3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Otoferlin
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
3QARA 4GNKB 1QATA 2LHAA 3F04A 3PFQA 4WWPA 4XE0A 3W56A 4QJ5B 2Q0ZX 3L08A 4NPJA 4Y1TA 4TS6A 3CSTA 3TL5A 2CHXA 4NP9A 4F92B 2K3HA 3R7RA 4FJYA 4XZ4A 1DJHA 4ANVA 3TWYA 2N1TE 2JQZA 4JPSA 5CCGE 1BYNA 5JHAA 3NZUA 3RDJA 3QAQA 4J6IA 4FADA 3NZSA 3T8MA 4URKA 4OVVA 1QASA 4OVUA 1RH8A 4F91B 1RLWA 2FJUB 3NSJA 3R7QA 3N5AA 2WXKA 4WWOA 5G55A 4Y1SA 4KITB 4TUUA 2WXFA 2V4LA 2WXIA 3HIZA 3B7YA 4L23A 4IQHA 4HLEA 2BWQA 2K4AA 4MJJA 3P2BA 1A25A 1DJGA 1DJIA 2Q3XA 4ICXA 4F1SA 4DNLA 3JZYA 2FK9A 3ML9A 2CM5A 2R83A 4WWNA 3L17A 4FULA 3KWUA 4L1LA 2CHWA 2QZ5A 4LCVA 1BDYA 5H4YA 2K45A 1E90A 2EP6A 3M7FB 2UZPA 4L1BA 2WXRA 4TV3A 4AOFA 4LDCA 3PS6A 5CCHE 1CJYA 3QR0A 2Y3AA 1HE8A 2KI6A 3FBKA 1DJZA 3IBEA 4NS0A 2YRBA 4PS7A 1WFMA 1W16A 2WXQA 3APCA 3DBSA 4A55A 3L16A 3PRZA 2ZKMX 2CJSA 2Z0UA 3FDWA 3S2AA 1K5WA 4BGDA 2WXJA 4ICWA 5G2NA 4KZ0A 4WAFA 3ZIMA 2CM6A 3F01A 3L4CA 2NCEA 4AJWA 4FHKA 1E7VA 3KWTA 3ZVVA 4HVBA 2A4ZA 1RSYA 2A5UA 4LT7A 4QJ3B 3QR1A 4ANWA 4FLHA 1DQVA 1DJWA 4WEEA 4V11A 4FA6A 3OAWA 1DSYA 1E8WA 2QZQA 5CCJA 2X38A 3F00A 4G11A 1UGKA 2WXHA 3SD5A 3TJPA 3PREA 4EZJA 3HN8A 4DK5A 2NQ3A 3ML8A 2K8MA 4F93B 5EDSA 2WXGA 1UOWA 1E8YA 2ENPA 3LJ3A 4PS8A 4QJ4B 3F05A 3ZW3A 4IHBA 4KZCA 1UOVA 2WXOA 4NPKA 2ENJA 3MJWA 3APFA 4FHJA 3APDA 3L54A 4BFRA 5H4ZA 3W57A 2ISDA 2CHZA 2CJTA 1GMIA 2D8KA 1E8ZA 1TJXA 2WXMA 4QAMB 2WXLA 5JHBA 3ENEA 2NSQA 2CHDA 3QJZA 3IM1A 1YRKA 4EZLA 3PYCA 4FJZA 4PS3A 1BCIA 3GPEA 2DMGA 2RD0A 4L2YA 4ANXA 1DJXA 4GB9A 4EZKA 1E8XA 2WXNA 5T8IA 3L9BA 5KJ7E 2B3RA 1DJYA 4XX5A 2WXPA 3L13A 4ANUA 3HHMA 1E7UA 1V27A 3QK0A 3CSFA 1WFJA 2ENQA 3OHMB 2YOAA 3DPDA 1TJMA 1W15A 2DMHA 3RPBA
chains in the Genus database with same CATH superfamily
4NSKA 4LFHG 3L6FA 3K6IA 4P46C 3HG0A 3LHAA 2HJFA 1Q0YL 3HE6C 5IJCC 5EZIL 1CDYA 3S9DB 3NZ8B 3FL7A 1N5AA 3KR3H 5KN5B 1O0VA 2EDXA 1CGVA 1IM9A 2BNUA 2WLKA 1WEJL 3HG1B 1D9KD 1JNHA 2YR3A 5E8NA 4NKMB 5KVDL 5J11C 1MFAL 2ZKYA 1IGFL 3NA9H 4X7DC 4MNHB 3AQDA 3UCQA 4C4BA 1T89A 2HVKA 4YO0B 4YH6A 4GAAA 1M05A 3KPSE 3QDGA 1MNUL 3UO8B 4LASH 4JZJA 2EH7L 12E8L 1UUNA 4GKZB 4NNYB 2QGBA 3GSVB 1CBVH 1DZBA 4LOUD 2VR6A 2GIMA 4EIBA 3BN3B 1KXQA 4M8QA 1TCMA 3P2TA 3GSXB 1DQQA 4OZGA 3WLBB 3WN5B 3D12B 2GJJA 1ZLDA 4Z8FL 5ID0B 3GXFA 3ZHNA 2OMXB 3MC0A 1J7VR 4KI1A 1VRSA 1T4WA 4J6RH 4JFDD 1S3KH 1RPQA 1WIOA 4DGIH 4YHOL 3STZB 3QUKB 2UY6B 4U0QB 8FABA 4CVZB 3FU3A 4LLVA 2QKSA 1K8DB 2EO1A 2F54E 1U91B 1ZY9A 1BZ9A 2YBGA 3NK3A 5HHNB 4A68A 3MV01 4G5ZH 3JWNH 4HPYL 3BVNB 3V7AE 1NIBA 3Q13A 2RH0A 4TQIA 5AVRB 4AJYV 5HJ3A 3R8BB 2VL4A 3H6JA 3BWZA 3KPPA 5ESVA 4JS7A 5E00A 5BRZA 1JF1A 1WG3A 2WZ6A 3ULUD 1U3HC 4ZYKB 4OQTL 3DSFL 3NBNA 5J6GB 1N0XL 4I3SH 2VLRA 2AV7A 3IJHB 4CVZA 1OAZL 1WWCA 2DQ6A 1CD0A 3IAGC 5IVXB 3FUJA 3QAZC 1TPXC 2VDML 1UYWH 2VDPB 3BKML 3R4RA 5L4IA 3DV6B 3G04A 2X10A 3FT1A 5IQOA 3MOAH 3LRSA 4PAZA 4M43H 2DQTH 2WKOA 1FC1A 2CUMA 4N8PA 4XP5L 4PCSA 3WFEL 1MFMA 5CBEA 4CILA 1WS8A 1FNSH 2RFXA 1FLRL 1BIHA 3QJOA 3T3ME 2PPEA 2VXVL 4X4YB 4LBEA 4JREC 1XH3B 4Q6IB 3FUEA 2JCCA 1OHZA 4RMUA 2HA1A 4NCC1 2VO8A 5GS1C 4NP9A 4YSOA 2OBGA 3L4XA 4AQ8C 1KLUA 3NIFF 2G0KA 4WTWA 5FKAA 4HU2A 3X1EA 1D5MB 2FJUB 4XN4A 3H3PH 3ABKB 3SY0B 4BH7A 5F0MB 2I7SA 1RD6A 5IHUH 4MRCA 3IFLL 2VR3A 4HLEA 2G3ZA 2WBWB 1A7NL 1RZJH 3K6NA 4PRBB 4BFBD 1NGQL 4LHUB 1F3RB 1O5PA 2NOYA 4RX4D 5I5IA 2FK9A 3T0EE 4OF0A 4FNRA 4BRJA 2VM4A 5E03A 1RZFH 3TO4A 1Z9MA 2XYBA 4N8CH 4YR6B 3UAJC 1GGBH 3RWHA 3ZKXB 4NN6B 1C5DB 2VZTA 3KE0A 4WKZB 5CJQH 1G6RB 3LKPB 3EOTL 5C6TH 5C0NC 4LCCC 5A2FA 4ELMF 4FABH 1USZA 2PCFA 1NAML 5DC9B 5IHZA 2NYZA 5HDBE 5EU3B 2B5IB 1S7RA 2WWMD 4N6RA 2BIQA 5MEOA 5D2NB 4B50A 2X1QA 1BQKA 5CS7A 5C09B 1BG1A 3K8MA 4NZ8A 3KBFA 3F3HA 2FBJL 4M5ZH 2A5UA 2HT3D 2VN6A 3MFFA 4HJ1A 4KXDA 1IV8A 4JFWA 1IBBA 5I76A 1RVFH 3HR5B 3SD5A 1T80A 3L81A 5E7BA 2NY4B 3ZT6A 2XWRA 3WNNA 2WP3O 1LE9A 3BW9A 5KSVA 5L6YH 3R0MA 1KFAH 1CFSB 3JZ7A 1EGJA 1OGTA 3F05A 1HCFX 2GG1A 4MMYA 4TSBL 1JHLH 3K6DA 4U3HA 5DJZA 3ARDD 3FQ2A 5DD1L 5DMGC 5EUOB 3OAYK 4NAQA 3JYCA 2DLTA 3MNVA 4QF1A 1KMGA 5B1AB 3WXVL 1M9SA 3EGDA 3QJHB 3VFNB 1KGCE 5KSBA 3DUSB 5F7BA 1J9SA 2ZKHH 2A7BA 2J1YA 2HKFH 2EIBA 4ZTOH 1A6ZA 2DW5A 3GKWH 4AXWB 3J2PA 5L7XH 4Y5YA 4GB9A 4EAEA 5GGUB 2UZIH 5KYNA 2CJ3A 3VWKD 2VRAA 1NFDF 1AGBA 3WIFB 3UTZA 2AF2A 3T4YB 1M2OA 4WV1B 1VKXA 3D87B 1E2VA 4LPXA 4JFEA 4QLWA 5I30H 1KENH 1WH0A 3QARA 4JRYB 3BP5A 1A7QH 1B9ZA 4XPHH 3C5ZB 4DIXA 2DWEA 2XLLA 1L9TA 3TL5A 4GXVH 3WNOA 5IVOA 2P28B 3ZL4L 1QLRB 3NCWA 5CSZB 4JKPH 4MDIB 2WPGA 4FQ2H 3HG1D 1TITA 3O2VH 3QCTL 3QUMH 4OLWH 3DBXA 4KFMA 4DCQB 3NRPA 5F7YC 2J5WA 3CFDB 3OKOA 4BKTC 1L7IL 4ZMQA 5F6IC 2W9DL 5IKCA 1CN4A 1PZDA 2I5YH 4U1JA 5EOQL 4XCYB 4FQIL 1H0DA 1SBBA 2X0VA 3RJQB 3BQVA 2ARWA 2IBZX 1U8CB 3MBXL 1A14H 2ZG1A 3NIGE 5L2JA 5T1JA 1KWGA 4NQEB 4BK5C 2O6CA 4GBXA 2HT2C 3O6LH 4YSDA 2ZG2A 4TVPD 2X89A 4YUEL 4A1RA 5D96B 3FQ4A 3MRJB 1IM3B 2LFEA 5J57B 3ZYOA 2DYRB 1ZJBA 1H8SA 5IW1B 5JXED 1CO1A 1K8IB 4DTGL 3K74B 2R29L 3L2LA 1AI1L 4K9EL 5GGVH 5DSCB 2IGLA 1D5IH 5LJYH 5IM7A 2BFVL 4O4YH 1BZ7A 1YPZE 5C0AD 1M53A 2EIZA 4D0BA 5LGHL 3L4CA 2NY5H 2VLMD 1PAMA 1GRWA 2ZIDA 3KL5A 3KYOB 4MA7L 2FX8L 3II3A 5DJ0B 5GGSB 1DBAH 2C3VA 2FWLB 3KDMB 5I6XB 5JPNC 5LG6A 1ZLUK 2X2HA 1P7QB 4R83A 3BFOA 3VD2A 1B0WA 3FUMA 2DQDH 4L4JA 2IV9A 5DZJA 1W80A 3CFQA 3MLSH 3RX7A 3FB7B 3D48R 4LRIC 4PJ9A 1BBJB 4YDJB 2IFGA 1N8ZA 5A2LH 4MD0A 1BD2A 1OP5K 1QBLH 1CFVH 2DJSA 2J8UB 2ZWSA 3EGXA 4BFGA 3MYZA 2E86A 4APQB 5EULV 1JNNH 3NCJL 3H53A 1F8TH 3CE1A 3CFEB 1X6LA 1BJ1H 2QQNH 5I6LA 2IO5A 2CHZA 3MYJA 1T21A 4TUOB 3SJVB 2ZWLT 1ET8A 1HZKA 1OARL 2KQMA 2GBUA 2WXLA 4ZXBC 4ELMB 3STLB 2CO1A 1MCDA 1NCJA 3X11B 4BK5A 1P4IH 3GSUB 4MNQB 4PEEA 4Z7QE 1S7XA 5DD0L 4X8XA 4PJFA 3RIAF 3BH8B 2VXQL 3GRWH 3GNML 3SCMC 2FWUA 3ZE0B 4ABQA 1E27B 3EO0B 1NWOA 4PLNC 5JQ6L 4IIZA 4UM8B 2H0FA 3GMNB 1ZA6A 4FQXB 1AC6A 1FV1A 4XX1G 3NJMA 4S11A 2QVMA 3O3DA 4WI8A 5E6ID 3O8XD 3CHXA 5JHDD 1RQ5A 1G7PB 3K72A 1DJHA 1X5JA 2VDOB 4FQXD 4P5KA 4ETQA 1Z9NA 2IXQB 5FM8A 1URIA 1HWWA 3F12A 5CLZA 3RGVB 2WZ5A 1Q0XL 3F6JA 1HIMH 3Q8AA 3WFBH 4CGUB 1MF2L 4EDXB 1CU4L 3WFCH 1QO3B 5AOIA 2BVUA 2KLRA 4Y19B 4QRPA 3OGCA 1BGXL 4PJGB 3ZHFA 2X88A 4NENA 3UADA 4U1SA 4ODHL 4PWFA 3P3TA 4H1LA 5AOZA 5TQ2L 2GTQA 3UTSD 1TMCB 4LNRA 4OM1L 5GRJH 2KS0A 2R39A 4ZXBA 5I73C 1HDMB 4OJYA 4YC2B 3VFWB 3WIHL 1RJYA 3VGAB 1YAZA 1KZYA 1QHQA 5FUZL 5JO5B 2OP4H 1J10A 4TNWK 3IJ9A 2VDQB 3AM8A 3ZKND 4UV4H 5D4QA 3KPSB 4I0PC 1HVXA 3JWDH 2I9TB 2ESVD 2ZKMX 2ZUUA 3CSPA 3VM5A 3L5HA 1UB5B 3GIVA 3QUYC 5CEYA 5GS0D 4JFUA 1H3TA 2QQQA 4K71C 2ZWNA 5CEZH 2OYMA 3VX1A 3I6KA 3TZVC 1I85A 1SN2A 5JNYB 3CHOA 4BSWB 1HHIA 3T3PB 2AFNA 4MSWA 1S7TA 2BC4B 2GSGB 1OP9A 2AQPA 4NLHA 4JO1H 1ZTXL 2DIEA 4N1HB 5GGQL 1AR1B 1V7MH 3CZFB 4Y89A 3O9WA 2ZP9A 3OKDB 3IMUA 2A1WL 1U3ZA 1P69B 1BBDH 4LBEB 4MJ2A 3A6BL 1XGRB 5MEPA 3LZNA 2Q7AA 3VVWA 5TTRA 5H4ZA 5IW6A 1A0QH 3ZXAC 3NRFA 3QXTA 2GCYA 5HDWA 1AR2A 2D8KA 2F15A 2IOIA 5HHOA 3OQRA 1QLEL 4XNMA 1BEYH 4TQ8A 1NCAL 2KC0A 2OMYA 4YLQT 3LKOB 5DTFA 1YRKA 3WKNA 1TUPA 4F8QA 2QVTA 1CR9H 4Z7NF 3Q8CA 5F44A 1J8SA 1Q1JL 3DO3A 1CS6A 2X87A 4DWHA 2NTSP 1XF1A 5ICYA 4F8OA 5DGQA 3WHE1 1A7RH 1RZQA 2F53A 3RWIB 3RAJH 4WIQA 3L95A 5ELIA 4YBQC 5D2NC 2Z8RA 1DEEB 2PYEA 4Q14A 3ZE2E 2HJLA 3V4LA 5HPOA 4WUUA 1SOKA 3ZE1B 3PFQA 3ZTCC 3AW5A 3JWNE 4XE0A 1EJ6A 1P6AB 1Z3GH 5GZOA 1G4RA 1BIIB 4HFUH 5JPMA 1YQVH 4N0YH 4JFQA 5CCKL 3BP7A 4JZNA 1OB0A 4I13B 4L5FH 4N3UA 4LP5A 3NZSA 3WS3B 4QI3A 3QDGD 1ASOA 1E43A 2JIXD 2BIMA 4JNXA 2EXWC 2APBA 3DX9A 1O7SA 2OPCA 4Z7WB 4WWOA 3V4PL 4ATWA 1SUHA 4JPKH 4RAUB 1JXGA 1F4XH 1P5UC 2K4AA 2B4CL 3CVHH 4HJSA 4ZMVA 1AP2A 2CGRH 2P45B 1ZT1B 1S7SB 2J1ZA 3TBYB 5D5MF 2J20A 4IRJD 3VXUD 5CFHA 5ICXA 4UUJA 5FUCC 4MJIA 4GUCA 1AD9A 3QRGH 3DGGA 3A6CH 5E8EB 5E9NA 4L0YA 1HFUA 4H8HA 2QELA 1M1XB 5DVNA 3GTTA 3WUWB 3TF4A 2DAVA 2FSEB 3AAZA 1RZKC 2CPUA 2VLJA 4I88A 3U6XS 1UB6B 2QGCA 3EFDL 3N6YA 5TGBB 4AYMC 4E9RA 4OGXL 5IGXH 3QUXD 4K3DH 1YEKL 3E2HC 5JXEA 4LNVA 3QFJE 1LP9F 2HXAA 5CLWA 5HDBB 2XUWA 3L7FA 4MDJB 4OCSH 1AGFB 3BCFA 2UXGA 4YDIL 5GRVK 1BREA 2XX0A 3F58L 5GGTH 2FRGP 3DGGB 1FCGA 3LRMA 1A6ZB 4GSDH 4OCLC 5IJDC 3LS4L 4QY8A 1WP6A 4DFHA 3EAKA 4K9EC 3PQYB 4LSPL 2A74B 4N2OA 4ODUA 2GK0A 3CVDA 3WIIL 1JZFA 1HZLA 1UWGH 5D1XC 1XGQA 2G30A 4Y7OC 3KLAB 3ZHLA 5IBUB 1E5UI 2Z1PA 4X5WA 4KRMB 5EO0B 1KBGL 4BFRA 3SEPA 3F7KA 5I6MA 1K4CB 2AJYL 2A77H 1RK0B 4WFED 3BAEL 4OD3H 2W65A 1ZDQA 3WTUA 4V2CB 3TPUB 4JY4B 3ALPA 3CN2A 4QR7A 3ZDZE 3P11H 3HBQA 5LN8A 2F8VA 1RKRA 1DQML 2Y1YA 4X7SL 2R69A 3S5LA 1SFHA 1GZHA 3A3YB 3GSNL 1WS7A 4NO0D 5DMGD 1NMCB 3DWTA 1ZLVH 3DOIA 2VLLB 2IAND 3HC3H 1RUKH 2FQFA 1H8LA 1P7KB 4M00A 4NZRH 2C3WA 4KMTL 5C9JB 4HCGA 5F7MC 1Y18B 4Y9FA 4OZIA 3IU4L 4Y2DB 5KZCB 2ADIA 5I8OH 2DEWX 2H47C 3TBCA 3DX8A 4KPHL 4S0TD 1JF6A 2Y24A 4CGTA 4F3FB 2QQKH 3Q8EA 4OH2A 4P5MA 4QEGA 4WW1B 1MHEA 5SX4I 5JW5B 3F2LA 4OLXL 3CGTA 2E6PA 1LTXA 1LK3L 1UWEH 2XDHA 4HEPG 3VWJC 4DZBB 1FV1B 1A4CA 1KXTB 1MFCH 5GS1A 4GLRI 4JN1L 2GJ6B 3WAJA 3US0A 1WDAA 5EBGA 1SM3L 2WINA 3QWQB 1E30A 1BXXA 4Z6AT 3NPSC 1JD7A 3V0VB 4FXGC 4MB5A 5AL8A 4YVUA 4KKAD 1WLHA 2FBRA 5D6CB 3QIWB 2ZAHA 4YXKH 2ZF9A 5F70A 3X2QB 2QSQA 3VXQA 1YMHA 3BHBA 2CO2A 4S0SD 2J43A 3QUHA 3C60A 4UBDC 4AGPA 3QUZD 4NZFA 3GBLA 1D5XA 3GMPA 3CLEL 3X1BA 3UAJA 4DK6A 4HIIB 4O02L 3FT2A 2XVGA 4NIYE 4HJ0D 4F27A 3HB3B 4NQEE 4G7VL 3MKKA 4QRQB 3GUTB 4HD9A 3ZIMA 1XR9B 4HS8L 4AENA 1E7VA 4XGZA 4Z0XB 1NFDA 1JCKA 4N2LA 4Y4HA 4JFED 3KWTA 4A2DA 4D9QE 3KPMA 3PWUB 4RGNC 2AEPH 1UFUA 5EU6A 2ZSVA 1DQDH 5FK9B 4RQQA 4ZMNA 2AITA 5J0BA 1UGKA 1QNZL 2DI9A 2XQYG 1N6VA 2QPEB 3HMWL 4OJFL 1CPUA 3F83A 5HHMD 1ZAGA 4HF5L 3WL9A 3FT2B 1XGZA 4GXUM 4XCNA 5BOPA 3NABL 5AD0B 4P2OB 5KSAB 3MJGX 1EUTA 3FQUB 3L3HB 3MUJA 4XWOD 3SDAB 5FPIA 2VL5B 5PCYA 2CJTA 2MKLC 3IT8D 4QHKJ 3RL1A 3ULVD 1MRDH 3ATAA 2BVQB 3L1EA 4XMPH 3ZMNA 5E2WL 5D9SA 1GYWA 4YDMA 4A6YL 5ESVB 4J3OH 3F12B 1JV5A 4GEIA 4U05A 3T71A 3UBXA 4HEPA 3LCYA 4N2CA 4GRWB 1RZKH 4UOW0 2CDFA 4NC1E 3BUIA 1I7UA 1ZHBA 5C0EB 4JRFA 3D39B 3W1ZA 2MQ0A 2VN4A 5MEQB 1YNTB 3KYNA 4FNLH 1WRFA 1M9WA 4Y5YC 5DS8A 1WC7B 3C6LD 2IIJA 5IMLB 2HRPL 5CP3H 4EI6A 9CGTA 3S34H 3ZT7A 3QWRA 1EAPA 2FHBA 4ZX3A 1ORQA 3LHPH 1DFXA 1TVHA 2OTUA 2IPUK 3G5ZB 4UTBL 5GSVB 5DK3A 4Z95H 4OVVA 3R19A 5T3XH 2EDDA 3G6AA 4KK9D 2V5RA 3PWPE 3QZLA 1LM8V 3CFBA 3UZQB 2W5PA 1PZAA 1XF2A 4A67A 4F7MB 4IYKA 1CDUA 1EO8L 1WBXB 2N0KA 4TVUA 3PE9A 4IJTA 4RMRA 4IDLA 5C8JA 4LQFL 1OP3K 2NT1A 2B2XH 5E1HB 5CMAA 1ACYL 4F2MA 4Y19E 1ML0A 4X80H 3WHE0 2BC4A 3OM3B 1QZNA 1IBZA 4GS7C 1X9RA 4W9DC 4Q4IA 1JWUB 3GRBA 4DZ8A 2YN3A 4HLJA 5E51A 1DJZA 4WCYH 4YSRA 3WKMH 1QSED 5I1IL 2FO1A 2Z7UA 1I8LA 2Q86A 4H40A 3H8NA 3VRJA 4UIKL 2EECA 2Y36H 4OCXL 4BSVB 4G9FA 4GRLD 1CGWA 2BS71 2BXYA 4F2MB 3EJQA 2DJMA 4OJCA 4XNMB 4JFFD 5IIEB 2RQEA 3HN3A 5JUEH 1X5LA 2F5BL 3CC1A 5JOPD 1RJLB 3SKUD 3SYCA 2NXYD 4TUJA 1GL4B 1N6QL 1MRCL 2OTWB 2NW2B 4U1IB 3TPKA 3LDBB 4AW7A 5IHZB 5C09A 2VMDA 1MCPH 4KY1L 5I1EH 1RZGB 1GOGA 3CIAA 3D85B 3M88A 3QUZB 4ABUA 1EBAA 5MEOB 2VDQL 3FB8B 4NQDE 2FT7A 1J1XL 4XXDA 2K4WA 4I77H 1OAQH 1MI5B 1TTGA 3TNNA 3UTQA 4H44C 3V0WH 2VQUA 4XH2B 2HLFC 1G0YR 2E9WA 5FHBH 1MFDL 4S1RH 4LEXL 3PYCA 3F65A 1YUHB 4HOZA 3E9UA 2XYCA 4MX7A 5D7IA 4YVNA 1M7XA 4AEHH 5I2IA 2GI0A 5EEYA 1NCUA 4A2LA 5CUSH 3ZYIA 3K1DA 4NGHH 5F3HA 1BFTA 4DN4L 3QIWD 1GPOH 4JKNA 2FEEI 2IALA 5F7KC 3ULVH 5F88A 4KDVA 3OR6B 3NCBB 3VCLA 1WT5A 4HYTB 5HHNA 3W11D 4TS6A 1B0GB 5JHLL 1UM5H 5ABZA 4NDMA 2N1TE 4MJIB 4JW3A 1BM3L 2N7BA 4PJ7B 5DEFB 2RMNA 5JHAA 5JIIA 3O11B 4X5QA 3OLGA 3VFSA 2FEEL 4KH2A 2ZX6A 4OSUH 3WE6A 3GMOA 3O3BA 4ZMLA 1AXSB 2ZUSA 3R0NA 1FGVL 2EDFA 4HS6B 3N5AA 3KPPB 4DP4X 2EO9A 5DJYB 4F5CA 3RFZB 5I1CL 2BSRA 3B3BA 3IWUA 1BVNT 2R4RL 2Q2EB 1CGUA 4IOFC 4HWBA 3WS6A 3O6MH 2XWJB 2PWFA 2NCMA 4U3SB 5I1LB 3VTTA 4Z7WE 5ADOL 4FQCH 5I9QC 4XN2A 1GYAA 1UVQA 2L7JA 4QXGL 2UYLA 2X9YA 4ZODA 3T6ZA 4QRFA 2ZICA 4UM9D 3O3EA 4YS4A 1R4XA 4PYGA 5CCHE 3B3IB 1AXSA 3AGVA 1FWXA 3V5KA 2JXMA 2B20A 4TL5A 3ET9F 3TV3H 2OI9B 2V2WB 5ENWB 4O51B 4N0FB 5EBLA 1NEPA 3G5VB 2WXJA 3CZGA 2QMJA 3O4LD 3WNMA 5CN3A 4AL8L 1HL4A 5CZVL 1AZZC 2OJZL 5AG8A 3KGRA 3IVKB 1FNGB 5E08L 1KLUB 1HZHL 3QUYA 3C5SB 4WF7A 1NUNB 4K5NA 2YQGA 3PQYD 1GY2A 4DW2H 2NYYC 2FR4B 1CLVA 1I8MA 3C75A 3LN5A 4K73A 2W60A 4FFZA 5IB3B 1VESA 3O3UN 2EXYD 3CMGA 4NRXB 3U30C 2HWZH 1J86A 3BN9C 4Z3FA 4I8DA 2FTAA 5IW3A 2B8OT 3MLTB 4TRPL 4YJZL 2ADIB 2I27N 3MRHB 2E47A 4OGYL 1BVNP 2P48B 1UD6A 4XHJD 4F3FA 4QRRA 2FDBP 2NY1C 4FXGB 5EN2A 1DBML 1NEZA 5JORA 1DLHB 1WAAE 4WLCA 2EVJA 1G7QB 1UCBL 3QUGA 5DO2C 4FDWA 4L8CB 3O4OC 4YHMH 3EFOA 5AW3B 4BH8B 5IHHA 2WXPA 3LMJH 2PCPA 2V2XA 1ZK5A 3P9MA 2VCOA 2WLHA 2YN5A 3LEVL 3CIQA 4IRJB 4O2CA 3V0AC 4L1HA 4GS7B 3L4WA 4FLOA 1JV5B 4AE0A 3FRUB 3FUNA 5CINL 2FCBA 5H94B 2W9LA 3LS5H 4R84A 4IMLB 3FTGA 3W38A 1NKRA 3ETBJ 2K6ZA 4JRYE 4NQXB 1MCCA 2XG4B 3FFCE 3GMNA 1DE4B 2A99A 3E6FB 2DYPD 4GP5B 4UDUB 4L18A 4NKQB 4IW4C 2FJFA 2ITEA 1AQ8A 4AUJA 4G8GD 5I1GL 2DDQH 1HH9B 4MMYB 4KRPB 1RIHH 3J7HA 2HKHH 4WO4D 4POUB 2PW2A 3WKQA 2IAMD 5D1ZC 4O2FA 5B7MA 1FA4A 5ISZB 5FFLA 4IOIB 4HK0A 4B41A 4LGPB 1CDBA 4JHVA 4HGWB 1KZQA 1B4LA 5HPMB 4FFZH 5D1XB 1J9QA 4XPTL 3HI6L 2LAGB 4PJEE 2AJXH 2RTTA 1JWMB 3U36B 3PPSA 4NXSA 3WIFA 4FYTA 2H1LM 2F6AA 1PX8A 2QHRL 5D7SH 4QDGA 5L0QC 1HYSD 1RCYA 4KHTL 5A16B 5KBKA 1G9MH 3IXTA 1YEFL 1KYOK 1AD0A 3IAPA 2X05A 3WXWH 3RZCA 1I8UA 1OCRB 3PWVB 5GGSY 4DVRH 1RUAH 2ZCHL 4YXLL 3OB0H 4X4ZA 3TYFB 1N59B 4G9FD 2V8LA 4E42B 1PKOA 2VISB 2VR4A 4TMPA 4Z78A 5JZ7D 4N6QA 4AYBA 2ADGB 3VW3L 1Q72H 3QPQC 4S1DC 1J1PL 4M6NL 3V0HA 3ARUA 4ZW7A 3W81A 4BSWA 3OG6B 4FQJH 3BXNB 1LNUB 3DETC 1QVOA 4BE5A 1JXKA 3NDYE 4KNTA 4XVJH 4XRCB 4HWBH 4CRPA 1NGZA 2UWEF 3ZQWA 1NJ9B 1FRGL 1JHTA 2IPUG 2Z91A 1IGTA 4MQXC 1M42A 4O02B 5EZJA 3O0RL 2J6EH 4GBXB 3CMOH 2ESVB 3VI4A 4QHMA 4PY7A 3LPGA 3LSOB 3GS0A 5DLML 2AQRA 3SDCB 5AB9A 1EXUA 2HFFB 5BJTA 3FH8A 1E9QA 2BVOB 4I5BB 5HVGB 4UT9L 3I9GL 4YHZH 4CVWA 4KKCC 1CXEA 4WY7L 4F80A 5GRUL 3T8XB 3IWVA 4UQ3A 5BRZE 5JDSB 1GZHC 1F45A 4GKOA 2P5WD 4YX2L 2C9SA 2QPSA 5IQ9B 3O2WL 4XPBH 3WU1A 1VENA 3ROLA 5T1LD 4NQSB 5HI4D 2JJTA 4UIMA 4J3OC 3VFUA 5FYKE 1WZAA 2NNXA 1WBYB 3L9RB 1MVFA 3GZKA 4EBQL 2MIZA 5KBNC 3GSWA 3K6OA 1OT1A 1KIUB 4JPWH 3IFPB 1XSOA 4Y4FD 5CIPA 5D2LF 5C6WH 2BSSA 3P0VL 5DYFA 4AMKH 1X5GA 5E4EB 4C8XA 4DKDC 3I6GB 3O8XC 4FZ8H 1QWNA 2JCCE 3BWAA 4W9HC 2MHAB 1CUOA 3WFZA 3PWLA 4A7QA 2PNDA 3RY6C 1VIWA 2AK1L 5GIRB 1IT9H 4ZT1A 2NW2A 3KJ6L 4U1IA 3AQZA 3QA3A 4S1SL 2WQRA 5DJDB 1WFNA 5TK2A 2G0LA 4A2FA 3RB5A 1KACB 4UU9B 1SQ2N 3A6OA 4MDRA 3WBDA 3AABA 4PTTA 1NDGA 4FX5A 1S5HB 3MJ8B 4X98B 5HYSB 4LHUA 4JM4H 1CDJA 1F41A 1N12A 3GXPA 1WWWX 4U1LB 4XNDA 1OV8A 1PQZB 2W0LA 3F5WA 4MMZC 3I6GA 4M5SA 2VDLB 3VXTB 2E56A 3HI1B 3IDNA 3ECQA 3GMRB 1AZNA 5E24E 2RR3A 1K6QL 3E6HA 1RJZA 5C0AB 3SDDA 4BFEA 3S3JA 3QWRD 5FLUA 3H2PA 4RSYA 1PY0A 5LDSA 3L4VA 4GRLC 2KLTA 5KVGL 3RFZC 4OTXH 1U0QA 1A9BB 2VLJB 2HPTA 3FONB 4LESA 1BJ8A 3UYPA 4N2IA 3SPVB 3APDA 1PAZA 4GEJA 1TFHA 4NI6A 1IAOB 4P4KB 1LO0L 2WQUA 4XZUB 3ATEA 1AGFA 1IBHA 1UKSA 5IFAH 5HHQB 3MRBA 5DI8B 3SGDI 4UOQA 4ODUB 3LTVA 3X12A 1T66C 3HNVL 4FNSA 1IM3D 4HETA 4L2YA 5J1AB 4DH2A 4AH2A 5I71C 3RTQC 4U6HA 2MMXA 1JZ4A 5ID0A 4W93A 4OI7A 3NN8B 2XA8L 2Z93B 5I1JH 1RK0A 1E7UA 1NCWL 1LVEA 5F9JB 2C26A 1XGQB 3I9GH 5IMOB 2GJRA 4LSUH 1UOKA 4FEIA 3BO8A 5E1AB 1RU9L 1U58A 1XX9C 2ENSA 4AYEC 4E0RA 3SE3A 2HT2D 3UTTE 1EVUA 4M9PA 4JEGB 2DKUA 2R1XA 3SGJA 43C9A 2EDLA 3Q6GH 3FQ1A 2Y06L 5EO1A 3RVXC 3SDDC 1JDDA 3AG3B 2VWEE 4JG0L 4HWBL 3TN0A 4LSDA 3ZE1E 4CN4A 3F7YA 2Z1KA 1RH8A 2G4GA 1C8QA 3FCSB 2AXWA 4U6HB 3R7QA 3FQTB 4WWKD 1QAWA 1K8DA 3O6KH 3RJOA 3SBQA 5T1MA 1JGDB 1J1PH 4M6NH 4CW1B 3T65B 1OOWA 5C0ND 5JR1H 1NGPL 2DM2A 1EHNA 4KTDL 5J11B 3MNWA 3N1QC 4K2UH 2YSTA 5AKTA 2E75C 1SF3A 3ZUCA 2CO7B 3TT1L 4FC3E 4YSEA 3HC0A 4FZEL 4MLSA 3WFHA 5FEBA 3DV6A 3G04B 4N0CD 3QORA 4XPGL 2AANA 3MRGB 3VWKB 5DUMH 4NZJA 3JWNG 2CUIA 1SUJA 5B21A 2F9BT 2VXSH 2W07B 2R27A 2XFXA 4Z7QF 3IJHA 2QADB 3UACA 4BCXA 1E3FA 4KXZH 3KM2A 3CN4A 3DBSA 2CUAA 4DP5X 3GBMH 1NIDA 3AWEA 4Q4EA 5EO9A 1YC8A 2GTZA 3BI9X 4ZUTB 2O61A 1CGYA 2AJXL 2WLMA 3MNWB 4DP8X 5MENA 1NUGA 3H9SD 4G6JL 2ED9A 3TA4D 1BFOB 2APXA 4WJG3 3W9DB 3WDHA 2B7DT 1LLAA 3TH2T 2WKOF 3BQUA 1CVSC 3RJDA 1FL3A 1K4DA 2BY1A 3VB9A 3WS3A 3SKOA 1NPNA 2ILLA 4PWKA 3IPEA 5CZRA 2OR9L 2WNXA 5LO7A 1RP8A 4U7MA 3QFJB 3SCMD 1RIHL 2OXGB 3P9WB 4BQ8A 5E9DA 2F58H 2IQ9L 5LLIC 1AQKL 1X7TA 4JB9L 4M3KB 4NRYA 1B4TA 2JCWA 2BIOA 3PF2A 4BQ6A 1CTNA 4XAWL 1KEGH 2KHAA 2UUDH 5EU7E 5FYLD 3IYLW 1UWXH 4U33A 4QRSA 5CJXC 1X5AA 5CINH 4BE6A 4UINH 5D1ZB 1VFOA 1TTAA 2XTJC 3NAAH 4KK5C 4XXCA 5E6IA 5TF1H 4ZMXA 2XETA 2ZUQB 2C9VA 4R7DA 5T5NG 1NCCL 2ZXCA 4XC3H 4A37A 3B9KC 3TJEH 5DA0B 2YKLH 3FB6A 3PHQB 4R3SB 3UMNA 5IB5B 3BZ5A 3H9HB 5DZOA 4PLKC 4GAFB 5EPMA 4ALAL 4LLMA 3EBGA 5D9SB 3JV4A 5FGRA 4I4WA 3ZUNC 5K9KB 2LLGA 3LSOA 3C5ZC 1KJ2H 4WWPA 4Y9BA 2EYSB 4ZPVA 5EFIB 4D9RE 5L2KB 1LXMA 3QDMD 5KS9A 4ELMA 1NTDA 3K0WA 3OLDA 1PLCA 4LCWE 1UATA 1D7FA 1TJGH 3RPKA 5FYJE 4KV5F 2BMKB 2W8CA 1TKWA 5BZWA 4U6VL 4NO3A 3FB6B 3PHQA 1NBVH 1NCHA 1GY1A 1ZS2A 3BH8A 4Y4KA 3LNGA 4PJFE 4UTAL 5E5UB 3UJIH 4H5SA 5EG6C 2HWZL 4ZZFA 4FQ1L 5GS0C 4X8JB 4G6FD 4KUZH 5MEQA 3BVWA 2O5ZL 1A25A 4WJ5A 3NA4A 4UMGA 4OD2A 4NQCB 3FFCB 2DB8A 3BVTA 4QCIB 4PLOB 4C56E 5BO1H 3FH5A 3QZMA 1M7DB 2OK0H 1HZHH 4ACTA 2E0PA 2GJ6E 4CC4C 1H8OA 3BKYL 4LDOB 2EYRA 5TJWK 3WY3A 4XXCC 5E6IC 5CZVH 4DP9X 3G5ZA 3IJ8A 1AMXA 1FFTB 3MV7D 1IE5A 4JN2B 2QVFB 3OKEB 4UILL 4CMHB 3ILPA 4MMXB 1R3HB 3SCMB 3QFJD 2VQ1A 1LYQA 1WHPA 2HJKB 3EO1B 4EZMA 1I8IA 2QSTA 4PWJA 4F9LA 4N9OB 4H8VA 3LKPA 4DO6A 1IGJB 2FJGA 3G6JB 5I26A 1M7DA 2ORBH 2JELL 5GGVY 3SOBL 2VDOL 2BNRA 4LLDA 3HC4L 3HCVB 4FQCL 4TTDC 3VE0A 3LPFA 2AERT 1AH1A 1E65A 4XNQA 3BD4A 3G6DL 4KUCF 2BWIA 5BJTB 2ICWI 3NT0A 5IF0B 3C2AH 5IUSA 1O9VA 4LEOA 2VR9A 3RQ3A 2XY2A 2XPGB 4MQTB 3Q3GB 3VQLA 2HJKA 3WSQL 4HUVA 4JM2F 3QH3B 5TDOB 5CWSB 1I3RA 3MV8B 2NYKA 2X3AA 5FO7A 5C0BA 1BM3H 2ZXDA 1GMIA 4IBLT 2I9LB 4W9CC 3JWOH 1XIWC 1AGDB 1YEGL 3V0FA 4JLRA 4J1UB 4OD1L 4UIMB 4DGVL 1Z0MA 3ZQXA 4WEBH 3HRZC 1XBDA 1ZHLA 1LO3L 1MFEH 2X4UB 1KT2B 4N2EA 3A23A 1NMCC 3ZU8A 2ESVE 4AEHL 4KKNA 5TE6L 2VR7A 4KKQA 3RYMA 1MWAH 1BLIA 1YN6A 3KWVA 2JKLA 2UXVA 4LKXB 4N86A 3ESNA 1P4LA 1A5FH 2XWTB 1G5AA 4QOKA 4EE2A 1QI4A 5LGJB 5HHOE 1I8AA 4JZOB 3ULUH 5DSCA 3BFQG 2OMYB 2OCFD 4FYSA 2VN3A 4HX1A 1WFIA 3LX9A 5EIIG 1J1XH 4XO9A 4ZYKA 5BV7L 2WTRA 1X4XA 3TIEB 1IAMA 2XV2A 3RGHA 4K5MA 5CFAA 3KDMA 1E4KC 4XNZC 2QSCH 1A3RH 4QXWA 4UB0H 5GZOD 2Z92A 1JFQH 3KDPB 1VADA 3ZRCC 1N0LB 3C6LB 7FABH 2ZCKH 2H6PA 1KPRA 2BWDA 2KZKA 4WUUE 4X9BA 5DJ6A 2BW4A 2F5BH 4ZUUB 2Z9TA 3QUXA 1JYVA 3G08A 3FMGL 2P8MA 3PHOA 1X4ZA 4JFQB 2A9NL 3AB0B 5EU5B 4OF3A 3S3DB 1NBVL 5BXFA 4GPVA 5EWIH 1J9TA 3T65A 2ETWA 4Y5XA 2VMFA 5DEGB 1U8KA 3IJEA 2PP7A 2XRAL 2GITA 1T2JA 1W16A 3BESR 3OZLA 3P77A 4JGNA 3GS7A 3V5HB 3L3DB 3W37A 3QORB 3S3CB 5D7HA 4ZQKB 1TVDA 4HZ1A 2E6JA 1IVTA 1U9KA 3N41B 4C54A 4Z7IA 4RETB 3TA3D 1MFNA 3PHOB 2AXHA 3SQOL 1UVQB 4QWWD 3ULAB 1VEMA 4APXB 5T5NF 5JLZB 2OTUB 3JYBA 3U9UB 3L3OC 5K9OA 3QNZA 4G3YL 2HFTA 5JIQA 4U1KB 1GW6A 3P3UA 2OCJA 2XX1A 1QSZA 1TDQA 5B38B 2VERN 5DFAA 1ZLSH 1SY6L 4NENB 3SKMA 4BKSC 5EBLB 5IMOA 3RPIA 4WKZA 2EXTA 1XF4A 5ANMA 1WCBA 1IEHA 5C0JB 3QYCA 4D8PA 3LHPL 1MCOH 1CLZL 3UTPD 3MV11 3QUXC 3FQNB 5HI4C 1F2QA 1TVBA 1YSOA 2FJHA 2HRPH 3EOAA 3BWUC 4F58H 1D5BB 1SN5A 1JRHH 3JUYA 1ZWIA 2Q8AL 5AFAA 4U1SB 1MI5E 3NJIA 4NNXB 2VLKD 1RFDH 1FORH 2X2JA 5I5MA 3UC0L 3GMLB 1OF0A 2GIYA 2P5WE 3QSKB 2UWEA 4KZDL 2NPLX 4TUOA 5FKPB 2K8QA 2ENQA 1VPOL 2PXYA 1VEOA 3WIAA 1VGEL 4X6DA 1NC2D 4R7DB 4JFPB 2Q1EA 4KK6D 1MPAL 4A2GA 4IRSD 4QXVA 5DFTA 1MRDL 4XMPL 5IOPB 1J0HA 4W4OA 3U7AA 2IFFL 1NANI 4J3SA 4HQQL 1G7QA 3U46B 1YN7A 3TJHC 5DUML 5ERWB 3QVAA 4KJWC 4XNUH 5KVMC 4LIQE 4DPCX 4PY8I 4MWFA 3BCDA 2VDKL 4LLUB 3U2SB 2YLKA 1SYVA 4X2UA 2QFPA 3GLDA 4N20A 3MROA 1KC5H 4X0KA 1RURL 2FX9H 4PI2A 4BWWA 1KCVH 8CGTA 2PPAA 1FNEA 1T2XA 3X3GH 1ZSHA 4H8WC 3MO1A 4Q58C 4Z3EA 2G60L 3MVSA 1D3CA 4M6OH 3ECWA 2VN5A 3D5OF 1DQJB 3SGEI 3UABA 3UZVB 2C3HA 2JTYA 1E90A 3EHBB 1W0VA 1MAKA 4H7VA 1P2CA 5F6HI 2V7HA 2IWKA 2BP8B 3BJ91 1B4RA 4DZBA 5K1JA 2W95A 4XC1L 1KBPA 4KVNL 1AHKA 2YGNA 3U0WL 5FUOH 1U8JB 5I0DA 3RWJB 1BSIA 5IJKC 4NJ9H 2EDYA 3OR6A 4LVEA 3DYMA 2L7EA 3QPKA 2QBWA 3T2OA 5ABDE 1RI8A 1DEDA 3CBJB 4C59B 1JS4A 5LXGL 1HX0A 2P47B 2V9UA 5T1DH 3NSDA 5TE7L 4YBLC 3PG2A 4PJIE 2X9ZA 4DVBB 4HFWA 5KJRL 2CR6A 3FQRA 4RGMB 1XEDA 3MLRH 5DYOB 2ENPA 3PL6D 2R1WB 4ZAKB 3RWJA 4JQIH 2KBGA 1YJDL 2AW2A 4YE4L 2XWJA 4ZFOL 1UWEL 1LK3H 4TPRL 4X8CA 5EFIA 4PRPB 4G8GE 2EAEA 1JTPA 4G83A 3VGHA 3SY0A 2GBVA 2KUTA 2NZ9C 1L6PA 3CN3A 3DV4A 5D7LA 5EBMA 1IFHL 1KOAA 1YPZA 1LNUA 1PD1A 4NWTH 4WO4B 1U8LA 5ITFA 5JA8B 1ZE3C 3CUPA 2ADGA 1K6QH 1ED3B 3IJ7A 2DYPB 5L8LB 1UD8A 1XL4A 2QHLA 2HPOA 3HC2A 3IN0A 5L8JB 4CC0A 4AYGA 1CG9A 1G84A 3OG4B 3P3SA 3SDCC 4QAWA 3U9PH 3VVVA 1NGWB 4NP4H 1T4KB 1U93A 1KBBA 1GC1H 1A1MA 1CL7L 1HSAB 1I1YB 1NJ9A 4OLUL 4Q56A 4RDQF 1IL1B 4OD3L 4BBWA 1HC1A 4F92B 1A6VL 2AGJL 2AVGA 1C7TA 1XTLA 2X4TB 4NFBA 4KKZA 2CBMA 4F33A 1S6NA 2CDFB 5AW0B 1HHKB 3MFFB 2BXZA 5SX5K 1F90H 2WXIA 1SOQA 3OKMB 4LCWB 4M7KL 4UBDD 4UQ3B 1QOKA 1HXMA 1ZRUA 2ZAGA 3QQXA 2HVJA 2HLEB 3MV9B 2FLBT 4HX1B 1S5IL 4BFIA 5K9JL 5CGTA 5F89A 1E5BA 4QRRB 4YDIH 3PQYA 4OCRH 5FO2A 2E59A 1IRAY 4J3OD 2D0FA 2PTTA 3ESVF 3RDTD 5E8DL 4PREB 4A39A 3ZR5A 4RAUA 3BD5A 1PLGL 2R2HA 4N87A 4RGND 5IUCA 3EFDH 3G6AB 1LEGA 2Y3AA 4L8DA 3OPZL 3KH4A 5IF0A 2JQMA 1BXUA 1IGML 4H88H 4PGZA 1TF4A 3MUGB 2XPZA 1I9RL 1M71B 2E46A 2HLAB 3LNEA 1BFVL 5JHMA 1F97A 4JY5L 4PJEB 1IILE 3HZVB 2G75A 3SKNA 3FRUA 2G2NA 5DDHA 3V95A 3L4ZA 4WY7H 4Z18A 1JPFB 4ZPTA 4IEFA 5E8NB 1GS7A 4HT1L 5HHVL 3GD1C 2KZBA 3DX3A 1PSKL 3BSZA 3AT8A 2YEVB 1QFHA 1N5AB 4YLCA 4P57A 2N0MA 5B8CA 5HGAA 1WA1X 1R75A 3BUQA 1SFDA 2FJFB 2LGNA 4OZIF 2EKSA 4XP1H 3CH1A 1JZIA 2CCLA 3L5JA 1FRGH 2A2QT 4AVJA 4PTTB 1QTYT 4KQ4L 3AREB 3P0YL 1B3JA 5BQ7A 4R4ND 3QQ3B 5CO1A 3U0PB 1XO8A 4L5FL 2FBOJ 1OAXL 3IXAB 3E9TA 5EOCL 1YMMA 2OMUB 4PH8A 4XODA 4N90E 3EDKA 1YQVL 2DI7A 4PJCB 5EHFA 5DJCB 3I75B 5CF3A 3HLAA 4IJ3B 2ATAA 1CZ8L 3QQDB 4A6YB 3FB5A 5SV3A 5MERA 4JFDE 3WD5L 5D6CA 1J5OL 1V3MA 2ARJB 1IB5A 2MPVA 3BZEB 3VSVA 3EYFA 3TVMC 3NYKA 1G7HA 5IFHL 3ATFA 1S9XA 1MCSA 3LNDA 4R90H 3DPDA 1G9ML 2G9KA 3FT9A 3FO1A 4I0KA 5G4MA 4KVCH 4MJID 3LZOA 5T1KB 2NY3D 3SN6N 3I6SA 1CZ8H 1DDHB 1NAMB 3NQKA 1A1NB 4LVOC 2A4EA 4KZEL 2YIHA 4PJCA 1ZHKB 5I1KL 1NC2B 2LLNA 1FSKB 3MXVL 1WUNT 1HOEA 2YD5A 5B8CC 2UY7B 4QIRA 2WZ0A 3HI6H 1KV7A 4XPTH 4FADA 2XZAL 2J8UF 5GRYA 1ITBB 3BVNA 5JQIB 5T1LA 2NUTB 1RLWA 1WZLA 3L2NA 1F18A 5E99L 6PAZA 2VQTA 5EU6B 5HHOB 2WANA 2YD9A 3NOIA 4FCAA 4NN5B 1JF1B 2CNZA 3D9AL 1QKZH 5JHDB 2WV3A 4R2GB 4M48L 4G8IB 3FJTA 4OQ1A 1E4WH 2DJUA 5DJ2A 4N2GA 2NY4C 5GGQH 3EXJA 3BH9A 2GKIA 3LRSB 5SX5H 1C5CH 4P2RD 3HE7A 1PSKH 5J6GA 4IU2A 4FLRA 1ND0A 2M83A 1N67A 3FQXA 3V4PB 4UZGA 4TQPA 2Z8VC 4TLTA 4PY7B 1NFIB 1ES0B 2DLFH 1SYVB 1T0OA 2FT8A 3N3EA 4R4FL 3IMWA 1QMUA 2XFGB 2NUTA 5ES4B 1SMDA 3IBEA 4NS0A 2J2ZB 5CBEB 4A63A 4DHLA 2RFXB 3TVMA 4ISVA 1IBFA 1FZKA 3QIWA 1D9KC 5ICUA 1ULVA 5TE4H 1TQTA 2NXYB 1QSFE 1YG9A 4JK0D 4G6AC 1IC7H 3L3GB 3OV6A 1W0VB 2DM7A 4PRHE 1J8HA 4FHKA 3N42B 3QBTB 5E8OB 5E8DH 3UO1L 3TEZA 1JN6A 2GVYA 4N5UA 2IDQA 2CUHA 5TQ0H 4JRXD 1G4MA 4OCRL 5GRJL 4AQEA 1X6NA 4BHUI 3MRGA 3NCMA 3ZZLA 4JFFE 4Q9RH 1DSYA 4DAGH 3KCWA 3DX4A 3F7PC 3O3DB 1BGXH 1OKEA 5TPWH 2GFBB 4P49A 5CSBA 1F90L 4M1CD 3HZKB 3QNXB 1P4BH 2K6YA 5DUPH 1Z2KA 3Q6FB 5HHXL 2BSSB 1HQ4A 5DK0B 1J9CT 1KUMA 1HIML 3SZ6A 3KXFE 3CFCH 4DJMA 2YPVH 4FL4B 5DHEA 4DP7X 3TEUA 4HWUA 4JM2C 5A2BA 1NANH 5K33A 5TDPB 3UAAA 2VLJE 3GI9L 1X7QA 3WJLA 1VFBB 4MD0B 5EIIB 2DLGA 1G87A 2WN3A 3GRGA 5A6IA 3U9PL 4DW2L 4RDQG 4JFHE 2IC2A 1QRNE 4PJEF 4JJOA 2HVBA 4HBQA 5HYSG 2GUYA 3TIDB 3LD8B 5IEKA 2OQJA 5LN4A 3N0PB 1VERA 5FYJL 1KJVB 3T3PF 3WNPA 3ZYZA 5DD0H 1UD5A 4Y1AA 5C7XL 4WO4A 5JTWA 5SWSA 3EYOA 5DS2A 2YS4A 1MW2A 1OARH 3TV3L 5HGBB 4E9WA 3H9HA 3BT2H 3JXAA 4MNGA 2P52A 1YVLA 2WWOA 1W6LA 1F8TL 1PVHA 3D39D 4HC1A 4IOSA 1YJDH 4JQIL 3RWEB 1I1FA 1OY3B 4BGLA 4EMZA 5K9KA 1EBPA 3C8DA 4WDIB 5ADOH 2XHNA 2YPKA 2DWXA 3EOBA 3ZKNC 3KXFD 4UAOB 5A2KH 2R15A 5TE7H 2XV3A 4UWQB 2HZHA 5LXGH 5D93B 2F54A 3P30H 3GLAA 3OAZH 3HKZA 2D2CC 3UZQA 4S1DD 1HNYA 4J2QA 5H4YA 5EH1A 1N18A 3SGDH 4L1BA 2OLDA 4Q6YA 4NQXA 1R3IH 3S8FB 2BFVH 1DE4A 3D4GA 2GCYB 1A4KA 1HILA 4K9EH 1ZVSB 4GBXD 3S35L 4ZAKA 1RP9A 4DKFH 4OW6A 1YEHL 2CDGB 4NXKA 4NGHL 4DN4H 2CK0H 2H1PL 1ADQA 4QKXB 4G80B 4PRIB 3PHSA 1UTDA 2A83A 5I2IB 5EO1B 4HGWA 4M6OL 1LILA 1XCQB 4MDIA 3JVGC 3L95B 3OAWA 1WYJA 1OALA 2EE9A 3U1SH 2JB5L 1RURH 2FX9L 3MGOB 3DBXB 4GT7A 3WNKA 1CLYH 1HE7A 3ZZ1A 1I1AB 1T66D 2NY1D 4G9FB 1BIIA 3ILQD 2XTSA 5JPMB 4DGYH 4DCQA 2ZXQA 2VRKA 3MJ9A 1UG9A 3AS2A 3UDWC 1H0DB 1UT2A 2MNUA 2WCPA 3PWJA 4GQQA 5D70L 4PJIB 4BZ2A 3J8F7 3O2VL 3QCTH 3VFSB 4EKXA 2OV0A 3BZ4B 3E38A 2HN7B 1U93B 2ISDA 4M29A 4KAQH 1JHKH 1QABA 1MCPL 3DVGB 3TFKC 4IBVA 1I31A 3GSOB 1SDDB 5J6HB 3GC3A 1OLZA 2H6UA 3QI9D 4CUCA 2P8LA 1FDLL 5B1JA 3DYPA 1WFOA 3IDXH 2DLHA 2MQCA 4HUWB 2XBDA 2JJWA 5I30L 4LXFA 4YNYA 1AO7B 4F7PB 1T1XB 4HLZG 6FABH 4QLRA 4G1EA 2ZSVB 4LCIH 4C83A 1T03L 2O61B 5HDBF 1HHGB 5FF6A 1T5KA 2I9LA 2F8XC 1KDJA 1M3IA 1OB1B 4Q2ZA 4OB5L 3WJJC 1MAML 1J12A 1JCVA 2KZ1B 4JLRB 5IBTH 2Q8AH 5C0BB 4YFLF 4HIEA 5DRZB 5F89B 2G5BB 3IETA 5INDB 4JO3H 2DBLH 4LCWD 4FJYA 1JPTH 2KT6A 2VXQA 2ZXAA 1MCOL 3WXVH 3FHQA 3G5VA 4P2OA 4JM0A 2J5LB 3E8UH 3MOQA 1YZZA 3PXJA 2GSIB 2Y25A 2Y6SC 1P4LB 2BRRL 1NA8A 2ROYA 4WWID 4IBYA 2N4IA 4AMWA 2ICEC 3EXLA 3C5SA 1UACL 3WKPA 4E2OA 5FLVA 3ESUF 3EYUH 3PL6A 1ZHNB 2FIKA 3CQQA 2UY7A 3FCGA 4PJFB 3FUDA 32C2B 2BVEA 3UEQA 4NRXA 4BUGA 4HISA 3SY6A 3SO3B 3FUIA 4FQHB 3UC2A 2BSRB 3MV9E 3IF1B 4XN9A 1T6WA 1A7BA 3BH9B 4P23A 4GIAA 2WVTA 1R3JB 4JE4B 1E27A 4JO3L 2Z4TA 2BIHA 4EI6B 3Q2LA 5F9DC 3GSWB 3RVUC 3CWGA 1KIQB 3FDWA 4F8LA 1LO4L 4BINA 2FT6A 3BZFB 5F7AA 1QA9A 2M8XA 2GAZA 3LKNA 4B9YA 4M7JL 32C2A 3ARZA 4J28A 3DETD 4LCIL 3UEZA 3VDAA 1RIVL 3FMGH 1J0KA 3LXBA 1OSYA 1ZT7A 3FT3B 4L4TE 5DRXA 3APNA 1W0WA 3S37X 5TGBA 5DZNA 2VUYA 4PBDA 5DO8A 2JKIS 2BP0B 1MOEA 4UAHA 1J8HB 5E8OA 2CBPA 1JHKL 1IARB 1XAKA 2QSCL 4M6ML 2PW2B 2BW5A 3B5HA 1ZS8B 5EU4A 4YK4C 3UIZA 2AJSL 2ENJA 3RNKB 3MRLB 5I1AA 3D4ZA 4U3XA 1MELA 4XP6L 3T09A 4UDUA 1ICTA 2BZDA 3EJZD 1IJ9A 2FQEA 3ULUL 4GG6B 1JYWA 2GFBA 3S5LG 5I16A 4IIQC 4OJFH 4XBPA 3ARRA 4ONOA 2H41A 2B4CC 1HAWA 1U8QA 2WAHA 1MWAL 5C08A 5JNYA 4KX7A 4D8PB 1PU0A 1TCRA 4BYHA 3ZMRA 2AEPL 4Y4HD 3SODB 3RKDC 4G7YH 1FFNB 1WBZA 3SGKC 1ORSB 3A47A 2ZYSA 4HS8H 4UZSA 3H1ZA 3TPUA 4EUPA 3VFPA 2DTML 4HJIA 1ZWIB 1VACA 3KYMB 4LLWA 2R56H 1BECA 4LLVB 3T4AC 3BKMH 1L4IA 3S35H 4W68A 2KERA 4HIIA 4CJ0A 2GY5A 5I16B 2VIRB 1E9OB 1OAZH 1JG9A 2VJ8A 1PZUB 1RUML 2VDNL 3ZDYB 1CCZA 3D4YA 3DSFH 1JZHA 1F4WL 3WSQH 3NSJA 4EI5C 1Z0NA 3RX5A 4XH2A 3SYQA 1ZIBA 4WHYG 3V4VB 1ORSA 3U79A 3B7TA 3DROB 1E6OH 1OZUA 4TNFA 3FTGB 1YC7A 3ZO0A 1OXYA 4G5ZL 1R34A 4HPYH 1KYAA 3IMBA 1SM3H 4GW5B 2HG5B 4RLDA 2JELH 43C9B 2A6JB 1TXKA 4J3TA 3T77B 2EVHA 5LNEA 2YPKB 3EOBB 4DGIL 3MBEA 4WUUB 1XEUA 4O2FB 1J0IA 2ZTBA 3C87A 2L0DA 4LLQB 3FQTA 3JSSA 1JMXA 4N8VG 5K9QG 1C12A 3TEXA 5KBLA 2CLVA 4O2EB 5I23A 4Z8FH 4MCZB 1OE1A 4LLYB 2F1EA 2ZKWA 7TAAA 3DXAB 5E5RB 4R6UA 3SB3A 4X6CA 1E5AA 2I07B 3K81A 2GJZA 3L5WB 3EJJX 3LH2H 2YAFA 1O7DE 4PW9A 1UXMA 4P06A 4LSRH 1RUKL 1URZA 3HI5L 3MRKB 5K39A 2V7HB 1PLAA 4MB3A 1A21A 2KQNA 4LL9A 4J2XA 1G7IB 2GK2A 2HMIC 1DQTA 5ECGA 3OHXC 3FPXA 4JZNB 1XXFC 3U48A 4HG4K 2IH8A 4L1DA 1AG0A 3A67H 4OZFB 2ZYRA 5I1LA 1N2RB 1QUNB 3IXTB 4KUZL 3RZCB 4ZSOA 5C92A 4QRTB 4MB4A 4OY9A 4PRBA 3D51A 4JFFB 4TOYH 1WEJH 2BS9A 4XX1E 2VC2L 4HUXB 5MP6L 5GSVA 4X6BB 5HHXH 3MKGA 3H54A 3QORD 4ZX6A 2DH2A 2JVUA 2X41A 1ZV9A 1G6RA 3VSUA 1MH5B 4M1CC 3A4AA 1W8NA 3VXSE 4E9VA 4NSKB 4EN3C 5C0FA 2BLFA 4OQTA 4P4RB 4FMFA 3S36L 1LK2B 4XNYH 2F7OA 2X70B 4I0PA 3H6AA 2FNWA 1R47A 3BDXA 4X6CF 3SDAA 3ECUA 5LGKA 4PGEB 4XN1A 4PTUA 1OP3H 2VMCA 4MQXD 2FZ3B 1A22B 2OR7A 5IR1B 4K3DL 2H4EA 3DHMA 3DV4B 3F5WB 5DHMC 5TH2B 1OW0A 3I02A 1Z9OA 4Y5VA 5IGXL 3IDNB 4YNYB 2XQBL 2P5WB 2XWBA 2AI0H 4JAMA 2PO6C 4WI5A 5AW4B 4AE1A 4XZ4A 3UCRA 1VB9A 5EZLA 3A6CL 2IADA 3NZUA 1U8LB 4PV8B 1BG9A 1NUFA 3CDGA 4P46A 1IC0A 5E7FA 1T4KA 2CO6A 4Z7OE 1Z9LA 2B3IA 2ICWA 1XF4B 2IQ9H 3O9WC 1CDHA 1IAIM 3DTXA 5ANMB 2YXMA 1V54B 1UXLA 2H8PA 2EUVA 2OR9H 1JNLL 2SEBA 4OGAD 1F4XL 2DWSA 3DNKA 3QJRB 3G5YA 2WTOA 1HL8A 1I9JL 3TBVA 1LE9B 5KSVB 3TP4A 4B9IA 1XCQA 5E99H 4LRNL 3MPCA 1MREH 2X89D 3CG8A 3EF7A 5AAMA 4KNSA 3B2VH 4X83A 1I8KB 4YDNA 1CXKA 1IBDA 2XZAH 5EZOH 3STZA 3LKRA 4EN3A 3EBHA 3BWUF 4Y7MA 3WEAA 4Z7NE 4RA0C 3L4UA 4R0LC 1OEZW 4X7CC 3QZOA 5JZ7C 1L5GA 3IDIA 4P5MB 3VGEA 4L9LB 4D3CL 3ULVF 2CWRA 1EGJL 3NH7L 3PWLB 1XBRA 2JLPA 3HE7D 3T0XA 5FM5O 4EO5A 3DPBB 5GQBA 3UAJD 3ZK0A 5C9JA 4R90L 2JWYA 2R7EA 5IFHH 2YA1A 5KSAD 1T1WA 3C09B 2FX7L 1DJWA 2RBLA 1J5OH 4HHWA 3DA0A 3WD5H 2FHFA 2O4EA 5FCSH 2PW1A 4P2AA 3JTBA 1OAKL 4YO0A 4W9EC 4MWFB 1AO7A 1E40A 3D7PA 2Z7YA 3HN8A 2P5EE 4MZ3A 1B0GA 1QLEH 5IHWA 5JW3L 1ZSDB 5EOCH 1OAXH 4GUQA 3FT3A 3A6BH 1J05A 4ZW5A 2Q10A 1BBDL 2ZQKA 3P0YH 1HNFA 5BOJA 1PY9A 1OQOA 1TZGH 4RZKA 2XTLA 1SDYA 1TR7A 2FLMA 3Q6GL 5DJYA 1LO2H 3S8WA 3CH1B 5HJGA 5LAXA 1CK0H 1FVCB 2GI7A 4NYLB 5D6DC 5AAMC 2EYTB 3SGEH 4ZMYA 3NPSB 4PGBA 2IANA 1TZHA 4F7TA 1DUYA 5SWSD 2HAZA 4LSUL 4YOKA 2WXNA 2EKSB 4X5PA 4JM2A 5IV2A 3GYRA 4HT1H 2APFA 2XA8H 2UYLB 2IH1B 2Y7OA 5DD6B 2WMPB 2CBOA 3INUH 5DJ0A 3Q5TA 4JY5H 4PG9A 1ZHNA 4P2CG 2LHAA 2C3VB 1U2YA 1I9RH 4CSSA 4EOWH 1RZPA 1K8IA 4BCZA 5ANHA 5FHAL 3BXNA 2YQ2A 1QVOB 3CVCA 4HCRH 2H45A 2FD6H 5DEZA 4HGKC 2OXGA 5FUZH 1O7VA 4PJ9B 1QNIA 1OCZB 3VMNA 1F42A 1KGCD 3BUYA 4ZD3H 4EDWL 1L0QA 4WGWB 5MI0B 5EC1B 4OM1H 5KVGH 1JPGA 4HIXH 2D7NA 4N24A 1CICC 3M6DA 1FAIL 1OGSA 1ZVHA 3SE6A 1ZEAH 5L2KD 1G1CA 3EDFA 5KZCD 1UA3A 3RL1B 2VYRE 4QWWC 4M7KH 4FMKA 2W80C 4TULL 2R83A 2CCWA 4NFCA 5AYQA 4N8VA 2WO2B 5LGJA 1EH9A 2W0FB 4WWKC 1FH5L 3ARDB 3MLZL 3BKJH 5IB1B 1UC6A 4U1MA 2WXRA 3LH8A 3KYNB 1J9RA 3MOBH 2AGJH 4JM4L 2BHZA 5I75C 1UXSB 2K70A 1H6EA 3FBKA 3GEFA 3S4SG 1J18A 1E67A 1IAII 2E4TA 4YDVA 4JZJC 4XCCH 4OLUH 3F6LA 5E5MB 1CL7H 2ZUWA 3KJ6H 4NP4L 5CEZE 2BERA 4LLAA 4LVNC 1T7VA 3WNIA 1I9IL 3OAZK 3I74A 3ZVVA 1GZPB 15C8H 4L3ED 4MBOA 1UADC 3E7JA 4MZIA 1ILUA 4UQAA 4HWNA 4M8UA 2OX5B 3GBNH 3TBTB 1TVHB 3EZ8A 3KWXA 1HHKA 1YEIH 3FU0A 5D93C 2E74C 1SXZA 2CG9X 5DUBB 4PM1A 5AOMA 3H9SE 1OOAA 5IROC 4EUPG 4IRSC 5D5ME 5JOEA 4GY4A 2XN0A 1A6WH 2OZNA 3R18A 3S7GA 1CFVL 1MW0A 3QHFL 2MJWA 2X4QB 1P9MC 3MLRL 4ZUWB 3T3MF 1N2RA 1QUNA 4P07A 2Z8WC 3V7MA 4G6MH 2VXUH 4QTFA 4L3CB 1BCIA 3HA0A 2F53D 2WQXA 5F7UA 3ZE0F 2RCSH 4NPYA 1RLBA 1G7MB 3PGDB 4HGMA 2JKTM 1Q4NX 1ESOA 1GVIA 1RERA 4TN9A 2WB7A 2FX8H 1A2YA 4LZKA 2YC1B 4WW2C 2IWGA 3GJFA 1T0NA 2V5YA 2CALA 1JVKA 2A9BA 1KGXA 2WC7A 2BNRB 2OMVB 5TFSL 1A9BA 5HDOA 4IKNA 3TTSA 4W9LC 1PTZA 3BVUA 2WNWA 2R0KL 3MRMA 4KI5F 4LSVL 4O9HL 3RWFB 3O6LL 4XVJL 4HDIB 1EPFA 4FOMA 4Z7UF 2EJ1A 4JGJA 4FNPA 1GYCA 2P49B 4FQJL 3GBEA 1R5WA 3FOMA 4P3DA 3HAEG 2WJ7A 1A2YB 2IH9A 4AQ8A 3VE0B 1T5WA 4H25B 4MNGB 4ZOEA 4JDTH 5EOQH 1MWAB 2UZYA 3HG2A 5C0GB 5I8KL 4HUCA 5EU6E 2X2YA 4RDBA 1AYOA 4PRPD 5I82A 2EDJA 4XO8A 2CO6B 4A6YA 1BQLH 2WAQA 5JIDA 1X5XA 1FH2A 3LV3A 1YEFH 5IB4A 3WXWL 3X14A 1UZ6E 4HQQH 2EEDA 2MTPA 4GUPA 2IALB 3SE8L 4KKLD 5D7SL 2QHRH 2SEBB 3TT3H 4FXTA 1MAJA 5K59E 4I89A 4DP1X 3CPLB 3GO1L 3EFFB 2NXZC 1VPOH 1HKLL 3ZT5A 1OTSC 3VDBA 4YHYC 3QG6B 1KTBA 1F3DH 1P6WA 3MRIB 4AM0B 4MMXA 1VFAB 1CF8L 2UZXB 3LXCA 4PB9H 2H26A 4BCYA 5L7XL 4WTZG 1ACXA 1IGYA 3KMDA 2CPCA 2VMJA 4YEFA 4ZUVB 2EEXA 2AXFA 2GBAA 2X70A 2K78A 3WE6B 1IGJA 1OD7A 5SWZA 4DQAA 5J9PB 2A6IA 3OR7B 4K7PX 4NX0A 5J3HD 4RMWA 1CL7I 1JL8A 2PP8A 3GSUA 5IVNA 4ACPA 4PCTA 3BE1L 3MRQB 3BEWA 4P8QA 3B1TA 1KXVA 3VFUB 1EEZA 5ACZB 1KCBA 2CD0A 3FSZA 5IHBA 2PCXA 4LL4A 3HAEA 2VABA 4KRNA 1EHLH 4EPSA 1JSYA 2XU9A 4MVBD 5MENE 1YY9C 5DMYA 3PGCB 2R2BB 3GPEA 1BVLA 3W39B 4PJIA 5DRNB 4UNUA 5I1HL 5J9PA 4JCMA 4NHCH 4UOW1 3EYSH 3KGTA 3UPCA 1B0RB 1XF3A 4YHML 2E7DA 2CGZA 4PUBH 3TJHD 4LSQH 1AS6A 3AB0C 3IN2A 1ZLWK 2KKQA 5GZNC 3RDTC 2O30A 2ZPKH 2WQWA 2CKBL 1OTUC 3CLFH 2CMRL 1WO2A 3C8KA 1O6TA 1G7LA 1XCTB 5GISL 4E9XA 2X4NB 3RL2B 3V0DA 4GKLA 4HUWA 3QAQA 1KYUA 4OIBA 4XMWA 5D1ZI 4APQA 1NL0H 2EE3A 3EH2A 2NY7L 2DLEA 2L3BA 3ARGC 4HKXA 3W0WE 1BFSA 1KB9J 2W0PA 1E0OB 1I53A 4MDJA 4J3UA 4FQQA 4FFWC 3QNZB 3ARBB 3K8KA 5BRQA 1MY7A 3WAKA 2ZCKL 2PWHA 1K2DB 2MCMA 3X3FL 1QPPA 5DRZA 4XMLL 1P1ZA 4UB0L 1H3VA 1A3RL 3GINA 4LGRB 2BNQD 2D4FA 3IK2A 1XMEB 2OJZH 1ETB1 1MKFA 3Q1SL 3TC9A 3A24A 4LCUB 4U1NA 3VB8A 3QIBA 1AE6H 4TXVB 4B53A 1XCWA 2NX5E 4KRLB 3GWJA 2H6PB 2Y5EA 1WZMA 3ASOB 3VSTA 3L5IA 4BEIA 1A5FL 4HMCA 3ARDC 1LDSA 3FO0L 4JY4A 4ZTEA 1OT4A 5EU5A 3RP1A 4X50A 3VXME 3WIHA 1OK0A 4WAFA 3MBEC 4PJXF 4JJ5A 3VYNA 3LPPA 4MLIA 3E6FA 1LO5A 4QXGH 2EZ0C 3FCBA 4LPWA 5SV4A 2D0GA 2JB6A 3MA9L 1M1SA 2YK1L 5E95B 5D72H 3VXPA 1YA5A 3OQ3B 2BOCA 3JT2A 4M43L 5IHLB 3RZCD 4M4RB 1NM9A 3AXHA 4G72B 4OD1H 1MUJA 3N04A 1CYWA 4LIQL 3JWOL 2WWKT 3GPSA 4HBCH 4WEMB 1H6FA 2XIDA 2R23B 2CSPA 4NQQA 3AS1A 5FM4A 2HX9A 4DPBX 3FTUA 1KLGA 4LDLB 2VLME 1HHJB 4PS8A 4QOKD 4P2RE 4OCYL 5TK4A 4Z7VF 1KN2H 2ED8A 5ILTH 4WFHD 4TM9A 2WBXA 2E3VA 2CRZA 1DJSA 3V0IA 4ELDA 1L9NA 3U6XA 3KPRB 4FNQA 4HJTA 5DVKA 4HIHB 1JZ8A 1I75A 1SJXA 4TVPE 1FG9C 3VMPA 2R0WL 4MJ4A 3QB7C 4UMSA 2YBRA 4M4RA 4PWIA 4R7VA 2VSMB 3QI9A 1A3QA 3CK0L 1A4KB 1HILB 3FRPA 3UYPB 4HXBL 4PY8J 1E8XA 4C58B 3BP7B 4F5CE 5D1XD 2ORBL 4TTDD 1AOZA 1BOGA 3IDGA 3QK0A 5DCCA 4L1TA 3DOSA 1D2OA 1ZS8A 3H0TA 5EU4B 3N2JA 3QEHA 4S1QH 4J6RL 2OMXA 5ALCL 4P59L 4Z7WA 4KHXH 1OM3L 1PNCA 3EH4B 4XGZB 4HLZH 2ADYA 3CZFA 2FYVA 3M8OH 3N40P 2CHXA 4X4XB 1HHHB 3Q3GA 4UILH 4F8TA 4HUVB 1EFXA 1KTCA 4WW2B 1OAQL 4I0PD 4I2XA 3V6BR 5C0BE 1AZBA 4ZBJA 4EUPB 5HTSA 4Y4HB 1AGEA 4JFDA 1ETJA 4M02A 4GRMB 5JW4R 2ZNXA 3KM1A 5I1EL 3EJSA 5D7JB 1ADQH 4XMTA 2OK0L 4EN3D 5HJ3B 2X44D 4L37B 1MRCH 3PUCA 4HALA 3NACH 1KIPA 3OGOE 4HULB 3HZMB 4NO2B 2KLSA 5BS0B 3HNTL 4ZS7L 4IBUA 1ZHKA 1SN0A 3CFUA 4S0HA 4JG9A 3GXDA 1LMIA 4K8RH 1CICD 3WTXA 3EUDA 1OSZB 5IVXF 1FPTH 5EA0H 2YD8A 4JBSA 5E70A 4MS6A 4BUQA 3D18B 2J8OA 4HJUA 1F11B 3S96B 4DETA 4ZW3A 2AP2A 4AZUA 4M9OA 4FLSA 3ARVA 5G2NA 2LQRA 1S7XB 2CM6A 1EJOL 2M2DA 2NXZB 2NCEA 4X4YA 1FL6B 2NTFB 3ULUC 4LPVA 1D5MA 3M86A 4IU2B 1ZHBB 5C86A 3BPLC 2DQEL 3QISA 1ACYH 1ZV2A 3HPLB 3HS0A 4DFIA 5CCJA 4XC3L 3SE9H 5AKSA 2R0ZH 3H2WA 5TF1L 5T3ZD 2EYSA 4JQIA 4HJ0C 3L9YA 3V4VH 1WBYA 4F15B 4YR6A 3N55A 3V6FB 4PBWD 4Q8BA 5K39B 4L4TB 1C5BL 1FE8H 1MN4A 4I9XA 3TEWA 3MRIA 1GW0A 2PO6B 1Z5LA 1S7QA 2AK4B 3DHUA 1SXAA 2I07A 3LN4A 2BMKA 2F7IA 5FCUH 5T3ZE 2X1WL 4K3HA 2XWEA 1NFKA 1JWSB 3WLWD 1J8HE 3N40F 4JB9H 5IG7A 4DVBA 2YD7A 3FQWA 1OGPA 5IJVA 2DQHL 2VDMB 4KK6C 3MLWL 5GIRA 4Z1PA 4DKAA 2JJSC 2XQYA 5ETUA 3CSGA 4NRYB 5JW4Q 3OBAA 1D5RA 2QPFA 4AV0A 4X5LA 4G7QB 1PZ5B 3CVHA 1CFQB 4QRTA 3C5XA 4M4PA 1S5HA 1WHOA 4WVRA 4X98A 4YDKH 2YEZB 4U1LA 2Q3ZA 2Y23A 4XWOC 4L0ZA 1MJUL 3BFWA 3VA6A 4JKLA 1H6UA 1KXTA 3KXFA 5C0GA 2ICES 3COOA 1H5BB 3KHQA 4I1RA 2P8PB 3JV6A 3DURA 3NPZB 5IT2L 2YAEA 1RJLA 3AG2B 3DRTA 5D7JD 4JPSA 4H8WH 2DJ4A 3T6WA 4BSJA 2O6EA 4X5WB 5EO0A 4P2QB 2EDNA 4V1DA 3N1PC 2EDHA 2WJ5A 2MSPA 3NABH 4M8QB 4PWHA 2AQ1A 1PEZA 1AQDA 2WBKA 5DD5H 5BOZG 2YUWA 3LAFA 4YHKH 3FQNA 1UH2A 1THAA 3LQZA 3FUFA 3OHXB 3LQAL 5CJOH 4XXDB 4C4UA 5T3ZH 1A7OL 1KCUL 4TUJB 1QNZH 3DSNB 3OTTA 3A4EA 4KTDH 2IQAA 3QUKA 1JERA 4OFYD 4G82A 3I50H 5SWSE 2UWEE 1MCBA 4Y4KB 2HFEB 3GXNA 1DQIA 3QQDA 3K6SB 4NKDB 2ROXA 2JJSA 1MQ8A 2YSSB 4MNGE 3FS9A 3DUSA 4Z0BL 1NMAH 4WENB 3QG7H 1U4EA 3DIFB 5E1AA 1JXFA 1O6SB 2HVJB 1I1FB 3F64A 4BFIB 4H8PA 2R1XB 3LQZB 3PHAA 3GB7A 3CLEH 4OI8A 1RU9H 1RZJC 1U58B 1EZLA 3M7OA 2PLTA 1JFHA 4Y4FC 5ID1A 1U36A 4PMEA 1FJ1A 1XCXA 2BINA 1DVSA 1HL9A 2DMBA 3I3EA 4ANWA 2VXTH 1OM9A 2JSFA 2X1XR 3ZRFC 4GW1A 4CAGA 3DIFA 4JHWH 1KULA 1F1AA 4JPVL 2E7HA 5H2BA 1HINH 1CE1L 3EZJB 3C9NB 1U8IB 4L3FA 1BJ1J 4CNIA 5IFAL 1G1OA 3IDYC 1JGDA 3HNSL 3V9EA 2L4OA 3MSPA 1ZVSA 1MFCL 1LO0H 4DEPB 1AS7A 5DK2B 3ME0B 4J3BA 5LVEA 4U6YB 4M3HA 3DMMB 4Y2LA 4J27A 1OL0A 5EEWA 3FTZA 3MJWA 1D2PA 5HSFA 3TURA 4S10A 5H37A 4P9HC 2PW1B 4N2BA 1IC4L 2OMZA 1YNLH 3K2MC 3CFKB 3REWB 4U4IA 1NEUA 4YL9A 2X4RB 1R5VB 1FL5A 4RGOH 2NXYC 5IROA 3TBWB 3OF6A 3RGBA 3RG1C 2WYHA 4Y19D 1J05B 2CJUL 2EIDA 2OFQA 3LZFL 4NZRL 5C97A 2ZXEB 4N0FA 5KW9L 1RULL 2A0LD 3SDYL 4J8RB 4FQQB 1V27A 4X6CB 3PDGA 1BMGA 4RQQB 1QG3A 1H15B 3CZUB 1JVOA 1FVCA 1PIGA 4NYLA 1DQMH 4X7SH 5KG9A 4ZUTA 5J6SA 1MLBA 2OSLA 3O8XB 2GITB 4XN8A 3FRPB 1JTTA 4PJAB 1ZHLB 2IEPA 4XCNB 2A77L 2P8LB 2AJYH 1SLWA 2OAAA 2RB8A 2WWMC 3QJTB 1BQHB 4U6XB 5KSUB 2BX5A 2V3DA 3U7YH 1PJWA 4FAAB 2YXFA 2ZXBA 4G8GA 2VR5A 3QDJB 2FATH 3MRRB 4NM4L 2ZOKB 3RTQD 3RI5F 4GRWH 3H4HA 2G9HA 3GRWA 4DNLA 2R51A 1G9MC 3W0WB 4XCFL 1XD0A 4BZ2L 4E36A 1KY6A 5B1CA 3F58H 3ETBF 2ZP0T 4OLZH 1HQRB 4WI0B 3OB8A 2IDSA 2IOOA 4P4KD 3TCXA 3BUYB 1UA6H 5EZPA 2GHZA 1AHWC 1CWVA 3EYQC 5AENA 3K8LA 4FXGA 2ZE0A 5JHDA 5JOPE 2WZPA 4Q74A 2APTA 3GF8A 3WDIA 4HJJL 4M8RA 3QR0A 1A1MB 1GGIL 1HSAA 5F96L 5CSGA 2X40A 4YWGL 1Q0EA 2IWEA 3POCA 3CPUA 4IOFD 2ITDA 4N8VB 2HRLA 1C1EH 3T6VA 2IXQA 4CU8A 4GG8A 4NZUH 1Q9OA 1QACA 3F6IA 1U95B 2KDYA 5J12B 3VD5A 4W6XB 4L4VE 4EDXA 4L8CA 5DWPA 3B8YA 1I7RB 4BZ1H 5K9QI 4JQXC 3L3KA 1QPKA 3SBRA 4CA4A 5HHMB 3V9FA 2WYIA 3BP6B 4Q9QL 2NZ1A 4X6DB 3P2DA 2OM5A 4Y4HC 1INEH 2QVIA 3TNMA 2ATPB 3NQIA 3MUY1 4NT6A 1ECZA 1OO2A 2UX6A 2HX8A 4MJ5A 1MEXH 3AU0A 1CI5A 5E5LA 4HIQA 1P4UA 3HS0B 4KJPC 3LKNB 4E5XB 4UYQA 4WJ5B 2IBZY 2OMTB 2PYFA 3DDGA 1RUPL 1KCLA 1QFUL 4HEMA 3OWRA 2FYYB 3ILDA 5I74C 3BDYL 4OZHB 5D7IF 1SMAA 4P2RB 3C6SB 3VW3H 2ZXWB 2D3NA 4PJ8B 5F8RC 2NDFA 3PIQB 4JZJB 5GXBB 5CAYB 1XT5A 5HDQL 1S7QB 1GCFA 4H8UA 4FF9A 2FJGB 4AJVA 2LU7A 2P43B 2GY7B 1YNKH 3KAAA 1BW8A 1BVKB 1CXHA 1GZQB 4FTVE 4JM2D 2DF3A 5DMIH 2VQ1B 4XO4A 1F58L 4KHTH 5CEYB 2AZAA 1KIPB 1T83C 5CN1A 4J3VA 4NO2A 2HRGA 4WU5B 3HG1E 3HG3A 1AD0B 1Z5HA 4J12A 4QHPA 3SQBB 3BAKA 3NFPB 3TYFA 1F13A 3KW7A 5F72S 5HHOD 4G59C 5EU6D 1LEIB 4D0DB 4CADA 1XGRA 1U92A 4BKLA 2XACC 3OSVA 1AGCA 2VISA 4WQOA 3UTOA 4ZUSA 1HCYA 2WXFA 2HUEA 3EYOB 4OBRA 5AW9B 3HE6D 1L7TL 3H2QA 1JI1A 1YYLH 4ZO8A 2RJMA 3BZ4A 3D50A 3OXSA 3SPIA 2FQDA 3KYOA 5D2LB 1AVAA 1UUSA 4GXUN 4HDIA 5ERWA 1MFBH 4B9PA 5D4HA 4MAYD 3NTCH 5JPNA 4OLEA 2VWEC 3ATBA 4X6FB 1KJ2A 5G4NA 3AFLA 5I75B 2N7SA 4PSPA 5AW1B 5E9DE 3LRKA 3LS5L 5DGRA 4TNEA 3UBHA 4AL8C 4WEUD 2ZCLL 1EDQA 1MCWM 1L0PA 2Y3NA 3VX0A 3V6ZB 4M61B 5CJ5A 4NKDA 3ZIYA 1AKJD 1CURA 1H3UA 2OP4L 3D0LB 3GUFA 2GK0B 3AQXA 3LMJL 3V0JA 5E23A 3OMIB 1SEQH 2FGWL 3VWKC 5E2TL 1B0IA 3ZE1F 5IJBC 1E5YA 2FECI 4MNQA 4L8BB 3TJPA 3P4NB 4G8EB 5HY9A 1I1YA 4BFKA 1E9PA 5DVPA 2P80D 2P8MB 4F2EA 5C3IA 2YEZA 3MGTB 5EOCJ 1MF2H 1ZLEA 2KL6A 3OWEA 4ES9A 3FQYA 5L9DL 3D2UB 1H3GA 5IREA 3L9RA 2XZQH 2Q6WB 3U4BL 2JIXA 2V8MA 2VDKB 1JGLH 1EMTH 2W0FA 3ARGB 4XNZB 5KVEL 5JXAH 3FQRB 3G9VA 4N8UA 3L3DA 4PW3A 5D5MB 4O2CB 1LP9A 2OL3B 3DX8B 1RY7B 4ZFGH 1U3HD 1U8KB 4XP9L 3FAWA 3AU1A 1LGVA 5E08H 1X5YA 3CZLA 1IZJA 3CFKA 5EU3A 3QNYA 1U2CA 4N26A 4QRPB 4AL8H 4NN6C 3V5HA 2MQ3A 4ZFGL 3VXUB 1IGIL 1X5MA 4OFPA 4FL4C 4KMLB 3FFDB 3OX8B 1T04A 1VLXA 2K7PA 3DTDA 1PZ3A 1W0WB 2ADFH 1M3JA 2AMUA 5D1QA 2YZ1A 2XZQL 2E9GA 4ZNEE 3NCJH 2DEYX 1XIWD 4G43A 3T8MA 1EFQA 2MPAH 3QDGB 4ZG1A 4RCAA 2CXKA 2LVCA 3OXRA 5GPRA 3ZYJA 1QBLL 3ZZSA 5I8EB 4TUUA 1IEBA 1U33A 2MNJB 1BXAA 4Y0GA 4V33A 3UZEA 5IQMA 4NZTH 2WP3T 3WEMA 2BVPB 1MXDA 1TLMA 1FCCA 2DQDL 1UKQA 4S2SA 1KELH 1E6JL 3BUTA 4NUMA 1QRNA 4RNRA 5E8PA 4DF9A 4TSAL 3V55A 1DSFH 3BSGA 3Q44A 4WI3A 3ZHDA 1I1CA 3WFDL 5CP7A 5IEKB 4ODVH 1XCTA 3QWOB 2Z0BA 4TV3A 5FA4B 1AS8A 3PS6A 4GKSA 3PL6B 3QT2A 5SWSB 1Q9LB 3L3IA 2YRBA 4LOEA 4GI8A 3J27A 4UOZA 2C3XA 2YMXL 3D09A 1GC1C 1JNJA 4LL1A 4B9JA 3C12A 4HSAC 2P5ED 4XVOA 3QCVH 3B2UD 4JFPA 1A14L 3GBDA 4Y88A 3A22A 5IVXA 4LEBA 3RVTC 4R2GC 4TLSA 3SPCA 2X2IA 3TOPA 3OZ9L 1ADWA 1W72B 5EUKB 4X0KB 3QYMA 3HN5A 4JMXA 5EUOE 2Q8BL 1MFDH 3BEVA 5FHBL 2G75B 2W9DH 3SKNB 1KTRL 5E4EC 5EDSA 1VEPA 4L9LA 1FC2D 1BAWA 5ALBL 4UT6H 2WYZA 4K0OA 3BP4A 4LAQH 1MWAA 2UZYB 2XQ0A 3L3KB 3O11A 2VDQH 2I60H 3I2CH 1P2CB 5CKGA 3MA7A 3U2JA 4OZFG 1D5XB 1EVTC 2JJUA 5ESQA 4GXVL 4KY1H 1DQJA 2KPWA 3IGUA 5DJXA 4PCKA 1SBSH 3AXIA 4XPHL 3ENEA 2CHDA 3GHEH 3ZGIA 3VXQB 4JDVA 5FOJA 3S88H 3D4CA 1F58H 1J1OL 2CDGA 3TGXA 2BP5M 3IKKA 3OC5A 4NBYB 5J3HC 5JUEL 3WTYA 1M6OA 1WZ1H 3EHBD 1FN4A 2P5EA 1U4FA 4M7LH 4H2AA 1NFIA 2UZIL 3MLUL 2XG5A 3DJRA 3OHMB 2Y7NA 5C0CB 2NQCA