3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
molecule keywords Otoferlin
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
4FHJA 2ISDA 4F92B 1WFMA 3W57A 1W15A 3ML9A 4QAMB 1RSYA 3W56A 3QR0A 2K3HA 2R83A 2A4ZA 3NZUA 4KZCA 1UOVA 2YOAA 4Y1SA 3KWUA 3ZVVA 2Q3XA 2K8MA 4L23A 4EZKA 5JHBA 2Q0ZX 4L1LA 2CHDA 3F00A 3HHMA 3L08A 1A25A 2NCEA 2D8KA 2V4LA 3KWTA 3S2AA 1QATA 4F1SA 2WXKA 3RPBA 3QK0A 4XE0A 2WXHA 4LDCA 1E8XA 3CSTA 4FADA 3L54A 2WXLA 5CCGE 4EZJA 1DSYA 3HIZA 4TS6A 3DPDA 1E8ZA 4FJZA 2FK9A 2Y3AA 2CHWA 2N1TE 2K4AA 2JQZA 3CSFA 4WWPA 3R7QA 3TL5A 2ENJA 1BCIA 4NPKA 4OVUA 5G55A 1TJMA 3PYCA 3FBKA 1K5WA 4G11A 4L2YA 2K45A 4XZ4A 1E8WA 3FDWA 5EDSA 4IQHA 1RLWA 3L9BA 5G2NA 3PFQA 4QJ5B 4QJ3B 4QJ4B 2ENPA 1GMIA 2WXIA 2A5UA 3TJPA 2EP6A 4IHBA 4ICWA 4MJJA 2DMHA 1BYNA 2LHAA 2WXJA 2QZQA 1DJWA 2CJTA 2CM6A 1V27A 3L17A 3PREA 2ENQA 4PS3A 4HVBA 3R7RA 3ML8A 3IM1A 4FHKA 4L1BA 4BFRA 3ENEA 2NSQA 2WXNA 3APDA 1BDYA 2RD0A 1UGKA 3PRZA 3L16A 3QJZA 4WWNA 4J6IA 3OHMB 1YRKA 3F01A 3F04A 3OAWA 4FJYA 4WEEA 2X38A 3M7FB 4A55A 1E7UA 4LT7A 3PS6A 5KJ7E 4FLHA 4LCVA 4AJWA 4FULA 4NPJA 3ZW3A 4F93B 5H4ZA 2WXGA 3GPEA 4JPSA 1E7VA 1W16A 2BWQA 3N5AA 2CJSA 4URKA 4ANVA 3T8MA 4F91B 4XX5A 4AOFA 3IBEA 3QR1A 2UZPA 1DJHA 2DMGA 5CCJA 3SD5A 4BGDA 4HLEA 3APCA 3JZYA 3F05A 4TUUA 4TV3A 4DK5A 4KITB 3ZIMA 1E90A 4Y1TA 3L4CA 3TWYA 1UOWA 2WXRA 3HN8A 2WXPA 2B3RA 2WXOA 2WXFA 2QZ5A 3QAQA 4FA6A 1QASA 3NZSA 1DQVA 4ICXA 1HE8A 2CHXA 4DNLA 3B7YA 3APFA 4ANUA 5H4YA 4NP9A 4V11A 2WXMA 3MJWA 3NSJA 3LJ3A 1DJIA 1DJXA 2KI6A 1DJGA 4PS8A 3P2BA 4KZ0A 4WWOA 1DJYA 1E8YA 4EZLA 3L13A 2Z0UA 2CM5A 4OVVA 4GB9A 1DJZA 1RH8A 4GNKB 2FJUB 4ANWA 4NS0A 2ZKMX 4PS7A 3RDJA 3DBSA 5JHAA 1CJYA 2YRBA 3QARA 5T8IA 2NQ3A 2WXQA 4ANXA 2CHZA 4WAFA 1TJXA 1WFJA 5CCHE
chains in the Genus database with same CATH superfamily
5DFVC 3CHRA 1NGQL 2R1YB 3CN0A 5AW2B 4A2MA 1RSYA 1KELH 3JUYA 3UBGA 1EDHA 3BLKA 1GZHA 1OF2B 3DGCR 3N04A 5FYLE 1ICTA 1J0JA 1FBIL 1L9TA 5FCUH 1JPST 5IBUB 4PCSA 5JXED 3QQ9D 3B43A 1IKFL 2WIMA 3DUUA 3HG4A 4LDCA 5BV7L 4UT9H 5K9JH 1ZWIA 1RY7B 3AQDA 4N0UB 2VKXA 4XTRC 4ONHB 4AUYA 1R24B 4JY5L 4AGQA 1D5MB 2OZ4L 2V3FA 5DJ6B 4UZSA 1I1FB 2Q8AL 1RP8A 1TFPA 4QRSB 2X42A 1OTSD 2XRAH 1UH2A 1DVSA 2YGVA 3ESPA 1O6SB 3I9PA 4EF3A 3ZMNA 1HYSD 4DP2X 5I0VA 4BQBA 1M2VB 3VI3E 3C6SA 5F7LB 1A6ZA 2XZCH 3DI2B 2AS5M 2ZG2A 3RURA 3QJQB 5CBAB 2PXYA 5J56B 1FE8H 2OJ1A 1E3ZA 2UXTA 3EO9H 4GKLA 4HBCH 3S3PA 1FZOB 3MRBA 4KRLB 4FCAA 5DLML 2RMNA 5IF0A 3KPLA 2R0ZH 3DYOA 5T5FH 4JFED 2AK4B 2OPCA 2XKUA 4G7YH 3TFKC 4JFPB 5C0AB 3L17A 3PHQB 3KPRB 2JELH 5D1QB 2EIKB 3C09C 3RQ3A 3VNZA 4S2SB 4YHMH 3O8XA 4S1DD 3JZ7A 3QFJB 4FG2A 1Y7VA 4JNXA 2B59A 3HI6H 2VSKB 5CINL 5E4OA 2NZ9D 3F7KA 3CZUB 1T4KB 4OGAC 2CMRH 1RUAH 4A55A 5CEZD 2ZJSH 1BFSA 4PP1D 3WFHA 4X4YB 4L8CB 4WU5B 5EC1A 5FB8A 4HUWB 5J6HA 4TSAH 3VD1A 1CXKA 3DPBA 1GTNA 5DRNB 4PJCB 1M6OB 1JGDA 1MHPL 2ZAGA 3S35X 1QEXA 1JPGA 1R5WA 1VRSA 5KSBA 3MRMB 1R5IB 2GITB 3CXDH 1YJDL 3BZDA 3AFLA 5AAMA 1FAKT 4UM8B 5EU6E 5MENB 4GUQA 1BIHA 4DK6A 1JZ4A 4C4UA 4TVSa 4L1SA 4P8QA 1L3WA 3U9UA 4NNPH 1CS6A 2VLMD 3MV01 3JSSA 2VXSH 5JA9A 2WKLA 5K39A 1IC5H 1UM4L 4LFHD 4PV9B 2PNDA 2JV6A 5G4OA 1YNKL 3F8UB 3M1OA 1ZV5A 2AQ3A 2BZ7A 2YAQA 3MLWL 2BY0A 2V3DA 3UTQB 3FONB 3I9IA 4R26H 4ODSL 2Y3NA 1KV7A 2WPGA 3OG6B 5AYUH 5IEKB 2O26U 1KBVA 3ZZLA 4PW4A 3RNQB 1HILA 1PBYA 3HAEA 3UO1H 2H2SC 3UPRA 2F8XC 3WMPA 4MQ7B 4WTZA 4NUJA 4FQQB 5DLLA 3U7WH 4DTGL 1A2YA 4G7SB 5E9NA 5JOFA 3QNZB 2XG5A 3MRFA 2YA0A 3TNMA 3BSHA 1MH5B 1BYOA 2ZXBA 1ESOA 5EF2A 4FTVA 4NUPA 5IHLB 4G8GD 4KBPA 1XZ0B 3QVAA 5KVFH 2AEQH 2XWEA 1SN0A 2BSED 1FRGL 1P5VA 3DIDA 4TQ8A 1Q9OA 4MNGA 1CE6B 4GQRA 4F58L 4H0HB 4UIMB 4KROC 3UG5A 4XPAL 1U91B 3KW8A 4IEFB 4RMTA 5E2VL 2NMSA 2D7MA 1JZDC 1KGYE 1X7TA 3UG3A 2ZSVA 3TYGL 2EYRA 4PW3A 1HINH 5JW5A 2CNZA 3BVWA 1FFNB 1MJ7L 4WFHD 5F0MB 1DUZA 4ORGB 1B4RA 1YSOA 3HTLX 3V5HB 2AJYL 4Z3GA 1I3RB 1KC5H 1T0MB 1QWHA 1DBBH 1EUUA 1G94A 1KJ2A 2EP6A 3P4OB 5KVDL 3D0LB 1OGAB 1NJ9A 2JKLA 6FABL 3GMLA 1S7UA 2G2NA 4KY1L 4HVBA 4ABWA 5D1XC 3FSZA 4PRBB 4R8WH 2ZCKH 3LQAH 2RFXB 2XNAB 3ZPDA 2DD8H 4A6YL 1NKOA 2RD0A 4UQIM 1YPZA 4XCCL 1BF2A 1TJIL 2HVKA 3PJNA 1H5BA 4FZ8L 1A4KA 3KYNB 1KENH 1UWXH 1CT8B 4KROB 4MNHB 3U0TB 4EI0A 4ZO6A 2VDQH 3U6XA 1NMCC 4YHOH 2C3VB 4HIIA 1A6VH 4OIFA 2XXCB 5G4MA 4RA3A 1NGPH 5DJYB 1NGZB 3RAJL 2NLJB 1SEBA 1KIQB 2X9XA 5HHNA 4IRSA 2F19L 3H9ZA 3OVUB 2F53B 1D2OA 4H4NA 2VQTA 1ZV9A 2C7UA 3D7PA 2ZUXA 4Z8FH 1D5XB 4ZG1A 5CLTA 3MNMA 3FQWA 2XX1A 3NCBB 1KB5B 4HHWA 5D4HA 3WY1A 4K94H 2NNRA 4WUKH 3UBFA 4AUJA 3ECWA 3CTTA 4F7KA 3T0XA 1BQ5A 4QRQB 4KZ0A 5BV7H 1DLHA 1X4YA 3M7OA 5CZKA 1BAWA 2YMTA 1VEPA 1SUHA 3MRCA 3T71A 3VD2A 2I9LA 3NYKA 2C9XA 2AI0H 3RDTB 1IARB 3SKNA 3J2PA 3GJFA 4HPYH 2YRBA 2MQ0A 1K3ZA 5T8IA 3K2IA 4C56E 5ISZB 1NMCB 4WV1B 5DZLA 3DTXA 1A6PA 3EOAB 4G3YL 4MS8C 4FKHA 2DQEH 4PJIB 3BAIA 4ES8A 1BM7A 4POZC 4AL8H 3QW9A 3V10A 4OGXL 3FB5B 1F4YH 5DTFB 5HYJA 2YEZB 2D8KA 4HUNB 2OSYA 5JIDA 1IIIA 3ZDYE 3GMQA 4KK6D 1D7CA 4YZFF 4LCWE 5D1ZI 2WWMC 4K5OA 3KDMB 2JCCE 4W4OC 1IRAY 3DIFB 5A6IA 3X17A 1E9OB 4LCCC 2ETWA 2Y6SD 4XT1C 4Y5YC 1COBA 5LBSA 2LAAA 3IWVA 4WO4B 4AYDC 1TVBB 1RK0B 2VERA 2X1XR 4XP9L 4FYSA 4HC1L 1A7NL 4DK3A 1N0LA 2P26A 2WSKA 4F57H 3DV6A 2VW7A 4OZGE 2YARA 2XWDA 4JO1H 3S36H 3MV7B 5DQ9A 3SCMA 4C83A 1MHPH 1NAMH 5LWYH 2GTQA 1KOAA 1EHLL 2PYEE 1X9RA 4QTHB 2J5WA 3HUJA 4KC3B 3TBTB 3BPNC 4M48L 1NOAA 2I07A 4Y8DC 3S37X 3KYMB 3LVTA 3IU3B 1XGPB 3KM1A 4FJYA 2P8MB 2E27L 2EECA 3QDME 5ADOL 4QHUB 3TWCH 2P5WA 3C9NB 5C0EB 1KEGL 4A1RA 1MAJA 1CLOL 4G43B 1Z0MA 4ZBJA 1KSRA 4EEEA 1JV5B 4Y5YB 1KXTB 4K9EC 4PRPE 4AMKL 2E4TA 5EOCL 2OV0A 1Q1JH 2E86A 1FIEA 5HVHB 2R2HB 3EFOA 2Q87A 4Z7WB 2EIDA 1BEXA 2OTPA 1AVAA 1OK0A 1DQLL 4KRPD 5EOQH 4MD4B 5E9AA 1WT5A 2NZ1A 2VR4A 4Y1TA 3TWYA 4M6NH 1AGFB 4R96B 4YNYB 1WEJH 4NXSA 5E8EA 4XBEH 2VDLB 2HJFB 3CC1A 4YFDB 1TTBA 5IB1B 4AV5A 4LU5H 2ZZUT 1I3GH 4JG1H 5EIIB 3QPQC 4LLWB 2MKLC 4N4YB 2IFGA 4LRIA 5B21A 4AEHL 4DGYH 1TZGL 1HSBA 5CJOL 5LXGL 1ED3A 4ZQKB 4X8JA 4NIKB 2MCMA 4A7UA 3ULVC 4MA8H 3DX7B 3NQKA 2OJZH 2QPDB 3K1KC 2NY0C 4F58H 1YECL 3KNBB 3N6YA 3JWNE 1OTTD 1I8MB 1HE7A 1SF3A 1TLMA 3OKKA 4QHKI 3V4PH 5A3IC 1OP5H 1FL6B 4Y5VA 1CJYA 4I18A 2WXQA 1RCYA 1AHWA 5EBMB 4LL1A 1BLNA 1AGCA 4RFNC 4ZO9A 4O02A 5KSAB 3D69B 1QFOA 4N22A 2HX9A 2UYLB 2XN2A 5E9DA 5F97E 3H4FA 4K8RH 5I75B 4MZ2A 1E3FA 3BT2L 1J87A 5E1AB 3QQ3A 3QZPA 4WHYG 1C1EL 1DVXA 5AOLA 1ZVSA 1MCNA 5I1LB 2XV2A 3M8OH 5I6OA 4BFIB 1WVZA 4U6HB 1XGQA 4JPVL 2WXKA 3U79A 3FUFA 3GUTA 3C08H 3IFNL 3FTGA 4XVJL 4YUEL 5KW9H 5D72H 5E7FA 1A6WL 3FQTA 1QR1B 4UYQA 1UM6H 5E2WH 1IV8A 3UBXA 1E6OH 3MHZA 1KFGA 2CXGA 1A9VA 3B2VH 3MV9E 1K5WA 4QXWA 2ESVE 4UTBH 5DHYA 5B1KA 3TPKA 4I77H 1UATA 4TQPA 3KAAA 1EGJL 3MBEC 4O58H 2COVD 4ACTA 2WXIA 4ZW8A 3VRIB 5E5MB 4KFZC 4RSVA 3RAJH 1T83A 2FE0A 1MCFA 1PX4A 2VDKL 4EI5A 3WHE1 1QSZA 1CUOA 2F19H 4Q7DA 4XGZA 1PF3A 3APDA 3KJ6H 5CN2A 5DUPH 3UTZA 4HU8A 1MZYA 4X98A 3CU1A 3RIKA 4GUPB 1FJ1A 1VFBA 3AUVA 4FLHA 2PPCA 4PGBB 4P3DA 1FLRH 1RLBA 1ZE3C 2V5SA 3GPEA 3IDYB 3MRNB 1DVFA 1X7SA 4ZO7A 1B0RA 4NZFA 3QR1A 1PS3A 1FC1A 1DANU 1LDPL 3WIFA 2IALA 3F7LA 4NZJA 2PR4H 4P48A 3TURA 2M83A 4YSUA 2ITDB 5I5IA 2BVYA 3QIUB 3VQ2C 2NYZA 5JHLA 2LQRA 2VE6B 2EINB 4AV0A 4OBRA 2XDHA 4LNRB 2EVGA 5IBLD 1NL0H 4ZMAT 4Y19B 5JMRA 3P3SA 4YO0A 1QVOB 1U3HC 2J57A 5I6LA 1O75A 3ARSA 5EO1B 4UV4L 1AXTH 4Q74A 1VKXA 3DYMA 1IGJA 4N24A 2HRHA 1W0WA 4Z77B 2WBJA 1X7QA 4HUUB 1UB5B 3MN8A 1HWGB 3U1PA 1BV8A 5EEZA 1MOEA 3TVMB 2UY6B 3RGVB 4I88A 2DLIA 4LCYA 1NC2A 3ZDXE 3BXNB 1MAKA 4HUMB 1RPKA 2IH3B 3VXRE 4ZXBD 2X05A 4NBYB 1EXUA 3WY2A 4HC1H 4R4FL 4DEPB 4S0TD 5F9WC 3B3IA 4WEUD 5FYKH 3G3LA 1LILA 5KYYB 2C9SA 2CLRB 3P11L 5BZZA 3SB3A 2V7HA 1JUFB 4HWEL 2I60L 2WV3A 2FUTA 3H42H 1FNFA 1LO3H 4HP5A 1IE4A 4BE5A 2O5YL 1HHHB 2HFEB 2XWJA 5DVNA 4M6OH 2ADYA 2AXHA 1YEDB 5DD6A 2MPAL 3MXWH 4ZAKC 1HJCA 5GZOA 1NEZA 2C9AA 1FO0A 2QSCH 2XN9B 1M4KA 5SX4I 1ZTXL 1HEZB 5H37A 3NIGE 3CD4A 4Q6YA 4J3OC 3QWNA 5DI8B 3RVUC 4HV8B 3ULVF 3HVNA 1WZAA 5G2NA 3WMQA 4J5VA 4K07A 5A16B 4OI8A 4UM9B 1CFQA 3KVQA 4K55A 3D3VB 4OCLC 3VI4E 3TIDB 2A5UA 1EEZA 4PJDB 2BNQA 2BHZA 4R4ND 5IQLA 4E41A 1U93B 3VJ6B 4QRTB 4JANB 4TUJB 5BPPA 2J8HA 2AFNA 5I66B 4W1TA 1I1CA 2IBZX 3BP6A 3P40A 3L1OL 1CZ8L 5LG1A 4X7EC 4Y4KA 5D7IA 2CRMA 2IDTA 4HKZA 5JNYA 2CO6B 2NQCA 4G8AC 4XP6H 3BZFA 1W72L 4FQHB 4G70B 3MR9A 2IFFH 1KYUA 4Z95L 2WSPA 4XHQA 3WN5A 3GXPA 2YLKA 3KBFA 2BP8A 3M86A 3V0IA 4M02A 3EYUL 1JNNL 3KJ4C 2OA9A 2Y1AA 3QHFH 1HDMA 4DP0X 2WN2A 5KAQF 3N0PB 5D2NE 5GRZA 5C71A 1IBBA 3TZVD 2WTRB 5I18H 5ANMA 4CMHC 2WO2B 1W91A 1DVFD 2XV6B 1GGIL 3V4UL 4NN7B 5C97A 4KI5D 3D08A 1XTLA 3T4YA 5JYLA 5DU7A 4RGMC 1BQSA 2PKDA 4F7EA 4DGIL 1IBFA 5E1GA 3B2DC 2KPWA 2QVMA 3AC0A 2Q76B 3KBHE 1QLRA 3P0VL 4CC0A 5HPMB 4Z3HA 4HJTA 3BPOC 4X5QA 5AZUA 5KVGE 3U82B 5DEGA 5B38B 1NFIA 5EU7C 3KGTA 2CHZA 2CLVA 2ICEB 5IJKA 2QV4A 4YXLH 4XXWA 2VDMB 1WBXA 3M46A 3FT2A 1BFVL 4YAQB 2EEFA 3X3GL 1BIIB 3IDXL 4CSTA 1FCGA 2AVFA 2AVGA 3TLRA 3CLEH 3TF7C 1T6VN 1NC2D 3IDNA 4PGJA 5EHFA 3P4NA 4NHUB 1XL6A 4LIQH 3LYRA 4PJ7A 3EYFA 3WXVH 2D4FA 3MLVH 1B6UA 2BSRA 3NFSL 3MU3A 4L5FE 3WSQL 4BA8A 5C9JA 4RGMB 4N2HA 2ADIA 5L7XL 4AIXA 2ZYRA 1F86A 4LAQH 2O30A 4V2BA 4WWKD 2PTVA 4Y16B 4NOFA 1AKJB 4QJ5B 1A3LH 1W0VB 1PSKH 3CSPA 4XXCA 4GIOA 2YPKA 4P2RE 5GZOD 3TESA 1UCBL 1EO8L 3CVCA 2D0FA 1DJWA 3JV0A 5A2AA 4GT0A 3VDBA 1RIVH 3GXNA 2CKBA 2J4WL 2ZWYA 3ZHFA 2UY7A 5DURB 4JY4B 2A6DA 3ZQ9A 4JRYD 5ID0B 3S5YA 3D52A 1MEXH 1BSIA 4K5PA 4W9DC 2BNQD 1HXMA 4A67A 1RJLB 3QCTL 1XSKA 3E0GA 4OUUB 5CD5C 4DKTA 4LEOB 4M9PA 4BM7A 2WLIA 2YRZA 5TE7H 1CURA 3GRWL 1YMMA 3NDYE 4DZBA 2ZP9A 2FO4A 4YXHH 1T89C 3X1EA 3MAWA 4NGHL 1F13A 1DDHA 4NQCA 1IGYA 3CHOA 3AG4B 3X14A 1DSFL 1GYWA 2NY2D 4OZHB 1NWPA 1MCBA 3JTBA 2ADFH 1BZDA 2VIRB 4HS3A 4OIIL 1JHTA 3QJHA 3ETBF 4R4FH 3DNKA 4NPYA 2G30A 1PKQA 4M8QB 5CCKH 3ZR6A 1NLBH 1S4IA 3ZO9A 1J5IA 5HD8C 3AY2A 3QWQB 4CU8A 1UWXK 3ABLB 4G5AA 4E0RB 2FLBT 3SQOL 2V2XA 4N9GA 4PB0L 4RLDA 3KW7A 1TJGL 1CGSL 1P84J 2YRLA 5F3BB 5I1CH 1R3KA 2ZUYA 4PY8J 4X5WA 3HI1A 5C0BE 3WTUA 4JM4L 3FQRA 1HVXA 4ZNEA 1KPRB 1ZTXH 2DQHL 4JFEB 1QACA 4U6YB 2ISDA 2FIKA 3FO9A 3OWEA 2F7QA 5EULV 3WDJA 1U58A 4BZ1A 1KPUB 2YXFA 3KPSE 3RVWC 2I27N 3TGXA 3PFUA 1LM8V 3QS3A 3RWFB 2FATH 1XR9B 4Z6AT 1KN2L 3GS4A 4QXVA 2JLLA 5DJAA 5E6IC 4ATWA 3ZYJA 3BKYL 2A6JA 2BXYA 1AZRA 4ZDHB 4X6DE 4H25B 4OT1L 3R8BB 3M07A 4DN3H 2UXVA 2YBRA 1HHIA 3QO1A 4NN5B 4M5YL 1NA8A 2M1KA 4QWWC 5I0DA 2MFNA 4M43L 2P8LB 5C3IA 2N7BA 3PGFL 3QUMB 4RISL 3K5SA 3FUMA 4BQ9A 2V33A 4XNMA 1Q72L 2VUKA 1ASOA 5HDWA 4F9PC 3LOWA 1RI8A 3AY4A 4HSQA 1YEEL 5KOMC 3DURA 5GS0L 5FM4A 1GKEA 4RFOL 3IGLA 3T6WA 4UILL 1Z9SA 5AD0B 2WNWA 4WSJA 2APXA 1GPOH 2DL9A 2G60L 4XXDB 2Q10A 1BVNT 5AL0A 1R1CA 1U8KA 3HZYA 5F7YC 3PHOA 4ZW7A 3RY6C 1AZZC 3WL9A 4BFRA 4UTAL 4CGUB 1Z5LB 3QA3B 5IBUG 4R2GC 2XVGA 1SHMA 5HYEA 2ZUVA 4F8LA 2OL3L 2KZBA 3KEHA 4L4VD 3QI9A 3CHXA 3GGWB 3EYOA 4OQTL 4YSSA 2CCLA 3DECA 4YDLC 1ODUA 2WZPD 1SMAA 3S6CA 5H94A 1N5YL 3SBRA 1ND0B 2DJMA 2G9KA 3H0TB 3IXTA 5KSUA 3NSXA 1TR7A 1KV3A 4GXVL 3IDJA 2BNRA 1MCLA 3OJDB 4G8GB 4XMUA 4EJ1C 2PXYC 4N0YH 2EDKA 2AXWA 4ESKA 5DD0H 4GAAA 5JQ6L 3LIZL 4RH4A 5HHQB 1T7ZA 2X4NA 5B8CB 2B3RA 3MRQB 3MCYA 5TF0A 3X3GH 4WQOA 4KVCL 1YMMD 5DK2B 1MRFL 2WAQA 3O8XC 1T5WA 2AK1H 1I7UA 3A6CL 5LCVH 1L0XA 2YEQA 2YAHA 5IJBC 2R2BA 4G8EA 1USQA 3DUUB 4IGBD 2QPSA 1IL1A 1ZY9A 3NJJA 3EH5B 4LKXB 3VX0A 4ZX5A 4YQXL 3QEHA 3WSQH 4W81A 2J2ZA 3V0WL 4LLVA 5EORL 3RY4A 3PAVA 3QZMA 5L7XH 3SO3B 2VMDA 5F7FA 4U7MA 1ACZA 5AAMC 4ISVB 4FKKA 1A6ZB 3FQYA 5D93C 1LP9E 2XXMB 3KWTA 3UFIA 2YD7A 3MRBB 1BJ1H 1OQOA 1HNYA 4WIQA 3M45A 3KPLB 1H0DA 3NFNA 4MJ2A 1AO7A 3UJJL 2VLKE 3HR6A 4FRWA 4AZ8A 4F8TA 3RHWK 1VZHA 1KG0A 4UQBA 2HP4A 2CG9X 1DVZA 2DQCL 3FT9A 1OP5K 1ZT4B 2ICES 1CDIA 3CDYA 1WIUA 3WTSA 1J5OL 1OOAA 1OP4A 1HAWA 3BOVA 2MKWA 3VG9B 4AEEA 1ADWA 3QISA 3UAEA 3UTSA 3WFHB 5EC1B 3PV6A 4ADGA 1QNIA 2X89A 4EQ2A 4HH9A 4JKPH 3BIAX 3RVVC 3DPBB 4G6JL 4AVIA 1JGDB 4NAJA 3VQLA 1JPGB 1R5WB 4JPWL 4YFEA 1XB3A 2B77A 3B5HA 4RETB 4YDMA 2I85A 4K3DL 4WFGE 1ZOXA 4F8PA 3NCEB 4NLAA 3U9UB 3UTPD 4X7DC 1RJCA 5INDA 2YZ8A 2ICWB 4FQJL 3D2UA 3P54A 5K39B 4TUOB 1MNUL 3UP6A 1GYVA 5HDQH 1Q0YH 3CN1A 4XVSH 1ROWA 1Q9WA 1VCAA 4WHCA 4GW4A 4X83A 5F3HA 1BZEA 4M3HA 4OZFA 3T3ME 4NT6A 2H0PA 4PSRA 4F7MA 3QIWA 4AGOA 2HTKC 4B7LA 3JZYA 2F2HA 1HILB 4XPFH 4M6ML 4NUJB 1G0YR 4PR5A 1KCVH 2C9PA 4ELKA 5JOFB 3MRJA 1BMWA 2XG5B 2F8IA 5MERA 5FYLD 5HDBE 4XAWL 3KL5A 3BFOA 4KHXH 1IU1A 2AQRA 1IGMH 5JIQA 3BSZH 2I69A 1F11A 3LD8C 1PLGL 4TUKL 4P2YA 4HULB 1F97A 4U1JA 5F9OL 2EKJA 3CU7A 1KDJA 1P5VB 1VEMA 1Q9OB 4JREC 2NXZD 1OAUH 4AEIH 3J07A 3N42B 2WW8A 4GNKB 4IMLB 1XWVA 1PLBA 4YSCA 3RDJA 4OCSH 4OI9A 3MLUL 5D7EA 3HB3D 3N2JA 1WZ1H 4WAFA 1SHXA 2ZSVB 3DV4A 3NA9H 4XNUL 2EYRB 3ZZQA 3VFPB 2HVBA 4LEXL 1CLZH 5E2TH 3P4MA 4IRSC 1MJJA 1ZPLA 2LU3A 5IMMA 1KJ2B 1BXXA 2PCXA 4D0CA 4U3XA 1NJ9B 4M6AA 5C7ZA 2Q7YA 4JJ5A 3DVFA 1C5BL 2D9QB 4S0SD 1TQUA 4MRCA 35C8H 2IBZY 5EZOH 1IBYA 2K4AA 5BJTB 2MOVA 1YPZB 2M8XA 2E9WA 1SLUA 2GJ6E 3F83A 5KBMA 5EO9A 1H5BB 2L7UA 4KKLC 1CDGA 2KDYA 4FL4C 4XN8A 4F20A 5SWSA 4X6FA 3HN3A 2H6OA 4KRPB 5EDSA 4XP1L 1P2CB 4N1HB 2VAAA 5HHPA 1N5YH 1WP6A 2B5IB 2L0DA 2VRQA 4JQVC 4QJ3B 1UD2A 3SDXA 3A5VA 4HIIB 4XN4A 5KVDE 3TJPA 2VAJA 4UI2A 1MELA 1TVHA 5CSBA 4DPBX 5KUKA 3G6JE 4CVXA 1HI6B 4ELMB 5HHNB 5KSBF 1L7TL 4JO4L 3UTSD 1EFXA 2FGWL 5AFAA 1SM3H 2X89D 3I6GA 2FAUA 2C7UB 3JQOB 4AE0A 3RPIB 4FA8A 3MJ9H 1JGVH 5ICXA 3FQWB 3PS6A 2NYKA 3SGJA 3D51A 5EH1A 1DLFH 1FIGL 4TF4A 2BVPA 4X2UA 4I89A 4BKTC 1E9PA 4L1DA 5B3SB 1N2RA 3H9SE 1CR9H 4ODUA 3CVDA 2DAVA 3PPSA 4GAGL 4CKVX 4FZEH 5TGBB 4PB9H 2DMGA 1R19A 2J5LC 4Z0BH 1MY7A 4D9RD 3GXUB 4KITB 1DP0A 2GK0B 1KJ3H 2HN7A 3SCMC 3U46A 1LMIA 5KYUB 3DTXB 2EDWA 5AZEL 4IS6A 4YBLB 1IEBA 3NGBC 4FA6A 3KCWA 4F15C 4ENZA 4DP7X 1U2YA 1BPVA 4P9MH 3VVWA 1A14H 5D5MB 3RTQC 5IFAL 4OLUL 2AJZA 3QIWD 1XH3B 3S8WA 2M26A 2VJ0A 3LEXA 2AEIT 5DS8A 1QRNE 4GI8A 3D4GA 1JBJA 1G6RL 3GMQB 4FMFA 4LXFA 1JP5A 1IQDA 5TK2A 2MOGA 3D85A 1M7UA 5ADPH 1G0XA 4UOW1 1QEWB 3NAAL 1XXFC 5BS0A 4KXZH 1ZCRA 1NCDH 1URIA 1X5AA 4GJTB 2H1PL 1JF6A 1VENA 3NSCA 4HJGA 4ODTL 1X6LA 1N0LB 3OB8A 5I0XA 3DV6B 5FW7A 4F1ZA 3O4OC 1M1XB 4FYRA 5MEPA 1J1XL 4G6JH 4C83B 2FJGB 3DLQR 5J9PA 4YHPB 5EIIG 4OF6A 4CVZA 2DQJL 3HUJB 3O11A 1DEEA 1MIEH 3FTSA 4PRPA 2VDLL 3BVVA 4AXWA 2MTPA 2GCYA 3REVB 2I07B 3QJFA 3SGKA 4D9QE 1YQVL 2NR6D 3MVSA 4LB8A 4F27A 1OP3K 4LLUA 2YZ1A 4GSUA 1WLHA 3TT3L 3DIVA 3GINA 4Y5VC 3HNSH 4I18C 1G7HB 3OKNA 2VXTH 1OTUC 3CXHJ 4PEEA 1DN0B 1AZCA 3RWDA 2NPLX 3QNXA 1PQZA 2WBKA 2ZKHH 4DVBB 3VGEA 4JFFE 1UWEH 3ARDD 2LT9A 4LP4A 1K8IA 1OM9A 3DC0A 2R7EA 1GIGH 2HLFD 3BEVA 3MFFA 1YN7A 4XNXH 5E8OA 3V9CA 4YPJA 1G4MA 1ZT1B 4XB3A 4K9EL 5E8EB 1ZV2A 3AG3B 3ETSA 4OCWL 1I85A 3LRSA 4PS4L 3BWAA 1GGCL 3CQPA 4TUKH 1HSBB 4ZXBB 3EGXB 1ADQA 4J6RL 1ED3B 5DUBA 2WAHA 4X8JB 3GRBA 5D2LA 1WRFA 1F2QA 2LGNA 1FL3A 2NY7H 3B9KA 2VR7A 2I24N 3ECUA 4HKBA 5K9OA 4KJQD 3OKKB 4BWWA 5DJ8A 5EF3A 2XQBH 3II1A 4PWFA 4I18B 1Z5HA 4MGXA 3ZE2B 1AHWB 3FCBA 4KKAC 3IRCA 5E6RB 1BLNB 1N8OE 5BZWB 1T0NB 2WXOA 2BSBA 4PJXE 1T83C 3OTTA 1H3UA 4NXKA 3E9UA 3BN9C 3TJEH 2GY7B 4EI5C 2GQHA 4AUUA 1IBHA 3QQ3B 2FHFA 1DL7H 1E27B 3BDBA 3RILA 1ZVSB 1WJ3A 1JK8B 2YWZA 5FUZH 1JK9B 3MGAA 5FUOH 4YL9A 2PPEA 3LN4A 4ZFGL 2ZOKA 5GS2D 1X9LA 2GT9B 1C5BH 3OJMB 4YHKL 2J8OA 4P9HC 5BVJA 3DBSA 3FU3A 4ZUWB 1JZHA 3FQTB 2J7LA 3F6JA 3UBXB 4QRPE 2GC7C 2HSIA 4S1QH 4PRIE 2CGRH 1FSKC 3CLWA 3QDJE 3RG1C 4KJPC 4KHTL 5JR1L 3ZVVA 2WB1A 5DHYB 2BC4B 3KLLA 5KAQG 4IBSA 3WIAA 1FORL 3WIHL 3IRPX 2CE6A 3NJXA 2OMZA 3D85D 2PYED 4IJ3C 3EOBB 2WUCH 3AS3A 1G5AA 1YEKH 2ZUUA 4V2CB 4CUCA 5BS0D 5AZ2L 5F1IA 3BVNB 2HMIC 2KPNA 4JE0A 1NBVH 1T0PB 2EYTA 2FGWH 2XYCA 2EIEA 3HUJF 3RZWA 3TV3H 2WBJC 3QXAA 3L5WA 5SWZA 4BZ2L 3QDMD 2X09A 2C1PA 2BFVH 3SKOA 1LO4L 1PEWA 1FJ1B 1VFBB 3BAJA 4XVTL 4M03A 5DK3A 4P3DB 3HC0B 4M5ZL 4AQZA 4FAAB 3TZVB 4PRPD 1KPVB 5F44A 5I74C 1G7IA 1WH0A 3CQQA 2EILB 3GTTA 1DVFB 1BQHB 4YMPA 1B0RB 2JMRA 2ZXCA 2KMWA 3DA0A 5IROC 2OMXA 1UD4A 3U83A 2ERJC 4OCXH 3WIFB 3TU6A 3R7RA 4P46A 4CMMA 4RWHA 1MXGA 4LVNC 4ABVA 3S98A 4LMQI 1F8TL 4FABL 3JT0A 4RWYL 3PNRB 3N9GL 5CR1A 1HHKA 4YO0B 1PJWA 2B2XL 1LJMA 1MKFA 1RKRA 1M7XA 4NWUH 3ARZA 3ZT6A 1VKXB 3W0WA 5GZOC 2ALAA 3ABGA 3U6XS 5JDJA 2DWDB 4HJ1A 1CFVL 2AKRB 1SJEB 3ZTJH 2XTLA 2XQYG 3A6BL 4AI7A 2OQJA 4XP4H 4QRRA 4FI8A 3BUQA 3MV8E 4WENB 5KN5B 1NC2B 5ACMA 5HPOA 3CPLA 2CDFA 2Y2WA 4V1DA 4WI5A 2VM4A 2H32H 2BY1A 2YC1A 2HFGL 1O6TA 4X4XA 2QVIA 1EXUB 3NABH 2Y7QA 5KVEH 1UZ8A 2OX5A 5HYIA 4NC0B 1HWWA 3B3IB 4NWTH 1S7QA 3ZSSA 2NUPA 3ZHDA 4LPXA 4Y4KC 4Y4FA 2V7HB 4RGOL 1TSHA 1B0WA 3UACA 4K71B 4WWKB 4R90L 2EDDA 2NUTB 4MMYA 1HZHL 1QZNA 3V95A 1WTGT 3C60A 2W9EL 4JG5A 5AVVB 1L9SA 3MV9D 4MQXD 2WKGA 4MDJA 4UAOC 3WN5C 3TO4C 1V7MH 2ESVD 1QPKA 3MXVH 1FO0B 4KKBD 2XPYA 2A4EA 1FZKB 5I6KA 3IN0A 1SNRA 4K23L 4PJ9A 2Y1VA 3I6SA 3U7YH 1A66A 3MRRA 1ZANL 4JRYB 2IANE 4MA7H 3LRLA 2YD5A 1CFQB 3H6JA 1JS4A 1BP3B 3K72A 4HK3J 4NKDA 5I5JA 4HJEA 5GHWL 1WFOA 1EEZB 3KPOA 2BCKA 5L6YH 2BNQB 1I8IA 3V0AC 1KWGA 3FB7B 1HEHC 2X41A 3AACA 3IXAB 5F6HJ 5SWQA 4D7BA 1N6QH 3QUGA 3OXRA 4TSCH 5DMGD 1IC7H 1H8NA 3BP6B 2Q7NA 2A9ML 2H41A 1NCAL 1XCQA 3FN3A 4KNUA 4XI5D 5D7IB 4PS4H 2F74A 1KGUA 4AJYV 3KD4A 2H4EA 1WFIA 4F2MB 1SXCA 5B38G 4J6RH 4OLXH 5HDLA 5E4IA 1G9MH 4P99A 4TOYH 3MR9B 4QOKA 4XXWC 2NY2B 4D0BA 4XO3A 2OR9L 2JJWA 1QSFE 3QEUB 4MA1C 4U3SB 4N2CA 1ZHBA 5L8JB 2VC2H 3VFSA 5DRWB 3MGTA 5DMJB 2H47C 3STLA 1EAQA 3EF7A 2CK0L 4H0IA 5A2LH 2QFPA 2XZAL 2PETA 1Z7JA 3GSNL 4MVBD 2IH9A 5ANMB 1PCXA 2FX9L 4YDIH 5CIPH 2XWRA 3K2UL 3MLSH 2A74B 4GP4B 4NHCH 2EVIA 3CFJA 5MEQA 1IGFH 3SDYH 1T21B 2A83B 4JHWH 5JIMA 1X5ZA 3T4YB 2CCWA 4X4MA 3TBWB 5DFWH 3US1A 3L5XH 1TQTA 1HSAA 4P46D 4A2HA 4A66A 1G9NC 2AQPA 5CHNB 2NCMA 2R8SH 4UYPA 4ZFGH 3WD5H 3DVGA 3LNEA 3O2VL 1CI3M 3VXRD 2Z8SA 4A38A 5FYJU 1IBZA 1OGPA 5DEGB 3MTXA 5AYTA 3D39E 1OB0A 1OT4A 1R47A 2WLKA 1EAPA 4K7PH 4TV3A 5FFOA 5C8JA 1QBMH 2J8UE 2CLVB 1CDHA 1O5DT 3W0WD 3WAKA 5F0PB 1WBXB 3GK8L 4HLZH 2XV0A 4AQ8C 2XT1B 2EH7L 2EKSA 2D03L 1YY8A 3LN9A 4Q6IC 4HMCA 1KY7A 1U2HA 1TO5A 4FNLL 1AACA 3LIUA 4QRRD 1JHLH 3N85L 3T8XB 4D9LL 4WLCA 2XWZA 3GUFA 4F7TA 1B0GB 2XJLA 4V1DD 4MXWH 4PJ7B 4YFLF 3BRFA 4H1LG 4MXVE 3U1SH 4ZX4A 5GRVK 4UT7H 4UT9A 1JZ8A 1AHKA 3RL1A 3NQIA 3FU5A 3GBEA 1KTBA 2CJUH 2VJXA 3Q8BA 3IJ9A 1IQWH 4ZSOE 4BZ2H 5C9JB 2JLPA 4K5LA 2KS0A 3AROA 3UH8A 3BH8A 2IG2L 1FHGA 3B9DA 4AX3A 3O2WH 1ZD6A 2DIAA 2E6QA 4ALAC 2O61A 2CHNA 2W65B 1R6VA 3ZL4H 5I1DA 4L4VB 4KK8D 2XTJE 2YPKB 3JBG7 3RZCC 4W6WB 5JW4N 4PJAE 4HAGA 4P2OA 5T5FA 5JQIB 2A73A 5DT1H 2IPKB 1G1KA 4Z7UA 1CFBA 4JO5A 4NSKA 3IJEA 4XN9A 5M94B 4XN5A 1T66C 3QQXA 1XGRB 2EDFA 4CVUA 3DXAE 1S7TA 4GAJL 2C4FU 4GQ9L 3LH9A 1MQKH 1UUNA 3JWOC 1PG7W 1HXMB 5D7IF 5DHVH 1IJNA 1RZJC 2XFXA 3B34A 3VXTA 4I0CC 4JG9A 2A2QT 2A3TA 1CFVH 2N4IA 3LKSB 3ZQWA 2WLIB 3V6FA 1RHHA 1YMMB 1AFVL 2J6EH 3AS2A 1CFMA 5C6TH 2NY4C 2FO4B 2NX5A 5AL8A 1DDHB 1IGYB 1YEGL 4WW1A 4X50A 2VLRE 5FK9A 1P6WA 5CZVL 4IGBB 3X14B 4QOKD 4LDOB 5KS9A 4HGWB 2H7WA 3NACL 4K3EL 4S1SL 4GSDL 4AYID 4X4ZA 2IPTL 2FHBA 2QQNH 1EBAA 2HJKA 5EU5A 1THAA 2HYMA 3FTVA 1PKQB 5HY9A 2AABH 4L8DA 5TFSL 2NXYD 3I84A 3KPSA 2G5RA 3EAKA 3L48A 5IKCA 4CU7A 3AY4C 2V2XB 4N9GB 1OALA 2WCGA 4GXUN 2DTML 1R3KB 1HKFA 1OSYA 2DLEA 4R7DA 4X5WB 5IWLC 3I2CH 4X6DA 1UC6A 2Y36L 2AJ3A 2Z7YA 1AZNA 2ZCHH 3L4CA 4MSWA 4FTDA 1M42A 1PY4A 3OKEA 2FIKB 2P5EE 4KKCD 4MB3A 4LFHG 3M17B 1S8DA 4WW2C 4BFBD 4AE1A 1P1ZA 3TEWA 2VDRB 1VESA 4PJ5A 2AJVL 3CDFA 4J3OH 1RZ8A 2HB0A 3LNDA 5GHWH 3QI9C 4L4TE 4P4RB 4CBZA 3JXAA 4CC4A 2A6JB 5JW3L 3VW3L 3MCLH 4MLIA 4NKQB 2VWEC 2YBRB 1HHIB 2MNWA 4PJ7F 5I19H 2L8AA 1B4JL 2X88A 1NMBL 3OXSA 4XNMB 4E9QA 4GEJA 2A9MH 4EDXB 2DWYA 4S1RH 3TCLA 1AGEA 3V4LA 1INEL 5EBWA 3DURB 5K1VA 5EG6C 4DO6A 2R2EB 4P2RD 2APFA 4PI0A 4UT6A 1ID5I 2OR9H 2QEJA 1MRCL 4XWOD 4F7CA 5ALBL 5LGYA 1IE5A 2NTFB 2ZXGA 4MXQC 5DD5L 3FTZA 1WWWX 4O2EA 3T6XA 3PHOB 3HB3C 1FQ9C 4HCIA 1PIFA 4JFDE 4Y2LA 1KGIA 3WL9B 2VL5A 4OIBA 4LGRB 1IC0A 2C8NA 3ELAT 5TF1L 1XSOA 3NFPA 4UBDD 2AJSL 3EYOB 2VITA 5DJZB 1ZEAH 1U3NA 5I1IL 4IKKA 1MIML 5KSVB 4P2OD 1AXIB 3NJKA 4O00A 1A4AA 1W6LA 5H94B 2OJEB 4DKAA 1OZTG 2BSSA 5KSUB 3IXTB 4XMPL 5AKSA 2DYSB 3KLHD 3C2AL 4YLCA 3FQNA 2NNXA 4UQAA 1K6QH 4R7XA 3QYNA 3IGKA 1BZQK 2YN5A 5E56A 3KBEA 4XNQB 2NXZB 2P42B 1XXDC 2FH8A 4PBXA 3PGDB 2D03H 2MEJB 4BIKA 4W70A 3CVHB 4UOJA 2H8PA 4HOMA 5C0NC 2CR6A 3HB3B 2YKKA 5EUOA 3MOAH 3SKMA 4N0UE 2JB6A 3I50H 1ETA1 4GMSH 5C0BD 3Q3GA 2R2BB 4G8EB 2QVTA 3QJVB 4LHQB 1F4WL 1QG3A 3EJYC 4F9LC 1VERA 3MLYL 4Q9RL 1DBAH 1TMCB 4IBZA 1R17A 3TA3D 4AGLA 2WXRA 4J1UB 2J2ZB 3P77A 4OQ1A 2OZ4A 2EDJA 1YEIL 1GS6X 1YEFL 3B56A 3KPSD 4R4BA 2WQSA 5EN3A 3P73B 1MCWW 3O9WD 5H4YA 5C0IA 1HNFA 2YA2A 1JGLH 1L9QA 3N1MC 3F7YB 2J1ZA 1EK3A 3NFNB 2HT4C 3GHPA 1A7OH 3DK2A 4AZ8B 1AG6A 1Y07A 3UL4A 2AV1B 1KG0B 1Z9MA 2EXYD 2LU4A 2PCYA 4CA4A 1R34A 3HHSB 5I76A 4P4KA 1R3JB 4IJTA 4B9IA 4IIQB 2Y7SA 3WFBH 3I74A 1V7NH 3GTNA 3U0WH 4GAJH 1J9CT 4KZCA 5L9DH 1KTRL 1BZ7A 2FWSA 2VW6A 4Y88A 3UTSB 1X9QA 1O9VA 1N64L 4RMSA 3O6FA 5D1ZA 4HH9B 1JTPA 2ZF9A 5TQ0L 4RAVA 5MENE 1CICA 4XCFL 2NNFA 2WP3O 5LGHH 2BJML 1NAMA 1OSPL 4X5RA 4PVNA 1CFNA 3LNIA 2ZE0A 1FZJA 4QTIL 5EEYA 3TN0A 2VH5H 4JDZA 3TNNA 4K7PY 1MJ8H 4IOIB 3Q6FA 3F3HA 3V79C 5DUJA 3WG7B 1TQWA 3RJOA 3G5ZA 5D7SL 5HHME 4AW7A 2VSMB 4XNBA 5DZVA 5IIEA 3N44F 3ARBA 1XGYL 1L4IA 1T04B 4H26B 1D7DA 3H85A 2LU5A 2NY5H 5F3HB 1AQDA 4OZFB 5SX5K 4NT6B 4R5XA 2DYPA 1FDLL 4RMBA 3QIWB 5IMLA 1P69B 4KUZH 4R97C 3Q8EA 5DD3H 2M2DA 3O3DB 4O4YL 1UQSA 3WUWA 4PREA 1H3GA 3L16A 1GY2A 3MRJB 2ED9A 4EI6B 1EDYA 3FN0H 5MERB 3VWJA 2HLAB 4WJG3 5I1GL 4YZFE 4LT7A 5ENWA 4R3SA 3SPCA 1SLWA 3WJJA 1BMZA 4DESA 2BCMA 2L04A 1GMEA 4NQSB 5GRJH 1N6VA 4XBMA 1Q38A 1E3XA 5ETUB 1ZLVK 3IPEA 3UG4A 3CWGA 3JTTB 3JWDC 4OD2B 3TH2T 4URTB 1MWAB 1KBGL 1Z9OA 3FCTA 3F05A 1ITCA 3W9EA 1CO1A 4QXGL 1G9EA 1LNUB 1NMBH 3G9AB 3QXWA 4JHUA 3WDIA 2VN4A 1M71B 2DQIL 2DQUL 3DV4B 1CF8H 1M3JA 1RERA 4OB5H 4C4KO 4EDWL 2HFFA 3ETTA 4LKCA 2Q6WB 4XCYA 2YO3A 1G43A 2JKWA 2WLZA 2ICCA 4P5TA 3DHUA 3B37A 2YKLH 2VLKD 1MJJB 4WEMB 4YWGL 1EHXA 1YMHB 5IMMB 4UU9A 3AAZB 3PP3K 5DQJA 4RAHA 3BO8A 1IX2A 2ZOOA 3SGJC 4OLYL 1GGYA 4JJ5B 3P1VA 5DD1L 1LQSR 2K3TA 3BZ4A 2WLMA 1V55B 3JV5A 1QTPA 3LZFL 3ARDB 3BP5A 2JXMA 1JWUA 2Z1PA 5EO9B 3FO2B 3FB6A 2Z91B 3P3RA 5I1IH 4NRXB 4X6FB 5I9QC 3W39A 4GKZA 3VDAA 2GYSA 3ILDA 3GMPA 4MNQE 5HHPB 1VGEH 3SDXB 1HZLA 2O6EA 3SE9L 5I71C 3SPJA 3IU4H 1GC1L 3ZYZA 4QO1A 4KX7A 4NN6C 1F3DH 1JCKA 3K2KA 3WLBA 4M7JL 3KLQA 2YAEA 2XY1A 1IIKA 1U42A 4GIAA 1BLIA 1KCSL 3MRPA 1N18A 3H7LA 4M8RA 1XAUA 2Y3AA 5HHVL 3GMNA 1G7LA 4MAYA 5L8KB 3L3GA 5DEFB 2WBWB 3PDGA 4AMWA 1OSZA 5BRQA 4H0GA 3DVNA 4M5SA 3I6GB 5D1ZD 1TLKA 5ESAA 5G55A 3S97C 5JXAL 5D1XE 1EAOA 4QY8A 1CICD 5ICXB 4TQHA 2A1WH 4F3FB 1HHJA 1SXBA 4JDTL 2DJUA 3QC6X 5AW6B 5BZDA 1M57B 3FCUB 2ZICA 3TN0D 4ODUB 5D7JA 3CIQA 2DIBA 3I9GH 1UB6A 5ISZE 4WHYH 5ILTH 2SODB 4PAZA 3FH8A 4FNRA 5EV7A 4HS6A 1SHWA 3VXSE 2J12B 3PP4H 5LBSL 2CIIA 2HN7B 4MAUL 3VGFA 3U46B 3ZMRA 3Q2LA 4ZOEA 4J6IA 3ARBD 1YRKA 3KWWA 3IGFA 3NP3A 4IS6B 3W37A 1WSST 1IEBB 2I25N 1D5BA 4X80H 3ZW3A 2DYPD 4RGNC 4BK5C 4N6QA 5LB1A 2AEPL 4Z5RA 3RVTC 2AQQA 4GRMA 4DKEL 4CDHA 4HKXA 3U2SA 3T1FB 4OZGB 4F91B 4WI7A 2D31A 1RU9L 4ZUUA 2IAMA 1IQDB 3CC5A 5A2JH 3VWJD 2DMCA 3WLWD 1NC4A 3D85B 2PYEB 3GSVB 3FK3A 3WCYA 3LB6D 1I1YB 3M6DA 4HOXA 4JLRB 5IR1A 3GHBL 3TBYA 1L6XA 3GNML 3HCVA 2AJXL 2Q3ZA 3VXOA 5BS0B 5I15H 1S9YA 1UOKA 4HD9A 5J13C 2BIMA 1FH2A 1D6EA 3MV7E 5E8NA 4HGMA 4HJGB 3K46A 1MJUL 1YN6A 3BWUF 3HKFA 3KYAA 4HC1A 4WK0B 1U8NB 2VOTA 4GOSA 4XH2B 3C6EA 5CEYB 5ALCH 5L2KA 1LXMA 3QDMB 1DJYA 5FHBL 3SGDI 1NMAL 4WKZA 4DKFL 5J9PB 1MHCB 3LDBC 4TNWK 3LSOA 2JI1A 4CVZB 3U4EA 4WNJA 3EYSL 3GKWH 1DEEB 4NZTH 4PRPB 5B39A 5FYJL 2GJ6D 2KERA 4AXWB 1UEMA 1CDCA 1B2WL 4W9IC 1J88A 3WXWH 2GIYA 3WDHA 3SDCA 3B9KC 3HOGA 2VXUL 1AAJA 3Q2VA 4OFIA 3VG0L 1U8HB 5D7SH 3IMUA 3EH2A 4CSSA 4ENEC 3DX8B 1GHFL 2RQEA 3UGUA 1K8DB 3VWKD 4FQ2L 3OKNB 2CHDA 4HA1A 3HPJB 4L1LA 4NM4H 2BFGA 1XGYH 2FWLB 2CA4A 1VF5C 4YHNA 3RWGA 3ZSTA 1PQZB 2PPDA 3B7SA 2VR3A 5GGTH 4DP6X 4KUCD 3SDXF 4BV1A 2NY1C 3H3KA 4PYGA 1N3NA 2L7EA 1KIUA 2GBTA 2WNGA 5MHSE 2AHIA 1A6TA 3CCHA 1K8IB 4J8RA 5F7BA 1OIOA 3BEVB 1J8HA 4O02L 3CXFA 3MYJA 4O4YH 4D94A 5JYMA 25C8H 3BKJL 1IC4L 4MX7B 3NJFA 5E95B 2WYIA 5T3ZL 4WI4A 1FAIH 3NTCL 1CXIA 3FH7A 3LRSB 5E08L 2J43A 1P6FA 3BWAB 5DHXB 2XY2A 5FO9A 3DJZA 2PCPA 2D9CA 3WN6A 5LAPA 3POCA 3NJMA 3UBXG 5D2LB 1Y6NR 3CDZA 3K4ZA 2WVUA 4GQQA 3BE1H 4L0PB 3MUJA 1CD9B 4FLQA 4JFZH 1F2XK 4NKIH 4HKBB 2VUOA 1YEJL 3NRQA 5I8CA 2EE0A 4OFVA 5FV1L 1IM9D 2HZHA 1HL8A 1RL1A 1W2KT 2VABA 4QXGH 4D3CH 4GI9A 2CD0A 4N8VA 3T4AA 4OH2A 3HLAA 2YPLA 2CJ3A 5F3FA 1E4KA 3HS0C 2OSWA 1NGWA 5LBVA 3D0VB 1P84K 4U1GC 1U92B 1HCFX 2Z64C 3VH8A 2ZG3A 2A4CA 1OAYH 3MV9B 2D7QA 4XVUC 2MSPA 4J23A 2ESVB 3EFFB 3GZPA 3QWRD 2FWOB 2JKRM 1CFTA 4QHPA 5T1DL 4OD3H 3OMZA 3TH3T 3QUZC 5GS1A 1S9VB 2ITEA 4OLYH 3ZKMD 5DR5L 3H2QA 4FEIA 5FA3B 2D3LA 3U9PL 5EZPA 3ULVE 1A1MA 2F1BA 1DBKL 3L3OC 4MB4A 3E8UL 4TNEA 1I8AA 3BGMB 1LDSA 3EHBC 3TPUB 5C0FA 1JZEA 2VDNL 1BQHG 4I4WA 4P9HL 2UX7A 3BP7B 5J11C 4HWUA 4YBQC 4G9DA 4ZTPH 2K8QA 4P46C 3O0RH 2FEJA 3NCJH 1XBDA 2YK1L 1BBDL 2C5DC 2OMZB 3T2NL 4LASH 4C4BA 1TZHA 1GC1H 2UUDH 4Z78A 1YEHL 2QDVA 2CDEB 2J3SA 1EQWA 1IAIM 2KYIA 4XO9A 1PIGA 4U1GB 3V52L 1KCSH 1QI3A 4D9QD 2R27A 4PJEF 5JHLL 3QARA 2EYTB 2X10A 1JFHA 2H2PC 3ULUH 3QXAB 4M8VA 3X3FH 3L5WB 4AQOA 4EQ3A 1H3PH 1Q9LB 3HC4L 4KKRA 3P9WB 4ODHH 1XEUA 4UQ2B 5J7CC 1RVFL 4JFFD 2B4CH 5AVWB 4LPCA 1JWSB 1BZOA 3MCKB 3QHZL 5T5NF 3GO1L 3D05A 1LEKB 1MCOH 1SY6H 3CSTA 4I0PD 1Z3GL 4EZJA 1SBSL 2QMJA 4FP8L 2FIRT 4HUVB 4CSZA 4U1LA 4P46B 2V9QA 4ZS7H 1D9KA 4CMMB 4Y19E 4MAUH 3L6FA 5C0GA 4DGVL 3P9LA 4Y4FC 1R3HB 5C6PB 4UIKH 1V54B 1D5IH 3VXRB 4DVRH 1EWHA 4QYOB 1HHKB 1YYML 3C60C 4QHMA 2VXVH 3KH4A 4OM1L 4AGPA 1S5IL 1F4AA 2OMWB 5F6HI 5FO2A 4G9FA 3W0WB 4Z7NB 4GG6A 3FOLA 1WFNA 3A3YB 2X4OA 3D5OF 4FNQA 2P5PA 5H37G 3ZXAC 1X5KA 2B1AH 3LZOA 1DQJB 3VRJB 5D2LF 3GYRA 5C3LD 4PJ9C 4QRRB 2GTZA 4BJLA 4GKNA 3IGUA 4LRNH 3CPLB 2CDFB 4G1MA 3Q06A 3RWCA 4FE9A 3GNMH 4V1DB 5FGCE 5JPNB 2YC1B 3IJHA 3LPGA 4HJ0D 4WEEA 4DUXA 5FO8B 2Y7QB 4HIHB 3ZLQC 4ZX3A 1UZ8B 2ZXWB 3NIGB 4XO8A 4Z7AA 4LSUH 4QHLA 2OX5B 3QWOB 3QXTA 3LPPA 3ZYIA 5KG9A 3OLIA 3V0VA 1S7QB 4XMLL 2NUPB 3H7BA 5F6IC 4A63A 3MLRH 1NMAH 4KKQA 4RCAA 4OLVH 5J6SA 3VI4B 1JGUL 4KDTA 3TOPA 3FHQA 4DOHE 1NM4A 2XN9E 1DFXA 4MMYB 1U8PA 2YXWA 4PRID 5AQ0A 4DK5A 3PABA 4CNIA 4MDJB 5CGYC 2AXJA 2O5XH 4MYPA 1U8LA 4HJSA 3MOBL 1KBBA 4NDMB 1H3VA 2I32A 3OKDB 4ERSL 4NQDA 4JGUA 2XKSA 1QASA 4H5SA 1MFAL 3D3VE 3WHXA 2HKFL 2AGJL 3THMH 3T08A 2X4PA 3B7YA 1UA3A 3U25A 2XVBA 3MRRB 3VRLF 2WQWA 1I7ZA 3K72B 1A9EA 1OPGH 1IFHL 3WKMH 1NCUA 4PD4J 4KTDL 5I24A 1DJZA 4BFEA 3PF2A 4B3VA 2XIBA 3O81A 1HQRA 3BW9A 4GH7B 4XP5H 5AKRA 5SWQB 4QXUL 5LDSA 1KLGB 3OXRB 4KTGA 1E5YA 3CN4A 3BKJH 4HKJA 5EU3B 1ETZB 1CK0H 1VDGA 2I7OA 4A7VA 2K6WA 4EN3D 4BSVA 1XCQB 3REWA 4YXKL 4F2MA 3IKCA 1EANA 4XPTL 3NVQA 2PP7A 3OX8A 4KJYA 1XZWA 1T1ZA 1N12A 1M9SA 2BINA 2XUWA 4L9DA 4QOKB 1KLUA 3MLXH 3OHXA 4MCZA 3SPVA 2RTTA 2TSAA 1H9DA 1THCA 3V2AR 1E5BA 2G0LA 3ULAB 1DVTA 2OXGB 3QXUA 4HFUL 1ZHBB 2A7BA 5DQDH 4WEBH 5EPMB 3OKMA 5ECJE 2NXYB 1JZ2A 4I3SL 3IMSA 4HEPA 3SDAA 4N90E 4KI1A 3VGAC 5CEXB 3S3CB 1NANI 2UVFA 2HPOA 4Y5XA 3CN2A 4UDTA 5EA0H 5KBLA 4JY6A 3UZEA 1UD8A 3V5KA 5IVZA 5MEQB 1FPTL 5ERWA 1RZKH 4AQ1B 4LQFL 4GY4A 1T1WB 4CADB 1HSAB 4F5CE 4WJ5A 2O1AA 1D9KD 5E4EC 2DM2A 2GJRA 5BMFL 4Z7NF 3MV8D 3LH2L 5GGQH 1S9WB 2CPUA 3DVGB 3AMKA 1XF2A 2XJKA 2WY3B 4GFTB 2A38A 2R4RL 4FQ1L 1G9NL 3S96B 5C8JB 3ALXA 3D07A 3VXNA 1QZ1A 2VDNH 2IGFL 4G9FD 1M7IA 1WBZB 3N06B 5D9SB 1ETJA 3SOTA 3SJVE 3AW5A 1YY8B 3HZVB 4HAKA 1SFHA 1ACXA 5JOPD 5A2FA 4LHUA 1G7MA 1G5GA 3V4VL 3VFWA 1B90A 1BQUA 4YL4A 1U8QA 5T3XE 1BVZA 3A23A 3O4LA 5LCVA 3TO2A 4JFXB 4GRWB 2CKBL 2Q2EB 3BD3A 5ITFA 1A6UL 4UQ9A 1LWHA 1SYVA 5CJ5A 4UQ3B 3MACL 4P2RB 2YAPA 3RL1B 3LKNB 4YHLL 5ICZA 4N3TA 3CFDA 3L45A 4IKJA 3DMMA 2ZOLA 4FFVC 5M95B 2X4RB 3VFGH 1JWMA 2UWEA 5KVMC 3BH8B 2MRYA 2IF7A 2IAND 5EU7E 5DZJA 3VMOA 1F4XH 5JIKA 4ANUA 2O61B 1BM3H 1QOKA 2A9BA 1U41A 5I1DB 1EZVX 1WUNT 3S4SA 1PZ5A 4PLOB 4K2UH 4XO4A 1QNZH 3RBGA 2Z0UA 4N8CL 4YFLI 3PQYA 1Z3GH 3MUGB 4ALAL 2K6ZA 3MUUA 4P2OB 2ZKMX 4FP8H 4PP2B 3VFMA 2A73B 5IVXA 3HBGA 3RL2B 3UAJA 4EN2A 2EACA 4PV8B 3NZ8A 4Z7UB 5GGSY 4UDUA 4CDGC 1ANUA 3DSFH 1N68A 3ARGD 1I4FA 3BD4A 5F1NA 1S7TB 4N68A 4PJ8A 5IW1A 5DJ2A 1S7VB 1QSFD 4NNXA 1J1OH 4E2OA 3O6LH 1CDUA 2XFXB 4JZOA 3SYQA 1XF3B 2LU7A 3S3BB 2OMYA 1AIFB 1E42A 1T1XB 1AHMA 4EUPA 2FECL 4M9OA 3V6FB 1SJHA 4N2GA 4POUB 3JWOL 5KJRH 4GS7B 1X5HA 1RZJL 5HGDA 1QKZH 1XH1A 3SZKC 1B2YA 4HS8H 3F58H 1BQLL 1QLEL 5C0BB 1EJFA 4FG6C 1REIA 3HRZC 4MMXA 5FK9B 2DBJA 3DUSA 4CC4C 3FRPB 4BZ1L 5KS9B 5AKTA 4X9BA 1Z2KA 2P5EA 3T77B 1FA4A 1XB8A 3L9BA 1IT9L 3OPZH 3QC5X 4L8DB 5DZOA 3TA3B 3QEGH 2B39A 4XMLH 3KPSB 3KYKL 3SDAD 2QGDA 3SY0B 4MJJA 4O2CA 1TMQA 3N1QC 1GOHA 1JNHB 2JKNA 2K7PA 3D39D 4WNQA 2QZQA 3O9WB 2E7CA 3GSQA 4LLMA 2VM9A 3RB5A 5F8QC 4R7DB 4ZYKB 3MDJA 4FHKA 4X6DB 3US9A 2HX8A 2VMFA 3TT1L 3SO5A 2AJ3B 4W9JC 1R3LA 4JMXA 2J25A 3I9AA 1QSEA 1DZ0A 5JIHA 3FUKA 3UJTL 3KDPB 3OZ9H 3M7FB 5HGGS 5HVWA 2ATAA 4HEMA 4AKOA 4KMTH 4P23A 5B4MD 4APQA 1EJOL 6PAZA 2NW2B 1YNLH 3IT8D 3LQAC 1IFHH 3MTRA 4M4PA 4LLYB 3CH1A 3X12B 2WBXA 5I73C 3FFCA 3LEVL 1MCIA 3NJNA 4GRWF 4TVPL 5GXBB 3GB7B 2DWSA 3WFCH 4LHUD 1KEML 2ZUTA 1VPOL 4GPVA 3OAYH 3TP4A 3ROLA 5F7HA 5TQ2H 1HU8A 4GRLC 3O3BA 2FBRA 3TCLB 1AGEB 2VLME 1T3FB 3F6IA 5EBWB 1QABA 3KLKA 2XTJD 3SGEH 1V10A 5EN2A 2VZ1A 1DCLA 4JM2A 5D71H 1YY9C 2C1OB 4FFZL 1M05B 1YYLH 3RWEA 3LKRA 4F7CB 4I5BB 1WTLA 2WWKO 1CBVH 4YPGA 5HJGA 2ICWJ 3JYCA 5A40E 3L4VA 5IHZB 3SODB 3MREA 1XB6A 2EIMB 1S3KH 3CXHK 4K94C 3WTWA 1ZS8A 3D9AH 3T8VA 3NFPB 1OCZB 1UA7A 1X5XA 3RUGA 2OL3A 1OWRM 1XIWA 4Z7UF 2K3HA 4Q0XH 4H88H 2Z93B 1RMFL 3PQYD 4MDIA 5EZLA 5EF1A 4G7VH 3S9DB 3U2IA 2NCEA 1FYTA 2Y5EA 3RKDD 5ID1A 3UAJD 2BSSB 1F18A 4U31A 5E5LA 1ZLWH 5AOMA 3Q48A 1ZXQA 1PPIA 2QFRA 4AL8C 1G9NH 4PJ8D 5AUMB 4FYQA 1VJSA 3R0NA 3J7HA 3DRTA 1NCJA 3IDMA 5JHDA 2EDRA 2VUYA 4X5XA 3OJVC 3LIZA 1LTXA 1BD2A 4JB9L 5I30L 2QR0A 5KS9F 1MUJA 1S7RA 2H8PB 3ARED 2RA1A 4N9OB 5HHXL 4GSQA 1PYWA 2E46A 5F7MC 1R4XA 5EUOB 5C3TA 4P4KC 3SKMB 1U6AL 4HXAL 4PQXA 1LP9B 1R0AH 1G7QA 3O2DH 3NCYS 1BFTA 2FDBP 5DJ0B 3U4BH 5HI3D 5BV7B 3AB0C 1N59B 1IAMA 4KGLA 2BSCA 3K2MC 3QYMA 1RZIA 4U7SA 1P7KA 4B9JA 2VLKB 4GMTH 3NCXA 2P5ED 3O6FC 5BQ7A 1JD7A 5D6CA 2XZQL 3OAUL 4X6DF 2DBLH 3O6KH 3P77B 1KYAA 4JW3A 4DO4A 2OKMA 3UADA 3ISWA 3K6DA 1KB5H 4GW1A 4JZNB 5C0IB 4L4TD 3MLZL 1SGKA 3DYPA 2K9FB 1JHKH 4N8CH 1LD9B 3UC0L 2GY5A 4XC1H 1DQMH 1HKLH 4ZMNA 2YA1A 4RIRA 2LFGA 1IBGL 4L9LA 2FECI 4NZRH 5I76B 1MLCB 4QI3A 5F8RC 4GXFA 4WI3A 1JG9A 4OZFG 2GFBB 2ORBL 3BDYL 4PW9A 4KXAA 2P80D 5KSBE 3IJSB 1FFPB 3BUDA 4OCNC 1OANA 5D1ZB 1ZA3A 1H3WM 2QTVA 5IW6A 1LEIA 1CICB 3MODH 3B1UA 1HIML 1UACL 1XO8A 2I7SA 1CFNB 4LCIH 3WJJC 1YA5A 2F7IA 3H9HA 4KO5A 4U1IA 5IK3A 3GFUA 3TN0B 4ANXA 5GS0D 4ACPA 4PRHA 3MRLB 4OJFL 5B22A 5CCHE 2FEDC 3ESUF 5LKNA 5IEHB 3Q6FB 4ODVH 2E7MA 3CV5A 3KWUA 4ONGL 3Q01A 1F90H 4DEUA 1N5AA 3PWNB 1T7VA 1MCPL 1J9TA 5IIEB 1JN6A 2WK2A 3ARBB 1RIHL 3STZA 2E0PA 1C5DA 4DQOH 4HCRH 1AQDB 3KWXA 1JZ7A 1ZLUH 2AJUH 4K8RC 2DYPB 1XIWD 1C8QA 4FQCL 5I1JL 2FK9A 2ILLA 4P5TC 1WHPA 3GJFK 4KAQH 4L4JA 3TT1H 4G6AD 3DO3A 3JVGA 1UQSB 4MD0B 3WUWB 2ENJA 1A6AA 1TZOA 4FTVE 3ZZ1A 2E4FA 2R9HD 2ZOWA 4I0KA 4NKOA 1GXEA 1U8IB 3VWJB 1OWWA 4CVWA 1IMHC 5CJQH 5ENWB 4R3SB 2MNUA 4YHZH 4MNGE 1GJWA 1JRHH 3M1BB 5JUEL 1QAWA 1KIRA 1ORSA 4PWEA 5EUOF 3SY6A 4WSKA 1Y0LB 4KJWD 4NFCA 2NW3A 2J1WA 4X7FC 1E65A 4IOSD 2ED6A 3FCTB 1RJYA 2YAOA 1OCWL 3OZLA 4TN9A 3W9EB 5B1AB 4JDEA 4WK2B 3Q9QA 4WFFE 1ZGLA 3RP1A 1J1PH 2J71A 3EJZC 3JWDL 5ITBH 5DFVD 1FLTX 2X38A 3VGHA 1A3ZA 2XN0A 1A9BB 2W60A 2EE3A 2DLHA 1NPNA 2GJ6B 4LCVA 3EYQC 2VZUA 5LAXA 4MAYC 5HHOA 4YDKH 1A3RH 2WIIB 1A7PH 3EDEA 4UU9B 4WKXA 3FMGL 4OLZH 3BO8B 5L0QC 5FO7A 3VWKB 4NO2A 2W1NA 2X4TA 2WANA 3RGBA 4G5ZL 5HDOA 4G7QB 3BZ4B 3NEXA 2BP0B 4C54A 2W81C 1FH5H 3F7PC 4XC3L 3CFEA 4XTRD 4YE0A 4LO9A 1LO2L 3INUL 1INQB 4KTEL 1KBKA 1E9QA 4WNSA 4W68A 3BP5B 5D7JC 3F65A 1JAEA 2VISA 1RUPH 2D7TH 3QDGA 3FB6B 2YQ2A 4FI6A 3AG1B 5GRUL 3W39B 4Z7QF 3HPLA 3SHSA 2HXAA 3TBCA 2VDOL 2RCSL 3C5SA 4DJMA 3V0DA 4NO3A 1A8JH 3B5TA 4QO1B 3GLEA 5HVGB 1RFDL 4G1EA 1RH8A 4XOCA 3TFKD 4QGTA 2IBBA 5JOEA 3MRPB 3A24A 4Z76A 1G7LB 4PUBL 3DJ9A 4ODBD 2FD6H 1NIDA 4TTDC 5HHMD 1OSZB 4JB9H 3ZHNA 4U6VH 2IAMC 1A0QH 4LSTH 3VFRB 3HI5H 1GY1A 5L0QB 2YLHA 1IM9B 4OGAD 5HHXH 1TZIA 1U95A 1HHJB 4Z3EA 3RU8H 1AKPA 1PD6A 4MHHG 3HBQA 1NZRA 4NM8H 2X0VA 4PRHD 5DGRA 1UB6B 4JQXC 4AY0A 1Y18A 5TTRA 4JBSA 4PMFA 3LEYL 3VXMA 3AQYA 4KX9A 2EADA 3QORC 1BBJB 3STBA 5HYJE 4R5VA 1MLBB 5CZXC 4WHDA 1D5BB 1DVUA 1UD3A 3BAEL 1XSIA 1NBCA 2WMPB 3DX1A 3LNGA 1WPCA 2R15A 4HIEA 1MFDL 1RULL 3ALWA 3SDCC 2OMVA 4HKXB 4N25A 3UC0H 4GLRI 5GGVL 1G6RA 4ZUUB 2E7DA 3GC3A 3CC5B 1OGTB 3C6LA 3EUUA 3RHWF 2JK5A 2C9RA 2NZIA 3FU8A 2PWDA 2IWFA 2H2SD 5LJYH 5IR1B 3B9EA 1XGZA 3HCVB 1X6NA 3PPEA 2B14A 4PY7A 4W9EC 2H32A 3VXOB 4KQ4H 2L3BA 1D6EB 2Y07L 3IJYB 5DYOA 1XBRA 3AVEA 1YN6B 4W4OA 1EZVY 3LXBA 3PNWB 2VO5A 3JWNG 5BW7A 4XN1A 3HG1A 3WNLA 3HUJE 3II2A 4MQSB 2JIXD 1UACH 4QNPF 1U3JA 5F2FA 2YHGA 2DTSA 1OB1A 3LSOB 3PY9A 4JFFB 3ZGHA 4PH8A 1E28B 3L9RA 4XNYH 5B39B 5F7EH 1UWFA 5TDNB 1UA6H 4HZ1A 5DZPA 1S6NA 5TDPA 3KPQA 4I0PB 5HHOD 2VZOA 4EIBA 1R3IL 2P5WE 4I13B 2RGSA 4MNQD 2EDEA 4ZMTA 3RYMA 2FT8A 2CBOA 4NP9A 5FUCC 2DQFA 4OBSA 5E03A 3T4AC 2EH8H 2QVFB 3RWGB 3H6AA 1Z9LA 4PRDA 1MCKA 2VRKA 4WI2A 1N3NB 2OULB 4FQCH 1KBWA 1KIUB 5EZIL 5FW8A 5FYJE 3V0JA 5IV2A 1A6TB 4J8RB 4JL1A 2IQAB 2Z31A 5D1XD 5I8EA 5C2BL 3MNVA 5CU5A 2JWYA 3N41B 2X1WL 2JB5H 3ULSA 3BH9B 4PJXB 3PGCA 1KUMA 3I75A 2OYKA 4IDJH 5FO9B 1Q94A 3QUKA 1AQHA 2PCPB 4R0LA 4HK0A 3AU1A 1GGBL 5IM7B 2A6IA 3VXSD 2FBOJ 3QR2A 4A2GA 3P3UA 2X7LA 3U4AA 5E9DE 1TF4A 4JR9H 5I8CB 1CWVA 2ZCLL 2VABB 4KQ3L 3FUIA 3HLAB 4HQQH 5T3ZE 4U6XA 1DE4A 1SLVA 3MRHA 4JO3L 3UYOD 3MBXH 3KWVA 3VH8B 4PRIB 4PWIA 4MWFA 1TCMA 1AY1H 5A1AA 3G5VB 4JN1H 5H2BB 2RACA 3R8QA 4Z7VA 1J5DA 1NPJA 2F5AH 4BELD 1KULA 4HYTB 4M62H 5I1KH 4RQQA 1FNSH 1IGCL 3NEEA 3SBPA 1T2QH 4AH2A 5GS1B 5FPIA 2FQEA 5TE4H 4K7FA 1A1MB 4KGJA 9CGTA 3BUYB 2SEBA 5DUML 3UIZA 2H3NA 1A5FH 1P5UA 3K6OA 4AT6B 1TU2B 3CDCA 3N43F 2R29H 1OM3L 4X9GA 2P8PB 4MS8D 4I4WB 1I8KB 5GRUH 2PWEA 1E6JL 4YSOA 1I8LC 4POZD 2RR3A 2V9UA 4I48A 3VDCA 5BO0D 4EN3B 2RCSH 1TZHB 5FOJA 3ZGIA 1I1AA 4TL4A 1RFDH 4MDRA 4OJDH 2HFTA 3U30C 3NP4A 3FFOA 2WWMD 2VDKB 2VDMH 3X2QB 3ZIMA 3KPTA 1O6VA 1U8JB 1EDQA 3EJTA 1G4RA 5FHAL 1RURH 2XZZA 4BZ2A 2DQDL 2QHRL 3TIEB 4N3UA 4D8OA 3GD1C 1BVNP 3MJWA 4OSUL 3H53A 2DDQH 4NO5A 2J21A 4ZPVA 3CFQA 2EZ0C 5T3XH 2DY2A 5MHSD 2WGNB 3GPSA 4DN4H 2LTQC 1HH6A 5IJVB 2AP2A 4BDVA 2PP8A 1TETH 1I31A 4E9TA 5ELIA 2QKIB 5HDRA 4ZFQA 2KL6A 4U1LB 4QLRA 2BVQA 1D9KB 3MV8B 3FT1A 3L3DA 2ZWZA 4I85A 4BH8A 2ED8A 3DETC 3QAZC 4OCYH 2F1EA 2R1WB 4AVJA 4QHMB 1FZMB 5C08A 3IGAA 3ARFC 5C0DB 5J1SC 4GG6B 4G9FB 2YUWA 5FM5O 3FOLB 4AZUA 4OM0H 1MFMA 3SOBL 1XGTA 2X4OB 1X9UA 4Q9QH 4U1KB 2KZWA 2YFNA 2Q2LA 4HT1L 4R7NB 3GMOA 4RMRA 2WLLB 3DPDA 3L3IB 2GTZB 2J6EA 2OBGA 5EWIL 1F1AA 3CSFA 4G1MB 4PSPA 1XH2A 3QZOA 3IJHB 2YQ3A 2XQ0A 4ZFOA 1R0AL 1S46A 3G6DH 3P30L 4XPHL 3QPQD 1FG9C 5IJCC 4G8FA 4QHLB 3D06A 3ILPB 2FX7H 1JPSL 2UZIH 3O6MH 1BAFH 1ZLDA 3GQFA 3OGCA 3TBBA 2J73A 5KG9B 2FUQA 3H7BB 4IHBA 1CU4H 2IANB 1AE6L 3BESR 4XBGA 4XCNA 2NY0D 1UEYA 2CRZA 5A3ID 3K6NA 4JGJA 1AC0A 5HI5C 1ZLWK 2CBTA 5AAPA 2PW2A 3PABB 4CW1A 1INDL 4N28A 2J1KA 3H8NA 3DX3A 2BOCA 3WHXB 2IJ0C 4H5SB 3PWVA 5TPWL 3NCCB 3NCWA 3ESVF 3CVBA 2IGTA 3CUPA 2BNQE 4I1RA 4B6ZA 2Y06H 2WQAA 1TQCB 1T5KA 1JMZA 2FJHA 4E41E 3ARGB 3AADB 1UT9A 2PO6A 1U8OA 1WZKA 1A1OA 3CFNA 3UZEC 3ZKXB 1JMXA 1MFCH 1QSFB 2HWZH 5EZIH 1VGKB 1HQRB 2ZQKA 3BW9B 4AYSA 2PP9A 2F1AA 3HMXH 5D7IE 4FQLL 4J27A 1MG3C 2HG5A 4HKJB 4B96A 3LS4H 4KXDA 5DMYA 4NO0A 1SLXA 2VMCA 3UZVB 3UIYA 1CLVA 1UZGA 4PCKA 3LZLA 5INCA 3IKCB 5FYKU 5TDOA 3WNKA 5GJSH 1WWBX 5FKPA 4ODWB 4BINA 4ZZKA 3L4XA 2AEWA 4RDBA 3KCPA 1W72B 1GGBH 3OHXB 3QG7H 3MBED 5CEZH 5DDHA 1JPFA 2CUHA 2UZXB 3A67H 4HHGA 5DJDA 4OVVA 4J4PA 3UMNA 5I8KL 4GAFB 2IDQA 3QUMH 4PM1A 4QF1A 5ANME 1EEYA 4NAMA 3EIFA 3DSNA 3SDAB 4J28A 5F7DA 3WJMA 3LKOB 1KTLA 1ETB1 3D39B 4Y5XB 3GSNA 2X3AA 3IAPA 1VFAA 4UDTB 2J8UB 4Y9FA 2ATKA 3FF7A 4BHUA 3CBKB 3GIVA 4NC1E 5FCUL 3DMMC 4AITA 3COOA 1AP2B 2PTTA 3MI6A 43C9A 1FNEB 4LBEB 4WJ5B 2XWTA 4GG6F 4UT9L 1S7SA 2YEVB 1MFNA 2IOIA 2LOEA 2BVOA 2WNKA 5K9JL 1F42A 4X4KA 1XF2B 4JQIH 3GBMH 4AYBA 4ZQTA 4UOW0 3IJ8A 1AS8A 4N2IA 1QQDA 2VERN 3BQUA 5DUMH 1F3RB 5C08D 3MZTA 1G84A 2XRAL 4FNUA 4DIXA 1M7IB 2CLZA 1GSKA 1I9JH 4AIEA 2HLEB 2W80C 4LSQH 4ZSOB 2XZCL 5T1MB 2BMKA 3BISA 4LHUB 2K6YA 1U3HD 2GEEA 1FE8L 2D7PA 4PJ7E 5E5UB 3EO9L 4HBCL 1U8QB 5FGSA 2EDYA 3UAJC 4AVKA 2E5EA 4Y4HA 1TFHA 3HJ0A 2R0ZL 5T5FL 4P3WA 3TC9A 3ES6A 4NB7A 3P2TA 5ITFB 1JPTH 5E94A 1SYVB 2XTJB 4PTUA 2JELL 2V5YA 1AXSA 2ALWA 5ICZB 4YHML 3NA4A 5ESVB 5F88B 3CFDB 3P0GB 1VCBC 5CGBA 2GUYA 3HI6L 5DS2A 3BKMH 4XAKE 4JKLA 4ZFZB 2UWEB 5KTEH 2X4SA 2CMRL 2QHRH 1RUAL 4O2FB 5I6XB 1N6UA 2ZJSL 3D25B 3PAYA 4HPHA 4PJFA 2CALA 2IMNA 3Q2CA 4TSAL 4MMXC 5DXWA 3DHMA 2P52A 1SDYA 1JF1A 2F08A 3NJLA 5AW9B 4QCIA 3EOTL 3PQYB 4JZJA 4MMZA 4UINH 1T7WA 3UXFA 3CXDL 4BH7B 5CZRA 1ILUA 3TYFB 4FXKB 3FT3B 1CL7H 3V8OA 5CD3A 3VFMB 5HGBA 4MZIA 1IILE 1HAUA 4DETA 3ZN6A 1TCRB 3E9TA 1JL8A 3NZ8B 4NNPL 2EC9T 4ZAKD 5B1CA 1KTDA 3FOMA 2BSTB 3OF6A 4XPBH 4UDUB 1FVDB 4TVUA 1IC5L 3QH3A 1YG9A 5D7KE 4J3OD 5F1NB 2PO6D 2BHFA 3Q2NA 4PJ8B 5CLYA 5FFLA 3PWPA 5IW1B 3RVUD 1SJVA 1YMME 3Q2WA 5JHMA 4LPVA 4NNXB 2EVJA 4XOEA 1XGUA 5I8OH 5IB3B 4ZTOH 5IQOA 1X5IA 3C87A 4R26L 5AYUL 4EUPB 2AQTA 2NNCA 4GBXA 3TM6A 4NO0D 1SJHB 1KT2A 2YD8A 3MRGA 2WGXA 3AREB 4N90D 4NQCE 4P23C 5HGDB 3UO1L 3KPNB 5FFGA 4APQC 4Z23A 2Z92A 4W9CC 2FJSA 1A4CA 3U7WL 3VM7A 4A68A 3SQBB 4B9ZA 3DUSB 1PKQE 4I3RH 5JIIA 5F9JB 1X5LA 1T89A 3ZE0B 1DCEA 2P5EB 1S5HB 4L3EA 3DBXB 3BDXA 2WINA 5GGUB 3B8SA 1P7BA 1KXVA 3FULA 3S2AA 3ZE1F 2AEQL 1QATA 5KVFL 2WLHA 3I02A 5EEWA 1J0KA 4XE0A 3CZNA 3GXFA 4P57B 5GISH 4NNYB 2WN3A 4WNQB 4D7PA 3GSQB 4ZNEE 4L4TB 1AR2A 1C08A 2H6PA 3PDDA 4JM2C 1A65A 4DPRA 1SDAB 2ITFA 1SXZA 3SJVD 4YK4B 4KMLB 3VXUA 3U6RA 4OCMC 1ZK9A 2P7TA 2QHLA 3HMWH 3DO7A 2YIHA 2RH0A 1OGSA 4P2QA 2BOBA 4L8SA 2GB2A 1KC5L 5E6YA 1DBBL 1UFGA 1NFAA 2DKUA 3CH1B 1XIWC 4OD1H 4Z3IA 3KVPA 5CR8A 3ATAA 4G6AC 5DA4A 5IHHA 3CK0H 2KC0A 3JV6A 4R8WL 3E6FB 1GZPA 2ZCKL 1MREH 3LQAL 5D96B 1MCEA 2DD8L 2DWTA 2ZIDA 2N59A 2W0FA 4DPAX 3ROLB 2V2TB 4PBDA 1F1DA 3I3BA 3OGOE 5I6MA 3NSFA 3O3BB 4FMKA 5FV2A 4QEGA 3UTPE 1KENL 3VFOA 1ZK5A 2UWEF 3EO0A 2VDQL 2A6KA 4YHOL 5EN2B 3FU7A 1A6VL 2APWA 2WSDA 2QQLH 5D8JH 3TBVB 3CSYA 2Z8WC 1MPAH 1NGPL 4F9PA 1LO5A 2W59A 4TM9A 1WZMA 2EXTA 2J72A 4P5KB 3UYPA 5CN3A 4TVPE 4YPGB 5AALA 2WOBA 5C9KA 3MREB 4YC2C 1JV2A 1EPFA 4W9HC 3MROA 4UZGA 1IBDA 2VWEE 4Z8FL 2PR9A 5IVXF 1MCJA 1CGYA 2OL3B 1UVQB 1XIWB 1MRDH 1UXSA 4PGDB 2WZ5A 3RY6A 3IMBA 4K94L 4WUKL 3S35L 5EZLB 1I9RH 3MA7B 5AB9A 4ZMPA 1KJ2H 2BNRE 4ZMOA 3LKQB 4HDIB 1ID2A 2AI0L 1OV8A 1V8HA 1ZIBA 3FBQA 3KR3H 2Q8BH 4HPYL 4K4KA 3X11A 4DSYA 4F92B 1U0QA 2DQEL 1DQTA 1C12A 5DHMC 1CCZA 2R83A 4WU7A 4AL8L 4N0RA 4Y1SA 1F4YL 1MUJB 4GO6B 4JO2H 3P02A 2NY3D 1GYUA 2MJWA 4L9LC 3ZE0F 1WC7A 4XMZA 5E8DH 4YC2B 5CD5D 3MYZA 5IMOA 1G7QB 3BAWA 1CTNA 4G8IA 4RAUA 4HPOH 4Q58C 5CILL 1NINA 5CWSB 5DK0A 4MJ5A 4Y2OA 5IESH 1P7KB 3IFPA 2X2HA 5D70H 3QJRB 1QBLH 3BPCB 2HT2C 3GSOB 4L29A 4RFEA 4G11A 1CBJA 2GEQA 4MD5B 1AG0A 1KXQA 4F57L 4JO1L 1AO7E 3S36L 4PVBA 1P4IL 4QIRA 3SDDA 5HD8D 1NAML 5LWYL 1HCVA 2QJDA 3EOTH 1CLYH 1JXGA 3BUPA 4P07A 3VE0A 3ZT7A 5DVOA 2QTEA 4TQIA 2IPUK 4JPQA 5D7HA 3OJ2C 1BDYA 1TKWA 4L9LB 1GR7A 3ILQD 3CFKA 5SV4A 3UTSE 3WO4C 3HNTH 3VO0A 1XD1A 3F12A 1BJ1J 3J27A 3HG0A 3BP4A 3TWCL 3RVWD 5JPMA 3C09B 3JVGC 5HHMB 3WUWG 3LNFA 4MQTB 1ZA3B 3LY6A 5GZNC 5E6ID 4JM2F 4ZFFB 1LEIB 5L88L 1Q1JL 5FF6A 4B53A 4YLBA 3QO0A 2BRRH 3FYIB 5EOQL 3H9HB 4U1IB 4QWWD 4M6NL 5IK3B 32C2B 2XYBA 1WEJL 4D9RE 4PRHB 4XBEL 2O6CA 4AQAB 1YDPA 3BHBB 2WXPA 5MI0C 5E24E 2O5NA 4E9VA 4LU5L 3HE7C 4ES9A 1DFBL 1MDTA 1I3GL 4JG1L 5TH2A 3LKPA 4LBAA 4M1GL 4DGYL 2IDCA 5I16A 3RUGF 2EIZA 2PCFA 4RRPA 2IEPA 5E7BA 4ZUTA 3NIFE 1IGIH 1JN6B 2AQ1A 4MA8L 4Q14A 3SD2A 1WIOA 3WIIH 1ZGLP 2OJZL 1MFBH 4OF0A 3STZB 1C5DB 1BEYL 4PCTA 4TULH 3V4PL 5FECA 2BY2A 5JHAA 4J3UA 4YJZL 4ETYA 2G2PA 4L05A 3QEQA 2WQ8A 3E2HC 4NI6A 4R2GD 2YFOA 4LPTA 3GI8H