNB 4L05A 2Y06H 1IGFL 4JO4H 5DQ9A 1KCUL 3O6FA 1HINL 4HJSA 3C6EA 3T2PA 3BQUC 3BUBA 4XVJH 3EGXA 4I18C 5PAZA 2ORBL 4MQ7B 1JGIA 2FYYA 5F9OL 4RWHA 4Z7UE 3ZUNC 4DZBA 1Z0NA 3S8FB 2JNZA 4TUOA 3MLTB 1I8KA 4N86A 4W9EC 4XMKH 2YRLA 2NZIA 1YDPA 1AZBA 3MRDA 5JDSB 3L3DA 3QS2A 1RZ7L 1OCWL 4C56D 4AQZA 4PGBA 2CRZA 3L1OL 3S2CA 1IB5A 2VJXA 4HUWB 5DJCB 3WE1A 1DQQB 4PJEB 1CFNB 3IE4A 3P77B 2ZUSA 4NSKA 5E2WL 1G7HB 3FBQA 4Z7UB 1KB5L 4MS8C 5AZ2H 3LKOB 1IZKA 4XMXA 3F7PC 1SQ2N 3WXWL 4JZJA 3MJGX 3LPGA 3B7TA 4OJFL 3V6OA 3EOAB 4GB9A 3MLSL 5EEYA 1G6RH 3QCTL 1NMCC 1LWRA 4GMSL 4ONFH 4YPJA 2WLYA 2IC2A 2OL3B 2P43B 4TNWK 4Z0BH 2XA8H 1IC1A 2X4OB 1HXYA 3KPRD 3VACA 5J6GA 3DRQB 3QBTB 3IJSB 3B5TA 5D7LE 5AYUH 1DFBH 1XF5A 4GI9A 4L8DB 3RNKB 5HGAA 1OTSC 5JLZA 5F21B 4ZMZA 1UA6L 2LLNA 1I4FA 5EU6D 4S10A 2CGRH 4QHKI 3T4YB 4MRCA 1HH9B 2DQGH 2Z91A 3GHBL 4BGDA 1XF4A 3ARED 3CVHH 3O4LB 5E4IA 1P84K 4IGBD 1RH8A 3H4HA 1YQVL 2G3MA 2R51A 3G6JB 5AVXB 4M02A 1T89A 3FXIC 5DJ8B 3ZRFC 3QB7C 1MCSA 4CGUB 2AEQH 2NUPB 1O7VA 1NANI 3CHRA 2Q7NA 1UXWB 4IEFA 4LCUA 4UT9H 1MHHB 1P84J 3T0VA 5KYXA 2YPKA 4E41D 2VDMB 1A7RL 1YEKL 1DANT 2FD6L 2PTVA 2DL2A 1OLZA 3KNBA 3QIUB 5D7KE 3CNKA 3VXTB 1EJ6A 2MCPH 5B1AB 1KACB 1YN6B 1JF5A 4D0BA 2AC0A 1A9BB 1YEDA 4A2EA 1WAPA 3GRGA 4FFYL 4WUUD 3WS3A 2NNAB 2A6KA 1T6BX 1DEDA 1DQVA 5KUMA 4DFIA 1A4BA 1NBYA 3ECUA 3UIZA 1YPZE 1MIML 3ALPA 3UAJD 4PFEA 1GOFA 5CD3A 5E70A 1HI6B 1M7IA 1YY8B 2YA1A 3RWIA 1JGEB 4WRLA 3NEXA 1U3HA 3GMLA 3MPCA 2ZX7A 3DMMB 5EN2B 2QPEB 5CWSB 3RPBA 4AIXA 2YPLB 4TRPH 2JQMA 4YSCA 2JKIS 2A7BA 5I5RA 4FYRA 3ZHLA 3HZMB 3GJFA 1RU9H 1IC4L 5TQ0H 2D0HA 5DJ0A 1SOQA 3B2MA 3RTQC 3PREA 5JYLA 4JX0A 1TDQA 3O4LD 2V2WB 4BSVB 4L1DA 1XAKA 4F27A 2FB4H 4IRSB 3QZLA 4UT9A 4G7QB 1YQ2A 3O8XD 2YXVA 3GHEH 1VF5C 3HI6L 4WK0B 1D5ZA 3HNSH 5HHQA 5SWQB 4JJ5B 5L8LB 5CEYB 3MRBB 1THCA 4KMLB 5DJDA 3NJNA 3WO4B 1J9TA 4G7YH 2OJZH 2G9KA 5IHZB 1YEIL 1ZGLP 4OD3L 2F1EA 4X4YA 2GSGB 1WHOA 2COQA 3DJ9A 4Y2DC 4Y1AB 1XD0A 4TQPA 5HYJB 5F9AC 5HYSA 3AT0A 3ET9F 1PGRB 4ZMTA 4HKBB 3EYQD 3CFIC 3MNZA 4RX4D 5ICZB 5KVGH 1IIIA 1OM3L 4M03A 3QIWC 3O9WC 3K72A 1FFOA 1I8MB 4KKNA 1A14H 4GW4B 3NCEB 3FU7B 2UWEA 4GSDL 3O2VH 3UTPD 4KOBA 1ZDSA 2LGNA 3QARA 2X89A 4H25A 4JPVL 2I07B 4NQEB 2FEDC 4UYPA 1JNNL 4RMBA 5E24E 3QPXL 3FB7B 2VW6A 1KYUA 5E6RB 4G71B 3CVIL 4BZ2A 1E2ZA 2EVIA 5LWYH 4UQCA 1L0YA 1DJYA 1HSAB 5HGHB 2VN7A 3QJFB 3L3IA 4GKOA 5D7JC 4DO5A 1HT6A 2J8UA 2BNRE 3EUUA 3QJRB 5EEUA 5HVHC 2ITFA 1UZ8A 4EDWH 3GPEA 4CVXA 3HOGA 4MXVF 4LGSB 2V8LA 3BEVA 2V37A 5I2IA 2CE6A 3Q9QA 4GAJL 4KK6D 3NZHL 4TSCL 3ZQWA 1D7DA 1XZ0A 1CICB 2XBDA 5DGQA 1E6JH 2GJRA 3MGAA 3G3LA 2DICA 1AZCA 1E2VA 4KTYA 2R69H 2CJ3A 3DTUB 3MRPA 1KYDA 2CLRA 4X6CB 5FO9A 3VXMA 3D3VA 3KPSE 4TL4A 4JPKL 3HN5A 4IKNA 1X5GA 1PLBA 2OSXA 4GG8B 4HJGB 5I71B 3DGGA 1W0VA 4PJDB 4CN1A 1AXTL 4Y5VA 3TWYA 2DWYA 3GWJA 3Q2CA 4U1JA 2ZXAA 5B8CC 5CAYB 5H4YA 4LNRA 4PJGF 3U9PL 3EHBC 2GITB 2CIKB 2MHAA 2BX5A 4L8CB 5FS5A 5B3SB 1IAMA 1X5YA 1O0VA 1SJEB 2ENJA 4AYBA 2XYCA 1RVFH 1ET8A 3AQYA 4FL4C 1CIUA 1G0DA 3O3EA 5ISZB 4EZKA 2BWQA 2JWYA 5DJZA 4N6RB 2ILLA 3MJ8B 1JVKA 1H15B 3UPRA 1BVZA 3CFJA 5HY9A 1AQKL 1PAMA 2ZXEB 4G1EB 4K07A 4OLZL 3D9AL 3OMZA 3LKPB 4ZK8A 3BISA 1H3XA 4HF5H 3SDDD 5LG6A 3UOAB 3N85L 5JQIB 4AZUA 4UTAL 2AITA 3CFKA 1JZGA 4FNSA 3GSOB 2VNCA 4JB9L 5AW3B 2K0RA 2I9TB 25C8H 1KNOB 1J5CA 2DPKA 2HX9A 4J28A 5BMFH 3PL6C 4ODWB 5I1KL 4YDKL 2NZ9D 4YXHH 2Q2EB 5D2NC 1JGLL 1YPZF 2Q87A 3CLWA 1J5OH 4ONGH 3DVGB 4FMVA 4F5CA 1YECH 3G6DH 1J48A 1RUQL 3Q8CA 4YEEA 4PVBA 2EVFA 4L3EA 1P7BA 1OTTD 3FB8A 3D3VD 4Y1SA 3CFDB 3X1FA 5D7IE 5BS0D 2I9LB 4X9BA 1BZ9A 2DI8A 4KZDH 1CT8A 1F1DA 5ESQB 3VU2A 2BXYA 2WCSA 4JHVA 1OT1A 1WFTA 4HS6A 5C2BL 5KW9H 1BF8A 4XE5B 4BCXA 3JXAA 4H0IA 1ASOA 4DAGL 3ULUC 3QAZC 5IMMB 3ZLQC 1JFQH 3Q8FA 2EIZA 4DVRH 2CKBA 3E3QC 1JGDA 4D94A 4M6OH 5AL8A 4OFDA 1O5PA 4N8PA 4R9HA 1W16A 4LHJB 1D7CA 3CFMA 3TYFA 5J4MA 4YBQD 3DJSA 2H9GA 1RZ8A 1KDJA 1SYVB 2D4DA 3ZTEA 1HOCB 4J3TA 4N8UA 1BECA 5G2NA 4MD4A 2ZAGA 1LE9B 5I15H 5T3XL 3DV4B 4PJ6A 4L37A 3I75B 3HZMA 1AGBB 2C9SA 1EAOA 3UO8B 4JRYE 4KGLA 4AQAA 1FO0L 2O1AA 2OR9H 3IFOB 3MLUL 4J5VA 3MRRB 5CO1A 4EIBA 3FT3A 1JHKL 1WVZA 3LKQA 3ZT6A 4URKA 2IG2H 4Q14A 3VGFA 3PHOB 3FDWA 1XTLA 2WN3A 3QDME 5DC0A 1WBXA 3T77A 3HG1E 5KSBA 4J6RH 5EC1B 4PJEA 2X9YA 4Z78A 3P69A 4JRFA 3W0WD 4AYFA 1A47A 1UB6B 1QPPA 5HDBF 1E8XA 3QDMB 3CN3A 1TYJA 3QZNA 4NPYB 4Y1AA 1HWWA 3V0VA 2OQJA 3TZVC 1L9PA 4OLYL 3MNZB 2YSTA 3VDBA 3GLZA 3EDDA 4MJIA 5GS1B 4FZEL 1J9SA 1X7QA 1ANUA 2ATKB 3NZ8A 2VLJD 5CJ8A 3SBPA 4Z7WF 3IF1B 5ANHA 5JR1L 1DJXA 4XVOA 1GGYA 4L3EE 4XNQB 4LHQB 3WFBH 4NRZB 4C83B 4UT7L 2HUEA 3FUDA 2FEDD 2VDQH 2BOBB 1M71A 2Q3AA 2VDOB 5K33A 1BFTA 1IAIL 4JS7A 4IKIA 4F2ME 4U3HA 5B4MC 1FSKC 1Q0EA 3MMEB 4Y8AA 3GC3A 2KDGA 4KNTA 5T3ZD 2XZAH 3NIFB 5ITBL 5DJAB 2ADYA 3LIZL 1WS8A 3O9WD 1IV8A 1PY0A 5AOZA 5IB5B 3RWFA 3FFDB 3W37A 3LEYH 4G80B 5MP6H 3IGKA 5IEHA 3NCFB 1AYOA 1PD0A 1P69B 1YEGH 2CHNA 2BY3A 1Q9KA 2G2PA 5ENWA 3FUHA 1IBYA 4UI2A 5EIQA 5AVUB 4Z7NE 4PR5B 3VSTA 2K45A 4YS4A 1ZA6B 4P2OD 4FNTA 4LBEA 3MGOB 4LOUD 3TBWB 3VG9C 1ZVNA 1UD2A 1FORH 1VB9A 3JZ7A 4S1QL 1R3JB 2XQ0A 1L0QA 3IU4L 3DNKA 5DJ2B 3VXTA 3ZX1A 1A6VL 3E1ZA 1YNTA 2H6UA 3OX8A 1PLCA 4U6VL 3S3BB 4DP9X 1XIWA 5CJQH 5JW5A 2W38A 1OGAB 4HK0A 3U48A 4JREB 3O6ML 1F4YL 3CX5K 5IM7B 1DQJA 4X7EC 5B38G 1MFAL 2PR9A 3V52L 1U8KB 2Z65C 1J5OL 1IM3A 2OV0A 2N1KA 3FTGA 1H3WM 1MVUB 3EHBD 5M95B 2VL4A 3D4GA 1GKOA 3CC1A 4PBWD 4CADB 3L3OB 5SX5H 1T2QH 4BH7A 2FECL 3CC5B 2XC8A 5JNYA 1EO8H 1S8DA 2FGWH 4PD4J 2VZ1A 5IGXH 2NT1A 2YGQA 4JFHE 2FQFA 3LD8B 3LV3B 5I6OA 4NO5B 4H8PA 2LVEA 3ZZLA 1HILA 3S34H 3LVTA 2I69A 2ZUQB 5D6CB 4G6KH 1SXSA 3GKWH 4NKMA 4C58B 3C8KA 2XWBA 4XNDA 1V5JA 4MS6A 3RRQA 1U0QA 3OVUB 5CUSH 3S9DB 4FF9A 4PRDA 1XR9B 2Y2YA 3U83A 2WXQA 4EXKA 2YD0A 3D30A 4Z3IA 3EF7A 4DKTA 4U3CA 4LSTL 2X6UA 3U30C 4MB5A 3EFDL 2JELH 1ZGLM 3Q13A 4RGOH 2EAEA 4ZMQA 2PO6C 4OLYH 1NKGA 2F7OA 1X4YA 1U95B 3QUXC 1YJDC 1QASA 1B2YA 4GUPB 1W72H 2NQCA 4XP5H 3EG9B 2ICCA 1A2YA 4Y7MA 2CXGA 2VQ1A 3TV3H 1Y1DA 2ARJQ 2KYIA 3L7FA 2Z0BA 3UX9B 1PQZA 1BLNA 4YDJB 1WWCA 1N64H 3K71A 2A74B 4OKDA 1G9HA 1TZGL 4N8VB 2XTJD 2BRQA 3AXHA 3MBWA 5J0BA 4JM4H 4WDIB 1CI5A 1RZJL 3K8LA 5DF0A 3E9TA 2B59B 3W11C 1K8DB 2OW7A 4AEFA 1CTOA 1KPUB 1VKXA 2Y2TA 3MXVH 5F1OB 4NQEA 4PBVC 3W5MA 4B41A 4AE1A 5I75C 1GTNA 3UZQA 4WQOA 4PRPA 4NWTH 2AK4A 2BJML 3MXWH 3IJEA 2J4WH 3E9UA 3HRZB 3LNEA 2CHZA 2BHZA 2FJUB 4Z76A 3OB0H 3FQRB 4XC1L 1NGYB 4K3JH 4L1LA 4TS6A 3GO1L 3LKNA 1HHHB 3DV4A 1Q0YL 2VQTA 2WZ6A 2Y24A 3GMPB 1J8SA 5KVGE 3WHE0 5I16A 1JMZA 2BNUA 5BV7H 1CYXA 3OZ9L 4M5YH 4TPRL 1NGZB 1U8JA 3VGAB 5E6SB 4YHYB 2JJSA 3TBSA 2ICEA 4X83A 5AVYB 3KWVA 1AP2A 3V6BR 4PTTA 4FFVC 2QSTA 2ZWNA 4MB1A 3B2VL 4F3FB 2FECI 3VWKD 2SODB 3FCBA 5EPMA 4JZJC 1K8IA 4WFGD 2GK0A 4GNKB 4UTBH 3U6XS 2E27H 2WD0A 4OTXH 3OL2A 4DZ8A 5ID1A 4LNRB 3BQUD 4PJFE 3O3BA 3GSRA 4AL8H 4L3ED 1MFMA 4XNXL 5FECB 4Y89A 1L9RA 2WY3B 4AL8L 4Q9RH 2HT4C 1EAPB 2A6JB 2O6EA 1QEWB 3U2IA 4PJHA 5D55A 1EERB 4LLWA 4PN6A 2E9WA 2DMHA 2FH6A 1QFPA 4QJ4B 4C4UA 3X3GL 2BVOB 2HFGH 1PCXA 4Z7NF 4IBUA 2FVNA 3EFFB 4A66A 4R2GB 4XHJC 3BCFA 4HKJB 4ZMWA 2APTA 3OAUH 1AD9A 4LT7A 1SEQL 4XVTH 2BC4B 5KVFE 1XB6A 5I1CH 1TMCB 4MBOA 4L0PB 2APFA 4M5YL 4TPRH 1ONQA 3WGUB 3LTVA 1G9MH 2CO2A 4J39A 4LVNC 3LKSB 2JLLA 4XXWA 1DYZA 2OULB 2WXPA 5IUCA 2WB7A 3QFJE 1P5VB 4ODBD 3QIBD 1SOXA 1OWRM 1QRKA 2O5NA 1WCBB 1INEL 1IKFL 2M2DA 3H7LA 1OAJA 1AR1B 1X5FA 5GGRY 2HP4A 3W3BA 1ED3A 4RSYA 3ARBB 2PWHA 2ED7A 2GTWA 3BPOB 5KSAC 3RGVA 5CIPA 2KC0A 1HL5A 3VB8A 3D2TA 3VWKC 1SN0A 2FWUA 1SUHA 3HZVA 2ATPB 3EGDB 3GRWA 2W0LA 4R0LA 3PP4L 3GSWB 3NK4A 2VQ4A 5EEZA 4KNSA 5KSAB 1J1OH 3NJIA 3FB5A 3JVGA 3L9RA 4ELMA 1KLFA 3V2AR 4N2FA 5JHDD 4PJHF 2XU9A 3RX7A 2C9UA 4OLWL 2OMWB 4BK5C 1A1MA 1CLYL 3VA6A 4GRLB 5CP3A 2KZ1B 3QZBA 4BH8B 3MACL 4LVEA 1KC5H 2XV2A 3Q01A 4AVJA 4O2CB 5IBLD 5JR1H 3H9SA 1L7IH 4ACPA 3FC8A 3N41F 4BH7B 2A9NL 3IGFA 4Y2DA 1ZHLA 3GNMH 1ZV5A 1DFBL 1KJVA 1AVAA 1CURA 5AAWC 4OBRA 4NO5A 1DQML 4QRPB 5GZNC 1MCIA 5CZKA 2WYZA 4IQHA 5T33H 3OLGA 1ACCA 2VMJA 2V4LA 1WZKA 3IDUA 4F2MB 1TVDA 5D2LE 4R3SA 1ZV2A 3LKQB 1J1XL 2V5SA 1Q9WB 4S1DC 2P24A 2CO7B 3NZHH 4TSCH 1PAZA 3QWRD 4RAUA 1BW8A 2E5EA 4X9GA 4BKLB 1G0YR 4JFEB 5TK2A 3FO9B 3TS8A 1U95A 2I32A 1QA9B 2QSCL 1I1AB 3NFPA 2PYFB 1PW3A 3PYCA 5FV1L 4NIKB 1DBAH 1OCWH 2WKLA 1R3HB 3QQ9C 1Q9LA 1Q9OA 3T6VA 4W9DC 4P9HL 4PRNA 2AJVH 4PY8J 4WGVB 3BPNB 3MBWB 4OZIB 3SDXE 3IDYB 2CO4A 2B4CH 2YRBA 1IT9L 4YHNB 3STLA 1WA2X 5PCYA 1MREH 1TQUA 3KYOB 3S88L 2J71A 2YAEA 1RJYA 1I1YA 4D3CL 1UD4A 1KIUB 3EFOA 4R96A 4LCYB 4HMEA 1QG3A 1QI4A 1DO6A 3QEUA 4KQ4H 4UILL 4Y4FA 5DJAA 4MXVE 4K55A 3L81A 4WTQA 5EU4B 1ZCRA 3K6IA 2J5LC 4MXWL 1YYLH 1A21A 1KFAH 5C0BD 3MOAL 1QTYT 4PJ9A 1COBA 4G6AD 4Z76B 3WLWD 1J8HA 1FIEA 3IMUA 4MA1C 3FQ4A 4XVUD 3U46B 1I8UA 4JRXD 3WMSA 3ZRSA 3HAEG 5LG1A 4ZFOA 3IPBA 3AU0A 2RACA 4C4KO 3RKDC 1FDLH 3NZUA 3L5HA 1TG8A 4QRSA 3GHEL 4RZCB 1YVLA 4QRTA 4YXHL 1HX0A 5CGMA 1QFWH 5A16B 4NRYB 5FYKD 3R18A 1CFTA 4P46C 4BKSC 3O0LA 4YDNA 2E7MA 2V7HA 3O3DA 3IT8D 2W9EL 3EO1A 1DSFH 1IEAA 2IFGA 3R7QA 2NYZA 4P2RB 5IM7A 3UACA 3TP4A 4BUHA 2EDOA 3L54A 4XVUC 4OIBA 2UY7A 5TPWH 1CLVA 4P2AA 3U6RB 2FGWL 4Z77A 1LGVA 1NJ9A 5F1IB 4Z7NB 5TDOA 3WD5L 3HA0A 4XP1L 4NBZB 5E4EB 3RJDA 1G7MB 4HKXB 4GLRH 4WW2A 1KJMB 4P57A 1NCCL 1R5IA 2QZQA 4UILH 4L4VD 2BY2A 2YS4A 2CK0H 4OU3A 2X3BA 3AQZA 3DVNA 3O41B 1HAWA 4K73A 4WNSA 2H3KA 3VJ6B 2ZUXA 4XOEA 3SDDA 1ZOXA 1PZSA 3LRHA 4PV9B 5KTEL 1BDYA 5H8DA 4EIZC 3C8KB 3HE7D 3S5LA 1MG3C 1I8IA 2X87A 3DGDA 3INUL 5A40E 3V0JA 1KCSL 3WNMA 4P9ML 5BRZB 2UZIH 4OY9A 4TOYL 4AQEB 1ONQB 4J3VA 4PMEA 3NACL 3EJQA 4JR9H 2ZJSH 4AQ1A 1J18A 3WCYA 3O6FB 3FQNA 4FQQB 4KDWA 2NXZB 1ZK9A 4FABH 4L9LA 5BVPH 3MA9H 2H8PB 1XEUA 5D7IF 1P0SE 3K8MA 4NQVA 4G8GB 1GYVA 5DS8A 5AZUA 2R0ZH 1YEFL 1T1YB 4W4OA 1KIQB 1QUNA 4JO3H 5EH1A 4NO2A 3VGAC 4DZBB 1TCMA 1JD7A 1FGNL 4KDVA 1UT9A 1ZHNB 1ED3B 1YPZB 4YC2B 2WWKO 2VDNH 4KPHH 5JDSA 4Q89A 1WBYA 1B6UA 4RMQA 2X40A 2XWRA 1OSYA 2FEEI 1SNRA 4NS0A 3BZFB 1TTAA 5AUMA 3VWKA 1WBZB 3M07A 2WXGA 5DFVD 4YFEA 4Z7UA 4JRYD 1UJ3B 4LEOA 5EA0L 1Z2KA 5CLWA 4H40A 1G6RA 4EQ2A 5LB1A 4E9TA 5IKCB 5D2LF 4U1IB 4W70A 4CU8A 4HOZA 3P54A 1MW0A 3E2HC 2XZZA 3QDJD 3TGXA 2ZSVA 3DUSB 3BUYA 4GSUA 4XN2A 1QLEH 1PY9A 2E76C 2ZYHA 3KL0A 2FX7H 4XMLH 4D0DA 3O6FD 2OL3H 4OLWH 1K5WA 2VDLB 3KJ6H 3QZWA 4GBXC 4R4ND 3V0GA 2DJ4A 3QWRA 3VFUB 2XKNA 2BCMA 4AC4A 3MV7A 3PGCA 1JWUA 5I9QC 4DUVA 3AXLB 3T4AC 2E6JA 5JDJA 4M56A 5K5YA 2OYPA 3NCWA 3ARFA 3FF7A 3TH3T 2BVYA 2F58H 3HZ3A 4PBXA 1CYGA 3D6GA 3MLUH 3D18A 3IVKA 3BP5A 2VLKA 5FKPA 1YYCA 5H37A 3LJ3A 1L9NA 4B5EA 3HRPA 1BZOA 1FAIL 2IOMA 4MMXA 5BZDB 1MWOA 1FFPA 1JXKA 1FFTB 4YHIA 5JO5A 1TITA 3K1KC 4S11A 2WHVA 4PJ7B 1DJHA 4JEGB 4FFTA 1J0JA 4ZT1A 5JUEH 2CK0L 2XCMC 1WP6A 2HRPL 4UIMB 1S4IA 1Q1PA 4IGBB 1KELL 5D4JA 4DOHB 5HDQL 3VGHA 1BYNA 2OP4H 4NQCA 1QR1B 4Y0GA 1AO7A 3WIHA 1ZWIA 4U6YA 4E41A 3FQWB 3JTTB 1FHGA 1TQBB 4OCYL 5D96C 1AMYA 1LEKA 4QO1B 4DPRA 3APFA 5C3TA 1ET7A 2RQ8A 3FK3A 3WTYA 3TEZA 1E8ZA 4NHUA 3P30L 2HRPH 2X0WA 2J88L 2VXSH 1U3YA 4YSRA 5GS2D 5E0QA 4FXKC 1YY8A 2H1PH 4B9CA 2O5YL 3WAKA 3HLAA 5I8EA 3DMMA 2P5PA 4H2CA 3D0VB 3MNWB 1FNFA 3O6LH 4KTDL 3UAJA 3U9WA 3WUZA 3ZHDA 1NINA 4MXQD 4Z5RA 1GC1C 2NTFB 1AHWB 2QDWA 3MV7D 1CG9B 2OTUB 2FIKA 2NY2B 1BWWA 1S7QB 4YZFF 2D31A 3LN4A 4UTBL 3DO3A 1ILSA 4CMHB 4BSVA 4L0YA 2G3ZA 4XO3A 2VISA 2IIJA 2OTPA 4PVNA 5B38B 2EXYC 1YYLL 1WS7A 1XTMA 4G8EB 5BO1L 2D7MA 5ALCL 5C09B 3B9EA 2XXCB 1UWEH 3AQDA 4P5TA 3P9MB 4M1GL 4XCFL 5IROA 1S7TA 3PPSA 2XPGB 1RFDL 2WGXA 2XVLA 4GW1A 5HYQA 1PZCA 1E40A 1XT5A 1LO0H 2ENQA 1I9JL 1UM4L 1OOAA 2D03H 3MJ7B 4JO1H 1EGJA 1JZFA 2K3HA 4JE4B 3TU6A 4MA7H 5F1KC 4F7TA 1S9VB 5B1BB 1T22A 1SEBB 4P3DB 4GRMB 5D7EA 1NEPA 2QQNL 4M93C 3U6RA 2HLAB 2ZUVA 1FORL 4M48H 3IMVA 5TDOB 3TBTB 2BVTA 4HX1B 1OKEA 4PS4L 1C5DA 3BMWA 4FAAB 2FWOB 2HFFA 4EBQL 1NCTA 4WW2B 3NN8A 3C5SA 1N0LA 2VDNL 4KPHL 2X12A 1BYPA 5H94B 3HE6B 3MYJA 2OFQA 5KAQG 4NQXA 2VZ3A 5MP6L 1AI1H 2FH8A 2K7PA 2GJ6B 3G5XB 1NAMB 1BSIA 1MNUL 1PMYA 2V5MA 2NXYB 3MRFB 1ZLDA 1F1AA 2NY7H 32C2A 1I8IB 2VKWA 4RH4A 5EBWA 2E9BA 3TN0A 2WNXA 3VXSA 3EO9L 1E8YA 3H55A 4BWWA 2XN9A 2WMPA 1S5HB 4MA1B 5F97E 5ABZA 4IJ3B 1X5HA 4K94C 3WO4C 3CX2A 4Y2OB 4DIXA 2JVUA 3KPPA 5KS9F 4J27A 4QXGL 5BXFB 1GYWA 3REWA 5C0FB 3D7PA 5BOPA 1YEEH 4LO9A 3EJCA 3RB5A 3EJRA 3FUNA 7FABH 3FN0H 3UMNA 4YDKH 4GG8A 1BXAA 3OJDB 2MOGA 3D2UB 4FHJA 4OZIA 2EQDA 4QGTA 4DCQB 1D5BB 1UT2A 3U36A 3NPSC 3PGDA 1NMAL 2WLMA 3E8UH 1VDGA 1T7VA 1MAJA 1RJYB 5T3ZE 3B8YA 2W65A 3KPLA 3NDZE 4O02L 3QQ9D 4ABWA 2NX5B 5SWSA 1FZJB 3AS2A 4L1SA 3V5KB 2DBLH 2LOEA 3RVUC 1G6RB 1PPIA 4ZTPL 3TVMB 4ZUSA 5D1XC 3CHQA 3NPSB 4A6YB 4E2OA 3DX1A 3DUSA 1TTRA 1CXKA 3QE5A 3FRPG 5FUZH 1B9ZA 1PIGA 4W9FC 5FK9B 5MEND 4XNUH 2DMGA 1UD5A 4PJIF 3T65B 3BAJA 4RDQG 3RKDD 5AQ0A 3PCYA 1HE7A 1BM3H 1E5AA 1JWUB 5LNEA 3GB7B 4Q9QL 4TVPE 1N9PA 1W9XA 2KPNA 1IKNC 2FJFB 5E00A 5D2NA 1JSYA 3JT0A 4FNPA 2CO3A 1CK0L 2RFXB 2X6BA 4KX8A 1MCKA 4EI5A 3CN2A 2GT9A 2QELA 5I1EL 2F53B 1SM3L 2EYSB 4AH2B 1DN0B 4DPCX 2QT6A 4XN8A 1V7ML 1OAYH 3KD4A 4MA8H 3VFTB 1NAKL 3H54A 4JQIH 2AV7A 4PY7B 2XJKA 3FRPA 4MAUL 5HGGS 4Y5YA 3D34A 1L7TL 1ZHBA 3GBDA 3MRLB 3ATDA 3O8XC 3PQYA 4N8CH 1BFOA 4QWWD 1CT8B 2QGCA 4GAJH 3T8VA 1IFGA 4Q9RL 1EFXB 4AYID 3TC9A 1QFOA 5K9QI 1G7QB 1G9NL 2ZKMX 4YL9A 4LAQH 1PNDA 3BFOA 5IK3A 5AEAA 5CFAA 5IMMA 3E6HA 4PREB 4F8LA 4N3UA 4F8TA 1GJIA 3RTQD 1U58A 1MZZA 3CDZA 1U8OB 2H6PA 4LSPL 2CKBB 2R39A 2P1YA 3IDIA 5LCVL 1YN7A 4PS4H 3GLAA 5HHOA 5D1QC 2GJZB 3UJJL 2BP5M 5H4ZA 5GJSL 3QIBB 2JSFA 2HKHL 1NBQA 4J3UA 2OJEA 5IVNA 2D7TL 4AQEA 3MV11 3LX9A 3SGKA 3FPYA 3SCMA 5FA3A 1XCQA 4QXTB 5C07D 4JFPA 3BKCL 3FQNB 4FQQA 3L9YA 2ZWKA 4DVBB 3WNJA 5FV2A 3DLQR 2V33A 5KOVC 1EEQA 2BFVH 2XWEA 3SDAD 1MRFH 3W38A 2GSMB 1CGUA 4G6ML 2XSKA 4IIZA 4O4YH 4RISL 3MI6A 3FAWA 3T2NH 3MRNB 3LQZB 5TGBB 3F65A 1P7QD 2PYEA 4NQCE 4DETA 3LS5L 2WLNA 1SDDB 2VDPB 2G3NA 4LCVA 3BXNB 5DK0B 4QOKE 3ASOB 4DESA 2J6EL 3WUWB 4PJHE 3VFRB 2XTJB 4KRPD 3O11B 2KKQA 4M7KL 4MKTA 1GZQB 4UMSA 4CKVX 4X9FA 4XRCB 1I7RB 4G6FD 5D1QA 2QPUA 5DWUH 5K39A 2TSBA 4C56A 3GIZL 1ZGLA 1N3NB 5GIRA 4CBZA 1NPJA 2BP0B 5HHXL 2Y23A 3H9SD 3LB6C 4YN3A 4LLAA 3WL9B 3ZSSA 5KANI 1TTUA 5JQ6L 2XVGA 1RU9L 3T0EA 3TV3L 2D7QA 4QMEA 4V2CB 3KPOA 2QVTA 3K4DA 5IVZA 4F93B 4KK5D 1SLUA 2CBPA 4LQ1A 1U8LA 2X70B 4NZ8A 4Y19A 2ZAIA 4GRWH 4DKAA 2BOBA 4IU3B 3BCDA 2AAVA 1BQRA 4LSQH 4P3CH 3AXIA 1Q0XH 4JPWL 1SM3H 3ULUD 3HIZA 2DMCA 2WWMC 5D7LA 2O5ZH 3MFFB 3WEAA 5KS9B 5FCUL 1QPKA 4GBXD 3D18B 4R4NC 1E67A 5HHOE 3FFDA 1NCNA 1R24A 4ZQKA 1OP5H 3TPUA 4I8DA 5JHMA 4CJ1A 1K2DB 3FTSA 1TETH 3M17B 1O6VA 5T1LB 2I24N 3PUUA 2JIXB 2NZ9C 2A2QT 3CZKA 1A7RH 1YEKH 1C8QA 3FUFA 4AJ0A 4YX2H 1JZ6A 1I1FA 4IGBA 4FQ1L 1VESA 3DI2B 4L5FH 4ATTA 2QSCH 3QNZB 1PSKL 3PIQA 2VRQA 5F89B 4QRRA 4OBSA 5F6HJ 4V1DD 1S9WB 4UTCA 5KBKA 3ZQXA 5I19L 4P2OB 5JW3H 3MGTA 5GGUB 5IJVB 3LEYL 2WUBL 3EO0A 4GSQA 3FUMA 1L6XA 4LKXA 5CZRA 1G7JA 3D2UA 3D85B 1TXKA 2PXYC 3MYZA 3VNZA 2MTAA 1XGYL 3QWOB 3SODB 1TVHB 1LM8V 2EC8A 3X17A 4DCQA 3NSXA 4K5PA 3S97C 3V79C 5CKGA 1M2VA 1AXSB 3NJHA 2BVUA 3FN0L 4KKZA 2H26B 5LAPA 2NX5A 4PJIB 1JHLH 3BZ4A 4TNEA 5MEQA 1BAGA 4WENB 2NTFA 1VCAA 2O6PA 2PCFB 4I89A 1TEFA 1AS6A 2J56A 3OHXB 3JWDC 4OT1H 1R75A 3LV3A 3A21A 4MZ3A 2R0WL 2DWTA 2BRRH 4MCZB 4A1RA 1GIGL 4RWYH 1ZT4A 5D4QA 4JY4A 2MIZA 1H5BA 5DZNA 5KVDH 3VI3A 4G9FE 1U8MB 3X11B 2YWYA 1ZIBA 4FXLA 2Q3XA 2AV1A 5C6TH 2CHDA 3GSVA 1YMMB 2IAND 4NBYB 5E6YA 4YSSA 4PWGA 2H45A 1AJ7L 3GDCA 2WXJA 1NDGB 1U92A 4BBWA 2VDKL 5IQMA 2VLJB 3RU8L 1RJZB 3ZHNA 4OGYL 4YR6B 1Y18A 4O2FB 4FG0A 2UZIL 1SY6H 4X6FB 2JI3A 1A2YB 1A3RL 4WK4B 4P4KB 5C8JA 3DPBB 5EU5A 3IB4A 1RZKC 3AS0A 1KLGA 1I9EA 3D2UD 4UWQB 2ZPKL 2FHCA 3QHFH 3GLDA 3C5JB 1MUJA 2JMRA 3SPHA 3MRGA 5D72H 1EBAA 1UJ3C 3VI4A 3HG1D 3FSAA 5IK3B 3VM5A 2AZUA 4EI6B 3DSFL 2X9XA 3IRZA 1A0QL 5GSRB 3C5ZA 3V5DA 1RURH 4I4WA 2NUTB 2XZCL 3I2CL 2DJSA 4NCC1 4KHTL 1NAMA 3DROB 2CXKA 4F20A 1U91A 2HVKB 3H9HA 2CJSA 4DO6A 2NR6D 1DVFA 4YNYA 1YNLH 4X4KA 3BFQG 3POCA 1JNHB 2F54D 3FO0H 4JFFD 4HIEA 4OCWH 1RUAH 3M46A 4DGYH 3O9WB 3SKMA 4PRPD 1U8PA 3WEMA 3OBAA 4CSTA 1EGJH 3TN0C 1HJBC 2APXA 2AEOA 1G7LB 4KROD 4RMWA 4OCSH 4WHTA 4CA4A 2R1YB 1KPRA 2XN1A 2A6IB 4K23H 2G5UA 5I30L 2KPWA 3CFTA 3J2PA 5DQ9B 2B9BA 2C5DC 3CMOL 4FOMA 1AHWC 5FYKE 4I2XA 4NOFA 4AXWA 1DR9A 3H56A 3O0RL 4FQJL 2ICEB 3F6JA 1CVRA 1KXQA 3AG3B 5E9DE 4AIZB 4FQCH 3L1GA 2ZWSA 4MA3A 1YDPB 4XNYL 2DRUA 3L3GB 4C59B 3OKLA 2HMID 2C9QA 2OXGB 2FJSA 2ED6A 2CIIB 5CEXA 1HQRB 3C60D 1ND0A 3CVDA 4ZRGA 3C6LB 1ORSA 3W1ZA 1YEJL 3D87B 3IJ8A 4I0PA 3BP7A 1A6AB 4EN3B 4Q9BA 2CD0A 1OD9A 4L4JA 5TF1H 3QC5X 2VDLH 4LLWB 2WLLA 3ME0A 4KHTH 1IT9H 4JFFB 3DETD 3DDGA 3WL9A 1T21B 3BVNA 4GRWF 5BRPA 4PJAF 4XVJL 3MUUA 5DD3L 2FBRA 2G0KA 2YO3A 4LQFL 5D2LB 2ZX8A 2X70A 1A3LL 1U8LB 1JGLH 2XVBA 4F7CA 2CK2A 2VL5B 3W0WE 3CV5A 5KWYC 1FBIH 4P2OC 3TNMB 2HJKB 3QJTB 1OAKL 3HR6A 3VRIA 5EF3A 1KB5B 5EC2A 4XNZC 1DQLL 3MFFA 1RHFA 1ZA3B 3OKNA 4UNTA 1S78C 4GT7A 1U8IA 4NCDA 3PHSA 2YLKA 2BFGA 4HXBL 1I9RL 1XZWA 1F18A 2WSPA 4MMYA 1A7OL 4EIUA 3OKOA 3HG1B 3HNTH 2AEQL 5KAQF 3C87A 1LNUA 4OZGA 1UQSA 3FFCA 2O30A 4XH2B 4F9LC 3V4UL 2D7NA 3OHXC 3UL4A 1SZNA 2B0SH 2VUYA 4P5MB 3RZCD 1OPGL 2EIEA 4L29A 2P5EA 3QIUA 3JYBA 3EZ8A 3NABH 2Y5TA 3CSBA 2WZAA 3JSSA 1EJFA 2Y4SA 1FVEA 3ZQ9A 1NM4A 4XTRC 4QXGH 4APXB 4KRLB 1PTZA 1PZ5B 2CLZB 1CGVA 4AGNA 1OV8A 1HYSD 2EIBA 1X5AA 3QUZC 1SXNA 2WXIA 3GXUB 3L9EA 1MFCH 4S2SB 5GGQL 2OMWA 4EO5A 4NO3B 1ZLVH 5AAMA 4N28A 3F84A 3DBXB 3TTSA 4JDTL 5ACZA 2OJEB 2OK0L 3ARGD 2IOIA 4NAQA 4U31A 4O2CA 4YZFE 5CWSA 5SX5K 3U7YH 1JGUH 2YD7A 2ZOTA 3GJFH 3UPCA 5DR5L 1Z5LA 4P46B 5E5UB 1JF6A 2IANA 2EKJA 4XVSH 3VGGA 1HI6A 1M7IB 3H2PA 3HB3C 1FN4B 4PRID 4QWWC 1JK8B 3SQRA 3WG7B 1NGPL 3NCJH 3SYCA 2Z8VC 2QR0B 5AAMC 4WGKA 2NW3B 5DJ0B 1KYOJ 4LVOC 5D1QE 4FERA 2HUHA 2ED8A 3IFLL 5E51A 4J2XA 1HSBB 5LN8A 2P4AB 2F68X 1ZLVK 5AOIA 3UAAA 2OJZL 3B7SA 3X2QB 1AC0A 1GHFL 1JERA 5LWYL 2FBJH 1GMEA 1J8KA 1U3NA 5FO7A 1A6TB 3S35X 3RZCA 1UHVA 1T83A 1CR9H 2E8ZA 3LHPL 4X8JA 1AKJB 1REIA 1TQTA 2PR4H 1VJSA 1A6VH 4DQOH 5HPMB 2D03L 3FT4A 1I7RA 1I1AA 4XCEA 2BW5A 4K0OA 4A2LA 1QFUL 2X28A 4H5SB 1LILA 2ZCKL 3WE6B 2YUWA 4BHUA 3T09A 3H9YA 3VXME 5AVWB 4IMLA 1MH5A 4Y1TA 4DO4A 3PDOA 1ZAGA 4YHZH 4ZO9A 3WIIL 2A1WH 3L3JB 5I0DA 2KZWA 5C0NC 3KEDA 2FO8A 4R6UA 3IGAB 4I5BA 4DERA 4HG4J 3WNNA 2HMIC 1GKEA 5GSRA 1K4CA 4LCYA 1QNIA 3E6FB 5IR1B 1TO4A 2M1KA 2MNUA 3I85A 4O02B 4PRIA 3FHQA 3IWVA 1IGCH 1JF1A 2DY2A 2WXOA 2NNXA 4HV8A 2YJQA 2DQEH 3GRBA 1FH2A 1B4JL 3VMOA 2CH8A 3D50A 3CFUA 2AAAA 2J73A 4KK6C 4NNYB 4XNAA 3GINA 2A5UA 2WZPD 3MLRH 4G83A 3K81A 3GSXA 4AW4A 2J1XA 1WFNA 4L8BB 1S3KH 4ETYA 2ZWYA 1DQQA 3P4OA 2DQMA 4KRPB 3C08L 4NZRL 3RIAF 3D9AH 3D06A 4N0RA 3MUY1 2V3FA 1EA9C 3QA3A 3BEVB 2X41A 2B5IB 5GGSA 3DI3B 4U4IA 1S5IH 1T5WA 2CDEA 2ZNXA 3JBG7 5MENE 5FGRA 2JKTM 2WCPA 3DXAD 3PWUB 2R29L 3Q5TA 1TPXC 3KDPB 4Z7QB 4BFRA 1X7TA 1KGXA 1EUUA 2VJ8A 4LB8A 5JMRA 2G2RA 4O00A 4OW6A 4D9RE 3QQ3B 3TBVA 2E9IA 2Z7ZA 1BD2E 1TFPA 3GS7A 3SDAB 5IEKA 4U6HB 3RVWC 2IMNA 3VXSD 1KBGH 5KBPA 1JYNA 2QHRL 1NM9A 1MXGA 15C8L 1OM9A 4APQD 4JG5A 4PGJA 3K3QA 4P2RD 3WIFB 4Y5VB 5MENB 1JDAA 3D39E 4DKEL 4XBEL 2FD6H 3RVXC 5JXED 3D0LB 1CCZA 4UV7H 2HJFB 3ARBC 1RXLA 1DBAL 3D48R 6TAAA 4TTDD 3NCYS 2OZ4L 5DS2A 1C5BL 1UM5L 1MFDH 4NDMA 3E80A 3FCUB 3QEQD 1E9OA 5IHBA 5JORB 3O8XA 5I6XC 3ABZA 5JTWA 3QNXA 1F3JB 4A68A 1VFMA 4O2EA 1RQ5A 1LEIA 2EYRA 2XY1A 4FJ6A 3IETB 5I6MA 2FSEB 4UF7C 3BWAB 1JHTA 5JIMA 5T3XD 5KYYB 4OQ1A 1FUNA 1XMWA 4RMSA 2ZAHA 1QLFA 3IXAA 4RGOL 1I7TB 3UYPA 1GYCA 4HIPA 4XPTL 3VFPA 4OF0A 5EO0A 4X7CC 2C3XA 2GEQA 5BO1H 4PGEB 5DDHA 4C4BA 3WKNA 1T1YA 1XCTB 1Y07A 4Y9FA 5D71H 3SOTA 5FA4A 4JFEE 3PLYA 3Q1EA 1CDBA 1OOWA 3VQMA 4U1MA 2GIMA 4XNYH 2I9LA 2JLPA 3GMRA 1UCBH 1FV1B 4D9RD 1WBYB 4AGQA 3FUIA 3ASWA 2X9ZA 1FL6A 3DV6B 4QTHB 4B6ZA 2P5WA 3K2MC 5BQ7A 4G9FB 2PLTA 3KLAB 3G7TA 3KXFB 3QIWD 4PH8A 1TZHA 2AJ3B 4I0CC 2KZKA 4HJUA 1JYVA 5CBEB 4PI2A 2EUVA 1NAKH 1CQKA 5GZND 3MLVL 3STZA 4ZTPH 2WBXA 2D3NA 5KG9B 3MN8A 2R2EA 5DRWB 3EXJA 3S7GA 2C9PA 3H53A 4YAQB 3WUWG 1JZDC 3TBYB 3RHWK 1KGCE 5IFAL 1AGDA 1FN4A 3D33A 4OQTH 1Y6NR 4Y88A 2ZUTA 3DMMC 3RDJA 4OIFA 1BVKB 1S7XB 3GBEA 3H9SE 4GKNB 4KKBD 4XMVA 4I3SL 6FABH 3N42B 3RURA 3ZYOA 1ETB1 2AKRB 3S35H 4PW3A 4AIZA 1YNKL 4YUEH 5IFJB 5DSCA 2UXFA 1NUFA 2FDBP 3FOLB 5HYSB 1XGTA 5C97A 5I0WA 3BP5B 1AQ8A 3II1A 5HD8D 4XP1H 5KSVB 1DL7L 4RDBA 5KEZA 4FS0A 4HCRL 3C08H 4NZRH 2DBLL 2WBJA 4OUUB 3RJQB 1FFPB 3L3KA 4QOKD 2X5PA 3UJTH 5DUPL 2VXQA 4P5TC 4LCWA 3S4SB 2ZKHH 4AYFB 4XB7A 3FQYA 2G4GA 3L1FA 1FVCB 4HOWA 2XUWA 3T77B 3QDMA 4DGVH 2ZCZA 1EHAA 2EJ1A 2F7PA 3OMNB 3DUHA 1M3JA 3JWOH 4YEFA 3N9GH 1HHKA 2MJWA 5C0DA 1WD9A 4FNUA 4GXVL 2X6MA 1BMWA 5FF6B 4FQCL 1JDDA 5L2JB 1JPEA 2IAMC 2QV2A 2XV6B 3L3IB 5DHYB 1RY7B 1JRHI 5FYJH 5GRVK 4HCFA 3K0YA 3HZYA 3LQAC 3SY0B 4NRZA 4V2BA 3FO1B 1CC3A 4HWBA 4C83A 3T0DA 1SVCP 1J5IA 4H8HA 5H2BA 4KK8D 2IEPA 1UCTA 3FHEA 5IVOA 5AW8B 1ETA1 3ZZSA 1S9XA 5TDNA 4UDTB 2DMKA 3MV8A 2ZSWB 1AQMA 3MX0A 3P2TA 4F8PA 5CHNB 2YEZB 1OIOA 3CPLA 2R8SH 2ZKXA 5HGDA 3X14A 4KXBA 1MI5A 1FYHB 1KCVH 3QUYC 4FTVD 4KX7A 4X98B 3QEGH 3DETC 4ZPTB 4XMTA 2KDYA 5AVQB 4YBQC 3TFKC 4A7GA 2N3JA 4LDCA 3V95A 4M1GH 1HHGB 1NFIA 4XCFH 1QSZA 4UQ3B 2GPZA 4R2GD 3NFSL 4IBWA 1ZKAA 3GMNB 4P9HH 2VN6A 3O2WH 4RIRA 1YAIA 1MWAA 1UA3A 2HJLA 3L9BA 3ZE0F 2J8HA 2IWGA 2YD1A 4LGPB 2IPKA 3QHZH 4HJ1A 2R29A 3MLSH 3PWUA 1S9YB 4OZFH 1Z3GH 2KL6A 1ZEAH 4L4TD 4JMXA 3ZTDC 4X4ZA 1HCVA 3QRBA 5CEZH 1RSYA 1P9MC 3HJ0A 4ZJ9A 3QQ3A 4H26A 2IH8A 4ZS7H 5CILH 1DJIA 2YKLL 2A6DA 4P23A 3WJMB 4NO3A 5MEPA 3QP3A 5E2WH 1RZJH 2DQFA 3DXAB 5INCB 3SOBH 3WEXB 3GIVA 2HLFD 1DP0A 4HX1A 4XWGH 4L2LA 4NFCA 1P1VA 1MRCH 4WEMB 5DGRA 5FCUH 4JFSA 4B9IA 3O45B 3L3OA 1OW0C 1RZ7H 4PW4A 4WKXA 4WWID 4LLDB 3THMH 3I6KA 1E42A 2W94A 4B27A 3PUCA 1Q38A 3GZPA 3NJGA 1Q0XL 4PRHE 5LBSH 5HPOA 5DFVC 5TH2A 4CMMA 4ODVL 3R06A 3KLSA 4S1SH 2GY7B 3DOSA 4Z8FL 1VIWA 1HILB 4DGUA 1T7XA 1UOVA 2JELL 1CLOH 2AK4E 2YZ8A 1N70A 1UWXH 1UOWA 1KELH 4KJYB 5HHXH 2FR4B 3WKYA 1YECL 1DVSA 1NQBA 3RUGB 1HH6A 2XWBB 3MLRL 3MJWA 4POYA 5JOFB 2R4RL 4NQEE 3Q43A 1TFHA 1I1CA 1FL5B 4OI7A 1KULA 3ZIMA 4QHKJ 4YXLH 5J1TC 2ZP9A 3MCLL 2RHEA 5GZOC 4JUTA 2VH5L 2VLMD 1JNLL 3PP3K 3QUXD 2C3GA 4GP8B 4KJQD 4XC3H 3P0YH 3ARWA 4M8RA 4UM9A 4JANB 3GPSA 1UFUA 2XY2A 4JFQB 4W6YB 3PWLB 2Y1ZA 3G5YA 3HHSB 2A0LD 4UT9L 5D1ZB 3SJVE 2VDRH 1TT6A 4HUKB 2QGDA 1U8QB 4O4YL 4BK4A 3D25A 3QUGA 1LVEA 1UGKA 1O6SA 1CFQB 5F7EL 4W4OC 3RX5A 5IVXA 2OMYA 3KLLA 4G9FA 1RUKL 3UC0H 1E5CA 2I25N 2DIAA 4FXGB 3EH2A 3VFMA 3TNNB 2CR3A 2YMTA 2ED9A 4PJXB 2C7FA 2ZKWA 4K3GA 4WHCA 5AL0A 5E0FA 3T3MF 5IB2A 3MFGB 1KCLA 5CU9A 2DKSA 1JBJA 3BIKB 1JPSL 1JK9A 1Y0LB 5DVLA 3TN0D 2V5TA 3QPQD 4EMZA 4TVPD 3D07A 5MI0B 5DRNB 1N5YL 5BZXA 5JXEA 3TBYA 1I7UB 3GBNL 4W9ZA 2JXMA 4W9CC 4ODXB 1KGYE 5FK9A 4KXAA 1X6NA 1TTCA 2NQ3A 1WC7A 1EEZA 2UZPA 3ETBF 4I13B 3IRPX 1SMOA 1JWMB 1EPFA 1P4BH 2D2CC 4NHCL 5DYOB 4BSWA 3OKMB 3VXPB 4YPGB 4MWFB 2V2TA 1EHXA 5D2NB 1NGPH 3NCJL 4FG6C 4OFYA 1BHGA 2QGEA 2XZAL 5ITBH 3TXAA 4PCYA 3DIFA 4IRJC 4XPBL 3ZUCA 2ATKA 5EO9A 4KMQA 3SJVB 3VD5A 1MNNA 1CBVH 5EBLA 1WWAX 4NYLA 2AV7B 4PY7A 4YSQA 3AABA 3PE9A 9PCYA 2ODIA 12E8L 4MZRA 2QKIB 3WIFA 1Q90A 4E9WA 2YD5A 1KXVC 1CFNA 3FO0L 1N2RA 1EAJA 2AXHA 2H5UA 3U0WH 4KVCH 3ZGHA 1U58B 3CDZB 3JWNC 4KI5F 1OB1B 3SB3A 3F7YB 4NDMB 3ZMRA 4PJAA 2VRAA 1X5JA 2EIMB 4D8PB 3ECQA 1YC7A 2DWEA 3D12B 1ZHKB 4DEUA 4YDVB 1EHNA 4BEIA 4GRWB 4MTMA 4WUKH 4HJJH 2W07B 2WUCH 4QYAA 3WD5H 5HHVH 1VGKA 1AGFA 5DMYA 5EZPA 5DO2D 3CN4A 3HE7B 2ZCLH 1VGEL 3RY6A 3FU0A 1L5GB 4H44C 1AD0A 4O02H 2BC4A 5B3NA 3EOBB 4MX7B 4NO0D 1EEYA 1DVZA 2AGJH 2Z31B 4KI5D 3BC9A 3D39A 3QG6A 2E3VA 5DVOA 1IAOA 2IDSA 5HDLA 1DVXA 1ZLWK 5I0YA 3ZTNL 3SCMD 1HYRC 3OXRA 3FH5A 3MNMA 1XCTA 2ZT9C 4KTDH 2DQEL 4B7LA 3LPOA 3OAZH 2Z4QB 3UAJC 4K2UL 2VE6B 3QDJA 3OKYA 2HT2D 3RDTD 5AW6B 1AIFB 3CVBA 2DWDB 3KL5A 1G87A 3EW3B 3RGVB 1G94A 1VZHA 4K3HA 3HMWL 4FMKA 2DQJH 2KQNA 2BO0A 3MV9A 2Y5EA 1O9ZA 4BDVB 3U2SB 3H4FA 3ULVL 4DH2A 1GSMA 1H8NA 2PTTA 4RSVA 3E0GA 2Z8WC 3GI9H 3RL2B 5DQDH 2YPVL 5JNYB 3RKPA 3NEEA 5JPNB 1KLUB 1TTFA 2P42B 3KNBB 5KSAA 1A7PH 4ODSH 1R3KB 4O51A 5CBEA 4MXWH 1KYFA 3SGEH 5DI8B 5D1QB 5FHBH 3N91A 3ZE1F 2WLHA 1UZ6F 2HPTA 5C0BB 1INQB 5ANMB 4BH8A 1OLLA 1M42A 4ZUWA 4JRYA 5E6IA 2F1AA 4DQOL 3GLEA 1Z9OA 4HAGA 4DP2X 5B39G 1RIHH 4F7KA 5GQBA 3TPKA 4TUUA 3EBAA 4PRIE 5EN2A 3RWHB 3KCWA 4AE0A 5DVMA 5F71A 1RK0A 1WZ1L 4LCCA 5E94B 3VGBA 3ZOAA 4HUXA 5ESAB 1KZQA 3LS5H 5B7EA 3UZEC 3ZT7A 4NLHA 1LLAA 3GJFB 3ROOB 1FVDB 3X3FH 5IY5B 5GGRB 1MLBB 2EH7H 3HPLA 7PCYA 1UUNA 3TBCA 1EO7A 4MGXA 2GABA 3HBPA 1S7VB 5BRQA 2V7NB 3NIGE 2FR4A 1K4DB 1RZQA 1CO1A 1BJMA 3TWCL 1JN6A 2C9VA 4YHLL 1SBSH 4U0RC 5J89A 3S3SA 2Q6WA 1TJIH 3BT0A 1MFAH 4HLEA 1TETL 3JWDH 5E1AA 3QCVL 1QFWM 5KVEL 1ZJBA 4MRBA 1XD1A 4N0YL 4NC1C 5EF2A 3Q8AA 1A3QA 1YA5A 1QHPA 4EN3D 3N06B 4JK0D 3G04A 4J8RB 2HKHH 1OAUH 3D08A 1FFNB 4JFQA 5JXAL 2GC7C 4MHHI 4CRPA 2VSCA 4H1LH 1A4CA 2B4CC 4LLQB 2EECA 1P5UB 3IJHB 1V3MA 5DT1L 5EOTB 2VERA 2NLJA 4JPWH 3U9PH 4F9PC 2K70A 5E8OB 3K0WA 5FM5M 2AF2A 5DCCA 4XPBH 4WWKD 3PU7A 4PRNB 2YARA 1QSFA 3GBMH 4IRJB 2BSSB 1P5UC 1TLKA 3WTUA 1BF2A 2Y3AA 4OLXL 4YHOH 1CBJA 4PJ8B 3KYOA 1T4KB 5GRUH 2PUQT 1PKQE 5DQJA 3EFOB 2IBBA 3GIZH 2XHNA 1TQWA 4LLUA 4PJBB 3WTTA 2DQ6A 4PJ9B 1E6JL 4G9FD 2X4RA 5DUPH 4MCZA 3GBML 3I9IA 1KV7A 3X11A 1B0GA 4R4FH 4RIRB 4LU5H 3MR9B 3RNQB 1G7HA 2OP4L 4XOAA 5I2IB 2VAJA 2AMUA 1NCGA 1V10A 4PLKC 3ABLB 1U92B 3MJ9H 4QRSB 4TLSA 2DIEA 2Q9OA 5CMAB 2EDXA 3FCSB 1MCOL 1EJOL 4AQ8A 2ICES 2X1WL 4C47A 1F5WA 1NWOA 3V4UH 1HESA 5DEGB 4HMDA 2EXWC 4J6RL 1QSEB 4AMWA 5ETUB 1P4UA 4OF6A 4XZUB 1FFQA 4Y4KD 5INCA 2ESVD 2AXGB 2IF7A 3KDMA 4RFNC 3ARBD 1G7IA 4HFWA 4KO5A 3W9EA 3CZFB 1XGUA 4JKLA 3VCLA 4WO0A 5FB8A 2J57A 4FZ8H 3FRUB 1PSKH 3TH2T 4FLHA 2F19H 4OCLC 5DC9B 3OGCB 1OB1A 1YUHB 2XNAB 2BNRA 2EYTA 1NLBL 3A47A 5A2AA 5C0IA 1IFHL 2BCKA 4NKDA 4FYTA 1Z9LA 5C08B 4O5LL 5EZOL 3BLBA 4YSUA 4ANUA 2UYLB 3DURA 4QRUA 2AJUL 3OLIA 4ZUTA 4R26L 3DX4A 5AVVB 2UZXB 4V33A 1MCBA 4PP2A 1I3VA 2HG5A 2HH0H 4LE8A 2FX9L 5JHLA 4A67A 4G6AC 2IFFL 3QEHB 5I73C 4WHTB 1Q94A 4ORZC 3VD2A 2F18A 4KVPA 4XPFL 4Y2DD 1V8HA 2FJHB 1J5HA 1XVSA 5ERWA 3LZRA 4OZ4A 5A2BA 5J9PA 1UZ6E 4X2UA 2A9MH 4FQHB 3F7KA 2CBOA 3FBKA 4LF3A 3K6SB 4KJWC 3S96A 1PLGL 1KIQA 1D7BA 4GIOA 4URTB 1HNYA 3WFCH 3MLWH 4PAZA 4L3FA 2EDYA 1RURL 3IJ7A 5AALA 1MW1A 1A4KB 4XNXH 1IIKA 1OGPA 4PV8B 4A63A 2OMYB 4FXTA 4K8RH 4ZDHB 3MA9L 4XP9L 3TNNA 3O3AB 4ODTL 4A37A 1HEZB 4CL7A 2AFNA 5CBAA 3JV6B 3BFWA 1Z5HA 4OZHB 2OYMA 3KCPB 2JFCA 1U93A 5T1KB 3NIGF 3AWFA 3KPNB 4EI5D 4JFFA 3UZVA 4ZSOA 3GSNA 1ZT7B 3B3IA 4R8WH 4PP1D 3MHZA 1YMHB 3KG5A 1AQDB 1RUPL 2VDKH 3NJFA 2OZ4A 5ADOL 1I3UA 1AJ7H 4XAWL 3OMAB 4KNQA 1TYEB 4XX1E 2R7EA 1JWMA 4ONOA 4JN1L 5C07B 1UEMA 4GQPH 4KXCA 3APNA 3DSFH 2NXZC 3IN2A 1WWBX 4PCTA 4AYSA 4EKJA 5EMYA 5JHLL 1ZTXH 1MLBA 3HPLB 3NAAL 4BXSV 1E50A 4QPEA 4AMXA 4E9XA 5BS0E 3UO1H 1RUPH 3DTXA 1WAAA 4WTZG 3CHPA 3HMXL 2BIMA 3IDJB 4G5AA 3MRRA 5AW4B 5HHOD 2E7LC 3C60A 3ILDA 3RIKA 3MOBL 4NO0B 2VUOA 4ELDA 2YHGA 2VZVA 3BE1L 2DQIH 5I66B 5IBTH 1KJ2A 3HAEB 4G43B 5IP4A 3BLKA 3WJLC 5KSBB 4QTFA 5DZAA 3HC4L 3V9EA 1DTUA 3LS4L 1KGJA 3KYNB 2ZXGA 2DL9A 2WV3A 1EV2E 2Y5TB 1XF2A 4OD2A 3QJVB 4LKCA 2Q76A 3MNVB 3WTXA 3EBHA 3MRHA 5AW7B 4HSCX 4QO1A 2OX5A 3HKZA 1UA7A 1DDHA 3HN3A 4IIQC 5DTFA 4E41B 3JTTA 4NHUB 5DRXB 3QDAA 4ZMPA 3VD7A 4QXVA 4W9IC 5I74C 4MDJA 4MA8L 1XGRA 2CA4A 1P4IH 2NY5H 2X7LB 1D5XB 4UDUA 3HLAB 1AGFB 2XIBA 3K6FA 5T1MB 1NICA 2WXKA 3ULUE 2ZOUA 3V0DA 4M48L 4P46A 5IJBC 3RUGF 4LCWD 1CK0H 3HNVH 4GAAA 5A6IA 3RWJA 2DM7A 4JREC 3AGWA 1NIFA 5IMLA 2E74C 1IL1B 4TQ8A 4X9HA 4R26H 2GAZA 3U1SL 4AZ8A 3M1BA 3NJXA 4Z7IA 1LO0L 5DJXB 1BGXL 5J1AB 3MQIA 1ZPLA 1RFDH 4IKJA 1EHLH 1ZSDB 4PS7A 3U7WH 4JQVA 5C0CE 2X6VA 2EDFA 3MR9A 3WGVB 4MCYB 1OSEA 1NH6A 1ZT1B 43C9B 2GITA 4AYMC 1FZKB 4Y16D 1F8TH 2EINB 1I1AC 5ESVB 3FU9A 4R7VA 5CMAA 3TL5A 4Q6IA 1NC2A 3HW7A 3UP1A 2J5WA 2YD3A 5F3HA 4W6WB 4GRMA 4MHHG 2P26A 5HDBB 3FUJA 5DRZA 4PIRF 1SXCA 3Q2NA 2R1XB 2P46B 4IM8A 3ARGA 2X4PA 3BEWB 1UD8A 5DMJB 5J56B 2GB2A 3NUKA 4UM8B 2BVEA 4FQIH 1YRKA 5EOCJ 5F7DB 1NCBH 1IM3B 3NN8B 3K2UL 4GYBA 4Q2ZB 3IPEA 2ZYIA 1BWMA 2Z8SA 4Z3GA 4XPTH 3C5SB 3FL7A 5F96H 1UWFA 4E9LA 2H8PA 5LKNA 5CGBA 4JFUA 4J3OD 4PRIB 3U4EB 2X9WA 4G8GA 5CCKL 1KY7A 5GISL 1AXTH 3T2NL 5FYLE 5IOPA 3NSFA 4GKZB 3DIVA 3M8OL 4H1LG 4NNYA 1ZSHA 1U8NA 4LLYB 4Y5XB 2H2SD 2B9AA 4JN1H 2DI7A 4EPSA 4P23D 4XCCL 1J05A 5T5FA 1WIPA 2FZ3A 2B3RA 2CALA 1UG9A 2Y3NA 5AB0A 4BJLA 5M7QA 2A9DA 1H6UA 1A6ZB 1IARB 4F24A 4JKNA 3F3HA 2NX5D 3CN0A 2IALA 3VFOB 1RZJC 4HW6A 4KRNA 3RWGB 2COVD 3N50A 3LY6A 5CGYD 3SBWA 1UD3A 1Z3GL 3ZMEA 4LF3B 2F58L 2QFRA 3H42H 4NN6B 4OLVH 1XCWA 4FGMA 4HGMA 5BXFA 2JCCA 3RA7H 4HFUL 3UDWA 1U4FA 4X7TB 4NERA 1LXMA 2NLJB 1KTCA 2ZSVB 4WZ9A 2O5XH 4A2DA 1KV3A 2HRGA 2ZOKB 3VRJA 2RJMA 1TKWB 4TNVF 4HAKA 3T3PE 4XO5A 5I1DA 2VLLB 4ZXBB 4FLOA 5L2KD 4MD0B 4R5XA 4M5ZL 1M7UA 1VA9A 1JE6A 3PFUA 4ODHH 2AI0H 3LKRB 3TIEA 4N0YH 3JV6A 2KH2B 4WVRA 2NPLX 3D0LA 2UY6B 4JKPL 2DM4A 5E6ZA 5I76A 3OWRA 1PCSA 2CO6A 2J72A 3DJRA 1SBSL 4JFHD 1WCQA 5T5FL 5CNHA 3BH8B 5JHBA 2MCAA 1YG9A 4WY7H 1ZLUH 4HWZA 3BPCB 3T65A 1QLRA 4I7ZC 4PJXE 1T20A 5AB1A 3AS1A 5AKSA 1SN2A 3ZJAA 1KCKA 2B5IC 3Q8EA 4G1MA 4P4KD 3QUZB 4JDZA 3SZ6A 4NZDA 4AENB 3IXAB 5I16B 3KVQA 4N0FA 4DK6A 4NPYA 2KERA 4UU9A 3FQ1A 4M8VA 5DURD 3HMXA 3V9FA 2W5PA 4IBSA 5EBMB 1HWGB 2LTQC 2B20A 2F53A 4DUXA 5EZJA 3WTVA 1U41A 1QHOA 1MLCB 1X5ZA 5HJDA 4LSSH 2A9ML 1PZ2A 1WHPA 4H8WH 3BVTA 3DX8A 5DURB 4GAYB 3TONA 2Q86A 3T0BA 2CMRL 4HFWB 4XN5A 3K6NA 3RX9A 3TJEH 4JN2B 3W9EB 1D6VL 2UXTA 4Q6YA 4RMVA 2JCWA 5DD0H 1DJSA 3QRFM 3WFDH 3IE9A 1XQ4A 2B8OT 4I87A 4W93A 2YFOA 1Q72L 5CJQL 3O3BB 4MZ2A 2WN2A 3TCLB 3VXNB 1GPOL 2VR8A 4HMCA 2DH3A 3JWNG 1EZUA 1FRGH 1SLXA 2AJUH 2GUOB 4ETQA 2X4NA 3LZLA 4KJPC 3BMVA 2FEEL 2H3NA 2PXYD 4AG4L 5A43C 1EJOH 3S36X 3TO2B 4HZLA 4L18A 1HINH 1O6TA 3ES6B 3GMQB 5DRXA 4P59L 3GXIA 3RGHA 5KYWA 2Z35B 2AZAA 4HIHB 1HCZA 4XMWA 2R2HB 5I1KH 4N0CD 4XPGH 2BJMH 4Y9CA 3APMA 3JV4A 1Q72H 2JE8A 2Y69B 1VAHA 4U4BA 1Z5YD 4DNLA 2OPCA 2KLRA 2WWOA 5EUOB 3TO4C 2CAKA 4JHWL 3FH7A 1E43A 2VCOA 1EH9A 3P11L 3EYSL 4OFVA 1L4IA 1J1XH 2RD0A 4LSSL 4B0MM 2H4EA 3EGXB 1EIBA 2Z7WA 4XCCH 3LEVH 1FZOA 3SE3C 3QH3B 1ET5A 1XIWC 3AMLA 3WN5A 2AJYL 3WOVA 3X12A 3LD8C 3EH4B 2OM5A 4QGYA 5KYUA 1KFGA 2J21A 4DWHA 3CQPA 4ZW8A 1SDAB 2VUKA 1MG2C 3GZKA 5EOCL 4U7MA 2Y25A 4KVCL 1JCVA 2JTYA 4FX5A 5C0RL 3QISA 5AZEH 3HN8A 1N0LB 3MODH 3ILQD 2HXAA 1WPCA 4NENB 4HSAC 1M1SA 2E59A 4R0LB 4KK5C 4OZHA 1J0KA 3G5XA 3VFWB 4F7PB 2WQWA 1HHKB 5BZZA 1VLXA 3FQ2A 4NKMB 1YMMD 3MRFA 3FKUS 3LB6D 1HJCA 3AACA 5I8KH 1NFDE 3VB9A 3MUHL 4M9OA 1PYWB 1NL0H 4N2LA 1J9CT 3GQFA 3ARZA 3BKYL 1N3NA 5I82A 5IT2H 1IQWL 1YMHA 2D9CA 4FDWA 5EIIA 3ERXA 4WLCA 2UVFA 4GG6F 4G7RB 4Y9GA 4NN6C 4OZFG 2L0DA 3H9SB 1EVTC 3CH1B 1AI1L 1J86A 5E9NA 2R0ZL 2DQCL 2RTTA 1HXYB 2EIDA 5I1HH 2NSMA 1DQLH 1JXFA 2O4EA 4M43H 4MMXC 5CD5D 4X6CF 1F11B 4PG9B 4ZMOA 5JW4M 1PG7H 1KTDB 4ZMAT 2NT0A 1PIFA 3ARDA 4WUUB 5E1GA 3VGEA 2JJTC 3HI5H 1BLIA 5T3XH 4HHWA 1IAII 4BRJA 1XGZA 2JB6A 4QOKA 5CZXC 4Q6KA 3L5IA 5F7YC 3VYOA 2DH2A 4IGBC 1KT2A 4K3EH 4M7LL 1SYSA 1FJ1A 5D9SA 5JHDE 4QI3A 4JM4L 4WKZB 1UM4H 2A38A 5TF1L 5H35A 3RWGA 4XZ4A 1WT5A 3LQAL 4A39A 3VDAA 4RNRB 3V5KA 3MAWA 3MCKB 1WQVT 2A9AA 4H8WL 1HHIA 1P4IL 3A22A 3V6ZB 4N2MA 1MHEA 5F0LB 1N12A 5CGYC 5HD8C 5BV7B 5C2UB 1NCJA 4PJCA 3VRJB 4PSRA 1CF8L 1KTKE 3FQRA 5ALBH 4NM4L 3W82A 1G1KA 1BQHB 3V4PB 4YHNA 1SN5A 4PUBH 4XNUL 4HDIB 1ZVHA 4FLQA 1DCEA 2IGLA 3M45A 4IHBA 2W0FA 4P23C 5KJ4A 2GSIB 3ZKNC 1RJCA 2H26A 3T4YA 1CF1A 3LEVL 4AIEA 4JRXB 1FCCA 1NOFA 3OKEA 3QEUB 3DOSB 4OQTA 4R5TA 1YYML 1RPKA 3R19A 1FNEA 4HPYH 1DLFL 4F3FA 2R23B 4HIQA 1JXDA 1Z9MA 2E7CA 4I9WE 4AH2A 1LK2A 2WWMD 3UJTL 4YOKA 4B9FA 1R47A 4AT6B 4ZMLA 5ID0A 2OYLA 2GK0B 5C7ZA 4JDVA 4M7ZB 4IJ3C 3RUGA 1ZVSA 1ZT4B 3VG0L 5HJ3A 4DZ8B 1JPTL 5ID1B 2Y72A 2PKDA 4U3SB 4DKFL 4E41E 3CCHA 4QY8B 4R2GC 3ZVVA 2P8LB 4JQVC 4TULL 3BSZH 2BOCA 3JVFC 3RIFF 1XHHA 3X1NA 1H3GA 1QHQA 1SJVA 4JJ5A 4JY6B 1FYTA 1WUZA 1W80A 4UTAA 4F8NA 2XXMB 2WVVB 4UOZA 3D0AA 2OR7A 3L4TA 4U6XA 1T3FA 5IHZA 5IQNA 1TEYA 2K6WA 1OP4A 3EFFA 2NY3D 4N4YB 4OLVL 3ZL2A 1AO7D 1OF2A 2BDNL 1CIDA 3LDBC 2MCPL 2Q86B 43C9A 1I1AD 5EU6B 5F2FA 2PO6D 2WQXA 5C0JB 2BNQE 4M4RA 1HQ4A 4ESKA 1FFOB 1I8MA 1VGEH 2BIOA 3BP4B 1DVQA 3SDCD 2BNRD 4CW1B 4R83A 3WKML 2YLHA 1BZQK 4XXCC 2X4NB 1H0DB 5D1XB 4ELKA 2CKBL 4XAKE 3VFGH 4GMTL 5C0EA 1T66D 1CGSL 1V3JA 5E99L 1WGOA 5ADPH 3FB7A 3MRJA 3CVHL 1P4LA 5AWNH 1HIML 4BE5A 4Y4KB 4GQZA 5EUKB 2C1OA 5G5DB 2P47B 3ZKMC 3ZDZF 4FLRA 3BXNA 3BSZA 1WC7B 5E8DL 3VFRA 4RGMC 2WLZA 3MTRA 1U2HA 3FSOA 3NRPA 4P2YA 5CCJA 4Z0BL 4IMKA 5I18L 4F33B 2NQDA 1KBPA 2UV3A 4OCXH 2OMZA 2DTML 3OKLB 3MC0A 1QUNB 4H8QA 3T8MA 5IJKA 2BP0A 5KVEH 4ZAKB 4ELMF 3N55A 3HS0A 1CD0A 3VXUE 4ODHL 4ZMNA 2ZOKA 5FO9B 1YMME 3C6LA 1PJ9A 4GW4A 4GUCA 2AJYH 4M1CD 2HCZX 4K8RC 3A3YB 2ZQKA 4MAYA 1Z9SA 1F02I 1GC1L 2NW2B 3FJTA 4OLUH 4WHYG 4E9YA 3WKMH 2A99A 4L5FL 4RFEB 4BGLA 3HS0C 4WSGA 5D7JA 2DQHH 4NZTL 5CCHE 1URIA 1IGMH 1TTGA 1TZIB 3GYRA 4XMKL 2BHUA 2CDGA 2BXZA 1WRFA