3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Otoferlin
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
3CSFA 1TJXA 4A55A 3L54A 2CHDA 2N1TE 4FA6A 1RH8A 2Q3XA 1GMIA 2Q0ZX 4AJWA 2YOAA 4L23A 1DQVA 1E7UA 3FDWA 3P2BA 4G11A 3RDJA 4QJ4B 1DJIA 4OVVA 5G2NA 5G55A 4XZ4A 2Z0UA 3PYCA 2ENPA 2ENQA 4ANVA 4GB9A 1E7VA 1E8ZA 2WXHA 3NSJA 4KZ0A 2WXRA 4IHBA 1RLWA 1E90A 3QR1A 3QAQA 4ICWA 1WFMA 3TWYA 2K45A 2A5UA 3FBKA 3QARA 2V4LA 3OHMB 5JHAA 4URKA 3F00A 1DJWA 2FJUB 1DJYA 3NZSA 5EDSA 2WXOA 3L08A 3MJWA 3B7YA 4FHJA 3TJPA 1WFJA 2BWQA 2B3RA 1K5WA 1DSYA 2DMGA 4ANXA 4QJ5B 2R83A 4WWOA 5CCGE 2KI6A 2WXNA 4L1LA 4ANUA 3HIZA 2YRBA 1DJHA 2CHXA 4MJJA 4HVBA 3IM1A 3F05A 3IBEA 1UOVA 2WXMA 4F92B 2FK9A 1E8XA 4WWPA 1V27A 1BYNA 3ZIMA 1E8YA 4LT7A 2X38A 1RSYA 2WXIA 3CSTA 4PS7A 3RPBA 5JHBA 3PS6A 3QJZA 4FULA 4KZCA 5CCHE 1TJMA 2ISDA 1DJGA 2EP6A 2NCEA 4EZLA 4HLEA 4XE0A 3DPDA 1QATA 4WAFA 3L16A 3TL5A 4F1SA 4ICXA 1YRKA 2DMHA 3SD5A 3QR0A 1HE8A 4GNKB 2A4ZA 2WXFA 4TS6A 5KJ7E 4QJ3B 4AOFA 2LHAA 3T8MA 1W15A 4FLHA 2NQ3A 1UGKA 3HHMA 3ML8A 3PRZA 4IQHA 4QAMB 4DK5A 2WXKA 3N5AA 5CCJA 3F04A 4PS8A 4WWNA 3ZW3A 4Y1TA 3L4CA 4EZJA 2CHZA 2QZQA 1E8WA 2K8MA 2WXQA 3JZYA 4TUUA 2CJSA 4NPJA 4WEEA 3NZUA 3HN8A 4L2YA 3APFA 1DJZA 3ENEA 2K3HA 4J6IA 3ML9A 4BGDA 3QK0A 2ZKMX 4ANWA 3L17A 2CM6A 4F93B 2RD0A 5T8IA 4V11A 1BDYA 5H4YA 2WXGA 3APCA 1DJXA 2JQZA 1BCIA 2WXLA 3W56A 3OAWA 1W16A 3F01A 2NSQA 1UOWA 4NPKA 3KWTA 4FADA 3PREA 2WXJA 4FJZA 4Y1SA 1CJYA 4L1BA 4NP9A 3ZVVA 3L9BA 5H4ZA 3S2AA 3KWUA 2CJTA 3DBSA 3L13A 2K4AA 4LCVA 4OVUA 2Y3AA 3M7FB 4NS0A 3R7QA 3GPEA 4F91B 4LDCA 4BFRA 4FHKA 2QZ5A 4EZKA 1QASA 2ENJA 3LJ3A 4JPSA 1A25A 4FJYA 2D8KA 4PS3A 3W57A 2CHWA 3APDA 4XX5A 2CM5A 3R7RA 4TV3A 4DNLA 4KITB 2UZPA 2WXPA 3PFQA
chains in the Genus database with same CATH superfamily
5C07D 4MZ3A 1PJ9A 4GUPB 2LOEA 4NQCB 1JE6A 1OCZB 1NCJA 3T2OA 1IILE 3TO4B 4C4KT 5KVGL 3B9KA 3O6LL 4UZUA 4RH4A 2YARA 3GMLB 3ULVC 1G5GA 2ORBH 1BMWA 1PNDA 3ABMB 4LSUH 3FBQA 4XVOA 3E9UA 43C9A 1I8KA 4HHWA 5T5NG 4XMUA 1R3IH 3KR3H 3IYLW 4P57A 3TGXA 1K4CB 4JQXA 4XN7A 3E6HA 2ATPA 3MCKA 1PBYA 1GIGH 1TETL 2AP2A 1SYSA 4FQJL 5AAMC 2WXOA 1NGXA 4PLKD 4AGOA 5BRZA 5JIMA 4BQ9A 5MP6L 1A1MB 1C16A 4ZTOH 1PLCA 3IFLH 1TFPA 4JFEA 3D69B 5JO5B 1JV2B 2X4QA 4JRWA 3WEAA 3V4PH 3O4LA 4NHUB 1BVOA 4K2UH 1H5BB 5EU6E 1HHHB 3NJKA 5I82A 4J5VA 3OG6B 2FWLB 5D93C 1XSIA 3RTQD 5I66B 2AERT 4YGVA 2I07A 1QLRB 1F58L 2BOBA 2C9XA 3MLVL 2DPKA 3GHPA 1N59B 4X7TA 3VFPA 4CMHC 6TAAA 5FUZL 4F7TA 3KXFD 5A16B 3GI9H 3K46A 3DX8B 3VB8A 1WCBB 3WEXA 4PD4J 4G8IB 1LO0H 3PV6A 3V0GA 1O7DC 2DQDH 3KW8A 3QIUC 1EJ6A 1UEYA 3PQYA 4N8UA 1U3HA 4MASA 4Y5XB 5HDLA 3X14B 5FDWA 1W15A 5DRXA 1UHVA 1JGEA 1LLAA 2QZQA 3QQDA 4DERA 1YDPB 4A63A 5EZLB 3FL7A 5JA8B 4Y2DA 4Y4KC 3MROA 4EN3B 2K9FB 4GAAA 4N28A 3JV5A 4W9DC 1RJYA 3K6SA 5EORH 1AOZA 3ZZ1A 4KNTA 3QUMA 5C0RH 4P4KB 1JVLA 4HG4K 3SCMC 3KAAA 4WNQB 2Q3AA 3NCEB 3PP3H 3SO3B 2V9QA 3VFGH 1JYXA 1VADA 25C8L 2PR4L 1DE4A 1KC5L 1QR1B 4Q9CA 3K6FA 1B0GA 5JOFA 5J3HD 3L8QA 4XNQB 4PJGB 3DOIA 3EO9L 2ZX8A 4MQXD 1IT9L 1YY8A 2BS9A 1EVTC 3BH9A 4NCC1 1P1ZB 4GRMA 2APWA 4YPGA 1JGUL 4N1HB 1EZUA 4M9PA 1ACZA 2W0FB 5CEYA 3FU7A 5IBLC 1CR9L 1D2PA 2Z91B 2WN3A 5DHDA 4KJWD 2XFXA 3UL4A 1NOFA 1AXSB 2ZXGA 2ZNXA 3B34A 4YQXL 3KWWA 1I85C 2JKSA 4O4YL 1HEJC 3QEUB 2I9TB 4U3SB 5E56A 3NABH 4GXVH 3ZDYB 1KCVL 4G5ZH 4DFHA 1UCBL 4Z0XA 5I6OA 1S7SB 1U8KA 1LE5B 3U79A 1CGUA 3GMOA 4YZFE 5AYQA 4G3YL 1BD2B 3ZQXA 1CICA 3MSPA 3MUUA 4WDIB 3EHBB 3BZFB 1AGEB 3TJPA 2F19L 2BK8A 3QA3A 2BY0A 2H7WA 2H26B 1AP2A 2TSAA 1TQBC 1FFNA 3ME0A 3O3BA 1E9PA 2E7MA 1G9ML 5C0JA 1SXSA 2OYPA 1OP4A 1OE3A 5HHNA 4H8WH 3RTQC 2BIHA 4GO9A 3FZUD 1SYVB 5KUKA 4KMTH 4WW2F 5E9DA 3QDGE 2OCCB 3I2CH 3UPCA 1E9QA 1D5IH 3NCJL 3WIIH 1HK6A 3EFOA 2QMKA 1Q9KB 1G7JA 5HHOB 1MCOH 3AY4A 1BVKB 1FNLA 4HC1A 3LEYH 3MUZ1 1H8LA 2WBKA 3BMVA 4FKKA 1MRDL 5I19L 3MFGB 1FSKC 3BWUF 3SE9H 5HI3D 3GSNL 1FZOA 4PJ9C 4NRYA 5I1EL 1X5XA 2KMWA 1CWVA 4FQPA 3NPSC 3KVQA 4OZFA 5B7EA 1RZFL 1FH5H 2AJVH 2AQTA 2QQQA 3H7BA 2AEPL 4FLOA 4GKNA 5I8CB 2UWEE 1P5VB 3WLBB 1W72L 2IMNA 1N3NB 4LQFL 1LP9F 3NP4A 2R8SL 2DY2A 2G3NA 2ARJB 4K8RC 4LP5A 2IGLA 4OFIA 4ZMTA 4IRSD 1AHMA 3LKSA 3RNQB 3AJ7A 1XEDA 5A2JH 4QTFA 3CZEA 3WNKA 4XT1C 3UFIA 1DVXA 2ESVE 3QQ4B 4WK0B 3L7EA 4DEUA 5GGTL 3CXHK 4H5SB 4N5UA 3BAKA 2NY5H 1V5JA 3MRGB 1J12A 2MHAA 4OKDA 2P5PA 4XXWC 1MELA 2LGNA 1JF5A 3HLAA 2C3XA 3KPRB 1NCWL 4P46A 1T0MA 3BLBA 2JJSA 4ALAH 4M1GL 2WN2A 2FEEL 2E76C 2PPAA 2Y6SC 1H3WM 4XTRD 1DSFL 3K8KA 4HUXA 4ODUB 1TG8A 5AW8B 3L3GA 4CADB 3JWNE 3UTTA 1JK8A 1HXYA 3WEMA 2X42A 1XV8A 4M6MH 5KOVC 1FFRA 4R96B 5IEHA 5J8OA 3ESNA 1MFEL 4KKRA 2C8NA 4KJWC 1CD1A 4L29A 3VXRB 2FWUA 4PS4L 1MCHA 3HN5A 2B2XH 5KSBF 1LO4H 5DD6B 3ZDWA 3DTXA 2OQJB 2R0ZL 5HYJD 4ADJA 1EH9A 5IWLC 3UO8B 1GOFA 1L6ZA 2VLKB 4X7SL 5ANHA 1EAPA 5B3JF 5IFJB 1TJGH 2Z1KA 2Z4QA 1P4BL 3VU2A 5DMIL 3G6JE 4H0HB 4JRFA 2APFA 4XC1L 1Q90A 4FFZH 2KLRA 4M3HA 4ZUSB 4TNWF 3NIFE 3BH8A 1O6SB 1OSEA 4RLDA 2X4RB 2IAAC 2OSXA 3Q9PA 4PJDB 4LLWA 1FZJB 1QI5A 2HJFA 2EADA 3C5ZD 2AVFA 3TV3L 2BSEA 4Y4FC 5BS0E 3AXLB 2O6FA 1CO1A 1XB3A 3HAEB 3SDCC 5F9JB 2F68X 3ZQ9A 3FZUC 2CO2A 4QOKE 3CHSA 3Q13A 3U7WH 2PUQT 4YSUA 5D1ZC 2OCJA 4JKLA 1UURA 3BVTA 4PRAA 4GI6A 5BRQA 1VKXB 3QJXA 1IGIH 3G6DL 3IXTA 1PFCA 4HS3B 3ET9F 4J27A 3CV5A 5ESQB 6PAZA 2MJWA 2WWKT 3N91A 4OD2B 4ZBJA 5DU7A 3GMQB 1BZOA 1NANI 3S34H 4QXGH 2JLPA 5GGRA 1RFDH 4JX0A 4YK4B 2C9UA 4K23H 4NM8H 3SBWC 2EO1A 3MXWH 3VVVA 1QNIA 3NK3A 4U1JB 3UZQA 3GRWL 3QWNA 1UZGA 2DF3A 3V52L 2NZ9D 4UAHA 2FATH 3KPSB 3OZ9L 1KJ2L 5BXFB 5IF0B 2W1NA 4JKMA 5EIIA 2Y7LA 4L2YA 3L3HB 4U2YA 4XWOC 2AK1L 2B9BA 3D18A 4PJAB 4LMQE 1W0WB 4WU5A 2HX8A 2GJZB 3OB0K 3OHXA 2B7DT 4RGND 4GKSA 1DJXA 4NT6A 3C6SB 2E7CA 3NJXA 3CBJB 4EDXB 2YZ8A 4Y19E 4G6MH 5SWZD 3NCCB 1FL6B 4I9XA 3FQWB 2X2JA 1ITCA 5KVGH 4CVUA 2W9EH 3R7QA 4JR9H 2YPKA 4PY7A 4Q97A 1D6VH 3BEWB 5GQBA 2K0RA 5KUMA 2D4DA 3WKQA 3QO1B 3H55A 3TC9A 3K8MA 2W80C 1CXLA 1MCNA 2FH6A 4R2GD 3GS7A 5EBLB 1WFTA 2WXPA 1FVCA 4N3UA 2XX0A 1TYJA 1S9VB 1XGQA 3X3GH 3FCTA 4FA6A 2YIHA 1TETH 4AJWA 5BJTA 4H25B 4LLAA 3N50A 1KJMA 4QHMA 1ND0A 3HZYA 5MP6H 5DGQA 4QXTB 4LAQL 5BOZG 4YUEL 4JDTH 5CR1A 1CIDA 1JGIA 1NINA 3HC3L 1AGDB 3FRUA 5KOMC 1BWWA 4ZYKB 4KGJA 5C0IA 4HETA 4BELD 4NPYB 1TZAA 3WE6B 1HTYA 5L4MA 5LBGA 5DURD 4RSYA 1J5IA 5ID0A 4XP1L 4I2XE 2NY4C 1H6TA 5F1IB 1EVUA 4AZ8B 1XSOA 2YPLB 1M05A 4NQED 1DBJL 5HPMA 1OSYA 2ZUWA 4NNYB 4TUKH 3VXPA 1FNGA 3HIZA 2RA1A 1BJ8A 3MUGB 1IIIA 4AQZA 3I6LE 4YSQA 5ISZB 4Y9CA 4LOUD 1HZKA 2BLFA 2XA8L 1K8DA 4GUCA 4I77L 3B3IA 2DMKA 2DB8A 1OB1B 2NY1D 3SBPA 1A1OB 1XEUA 3DX9A 2Q6WB 2AK4E 4WEBH 5LCVA 3B9EA 3O41B 1NTDA 4GRLD 5IW1B 2NXZC 2ZX9A 1H3GA 1KLGB 3F6LA 2D3JA 1CS6A 1P5UB 2Z92B 5TK2A 2NY3B 5CN1A 4Z3TA 4UT7H 1R3LA 4AQ8C 2J25A 3CN3A 5KANI 3X11B 3EO0B 3C75A 2ICEC 3PNWB 3APNA 2BVPA 3KLAB 4JO4H 9PCYA 2UXFA 3EYVA 1X9UA 4G8FB 3UZEC 3L4UA 4LHUD 1BXVA 4FLHA 3DX4A 3RA7L 1A4JB 3KL5A 4BKTC 2DWTA 3WFDH 1HJCA 2EIZB 2BFVH 3KS0H 4IBSA 4KKPA 4JG1H 5AOIA 5BPPA 4NPJA 2C9QA 4UTAA 5CBEA 5CGYC 1KC5H 3UTPE 3CDZB 3IJYB 4RQQB 1LWJA 4ZFQA 4PJFB 1BQUA 2GIXA 3VFNB 1TZHB 4KKLD 2RD0A 1D9KC 2P8PB 3EO9H 3S35X 5E2TL 1U8IB 1W6WA 2VNCA 4KHTH 4Y5VA 4O02B 1DN0B 2XZCH 2VR5A 5GRWA 4WK2B 2OSWA 2FSEB 1CR9H 4ZFOB 3D3VB 2G9KA 4NQQA 5LDSA 2X4NB 1OW0A 2Y69B 4AKPA 4H1LH 2YWYA 3NTCH 2CKBA 5DTFA 4LDLB 3FTYA 5SV3A 1QW9A 4KK8D 5HYFA 2NX5D 4XC3L 4UILL 4LNRA 4J3OC 2X4SB 2CO6B 4NSKB 3U36B 2E3VA 3SKNA 3FT3A 3QRGH 5JHDB 1Y0LB 4L4VA 2WLYA 1LO3L 4QRQB 2A9MH 4UBDD 1DVQA 3QGVA 3SEPA 3ARGD 3WKNA 1OF0A 2XKSA 4OCXL 4LCYA 2YAEA 3TBYA 1NM4A 3T8XA 4ILDA 2IPTL 3AREA 5ESVB 2ADGB 5E5LA 4O58L 3VXNB 1FLRL 2VDMB 3GSOA 3QI9D 1WFMA 4OH2A 3HUJE 2XWXA 1SY6L 2E0PA 4MDIA 5AZ2L 3IGAA 3V7AE 1C8QA 1MIEL 1E27B 1PY4A 2XVLA 3GM0A 5L88L 5TQ0L 1JYWA 1IV8A 4I5BA 5HYQA 4PEEA 5D72L 1EHAA 2F7PA 4WU7B 2Y0SA 3ALXA 1WZ1H 3ARVA 3OXRA 4TMPA 2HVBA 4X6BA 4X5PA 5L4IA 5HHPA 3VU1A 3EADA 4WO4D 3ABLB 1G6RA 2NYYD 4IGBB 4PJCF 5I8KL 4J7RA 5I19H 1MRDH 1B3IA 1MCDA 1PD6A 1S4IA 4LCWB 4RFNB 2NY1C 5F9OH 4M1DL 1O75A 2GJ6E 5CP3A 3SE3C 4XPTH 2XWEA 1MLCB 4KMLB 4PP1D 4PGBB 1HSBB 1P84J 4RDQF 1RZFH 3WMQA 4MMXA 4WFHD 3CIQA 1E28A 2R2EB 4MAYA 4QF1B 1W72H 1MJJB 3MV9A 4K3EH 2OKMA 2EUZA 5ALCL 1OLZA 3OR6A 3KBEA 1H19A 2GTZA 3HKFA 1WUNT 4Y4HA 4Y8DC 2Z31D 3QUYC 2G2PA 3JTTA 1IFRA 1T0OA 3CSGA 1QZNA 1A9EB 5E6RB 4PP2B 4OF0A 1NFIA 2NY0C 4KKBC 4WQOA 5DEFB 1G7HB 4EQ3A 1SVBA 2CUIA 2OW6A 2FO1A 5CSZA 3NMEA 2E7LC 3LH9A 2OV0A 5HHXL 1ZWIA 3EUUA 1RZKC 5I1DB 4JFFA 4YXLL 4XPFL 1Q9WA 4MJIB 3PIQA 3HC0B 5TH2A 1WA0X 5JW4M 2P24B 1TEYA 2X3AA 2LAGB 2DQMA 4DN4L 1HNGA 2CIIA 5DFTA 2F54A 2MNUA 1IGTB 4X7SH 3TCLB 1V55B 5FHBH 4H8UA 1SHWA 4KK8C 4JHWL 4LFHG 3CZUB 3NA4A 4PHZA 4B9CA 5EZOH 1X7QA 1RSFA 5CD5D 3DGGA 2NNRA 2YGOA 3UP1A 4KITB 5C6PB 5GIRB 3WNIA 1FYTD 1LD9B 4NQCE 3S96B 3DX6B 3N9GH 4XXCC 3ARGC 4NI3A 2WJ7A 1BQHA 1MPAH 1A3LL 5ENWA 1SUJA 1QOKA 3VFTA 2XA3A 1NBYB 5I1IH 2IGFL 1MCSA 2MOQA 3I02A 4G6JL 4XCYA 1JZ8A 2X3BA 2P4AB 3C5XA 2NT0A 4Z7VB 4TTDD 2DDQL 2BVOB 3CVDA 5TF0A 5JQ6H 2VDRH 1OP5H 1WS8A 3KLHC 1X5YA 1ID2A 3QUXB 1G7LA 1UADC 2PF6A 3U0WL 1X9RA 2L4OA 4WWKC 4RAVA 3EYOB 3SQOL 1G0XA 3PL6C 2IJ0C 3GXFA 4DP2X 1CZ8L 2YC1A 5JOEA 4U1NA 3HG1E 2GSIA 3SY6A 1X5GA 2BHZA 1ETA1 3JWNC 1XH3A 4QRRD 2X3CA 1YSOA 4HJ0D 5E00B 4TSBL 1UOVA 3OGCB 3SE8L 3AWEA 1WFNA 5A1AA 5KW9H 3ARPA 4NENA 1TQTA 1U92A 3T4AC 1MIMH 2QKSA 1JYNA 4FYQA 3QG7L 4X8CA 4RCAA 3VXMA 3MJ8A 3RWCA 4XMKL 4XO4A 1IBZA 4ZAKC 5B8CA 5L2KB 1JWMB 4HSAC 2D03L 5F1NB 4L1HA 3QR0A 3AABA 4PRDB 1NKOA 2G9HB 2B1HL 2N0MA 3H7LA 4MYWB 4ZO8A 5H37G 5IR1A 2IAND 3BQVA 4OD1H 4DSYA 1B0WA 4RFEB 2BRQA 2J5LC 4JO5A 3DDGA 2VC2H 4X7CC 2QPUA 1J5OL 1XBDA 2PCFB 5BW7A 3ASWA 1THCA 4JUSA 1KIPA 3FCUB 5DEGB 3HE7B 4PCTA 5D2LE 4S2SA 5L8JB 4QXUH 4W9GC 1VHPA 4Z7WB 4EZMA 3SGKC 2WVVB 5LN8A 1NDGA 1BCIA 2NUPB 1BFVL 5EU5B 1T1WA 4RWYH 4NQUA 5FFGA 4DGVL 1QLFB 3WTSA 2C3VA 2GUOB 4M5YL 4IBVA 3R06A 2Q5BA 2VRQA 5LNEA 2VJ0A 5FGBC 3CVBA 3D33A 1C08A 3MLUL 3T1FA 1MWAH 1ICTA 4GJTB 4N90E 2EDEA 4Y1AB 5FYJH 1NUNB 4PJGE 4JFQA 5CD5C 4LAQH 3IDJB 1SN0A 4M1CD 2CCVA 2FIKB 1YQVL 5KVFL 1FF5A 4X6CF 1YYLH 3BHBB 1EJOH 3LQAL 3HOGA 5FYKE 3TWCH 1ZVSB 3BZ4A 1HXMA 3GI8L 4W93A 5FOBA 1WRFA 5KAQF 3OQRA 3F7RA 1RH8A 4GG6F 3EYFB 2M26A 4E9RA 1AC0A 1G4MA 1YMMA 3D2UA 4XP1H 1WFOA 5AKSA 5FXCH 2WGNB 2YKLL 1QFWI 1YN6A 1T3FB 1AKJB 4ZS7H 2K6ZA 3ZDYE 1XF4B 1Z5HA 1H0DB 1IFHH 4GBXD 2WZPD 1GZHC 2RALA 3D0LA 4BFJA 2CGZA 3NN8A 4FQLL 4HH8A 1A6VH 1MHPL 2CIKB 2R4RH 4DEPB 4PVBA 3UGEA 1BD2E 2JIXD 2XA8H 1Z0NA 3CFCL 1JWSA 4WW1B 2VW6A 2DYPA 2FEDC 4XOCA 1U8JB 2NNXA 1FFTB 2QT6A 3QT2A 4FDWA 4X5XB 1IM3A 4JHAL 1RIHL 2D9QB 3CFTA 2WSKA 1J18A 1MVYA 1Y1DA 3D85B 4G9FB 3IDMB 4PRBA 1EFXA 2EECA 3HMWL 5HHOE 5HSFA 4PYGA 1MEXL 1OXYA 4ZD3L 2HX9A 4P07A 4QHNB 2J72A 3IN0A 4UCFA 3DRTA 4JFPB 4J3WA 4KI5D 4OIIL 2XXMB 5I6LA 3GSNB 5DQDH 1LO5A 4HIQA 1KEGH 1GJIA 2BZCA 2TAAA 3QG6A 5D7IA 1J48A 1L9QA 1CD9B 1RPQA 3O4OB 3QFJA 4R7VA 5IG7A 3TA4D 5CZKA 1Z66A 2FJHA 4LEXL 4M7ZC 3TA3B 2DQEH 1OGAE 1H8OA 1W72B 4ZUVB 4J6IA 3O45A 1IQDB 4MA1C 1UWFA 4UT6L 3G04B 3MLZH 3TJEL 1PG7W 4UQDA 2G5UA 1IEAA 1AD0A 5FCSH 4KO9A 4A37A 3W5MA 4I1PA 1OGTB 3BYTA 3WELA 1DZ0A 4U1MB 2ZOOA 5L8LB 3W37A 1W0VA 3GNMH 3O6FA 3PWLA 2X1QA 1EHLL 5K9QG 3NA9H 5I1HH 3KPRE 4XVTL 2VLRD 3WIFA 3PJLA 4QHLB 2A73A 1G7PB 1G7QB 4BSWB 4IJTA 2WBJC 4PV9A 3HEIB 4OCXH 4Q52A 4QRPA 4UF7C 4NLAA 2XZQH 4PAZA 4YSTA 4EJ1C 4YDLB 4KQ0A 5CS7A 1XIWD 1F41A 1MSPA 4XP9H 2IPTH 1E2VA 2OTUB 1J8HD 2FZ3A 3QNZA 4AZUA 2YBRB 2RQEA 5DJ2A 5I5MA 5M95B 1OAJA 2PPCA 3II3A 5DO2D 5AW4B 3VXRE 5IVXB 2Q0ZX 2WMPB 3KPTA 2X44D 5F7NC 2A38A 2Y5TA 4G11A 2Q86A 2DMBA 4RMTA 4ETQB 2VN6A 5DR5H 5GRJL 1VSCA 3QORA 3WN5A 1VERA 5F7EH 1N7ML 5ERWB 5I8KH 5FO9A 3IJEA 4B9FA 2DYRB 4POYA 4M3KB 2JKJA 1D3CA 1TR7A 4XNYH 3K1DA 3C08H 3VNZA 1B3JA 3UTSB 3V4LA 4A7GF 5GGSY 1LYQA 1AG6A 1PLGL 4OZGA 4HJGB 5DHVB 1KF9B 1CLOL 4GLRI 2E9BA 3FCSB 4NGHH 5C0BB 4JFWA 4A38A 4DGUA 5T1KA 1M6OB 3TZVA 4AQ1C 2XQ0A 1LE9B 3QEQB 4H0IA 2Y2TA 3PAUA 3UROR 3GSWA 1P9MC 2W9DL 3BAYA 2AV7A 4H0LC 1P0SE 4QGYA 5JDSB 3MAWA 2JB5L 5JLZA 3TYFB 2DKSA 5BV7C 5FV2A 1J0JA 2IBBA 2XKUA 5D1QD 3CAFA 5D6DC 4C83B 1QYGL 4Z3GA 2DD8L 5D6CA 3P30H 3KPMB 3BUYB 4JDEB 4D3CL 3GPSA 4LIQE 4YDNA 3KPSE 3S88L 4LSRL 5TF1H 2W38A 4NP4L 4DWHA 3KXFA 3BWAA 1KJ2B 5DMJB 1ZHLB 5K9KB 2JKNA 3L3KA 3OXSB 4OLUH 1ETZA 1LDPL 1U2YA 4PJAE 1DDHA 2LTQB 4NZTH 1E2WA 2J6EA 5GZND 3OAYH 5CZVL 2YS4A 1JGLH 1AI1L 4IRZH 4JHWH 3VI3A 2E8YA 1CTOA 3WFHB 4APQB 3LPOA 3OAWA 3QNXA 4AITA 1KLUA 4Y2OB 3K6IA 5C3IA 1XD0A 5C0AE 1ZDQA 3QUML 4RZCA 3S3DB 4YLCA 3IMVA 4TTGA 1XCTA 4IS6B 4BFRA 2A9NL 5C0FB 3M1BA 1QASA 3MLTA 4G6JH 2BY3A 3VCLA 2IQAA 4PJBF 3S36H 3VD1A 2ZZUT 4PJ7B 3NCYS 3VD7A 2DDQH 5AW6B 4FL4C 4A2MA 4PD4K 3TEUA 4HKZB 4J6RH 5K5YA 4P23C 1YEIL 1WAPA 3WI9A 4EF3A 3CC5B 2QDVA 3I75A 3RWGB 2NDFA 2P26A 2UY6B 1L9RA 4I0PC 3REVA 5T3XD 3NH7L 3EJUA 3PGDB 1VCAA 3WY4A 1U58B 4P5MA 1CZ8H 4RDQG 4Q6IC 2H4EA 3US1A 4TSAL 1F0LA 3MQIA 3DSFH 3ESMA 2EXYC 5I8OH 5EEXA 4TSBH 3SE8H 1JPSH 3IAPA 2CJUL 4LSTL 3IJSA 5JNYB 3HZVB 2WUBL 2WBWB 1DL7H 3PWUB 3ULSB 2Q1EA 4N2BA 4K5NA 4KUZL 4XO5A 3JBG7 5F88B 4XMKH 2IDSA 2CXKA 3VI4F 1VZGA 2D03H 2A0LD 2HRPH 4MDJA 2WLZA 3TPUA 4HVBA 1AFVL 1QRKA 3TVMA 1GZQB 3VQLA 3V0AC 5MENB 5D1XE 1JSYA 2A4CA 2HN7B 5E5MB 3WHE0 2X7LA 3P3TA 3TO4C 3L81A 1J0YA 1DVFA 1JZEA 3QAZC 4HEMA 3I3BA 2KZBA 4NDMA 5IW6B 4EZLA 2ZWNA 3TJHD 4XNZB 5IVNA 3MRMB 4XZUB 3LNGA 3BT0A 5ITBL 4HWZA 1J9SA 4U7KA 4KOBA 1XGPB 4HC1L 4GT0A 4UOZA 3VG9B 3IJ8A 4LU5L 4RETB 1N2RB 2EDRA 3D0VA 4KQ4H 4TF4A 3T77B 4OUUB 4Q7DA 4HIHA 3SE4A 4DGVH 5CCJA 1X5JA 2NY2B 1T7VA 1W8EA 4MNHA 4S1QL 1BWMA 1WICA 2N7BA 1ID5I 2IBZX 4DW2L 4L8BA 1EGJH 4UQIM 4FFTA 1WAAE 3SKMA 4PJFE 2YQBA 5F8RC 1TVBA 5IQ9B 2FUQA 1DUZA 3QFDA 4HALA 4ELMA 3CZNA 3ZN6A 2ENYA 4PJ8A 3RDTB 1H5BC 2XWTA 3LQAH 3BX7C 1L9SA 1Q9OA 4JQVA 1CT8A 3DXAA 1GVIA 1MJUL 1YEFH 5KBLA 3QJHB 3MLSL 5IFHL 1FBIH 1UM5H 4PGDB 4JB9H 5HDRA 3D3VE 5BUPA 1YN7A 5HDQL 2AQSA 3IF1A 2W95A 1EDQA 4IMKC 2K6YA 4IRSA 1F6LL 2JB6A 2VO8A 5MEPA 2ICWJ 1NBQA 3C5SB 2RQ8A 2ADYA 1CFNB 1CE6A 1MJ7H 5HDBB 5HP5A 4L3CB 3N6YA 3WNMA 4Y5XC 2A99A 1JI1A 2HVJB 2F5AL 4NZUH 3QDJE 2BHFA 5TK4A 3DTUB 5FEBA 4N2CA 5JHDE 2ZSWB 4Q4IA 1CDCA 1CL7L 3ARWA 3AY2A 3FDWA 4AW7A 1AIFB 5CILL 4OVVA 1FZKB 2XG5B 3EYUH 3IDNA 1UYWL 4X4XA 1MVUB 4XPHL 2WLKA 3QIBD 4J3SA 3W11C 3GJFB 3S9DB 3I74A 3IDUA 1CFVH 4EN3C 2IDTA 4JHAH 1JVKA 1QHPA 1TU2B 4MNQA 5J9PB 4P4KC 1ZS8B 4UIKL 4L8SB 3VQ1C 3SO3C 3V5HB 2JV6A 3QDHA 1CVRA 3NSFA 3HMWH 3BMWA 3Q0HA 3RVUD 5D70L 2A0LC 2NTFB 3V4VA 1SDYA 3P0YL 1MG3C 1ZHNB 1DCLA 3MCG1 4W6YB 4LCWE 2W0PA 4OZFG 2Z93B 4KO7A 4HJTA 2QGBA 3TJHC 2A74A 4WW2B 1AH1A 1OPGL 3I6KA 3L2NA 1Z6JT 1QABA 2HFEA 3GIVA 3H3PL 1PMYA 2DTSA 1T04A 4ZTPL 2V5RA 1E3ZA 3RWIA 1A3QA 1MF2L 4R7DA 3VJ6A 3RVTD 2VLKD 2EACA 2JWYA 4RAUA 3ULUD 1J8KA 3TJEH 3FB7A 2MRYA 5DS8A 4X8XA 4QLRA 2UUDH 3CMOL 1MRFH 4ZQTA 5L2JA 2FJFA 3EHBC 4K15A 1QVOA 4OT1H 4BZ2A 4XH2A 1TFHA 3UC2A 3JZYA 2KERA 2BNQA 2R23B 1A6TB 2W07A 4M03A 1CF1A 5L4JA 3CWGA 1L3WA 3ML9A 1G87A 3SDXB 1E4KA 1KELL 4P3WA 3T0BA 4UNIA 4RGMB 4XNAA 3TBWA 1B4RA 1Q0XL 4NWUH 4HWBL 3BIAX 4JJ5A 1JP5A 4MNGE 4FJZA 5E6YA 4MJIE 1N26A 3GB7A 3VXUA 3O81A 2BFGA 3MBXH 3K81A 1RURL 3PXHA 2N4IA 4M61A 2FYYB 1CLYH 2AJ3A 1KCBA 3GLEA 4HU2A 5DJZB 4XN2A 2N0KA 4TQEL 5SWSB 5SWQA 3FQUA 2NUTB 4XGZB 5IJKA 2AZUA 1YAIA 5GRJH 4WV1B 3SOTA 1DO6A 4R9HA 4F8PA 5GGUB 1ZLWK 5EDSA 1TITA 1JRHI 3PFQA 3EJTA 3RL2B 2ITDB 2OMZA 1WD9A 2NPLX 3QJFB 4J4PC 3C8KB 5LQBL 2G4GA 3FK3A 4IOSD 5GJTL 2ZKHH 1GOHA 4QY8A 5KSBB 5EU4A 5T3ZH 2V7NA 1PLGH 4IKKA 4Z7IA 3P77A 4JO2H 4Z78A 3MLPA 3G3LA 1CLOH 4X9HA 3DV6B 3Q2WA 4HF5L 1G0YR 1M2VA 3C60B 4A7TA 3FSOA 2BPBA 1FN4A 3T3MB 1RIUH 1JWUB 1E2ZA 2AQPA 3CSYB 4ODWA 4OM1H 3VXOA 1XGRA 5I1LB 2Y06H 4O2CB 1HVXA 1EXGA 5EDXA 2IADB 3NZ8B 4U1IA 3HRZB 3MU3A 3L4VA 5DD3H 1NFDB 2X4PA 1GS7A 3GXMA 3O6ML 2F2HA 1EZLA 1NC4A 4KU1A 4WO0A 1E6OH 1GMEA 1ZT1B 3Q01A 1KN4L 4PJ5D 1RSYA 3QZWG 2IFFH 1TTBA 3KM2A 4WUUB 1QMUA 4E41E 1R46A 4E2OA 4OZIE 3RE0A 1S2EA 4D3CH 2P47B 4LF3A 4GXUN 4M5TA 4NQEA 3L5HA 1F6AB 2Y4SA 3CK0H 5CIPA 2OP4L 4ZXBB 1A5FH 4G82A 5L2KE 2ZX6A 4EE2A 1G5AA 2EDKA 3RAJL 4JG0H 4H20L 3VW3L 1FWXA 1AI1H 5IVZB 4G1EA 4PB9L 3VXTA 4DEWA 4ZNEA 1EZSA 1YVLA 3TOPA 3N5AA 3EO1A 4UOQA 2YUWA 3BUIA 1KCRL 2UZXB 5TPWL 1N64H 4RESB 1ADQA 1MXDA 2XZAL 4A2HA 4AIZB 3W38A 1BIHA 3FXIC 4XP4L 4KKAC 1D5RA 2HJLB 4MA7L 3KLDA 4UTAL 1YNLL 3X3FH 2JCCF 2NR6C 4NRZA 4Z7WE 3F7QA 2YPLD 5DA4A 3WO3B 1KGXA 5TE7L 3MBEB 3GMMB 3ZU8A 1UUNA 2CLRA 5ISZD 4YIQA 4WWID 5A2LH 2C4XA 4C56B 4DP7X 4DKFL 3BQUD 5GS2H 5DFVC 3EBGA 2VE6A 4UYQA 1N0LB 2EDOA 1U95B 3H9SD 4N5EC 4AYGA 2P1YA 3ZUNC 5D55A 2I32A 3GXNA 4Y1AE 2VN4A 2VERN 3NG5A 1O5PA 1ZLSL 2E9IA 2YGNA 2ENJA 2MNWA 2J4WH 1BBJB 2JELH 3NH7H 4OCSH 3UTQB 1DQJA 4KDVA 4YK4C 1U3JA 1GYVA 1F1AA 3A67L 12E8H 3GLZA 2CKBL 2EO9A 4X6FA 1N67A 4NEHB 4XRCB 4AL8H 1I4FA 3LPWA 4TSCH 3HNTH 5LJYH 4J28A 4AEIL 2CA3A 4NIYE 4OAWB 7PCYA 1MJ8L 3ARBA 4LSPH 1XQ4A 3H4HA 3KPNB 4XB3A 2WO2B 2DEXX 2WUBH 1MCQA 1NMAL 4TQIA 1FUNA 2J8HA 1KULA 3NJNA 4Z95H 4DGIL 4OLXL 1K8IB 3K91A 3STZB 3V2AR 3TONA 4YXHH 2NX5A 4B3EA 2Y3NA 2DQHL 4I7ZC 1S7TA 2VT0A 3LQMA 4G72B 5DYFA 1S5IH 1L9NA 5ICXB 4U1LB 3VWJB 2D7QA 1BOGA 4BGLA 5CAYB 1KXQA 2E9JA 3CPLA 2MKWA 3L4XA 3VXSD 2P7TA 2WLIB 1RZPA 1WC7B 3QULA 1TCRA 2YMXL 5KBNC 3QI9A 1J0HA 1FAKT 2NW2B 4OGZA 3JYCA 5F96L 1RPUA 1RJZA 3A4AA 3AROA 1FO0A 1J1PL 3LV3A 3ZIMA 2ZWSA 2X4OA 3WFCL 4G9FE 2G60L 3THML 4F2MA 3DUUB 2CDEA 1MFDL 5HHMD 3EJRA 3RY6A 1Z9NA 3BPOB 2ZX5A 4I18B 1INDH 2CO1A 2MPAL 4XMZA 3ZHDA 2JKTM 4HIJB 4AEHL 2OK0H 1IAKA 4M7LL 4XI5D 5C08D 4DW2H 4F8LA 2I5YL 3WUWA 2HLAA 2P80D 3TX4A 4MSWB 1REIA 1BV8A 2P5WE 4YDJB 5FK9A 3ECVA 3L95B 2OZ4H 4MB3A 3BUPA 4JGUA 4LSDA 4PS8A 4R7NA 4B41A 5C0ND 1ORQB 4MWFA 5T1LA 2BC4B 2B08A 4OD3L 3TIEB 5AYTA 1QBMH 1DSWA 3OX8A 1Y7VA 3ARQA 5EIVA 5ACMA 4ODHH 1M2OA 4NX0A 2AXGA 1Q94B 4ZS6D 5C09E 3BFWA 3L17A 2OYKA 1HHJA 3QDMD 2OX5A 1MFUA 3GUTA 2X12A 3V5DB 4IGBD 1HCZA 4YXKL 4WHYH 2V7HA 3RWEB 4F7PB 4OGXL 3FQRB 4JKWA 4BDVB 1JJUA 2XV3A 1JPFA 2J43A 4EIZC 4FG6D 3MR9B 4K9EC 4BK5A 1ZIBA 4FG0A 3L7FB 3E0GA 2CK0H 4MXWL 1JGDA 2Z8SA 3CH1A 4O5LL 3ZMEA 5L4FA 2PCYA 4LSQH 4P2QE 2NMSA 2Z35B 3SKOA 2VYRE 4PBVC 3VRLF 4F3FB 1UD5A 1P84K 3FU9A 2NY3C 2R7EB 2WOBA 1YJDL 4KK5D 4LRNL 3U30B 3PXJA 1XR9B 1T21B 1ZY9A 4MBOA 4L48A 3V6OE 3VFUB 1OAYL 1VZHA 2GSGA 4KI1A 3WS3A 4TULL 4EEEA 9CGTA 2YD1A 2IV8A 1I9RL 5HHVL 5IVXE 1TYRA 1CGXA 4IIQA 2G5BA 1HN1A 1BAFL 4XHQA 3UX9B 2HMIC 3IFOA 2G30A 1QSEA 4Z5RA 2VOTA 4X7FC 4QRTB 4LASL 3DHPA 4H0GA 4KNSA 4AYMC 3S3SA 4Q6KA 5BZZA 3B9KB 1FYHB 3ETTA 3S8WA 3KCPA 4L9LA 5CU5A 2ZXCA 4JRYD 1HX0A 3OHMB 1KPVA 3MLRH 3ISRA 4PREA 4WI5A 4CDHA 1WFJA 3UTSE 4PG9A 4P57B 3U2SA 3E6HB 2ATPB 2OXGA 4NM4L 5EHFA 3FU5A 4FZEH 1T6BX 4KROD 3H3PH 3ARDB 4ZTPH 1I8LA 1M71A 3L5XH 1CD0A 3MKGA 5BRZB 1SDDA 4NQDA 3SDYH 3LSOA 1UWEL 4PJCB 3FB6A 2CGRH 1C16B 5KVDH 4NKMA 1AS8A 5ILTH 3QEQE 3Q05A 4OIAA 2XWRA 2X38A 5MEOA 4JFEB 3TCTA 3CMOH 1XXDC 3N44B 3HMXL 4WI2A 2FB4L 3QJZA 4D8OA 3NIDB 2JJTC 3IU3A 3O4LB 1TZGH 5TGBA 4BWWA 2V5MA 4KK9C 3UYRL 3K71A 3EDEA 1UT2A 4YGVB 2I07B 5EBWA 3RGVA 2BOBB 3JYBA 1I3UA 1SMOA 2CBTA 4X7TB 1QSFD 1S78D 3VFPB 3GMRA 4QRUB 5HGHA 4F7TB 1Q0XH 2WWMD 3K3QA 2EAEA 5C86A 1AAJA 4RMQA 5F6HJ 4EAEA 3NDZE 5C7XH 1T80A 4P3CH 2CHZA 4UYPA 2VM9A 4NCC2 1MH5B 3Q5TA 1NOLA 1T2QH 2WYIA 3VFOA 4CBZA 1U3HB 2J71A 3GSRA 3PJSB 5FDWB 3C2AL 3EAKA 5DRXB 2L7JA 5SX4H 3N40P 3H6JA 4IGBC 1YEEH 3Q2VA 1JNNL 2YD9A 3HG4A 2NRDA 3QQDB 4CKQA 4RFNC 3O3UN 2KZWA 3GBLA 3FN9A 5ANMB 4MKMA 1EK3A 2Z34A 2E8ZA 3MROB 2A3TA 3OL2A 3JV6A 5H35B 5DK2B 4L5FL 5EU7E 3FMGL 1FNAA 2DJSA 5GJTH 3K6SB 1DQDL 1RJYB 4XP6H 1BEXA 4P2OB 4UM8A 5EA0H 1J9TA 3QUMB 1ESOA 2ZONA 4KY1H 1I9JH 4WFGD 1VADB 2IALA 2WIIA 1MWOA 2J1XA 1F4YH 2OL3H 1DE4B 2NSMA 2LU3A 5JOFB 1B0GB 3CLFL 1XGZA 3QHZL 2EXSA 4PJ7E 4HGWB 2WGXA 4YSAA 3ARSA 5T5FA 2R1WA 3CQQA 1YY8B 4JHZA 2MOVA 3HTLX 4GRMB 3LNDA 4MBRA 3DMMB 2IH3A 3MRQA 1VIWA 1ZT7A 5F9WB 5E9NA 3FU7B 5CEYB 5DJCB 2XFXB 5AAWA 2E27H 1G4RA 2XVKA 3KWWB 3T6WA 3FU0A 2A1WL 2A9BA 1T66C 1FL3A 2VO5A 1PEZA 3WUZA 4Z0XB 1CCZA 1U8KB 3GMOB 5EH1A 4TUJB 5AUMA 4FERA 2R83A 5I15L 1F13A 2IAMD 3ZKSD 3H3BC 3MV7D 1I1FA 4Q6YA 1HWHB 5LCVH 1ZTXE 3QA3B 1XGTA 4NFBA 4N2DA 1DR9A 1AP2B 2AQ1A 1EJ8A 2Z6FA 5ABAA 5MENE 3ME0B 1QR4A 3ATAA 3O3BB 1E9PB 4FNTA 4H88L 4HCRA 5C0JB 1LK3L 1E9OB 3LRMA 4HS8H 5HHNB 1UM4L 4BYHA 5D7LB 1IVLA 2Z7WA 5E9DB 1A7RL 2D2OA 2H1PH 2XZAH 3OJ2C 1HZLA 3SD5A 1E9QB 5LGYA 5B39G 2BIQA 3EFOB 4MA7H 4DUVA 1QFWL 1GJWA 2E5EA 2ID5A 2YKKA 5AYUL 3TEWA 1HKFA 2CD0A 3WJLA 1N68A 1JZ7A 3TEXA 1YPZF 5FB8A 4UDTA 4P9ML 3QUXC 4PRHD 4BV1A 3LKRA 4W9ZA 4GSQA 1NGPH 5KSUB 3VO0A 1OTUD 2CPUA 3SOBH 2GAZA 1F45A 3O9WD 4OZFB 3RVWC 4ACTA 4UTBA 5J6HA 1OP9A 2QV2A 4B9YA 3ESPA 3QYMA 4GKNB 3UIYA 4Z7NF 4R26H 4TVPL 1S9XA 3IKKA 1QKZH 4GAJH 3BAIA 2XSKA 4NQSB 1A6PA 1N5AA 3BN9D 1QQDA 3DX1A 3U9WA 1A6WL 3MZGB 2P44B 4KUCD 4P2RA 1SM3H 3D5OF 4H7VA 2A9DA 3LKSB 1P7BA 1PZCA 3CFDB 3DBSA 3IU4L 2QPEB 2MQ3A 3D50A 3NJJA 2DBJA 4M7KH 2FYVA 5F89A 4AEIH 3TASA 3L7EB 4K7PL 1KYUA 1WBXA 1WVZA 3DROA 3SKJL 1KBBA 4DGIH 2MHAB 1CXIA 3HLAB 4LP8A 1MFVA 1U21A 4OLYH 3C8DA 3LKPA 4TV3A 2NXYB 1UFUA 5HDBE 2VXVL 4JCWA 3MRIA 3D25A 5B7FA 4NKIL 2CPCA 3L3GB 1DFXA 4A7QA 2VLRA 2EEAA 1JK8B 4XWGL 1HXYB 2YBGA 1T89A 2IH8A 3BSGA 3QZBA 4ZMLA 5IEHB 4L1SA 4D0DA 4ISVA 2GBTA 1NLDL 4IU3A 5GRUH 1CD1B 4L29B 2J56A 3HE7C 3INUH 3B37A 4O9HL 3KHQA 3O8XD 3L4TA 4FXGA 4N8VA 5DUJA 1TOXA 1O6TA 3DTXB 5I30H 4XVJH 1O6VA 4HKJB 4R6UA 3ARTA 3NIGF 2Z4QB 4MD5A 1G6RH 2P5EA 1KY7A 4M5ZL 3NZSA 2HH0H 3W0WA 4B5ZA 2G60H 3HBGA 5EU3B 7PAZA 2XFGB 3BH8B 1JBJA 4RBPH 5CP3H 1GY1A 1T2XA 2WNXA 2MPAH 2X9XA 3KD4A 1RKRA 5BVJB 4YBQD 2HJFB 3RBSA 3DK2A 5EZPA 4AEHH 5LN4A 5I16A 4HIXL 3NFPA 2ICWI 4CNIA 4LDOB 2I5YH 1ZLEA 5JQHC 4MA8H 5I1JL 3S48A 1QBBA 1S8DB 2YGVA 4WI4A 5A2AA 4NB7A 1C7TA 5E6ID 5GZOC 2VJ8A 4WAFA 4PRAB 2VMDA 4HOMA 3I9PA 1WGVA 3IXTB 2O6CA 3RVXD 3QUGA 4BUHA 2IOOA 2BOCA 4BFFA 2OR8A 4EI5B 2Z9TA 4YDKL 2OR7A 4DEPC 4BFEA 4OR1A 5GGRB 4KK6D 4JO8A 1CMOA 5HGGS 1Q72L 4TUUA 5ALBH 2TRHA 3KS0J 4MS8D 2HLFC 3EGDB 4KHXH 3FT2A 1KCUL 3UZQB 1AJ7H 2VR4A 5D1QA 3SDXE 1B88A 1EMTH 4Q8BA 2J8OA 2YA1A 3QZWB 4OKVA 5JMOC 2ZP8A 4JLRB 4FGMA 1G9MC 4M43L 2J6EL 3D18B 5C0BD 3IB4A 1QRND 4WU5B 5E8NB 1OAYH 3A5VA 4TULH 2X2HA 5IHHA 4GKSB 2A2QT 3F8UB 4UDUA 3V55A 3BFOA 2AZAA 5HGDA 4I3RL 4ZSOA 2GK2A 1U8PA 3FKUS 5DYOA 5SWSE 1I8MB 4LASH 3UG4A 1RY7B 3DKHA 1MFAH 3T0EA 3EH4B 4HUVA 1GPOL 4BQCA 4Z3IA 1EIBA 2FSDA 4ERSL 1DQLH 2YPKB 4BINA 4AXWA 1KCKA 4WFFE 2Y7MA 4OFKA 4QDGA 3O4OC 3QH3B 4MD4A 4YN3A 1HKLL 1J9QA 5KSBE 5ITFB 3X1FA 2HFFA 2VLJB 3TA3C 1FVCB 4G8GD 1XGQB 3QXVA 3L9RB 3FCTB 2AKRA 3WOVA 5C0EA 3CZJA 3H1ZA 5IBTH 2O93L 1RLWA 2XTJD 1BBDH 4HV8B 1KJMB 4QHMB 2H3NB 3OAUH 1ND0B 3HZYB 1E4WH 5AVXB 2V4LA 3NRQA 3LN4B 3L4ZA 1K2DA 1YYML 2ZKYA 3FRUB 1CLZH 3T3ME 4MXVF 5E99L 4APQD 4TN9A 3F6JA 3JVGA 4PSRA 2ZG2A 5C0IB 2FB4H 4B0MM 5AENA 3KPLB 3VE0A 4XCFL 2UWEF 3WNPA 1ZGLA 3ARZA 5ID0B 4YDLC 2E4TA 1NFDE 2ZUQB 1CG9B 3BUBA 3OKEB 3V0FA 3WFZA 1OALA 2ZUTA 2EE3A 2XQYA 1M05B 3N0PB 5FGCB 5HPMB 4Z7OF 1IC0A 5AW2B 5DC9B 1NCNA 1FNGB 2YAOA 2J73A 4WUUE 3TTSA 5I2IB 4Z0BL 3NFNA 3PY9A 1UH3A 3VSUA 2ZSVB 3B3IB 1A7OL 2APSA 1CVSC 1EEZB 3GMNB 1WT5C 1CE1L 4FZ8L 5FYJD 1KV3A 3EKCA 4WEUD 3EJYC 4AH2A 4JFYA 3BDXA 3P0VH 4B7IA 2R0LH 4MS8C 4OSUH 1R3LB 1MY5A 3MLWL 4JZJA 3KBFA 3AITA 3HVDA 3RWJA 4A66A 2DQIL 1I82A 1NCCL 4AYID 3EYVB 5ICZB 5J6GB 4Z7UA 4C4BA 3D4CA 3EJSA 1CB4A 1ASQA 3A4FA 1ED3A 1IGJA 1G9NH 1N4XL 1SN2A 3G6JF 2AQ2A 3T08A 5CBEB 1RL1A 2ERJB 4DQAA 2PO6A 2AJZB 3MRRA 4R5TA 5IFAH 3UP6A 2IGTA 2ODHA 4C56E 5LDUA 3H3KA 3VTTA 1FNSL 4Y5VB 1IGYA 3FSAA 1JZ5A 4LLUA 3B8YA 3WV0A 5A6LA 1DEEB 2EE2A 4QT5A 1QPPA 3UBXA 3C5JA 1EHKB 2N01B 3APDA 4KDWA 3IGLA 4HPHA 1V7ML 1HINL 1U8QA 4NNPH 3FFDB 3U1QA 2PABA 3LHPL 5KVFE 2GFBB 4YHZL 5C71A 1IAIL 3OJDB 4NWTL 2CKBB 3BEVB 2GITA 3HCVA 3FTGA 4NAJA 5CGMA 2VWEE 5MERA 5D7KD 1FVDB 3TNNA 5C2UB 1S7WA 4NO2A 3SKNB 1R3KA 2LTQC 3FT3B 4L4VB 3VFVA 3SPIA 4ICWA 3QAQA 5IQ7H 1CGSL 3TN0A 1RIVH 2PW1A 2OLDA 2I9LB 3FO1A 1WPCA 3DUHA 4LCYB 5AW9B 3TBYB 4APQC 5TDOA 3RNKA 4E9QA 3BKML 2WQSA 2VQ1A 1Z2KA 3WL9B 2VGLM 4PCKA 5EU7C 2CO7A 3GSOB 4TPRL 5DK0A 5A7EA 1LK3H 3BXNA 4IYKA 4F9LA 1ZTMA 1S7XA 1P4IL 3IGAB 3LPFA 1ZV5A 3KM1A 4UWQB 1CU4H 5B1JC 5CJBA 5HYQB 3P2DA 1TLMA 4GRWF 2Q7YB 4CN4A 3V4VL 3OXRB 3V6ZA 4X6BB 4DCQA 4K3DL 1G43A 4HJIA 5BCAA 3CFKA 2WLHA 2Z64C 4MJ5B 1HFUA 2BM3A 3UPAA 4A7SA 1H8NA 5AOMA 4R4BA 5K93A 4P9MH 4I0KA 4YDVA 1MFBL 2XNAA 1E5AA 5B1BB 1UENA 3G6AB 3RILA 2WLJA 4NBYB 4P59L 1ZSHA 2VDLH 15C8L 3ZR6A 1IJNA 2F61A 2O6EA 3G5XA 1PVHA 2NOYA 3U6XS 4IMLA 1E28B 4TVPH 2NTSP 1YEWA 1FZMA 3MV9B 5C0CD 3LCYA 5AOJA 1T5XA 4AKQA 2WXKA 3C9NA 2XRAH 3QPXH 3ARFD 3QP3A 3OR6B 4AM0A 2ADFL 2DLFL 3BSZH 3S0PA 2WJ5A 1IRAY 4Y4HB 3KHOA 2L0DA 4JJHA 4BZ2L 5I73B 3EBAA 5DEZA 1XGUA 2MQGA 4NKQB 1KWKA 2AW2A 1SHMA 2EYRA 2GW5A 2X6UA 2XCMC 2JCWA 3APCA 3GTVA 4PJEF 3LKQA 3N1PC 3PP4H 5KVMC 2NSQA 2BHYA 1H3PL 3IFPB 2OI9B 5FKPA 2WM0A 2J8UA 3GD1C 2QVIA 2YFNA 3ZUCA 3CE1A 4OQTL 1KCSL 5DJ0A 1T4KA 1GXEA 3OKKB 4IHOA 4LCVA 3LPPA 4JFFB 4NO0A 5BOPA 4JFZL 3QR2A 2EDLA 3TT1H 3NCWA 1UA7A 4E5XA 4XNZC 2K8QA 5J7CC 1Q9WB 3PIQB 2XXFA 4UQ2A 5TH2B 3U2IA 4O9HH 3ZYIA 2YXMA 2CIIB 3VG9C 5E2VH 3B2UD 1KXTA 4WTZA 3VXQA 5HYSG 5DRZA 1RJLA 1RP9A 1BJMA 2XJLA 3W39A 2NY2C 4NYLB 3DGGB 5G5DA 1U93A 4AQEB 5TDPA 5EWIL 4HQQH 2PYFA 1UZ8A 1RZQA 1G1KA 3UDWA 2RMNA 1EHXA 1MI5A 2XC8A 3TLRA 2ENPA 2XG4B 2YSTA 4J3VA 2OXHA 5KSAD 2YD0A 1SJMA 2AJYL 4UB0L 1BQHB 1M6UA 1XB6A 3MRFA 3PAZA 5ENWB 5HD8C 1OAQL 3SZKC 3VFTB 3V4PA 4HIXH 2RAMA 4IOSA 3I02B 3RDTC 2OYLA 1FORH 2F7RA 4XCYB 5IJVA 2AQQA 3FC8A 3BP7A 4UM9D 2R1XB 3T0VA 1BG1A 1GGYA 1AQDA 1PZDA 3QIUA 3ZE0F 3W2DL 4UV4L 1C5BL 2IWEA 4QPEA 3L48A 1N6QL 4L1TA 1M7DB 2ITCA 1M42A 5MEQB 5AZEL 3F05A 4AYSA 4PJCE 1NPUA 2B4CH 5DVOA 4QRSA 2G2NA 1HESA 2IO5A 4YR6B 1ECZA 1KBVA 4HUUB 2YC1B 4U1NB 4JFEE 1JRHL 2JK5A 2DQFA 2TSBA 2VZUA 4XHJD 3PHQA 3WTUA 3PABA 3QXTA 5CP7A 1QHQA 4PJIF 2IDUA 2D4FA 3DPDA 1GR7A 4YE4H 4G42A 4HJJL 1N0XH 5JIIA 4Q74A 4G7SB 1KCUH 3PUUA 3BGMA 4WJG3 1U92B 1UM6L 4FQ1H 3CX5J 1TTGA 2LLNA 4PJ5A 4P2CG 1EBAA 1UGKA 1GZPA 4JO1H 2B1AH 2YK1H 2J6EH 1TYEB 5CUSL 1YEHL 4L8SC 1PZSA 5IR1B 1LMIA 4AUJA 2NZ1A 4S11A 4G7RB 2WY3B 4WFED 2R9HC 1ADQL 3RWHA 3FQTB 4DGYL 1DQML 1A7PL 3AU0A 5J89A 4GQ9L 3U6RB 2AEWA 1KIPB 4ES9A 5KJRL 1L0XA 3II2A 4HBCL 4EXKA 4S2SB 5ANME 1D7FA 1I85A 3WJJC 4W4OA 4Y1SA 2JI2A 1NGZB 3EJZC 4HU8A 4S1SH 4FFYH 4WW2C 1I1RA 4HIEA 3FTSA 1KNOA 1NDGB 3WFBH 2JKLA 2XPGA 1T1WB 2YUXA 1T20A 4K07A 2C3VB 4EVNA 3COOA 3R06B 1IKNC 1DVUA 1C12A 4JY5L 4QI3A 1BPLB 2IH1B 1C08B 3T1FB 3B2UC 4ZXBD 3LIZH 3BWUC 3ZX1A 1MREL 3US0A 3BKYH 3BQUA 2DQTH 3HZMA 4JPVH 3Q1SH 4ABUA 5F6HI 3HLKA 4Q9BA 1NFAA 2H0EA 3DX3A 3FULA 1BFTA 2ZYHA 1AE6H 4F7EA 1HXMB 2DLGA 5FOBB 4JANB 4D9LL 3OKNA 4ANKA 3F65A 3OMNB 4NC2B 4LLYA 4RGMC 3TFKD 1YMMB 3D2UB 1HQRA 3KPPA 5CEZH 1VFAA 3TU6A 3S5ZA 2DIBA 1YN6B 2DLHA 2BERA 3GK8L 4KRPD 5GGRY 1GGIH 4NZFA 1USQA 1DSYA 1NDTA 4PJ9A 5HI5D 2F74A 3NN8B 2VZVA 1GJUA 3KYKL 4PJXA 5LNDA 4Z8FH 1SEBB 4J2XA 4KAQL 1JWSB 4FTVE 3AMKA 2DYPB 4D7BA 1SBSL 4WV1C 4FZ8H 1GC1C 2KHAA 1E50A 1YZZA 1ZGLP 1NC2B 4XHJC 5E1AA 3MOBH 1HH6A 2GIYA 2DWYA 5IM7B 1R3JB 1ULVA 6PCYA 3VXSA 1IM3B 4NKDA 2UVEA 1QFUL 1A6UL 4ABQA 4HLEA 3GFUA 2JSFA 1ZLUK 3QHTC 2DQIH 3A0OA 3IJHA 4IIZA 5D7LE 2VMFA 5E9DE 3TPKA 3ZT5A 1MCKA 1XHHA 3LIUA 4LHUG 1UB6A 2EDXA 3CFIC 2DIEA 2AJUL 3CN1A 4PRBB 3VWKA 4BH8A 1KIQA 1QUNB 2D2CC 4XXWA 2VDOL 3C60C 3OPZL 4QAMB 5BVPL 4OI7A 5DD0H 5JXAH 3DRTB 2O72A 1CI5A 5IMKA 3X1NA 3F7VB 4PG2A 4JFDD 4OCYL 1LO5B 2Z8RA 2PPEA 2KQMA 3VWJD 4UUJA 5D7IB 1PW3A 1F00I 1NEZG 2K7PA 3PHOA 3HRZC 4PWEA 2O5YL 4KVNL 3QFJB 5IG7B 5JOPE 2FJHB 2JCCB 3QJTB 4HPOH 3AS2A 3GXDA 4ZUTA 3VD4A 3O45B 2BMKA 4MYPA 1L7IL 1L7TL 2JTDA 5I1CH 2H32B 1IAIH 3TIDB 4QNPF 2CMRL 2DICA 3GWJA 3QDMA 4K3JL 5LAXA 2R1YA 1W0VB 4ZXBC 3O6FB 1DQQA 5I71B 3PWLB 1I9EA 3ATFA 2VDNL 4LARL 2B0SH 2KQNA 1U2CA 5AEAA 35C8L 4FFZA 3L3JB 3WIFB 1T5WA 2ARWA 2A73B 3CCHA 4MJ6A 1DUYB 1R19A 4PV9B 4X6CE 4D8PA 4GAGH 4QRPB 1FQ9C 3L1EA 4EIGB 1H9DA 3NCBB 1OT2A 3M46A 3BKMH 3E3QE 5D7SL 3SDAD 3EZ8A 3QNZB 2R69H 5DJ2B 5D1ZA 4RGOL 3QNYA 1JTOA 3ZL1A 2B5IB 3BP5B 2VXSH 1NSNL 1F3DH 3QIWD 5LO7A 4J8RA 1FIGL 4ZX4A 3DVFA 5DZJA 1JV5A 4BFIB 1CIUA 3MLXH 1C1EH 2YQGA 3UJIH 2WC7A 3MBEC 3QORB 3P11L 3WN5B 1KYDA 4CVWA 1LEGB 3GQFA 4H13C 4OLWH 3VM5A 5FO9B 4XPGH 5IB2B 1FC2D 2L3BA 4JJOA 4G7YH 4ZFGH 4QR7A 4P9HL 1X7SA 3FTXA 1FP5A 2V2WB 2X0UA 5JORB 2C4FU 3NJFA 2GHWB 5JPNA 2CE6A 3RFZA 3S37L 2I24N 4Y9FA 4OLZH 3KPQA 5KYWA 2ZG1A 4P99A 5DMGC 4ZMWA 3SJVA 1KB5H 4W6XB 2RB8A 3ILPB 3F7KA 43CAA 1FI8C 3TZVB 1B2WH 2BCKA 2C3WA 4ICXA 4YLBA 1IE5A 3AU1A 2H6PA 3GSWB 3OKDA 5CXPA 1E3FA 5AVYB 2FRGP 2AV7B 3NFSL 4PJGF 5DXWA 3D07A 5F3HA 3RJOA 3SQBA 4XCEB 3MNVA 4OU3A 5JLZB 3B9KD 2WZ6A 4HK0A 1H3PH 2CNZA 3H54A 4M4RA 3DRQB 1Y1UA 3F58L 4ODXA 2BSCA 5DLML 2CO3A 3VWJC 4AWJC 1KCSH 4L3FA 1ZT4A 2R2HA 4BZ1A 1Z5YD 5D6CB 4NAQA 1VDGA 1NCBH 5DJ6A 4JDZA 1YNTA 1QHOA 3STLA 4JE4B 5E8EB 1QSFA 1CN4A 4JFHE 4W9CC 4RZKA 5T3ZD 1U42A 3KXFB 3BWAB 2XI9A 3DHMA 4JFUA 3L3KB 2DZEA 3S3BB 3U46A 1ETZB 3WDIA 1FHGA 2F8VA 3T2PA 5BRZD 5EBGA 3MUHL 5EO1A 1FIEA 1Z1WA 3BPOC 4I18C 3QNXB 2RTTA 4KJQD 4AUUA 5EWIH 3O4LD 4N24A 1HXKA 3QBTB 3LD8B 1IBYA 2QEJA 1EAOA 1N19A 2VR7A 4JZNA 4F57L 1EDYA 4OGAD 4RZCB 1JI2A 1AG0A 3GIZL 1XCTB 4DAGL 4S1RL 4LBEA 2DBLL 3MA7B 3JWDL 1ILUA 4RA0C 4TLKA 3M1BB 5E7BA 4DKAA 3MLTB 4AIXA 1A47A 2IQAB 4DP6X 3TFBA 2ZYRA 5FM8A 4WHTB 3KZ8A 4C4KO 2PYED 4G43A 5T5FL 2ZTBA 1GAFL 2VLJE 3AT0A 1DANU 4DKEL 1WWBX 3W2DH 4UV4H 3B1TA 3PQYD 3DGCR 3VA2C 3I75B 4ZUUA 1U8OA 1JYVA 3CQFA 4DVBA 3BRFA 3DX7A 5IUSA 1XCXA 2O61B 2CG9X 1OSPH 3BDBA 3RKPA 4QMEA 1HU8A 4P5MB 3D39D 4Y2DD 3ETSA 4Y16A 2CBPA 4JM2D 1ML0A 5LG6A 2ICEA 2YXWA 3IXAA 4I3GA 3IDYB 5C97A 5KVEL 5BUAA 3MFFA 3IJSB 4G1MA 2Y2WA 1DLFH 2BS8A 3RZCD 3U30C 2HFGH 5CIPH 1AOHA 3D52A 1GA2A 5I1KL 3HHSA 4O51A 2EH8H 3FRPG 5FGCE 2DAVA 4GIOA 4FQHA 3S4SG 4MDJB 5F7DA 2ZWKA 3TPUB 1NCTA 1D9KA 3TVMB 4OFVA 2VQ4A 3G5ZA 3N42B 4JFOA 2EDQA 4CJ0A 5HI4D 5I9QB 2B16A 4HD9A 4HCRL 5EEWA 1YC8A 5F97E 5GS2D 4F9PA 1HE8A 4E68A 1KGUA 2VISA 1IIKA 3KLKA 5D7HA 2AXFA 4N0YL 3B9KC 5FHAL 3WIAA 4W68A 4NDMB 5D9SA 1DQMH 1SBBA 4U6XA 4PBDA 5E08H 1NBCA 4HWZB 1PZ2A 5IGXH 1BXAA 1HDMA 1FNEA 2ZIDA 3BO8A 3O2WL 4JQXC 4Z76A 1CDHA 1XAUA 1PG7H 1NCIA 2HAZA 2ZCLH 3D0VB 2QTEA 4H1LA 3ARDC 4HIHB 4XNXH 5B38A 2F9BT 1JTTA 4UTBL 1PZ5A 1CICD 4MNHB 1BXUA 4JY5H 4MA3A 1INEL 1CK0L 1DQIA 4ODTL 4L8BB 1JNHA 3ZL2A 1NMBL 2JMRA 5IHBA 3SKMB 2FT7A 5EPMA 5I18L 1TVBB 4PI0A 1DUZB 3F2LA 4LPYA 4ELMB 3O9WA 4Q0XL 3VFMA 4PI2A 3HG5A 4ZMYA 1BZ9A 4WSJA 4OF8A 4PJDF 4PJ8B 2XWBA 4PRIE 2XWTB 2VH5L 3DXAB 3B2VL 4JPSA 3FYIB 1A25A 2JKIS 5K1NA 1X6NA 4D9LH 2AV1A 1YN7B 3QWRA 2FO4B 3IF1B 4K94L 2AMUA 3MA9L 1MQKH 4IRSB 4M7JH 1NZRA 4PJBE 5JZ7D 3ZMNA 1TMQA 5MEPB 5D7JA 4ES8A 1DQVA 2BNRD 4Z6AT 1A21A 3DJ9A 3SDDD 3G5WA 4XAKE 3H6AA 1YYCA 4V1DD 4LE8A 1HHIA 1U3HC 3F7YA 3MGOB 3OLEA 5JW5A 4LCIH 3SE3A 4YNYA 2WXRA 4L4VE 3WHXA 2FEEI 4K0OA 4OJDH 2EVJA 3MMEA 3OZLA 5FPIA 3DK0A 3CFEA 1ZEAL 5E2UH 3IDNB 4Y9GA 1DFBL 4X4XB 4DPAX 4YWGL 2DTML 1FAIL 4WSGA 5EEUA 1JIBA 2DWDA 1F4WH 1FO0H 1ZANL 3P9MA 3DBXA 3MJ9L 3O8XA 4P2OC 4F7CA 4JDVA 4MNQB 4DJMA 5HYJB 1CPUA 1BLIA 1THAA 1TVDA 3QUYA 3FPYA 3G9VA 5HYSB 3D08A 1UASA 4MJJA 4PVNA 4JG9A 3Q2CA 5DS2A 3GKWH 2MCPH 4WNJA 4X8JA 3VI4E 4L4TD 2EC9U 4ODVL 4WUKL 3V4VB 4P46D 4UOJA 4ZZFA 5BVPH 2YD7A 1NPJA 5J1TC 8PAZA 3TT3L 1P6AB 3OB0H 2EP6A 3RY4A 3UEZA 3HNVH 3DI3B 1PZ3A 3DMMC 3M86A 2CA4A 3C5ZB 3UTTD 3L3IA 5F9WC 4AQOA 2EXWD 1TPXB 2EEFA 3BRDA 2HKFL 4AYFA 3QDGA 2A74B 3B6SA 2ZAHA 4JN1L 4W9FC 2E6QA 1BGXL 4YSCA 2HFEB 3JUYA 3MRDA 3GIVB 5ACLA 5E6IA 3VQMA 1WK0A 2FNWA 3RWIB 3VJ6B 4R7DB 1KYOJ 3FW6A 3LVEA 3ZW3A 4ZNCD 1JZHA 1L7IH 2J44A 2OJZL 4RAUB 4RFOL 5I17A 2OMWA 1NEUA 3BAWA 5DS8B 2D7PA 2QQKH 3BP4A 2YAMA 3FB8A 5L2JB 1NMCB 3NJHA 4LLDA 1AGCA 2J88L 4XH2B 1FDLL 3PAVA 1UFGA 1V05A 4JN2A 2DWXA 3GJEA 1VGKA 4YO0A 2W07B 2RGSA 4Z7NB 3KWTA 1ONQB 2PLTA 2A7BA 1RVFH 1T7WA 1N6UA 3GGWB 3L9BA 4G2AA 4A39A 3TBWB 4N26A 5D7SH 3AFLA 3BLKA 2W5PA 1WAEA 4S10A 1R24A 4HT1L 2QPSA 5IQLA 2V5SA 3HVNA 3GB7B 3VXUB 3IETA 1V3LA 1PL3A 4M61B 4QYAA 1NSNH 4G7VH 3AY4C 4OFYA 1RUAH 3Q7JA 3RX8A 2G3MA 4RGNB 3C09B 1T1YB 2ALAA 1UCTA 3FQUB 4U31A 5TDNA 5F3FA 1K4DA 4X9IA 2X4UA 5IVOA 4E9SA 4B0MB 3PDOB 3LZQA 1HJBC 4LCCA 1PF3A 1D5MA 2R4SL 2XETA 4Z9KB 5SWZB 4S0TD 1E6JL 3BOVA 2OMZB 3H85A 2ZWYA 4N8CH 3WO4B 3LKOB 4X6DA 1A0QH 2QSCH 1HIML 5EU4B 1IM9A 1IGFH 3GBML 3U0PA 3VGDA 3FN0L 1TQVA 3UTOA 1RUQH 2WANA 3P77B 3K6OA 4XVSH 3QB7C 3UAJD 4Z78B 3S37H 2V5YA 3AB0B 3NIGB 4R2GB 1K5WA 1L0PA 1M2VB 2OBGA 3NK4A 2VUKA 3I84A 3WEOA 1WBZB 1FN4B 2WNGA 3DOHA 1BOYA 3GBEA 3ZT6A 3VXOB 1XGRB 3BT2H 3NFSH 3KMDA 2JJSC 1NBZB 2NXYC 2ZYSA 3GYRA 1RMFH 1GGCH 2HYMA 4PJFF 5T1MA 4CJ1A 1JZ6A 1BQ5A 2VXQA 3MCYA 2OMYB 3ZPDA 4FNPA 2YMOA 2VXTL 4U1IB 4RISL 4H26B 3ZL4L 3E3QC 4KTEL 3QWOA 4QOKA 4NZ8A 1J8SA 2CKNA 3GTNA 3J27A 3RL1B 3LZRA 1SGKA 3CSBA 4FFWC 4BUQA 1NCUA 2BRRH 2DN7A 2WXFA 5KJ7E 3RHWF 4K7PY 2DQUH 4FYRA 4NQEB 1MHEA 4KZDL 1WV7T 1ES0B 1XF3A 4FQIH 5CGBA 2Y9RT 4QTIH 5TTRA 3HFMH 3RB7A 1XZ0B 3BIKA 4G8EB 3VXTB 4G1EB 1RZGA 4MS6A 1MWAA 1XMEB 2CQVA 3ENEA 1UQSA 2AJXH 1ZHKA 2EZ0C 5TQ2L 2Q7NA 2RJMA 4GRLB 1NM9A 2AQ3A 2VSMB 3QPQD 3FT4A 1UB5A 4F57H 2YD3A 3WTWA 2KC0A 2VDPL 2WKOF 2YD2A 4GFTB 4DAGH 4S1RH 5D8JL 1SEQL 1AXTL 4JHBA 4NRZB 1J05B 2R2BA 4F33B 3PG2A 4UZGA 2Z7YA 3SBQA 2AAAA 4L5FE 3NSYA 4FQXD 4NJ9H 2CLRB 1XF5B 2OTWA 1GAFH 3D4YA 2R29L 3EFFB 4Z1PA 4DKEH 4JZOA 4GSXA 4Y19A 4FQQA 4U3XA 3RUGF 4EI5C 2BIIA 2E47A 2FWOA 3D87B 5CLWA 4DP4X 3HC4H 3B5TA 2DWEA 2WINA 3SGJA 4DQOH 5JR1H 3QXWA 1DQJB 3H0TA 4F27A 3E2HB 1F5WA 5KBMA 1I4FB 2XQBH 2LAAA 1K6QH 5T5NF 5KVEH 4URTB 3ARBB 3V5KA 2VIRA 1YMME 5F71A 4I89A 2XQYG 1FNFA 3DI2B 3UYPA 4NZDA 4RX4A 1QFOA 3CXDL 3FUIA 2V33A 2NX5B 1IC4L 3BVNA 3JT2A 2EDBA 4P5TD 1HHKA 3O3AA 1S7TB 2NY7H 2YAQA 1GKEA 2A6IB 2HKHL 2O6PA 2IFGA 3WKML 4FG4A 2YRBA 4GMSH 1NGYA 2K9UA 2YD8A 3DDFA 5FO7B 3IM1A 3CPLB 4YDMA 1F3JA 2WP3T 2P7TB 1F4XL 1WIOA 4PSPA 4A2LA 3L5JA 4E41D 3MLYL 5F0LB 5IROD 3QULB 3QI9B 4HS6B 1HZHH 5IW3A 2YEZA 1I3GH 3W82A 4Z7OB 2I60L 1RJZB 1JGVH 2DWSA 1I75A 2X4OB 1LM8V 5K39A 3O2WH 1BHGA 1NIBA 4F2MB 4JW3A 1WGOA 2HRGA 2YRPA 2F1AA 2X2UA 2H47C 3B7SA 5J06A 4WO4B 1ZA6A 3P3RA 2GI0A 3PF2A 2AK4A 1ASPA 4UTBH 1CFSB 4X6EA 1AO7D 2WYZA 1INEH 4KKQA 1BVZA 1IAKB 4ODTH 2VDOB 1NFKA 3IDXL 3DYMA 1A1NB 3MXVH 3ZKND 4Y7MA 2HLAB 5DJDB 4M02A 4R90H 2V8MA 2RH0A 1PYWA 1VA9A 3ARED 3EGSB 5FK9B 1OP5K 4G59C 2AJSL 3RGHA 5DK3A 3DSNB 2W65A 4R7NB 5CO1A 4ZPVB 2ZUQC 3CU7A 3ULUL 3I50L 2BIMA 2FBJL 4FD0A 4RRPA 2JCCE 1JK9A 2Y7NA 2AXGB 3ARFA 4K94H 1HYSD 2LE9A 3UCQA 1HHJB 1HEHC 4Z7VF 1CGYA 2OX5B 5FO8A 3GUTB 2Z31B 4KTDH 5ICUA 2V7HB 4TL5A 1A14L 3QXDA 5PCYA 5AD0A 1JPFB 2LW3A 2X9WA 4GIAA 2ORBL 2VDNB 1JGDB 3CH1B 3WTTA 3FB5B 1YCSA 3SKOB 1F97A 2CNYA 4QRPE 4MAYD 3KR3L 4OGYH 5ESAA 5GS0H 1E7UA 3MV9D 3VD0A 4YWGH 1FFPA 3LN5A 4Z3FA 1FAIH 4OCWH 4JMXA 1GIGL 4WI0A 3WS3B 1ZANH 1E4HA 3L1OH 2D3VA 4KJPD 4GO8A 3IVKA 2F58H 2HB0A 3K8LA 2ZPKH 3OKYA 3P73A 5AW7B 2DQJL 4YSSA 1KGYE 4OI8A 2R56H 4ZTOL 1PX4A 3IFLL 2C26A 4I48B 4FNLH 1MHCA 2P45B 4Z5RB 2ERJC 4EIUA 1F2XK 2PW2A 3V4PL 3CG8A 3MN8A 1MLBA 3KCPB 4K2UL 1FYTB 4XNMA 5C07E 5D6DA 3C12A 4WHDA 4OV5A 4Y5VC 4LLQA 4YL9A 4O00A 2WXNA 4PREB 3HUJA 3V0VA 4JFFD 3IAGC 1JCKA 1YEJH 1AZCA 1G9EA 2MFNA 3NAAL 2IWFA 3U2SB 1BJ1J 3ROOA 3PGCA 1OW0C 4GRWB 3TBTB 4Z7WF 1QFPA 1M71B 2DQDL 2DLEA 2F54D 1SDDB 4PRNA 1PSKH 3LSOB 2OJZH 3FB6B 1A2YA 1G7MB 1HL8A 4NKMB 4F1SA 4BHUA 5MEOB 2KLTA 1JCVA 4ONFH 4Q56A 3IU3B 1NBVH 4DPRA 1BPVA 2J88H 2OJ1A 5E8DH 5TGBB 4IRZA 1F11A 3K71B 1NDMA 4QRRB 2VLMD 5CKAA 4WKXA 4GUOA 2ZICA 5I1AA 1V54B 5EORL 5HDOA 5HGHB 5C0RL 1MNUH 3BISA 3T0XA 4GMTH 3RQ3A 3I9AA 1BZ8A 5GSRA 3V8OA 3VFGL 2EDYA 3FRPB 1WCQA 3VGFA 3BAEL 3IRZA 1L9OA 2MCMA 3KXFE 5E4EB 3VFOB 4P23A 2ZOLA 3AQDA 4ZOEA 1J1XH 3AGWA 1AQ8A 1TT6A 3NJGA 5IT2H 1KPUA 2EIMB 2VM3A 3ZDZF 4I0PA 3B7UX 4XO9A 1HEZA 3QQ3A 1PCSA 5H94A 3LB6D 1HQ4A 4Q6IA 1J7VR 3I3DA 1UWXH 4U0RB 3RVVD 3ZR5A 4PMEA 5LXVA 3NP3A 1E6JH 4M29A 3MRJB 1RZ8A 5AW5B 4G6KH 3VRLE 2R0WH 3F85A 5DRWA 2DJ4A 2EDHA 2NLJB 4HKXA 4DK3A 4HWEH 5ADPH 1VEOA 3QZPA 4CN1A 1X5AA 1HIMH 4GXVL 3T1WA 4G5ZL 1CFQB 3VXMD 3BESR 3WN6A 4KUCF 3H9YA 5F9DC 2IALB 2WIIB 3CX5K 3U2JA 5GHWL 4FQ2H 3MJ7A 5I0YA 3BZDA 3ARUA 3ECWA 1TVHA 4KKNA 5TE6L 4Y4HC 4D0CA 5I73C 5LWYH 4B9KC 3Q5YA 2R1WB 4WHCA 2H41A 4NQCA 1PKQB 2ZCKH 3ARXA 4M00A 3ZSTA 2IH3B 3EH2A 3CHPA 4JQIA 4AEEA 5IB3A 3IWUA 3GMLA 3EYSH 2OI9C 1IU1A 3B7YA 2MWCA 1QNZH 1BYPA 2WYHA 2FX8L 2ZXWB 5DI8A 4ELKA 4H8WL 2VXTH 4CILA 3MODL 4WSKA 4KMTL 1JS4A 1PDKA 3FYEB 4BIKA 1BFOA 1D5IL 1K4CA 3ZE0B 3U48A 3PFUA 1J5DA 5HGAA 4G8AC 1MCOL 4J1UA 1XF2A 4MAUH 1YQ2A 4X83A 2IG2H 3EG9A 2Z65C 4KNUA 1A1MA 1YJDC 3CHOA 4N68A 1CXKA 4GBXB 4X5LA 3SE9L 4JS7A 1UWGL 3GJFK 1I1FB 4WVRA 1D6EB 1OGSA 3HG1A 5EV7A 4FI7A 4XVUC 3FSZA 1CDIA 3D69A 1JV2A 2X89A 4K8RL 1FH5L 2AJVL 2MH4A 1WTLA 2ITEA 2VDQH 3CTTA 1UACH 4ZODA 1H5BA 4DN3H 1EGJA 1HHHA 2FDBP 1OPOA 3BZ5A 3EJCA 1AHWA 2P43B 5EIQA 3Q8BA 1QLRA 2VR3A 5JW3H 2NQ3A 1N59A 4OGQC 4UQEA 4BK4A 3BVVA 2UZYA 4IMKA 1TTAA 4A6YA 1CTNA 1DYZA 3QJVB 5A16A 5AW3B 2D7TH 1C5CH 1X5ZA 2AVGA 2QADD 3BSHA 4HJ1A 4QRFA 2EVGA 5G4NA 5GPRA 3P2TA 3GXUB 4JNXA 1FCGA 2IEPA 5IVXF 1ZHBB 3ZT7A 5FB8B 5DQ9A 4UDTB 2NY5L 4Y5XA 4BCXA 3X14A 4XODA 3LKRB 4Q9RL 2JFCA 2OM5A 2EIBA 2B20A 4ALAL 2LQRA 5IMLA 3WTXA 1VCBC 2GAZB 2ZG3A 3ZO9A 5J6HB 2W59A 2DYPD 5D2LA 2X2IA 3AS0A 4JFDA 2GKIA 4JPKL 1SF3A 5D71H 1UXMA 1LQBC 4ZO7A 1FGVL 4M6ML 2Y3AA 1JZIA 1S9XB 4ZMOA 2GABA 1JMXA 3RFRA 1OAUH 1QQDB 2B2XL 1LO4L 5DWUH 4P2RB 1PNCA 1UG9A 4XX1G 2F08A 4P4KA 4KKCC 4WNQA 5LHDA 2V9RA 3T3PF 2HT4D 1TJGL 4HUWA 1JL8A 1EFXD 1K3IA 4FFZL 1WBXB 3DROB 4MQSB 4NCDA 4QHPA 1KY6A 3LKPB 5DSCA 1IC4H 3CDGA 1IZJA 4AMKH 3L2LA 3J07A 2C4FT 3ARYA 3JWOH 2XN9D 4GB9A 2IPKA 2W0FA 1NQBA 1LILA 4B5EA 2VLRB 2CCWA 4AY0A 3WKMH 3T2NH 5BW7C 4D0DB 2BX5A 4ISVB 1JOIA 4IU3B 4P5SA 2AI0L 5KYUA 1XIWB 3QFJD 4N8VB 3SDAA 3K4DA 3BRGC 1J8HB 3BPNB 1OGPA 4TVPD 5AB2A 5CCGE 2I60H 1IGIL 4KBPA 1WA1X 2D9CA 3QIWA 5HYJE 3OQ3B 4YPJA 1BD2A 3W0WB 4OFQA 5A2FA 4HW6A 2AGJH 1KENL 2BJMH 3IDGB 5DMKB 5FA3A 4KJYB 1IFGA 4XBGA 3S34L 2VZTA 4QXGL 5EOCL 3CXFA 1J8RA 1JFHA 1RFDL 2PWHA 5HPOA 4G71B 4K23L 3WGUB 1A3ZA 4NM8L 3X1EA 3MXWL 3IKCA 3SD2A 4M56A 2HZHA 3WTVA 4TNWK 2H0PA 1RUMH 1EO8H 2FATL 4L0ZA 1SYVA 4J8QA 4K71B 1BQSA 3QYCA 5DZNA 1X7TA 4IU2A 4WI7A 3SB3A 4OM0L 3I50H 4ZFFB 3QRBA 1K5NA 3RYMA 1OM3L 4YH6A 4ZW7A 5AKRA 4AIEA 2BOCB 4QEGA 1YPZE 4AJYV 3B83A 3UJTL 4PV1C 4K7PX 3QORD 3ULVH 2WCGA 5I1GL 4G6ML 5CN2A 1A14H 4U1SB 1S7QA 4BZ1L 4J4PA 4LEEA 3HNSH 4WZ9A 2BP0A 1JZ4A 2W9EL 1C5DA 5AZUA 1DZBA 4JR9L 4NNXB 5I8CA 1D6VL 1P5VA 5DZPA 1I7UA 4Z7NE 4X0NA 5D1QB 5E0FA 2GBVA 1OGAA 1B9KA 2G5RA 1DANT 5H2BA 4OKVB 2ICWB 2P8MB 2W88A 4CVZA 4ZOBA 5J4MA 3RNQA 5KS9F 2SEBB 4X9YA 2YOCA 3X3GL 4M48L 4NN5B 5T1KD 3VFRA 3TZVD 2HT4C 1AQHA 1XCQA 1VPOH 2DQCH 1OL0A 1VEMA 4UV7L 4N2HA 3QJSB 4XO3A 3A6BH 2JLLA 1TZ8A 4UDUB 4NFCA 4P05A 5IB2A 2DQJH 1YLBB 2APBA 4N0UA 3KPRA 4JDTL 4P3DB 4B9ZA 4RGNE 5IREA 2ED6A 4ZSOB 5B4MD 3U7AA 1QBLH 1U8PB 2BSDA 5KYYA 4FP8L 3ZXAC 4HUVB 4CADA 2O5XH 3HB3D 3ECQA 5SWZE 5CLTA 3T6ZA 4AXWB 5FLVA 5CHNB 4NZRH 3S7GA 3A6OA 3UG5A 3VXRA 1PZAA 4MD4B 5GGVH 5FV1L 2HFFB 3NAAH 5CCKL 4RA3A 1U8HA 4RIRA 5EMYA 2WZAA 3QZMA 2EUWA 4P04A 3ZY7A 1WZLA 1D5ZB 1ZJAA 4TUKL 2HVKB 5EOQH 5C0EB 4PWHA 3NIGE 2VRAA 2PYEA 4PTUB 4LDEB 4D9QD 1NCDL 4JM0A 5D5MA 5I24A 1L9MA 3O11B 2MTAA 4W9KC 4ZUSA 4ZW3A 2HUEA 1K2DB 2WAQA 3STBA 1LEKB 3AVEA 5E2WH 4AIOA 2Y6TE 3O6FC 5I71C 4A2GA 4WEBL 1RI8A 1BZ7A 1ANUA 2D31B 3RX9A 3VE0B 3CNKA 4OIFA 1N8OE 1WLHA 2CUMA 1IGMH 1UA6H 3D39A 4UT7L 5GISH 5M94B 4YEFA 1ZGLB 4JM2A 3CUPA 4PGJA 4DZ8A 4JO4L 3WGVB 1WIUA 3ZTNH 3CX2A 4J3UA 4LVEA 2E9WA 3WFDL 1EA9C 3IT8D 3P0GB 3LKNB 3MO1A 2B5IC 2BFVL 4AEFA 3RZCA 2BH0A 4JG1L 2XPYA 4HS3A 2PCXA 3NFNB 3BAEH 1SXAA 4NQEE 3GO1H 5ESQA 5FWRA 4BJLA 2IF7A 5JIPA 3U1SH 5MHSD 3HI1B 2VZOA 3QORC 1I7TA 3WN5C 2QMJA 4Q4EA 2IH9A 3BJ91 5HDBF 4KHTL 3NT0A 1S9YB 2FX9H 2ICCA 4JFYB 3WBDA 4ZNEE 1EXUA 2XZCL 3BDYH 4V11A 1KTKE 3RWJB 1TXKA 4L4JA 1QLEB 1RU9H 1DBAH 1OAKH 5BXFA 4IEFA 4LVNB 2QLVB 5IF0A 3NTCL 4YHKL 4Z7UB 3ZVVA 2VDPB 3L3HA 3ILQD 4PJAA 5CEZD 2QJDA 5C3TA 2RBLA 1ED3B 2GJZA 3OF6A 1HYRC 3DUSA 5GHWH 3TZVC 2V9UA 1O5DT 3QRGL 2V0AA 4PLKC 5TE6H 3MRRB 3WJMB 3TVMD 2A9ML 3MVSA 4XX5A 3R7RA 1ET8A 5C0AA 2LU5A 3FQWA 4FHBD 1DVFD 4LLUB 1EV2E 2O6DA