3L9BA

Crystal structure of rat otoferlin c2a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
b'SHMALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRYQAADGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Otoferlin
publication title The crystal structure of the C2A domain of otoferlin reveals an unconventional top loop region.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l9bA00
3DBSA 3PRZA 2CHDA 4IQHA 1UOWA 2EP6A 4LDCA 2WXQA 3TJPA 1E8ZA 4F91B 3RPBA 3QARA 3ZIMA 4WAFA 4QJ3B 2K3HA 3IM1A 4FLHA 1DJHA 4WWNA 4AJWA 3QK0A 5CCGE 2WXRA 3FDWA 3F04A 4GB9A 1QATA 3PS6A 1RLWA 2Q0ZX 1CJYA 4L1BA 2FJUB 2A4ZA 5H4ZA 2A5UA 1TJXA 4XE0A 1DJWA 1RSYA 4FADA 3APFA 3ZVVA 2FK9A 2X38A 2BWQA 2QZQA 1BCIA 4FULA 4EZLA 2K45A 2WXIA 4V11A 4WEEA 3KWUA 1A25A 3QJZA 4L2YA 3N5AA 4KZCA 5G55A 1UOVA 4BGDA 3GPEA 2CM6A 2KI6A 1DQVA 2WXLA 4DK5A 4L23A 3OAWA 4FHJA 3F05A 4HLEA 5CCHE 1BYNA 2CJSA 3M7FB 1DSYA 1E7VA 2CHXA 1HE8A 4MJJA 3CSTA 4WWPA 1BDYA 4XX5A 4XZ4A 5T8IA 4LCVA 5KJ7E 4NPKA 4QAMB 4ANUA 1DJZA 2B3RA 3F00A 4TV3A 4ANXA 3B7YA 2WXFA 2QZ5A 3NZSA 3R7QA 1E7UA 3HIZA 3NSJA 5H4YA 2CJTA 2Y3AA 4HVBA 4ICWA 4QJ5B 4L1LA 4NPJA 3TWYA 4URKA 3HN8A 1RH8A 4G11A 2UZPA 3ENEA 2WXPA 5CCJA 3SD5A 3W57A 5EDSA 3APDA 3MJWA 1QASA 2ENQA 3NZUA 2DMGA 2LHAA 3L54A 3L9BA 4F93B 4TUUA 2NQ3A 2D8KA 4WWOA 3L4CA 1DJIA 3F01A 4ICXA 2NCEA 1DJXA 4JPSA 3QR1A 3S2AA 2ZKMX 4FA6A 3PYCA 3L16A 2R83A 4IHBA 4NS0A 5G2NA 1E8YA 1TJMA 2CHWA 2ENPA 3L08A 3LJ3A 2WXHA 4Y1TA 4EZKA 4F92B 4Y1SA 2ISDA 4BFRA 2K8MA 3ML8A 3OHMB 2JQZA 2RD0A 4ANWA 5JHAA 2K4AA 2DMHA 2YOAA 3PREA 4FJZA 3R7RA 4NP9A 2V4LA 3TL5A 1GMIA 2WXKA 2WXMA 3CSFA 4FJYA 4KZ0A 3W56A 2N1TE 4ANVA 1K5WA 4LT7A 4F1SA 4FHKA 3KWTA 4OVVA 2CM5A 4PS7A 3IBEA 3L17A 3ML9A 1DJYA 1W15A 4AOFA 3L13A 2ENJA 1E8XA 3PFQA 3HHMA 1V27A 1YRKA 2Q3XA 1E90A 3APCA 1WFMA 2WXGA 4A55A 2YRBA 3FBKA 4GNKB 4EZJA 2WXNA 1WFJA 4QJ4B 3JZYA 3QR0A 4PS8A 3T8MA 3RDJA 4J6IA 4PS3A 2CHZA 1W16A 2WXOA 2NSQA 1UGKA 1E8WA 4OVUA 3P2BA 4KITB 2Z0UA 2WXJA 1DJGA 4TS6A 3QAQA 5JHBA 3DPDA 3ZW3A 4DNLA
chains in the Genus database with same CATH superfamily
5D7EA 3RZCD 2CCWA 2JIXD 4JQIA 2XTJB 2VR7A 2ZX8A 3MFGB 2QHRH 3AQXA 3B7TA 1X4ZA 1SM3L 5EUOA 3VFVB 2V9QA 4JG5A 2KZKA 3L45A 1U92A 1DBAH 1QD0A 1WT5C 3W11D 1TQBC 1QYGH 3REVB 2WVVB 5AVWB 3G5XB 1QFWI 5C09A 3LV3A 4RZCA 3CFBA 3EYFA 4P2QD 3TNNA 3V0WL 4KRMB 4HG4K 3EBGA 4JO3L 5ANMA 4Y19A 3S37X 12E8L 4UZGA 3HC4L 3RDTC 1R3KB 2X42A 1YMMA 5E1GA 1PIGA 4GAGH 2IPKA 4OCRH 3MLZL 5E4IA 1RQ5A 1EFQA 4KKRA 4PGEB 3WHXB 1FVEA 4AQ1C 4Q14A 2BHZA 5DTFA 1XDTT 4IRZH 5E2TL 4UBDD 3ZZSA 4OD2B 4YC2B 4EXKA 4HS3B 4M5TA 1BF2A 2V2XB 2X1WL 3UZVA 4E9TA 3WTUA 3F7YA 1ADQL 4M7KH 3I3DA 3NCJH 1SY6A 4KO9A 4NQCA 4FQIH 5DJXB 3BUPA 5GGQL 5F7NC 2WBXA 3PWLB 3PHQA 3RVWD 4HWEH 3HE7A 2GK0A 2Y5QA 1LILA 5AAMC 4O9HH 4I13B 4FJ6A 4FMKA 2CO6B 2ZUXA 4LVNB 1B9KA 2ORBL 1NQBA 2J6EA 2WQXA 1NCWH 1G5AA 1UZ8B 4KVNH 3V4PA 1F1DA 1EMTH 3MLTA 2AV7A 3SBPA 3TBVB 4AEHL 4D3CH 2BO0A 4L29A 3DI3B 3T0ED 1H3XA 4PJXB 2AJ3B 1IKFL 2YGVA 4TULL 1GSMA 4FF9A 4YHIA 1K2DA 3GMNB 3WFDL 1CFQB 2I5YL 1JNNL 4UT9H 2VDPH 5E56A 1C08A 2AQQA 2X70B 5LG1A 1MHCB 3S97C 4OZIE 4CMHB 2LABA 5CJQH 4FFZL 5LQBL 1T1WA 3Q1SL 1G7PB 4I1NB 5GGUA 4Z7AA 1Q0YL 3RWDA 3VX1A 4XPFH 5D2NE 2ICWJ 2C26A 2V2WA 3L2MA 1H9DA 3TT1H 1HHJB 5ENWB 3VXSB 3SO3B 2OMTA 2F19L 1A7NH 4LGSB 5DEGA 2DEXX 1IGFL 2A0LD 3LKQB 4HJUA 4UIKL 5EC2A 4LESA 5GS0D 2PUQT 1INDL 1JPGA 5C7ZA 1A9BB 1MQ8A 3TTSA 4CL7A 3S2CA 2W80C 5DK3A 1ZIBA 2DPKA 2EZ0D 3ECVA 4PV1C 1X9RA 2FT6A 3CZKA 5FKAA 3MRKB 1SJHA 2WCGA 1X3DA 3FB5A 4GP8B 1CJYA 2DYPD 1E5AA 4FXKA 4G9DB 4YDIL 3WLWD 1X7SA 5C08D 5T3XH 4HJEA 3E6FA 2QQNH 1WO2A 1CXFA 2XWRA 4LF3B 5F7EL 43CAB 4GAJH 4J3UA 4OZGA 4U6YB 3TVMB 3F3HA 1BVLB 3OX8A 4L1SA 2W60A 3IXAA 3GPEA 3W2DH 5ICZA 1FFOB 3FHAA 1RY7B 3FOLA 3L3JB 1WWWX 3OAUH 1E4XI 4NQEA 1NLBL 1Y1DA 3IS1X 4G5ZH 4QHMA 3V10A 3VFRB 3C8KB 4JO2H 5KJ7E 5HYQA 4M1GL 3M45A 3NCFB 3T3ME 4DGWC 4OB5L 3OJDA 5CD3B 1OPGL 4UV7L 1AG0A 3VI3A 4C4UA 2H0PA 1A2YB 3O45A 1BAFH 3NAAL 5SWZD 1T03L 2HPOA 4K7FB 4DN4L 4X8JA 5CINH 4FZEL 1CIUA 1XXFC 4FQ2H 4IJ3C 4OM1L 5E8EB 4EVNB 2FR4B 4F9PA 4N2MA 4KK9D 2K6ZA 2WJ5A 1WWAX 2F53B 3DHJA 4Y8DC 4BUQA 1IKOP 5E8PA 4GMSH 4FLQA 4JEGB 4F7TA 2AQPA 3HCVA 2JE8A 2P5WA 2J8UA 2ZOKB 1FNGA 1YJDC 2NXZC 4G8GB 5HDRA 3MLYL 2WYTA 5IW1A 2KZWA 1F3JB 4U49A 1P7HL 5KBKA 2XC8A 4LLWB 5DFTA 2XA3A 3R8BB 4XHQA 2QTEA 1X5KA 1WAAA 1U8PA 3L5XL 4K71B 1I1AD 1D9KA 1KCKA 1KIQA 5ABAA 1EIBA 2DRUA 3QEGL 4Y4KD 4GFTB 1BW8A 2WXKA 4FJYA 3SE8L 3O6ML 3H0TB 3MX0B 3AUVA 3BWUF 5I1AB 4L2LA 4G43A 4LBAA 2WBWB 1DE4A 4WEMB 2CM5A 4YE4L 2ZD0A 5EA0H 1OGSA 2VR3A 4AOFA 4E41E 4BQCA 1TMCB 3N50A 1UCTA 4C56D 1JJUA 2XXCB 1BMGA 1JGEA 3Q5OA 4K5OA 4QRPE 5EBLA 4WI9A 2HG0A 3MRNA 4XP4H 3Q43A 2HT3D 2J8HA 3RB7A 4MXQC 2DQDL 3RHWF 3PWPD 1NGYB 1AQKH 2GEEA 4JM2D 4LK4A 3VM7A 2G4EA 2X4UA 4BK5A 4LCWE 1SYVB 3AWFA 4AQAA 4L8SA 3PPEA 2R69H 4FFZA 4GXUN 1JUFA 4J3TA 3P9MB 2CGRH 2UZIH 4WW2C 4IMKC 1YJDH 2JI1A 4XBMA 1DVFB 2YQ2A 1NJ9B 1UOLA 2FUTA 5E6UB 5IHWA 2JCWA 5JR1L 5I6LA 4FTVD 3LKSB 4DETA 5KSBF 5DO2C 2X4PB 1G0XA 4TM9A 5LGJA 3OKDA 4PCSA 2PWHA 1JHTB 1D5XA 1MJJB 1PL3A 5BRZA 4JK0D 3BVNB 4F3FB 1EDHA 1NDTA 3O4LD 2VCOA 4QTHA 4Q9CA 3NN8B 4ONFL 3COOA 1UM4L 4DVBA 3MRPA 3ATDA 4OI8A 1FH5L 5HDLA 3MLRH 4M48H 2VN5A 1GGCL 4GW1B 5L6YL 3B37A 4H0IA 2EDJA 3PE9A 1CC3A 1XCQB 1L4IA 4WWPA 2WD0A 3IE9A 4U1HB 3JT2A 3WJMB 1GGIL 5BQ7A 2YGPA 4GS7B 1EZVY 4GAYA 2OXGA 2O6CA 3M1BB 4KO5A 5KAQF 4OCXL 4WI2A 1QSFB 3ZT7A 2WCSA 4WFGE 1X6LA 2Y36H 1PS3A 5BS0A 3TIEB 5TPWH 3GWJA 1S7QB 1DEDA 3S8FB 2XSKA 1QRKA 3L9RA 1ZVNA 3TT3H 3C5SB 1A3RL 1KTJA 2OP4L 1R47A 4KQ0A 3BQUD 4ALAL 1A64A 2BVQB 3HE6A 3P30H 4P23C 1TKWA 2WLMA 2YMXL 1P9MA 5GJSL 4PY7A 2O30A 5KYWB 4Z95L 3L9YA 5F9WC 5E9DE 1AI1H 4AGOA 2YPLA 3O3DB 4FYTA 5L2JA 5FGBA 3L3OB 1C12B 5CP7A 5C07E 3RU8H 3QI9B 4G1MA 3NIGB 3Q8CA 3JWDC 1JAEA 1IBBA 3TWCH 5GRVL 1OGPA 5DYOA 2CNZA 2H2PD 4XVOA 2DWSA 5HD8C 3RWGB 3LZRA 2OMBA 4PIRF 4PJ9B 4MFHA 3CDGA 5C2UB 1F90H 4WLCA 2BDNL 4XBGB 5AAPA 4Z6AT 2VZ1A 1OSZB 3PNRB 1FZJB 5IBUG 3VXUB 5DS8A 4B27A 2ENJA 3C08H 3CXHK 1P4LB 3PFQA 2XRAL 4KI5E 3CHOA 5A40E 3S4SB 4M6MH 3QIBA 4FL4B 5C09D 2Q3XA 1TQTA 5I1IL 3EYVA 4N1HB 3G6JA 4WJ5B 3D07A 3WXVH 1KCWA 1KC5L 2D3JA 4MB1A 4Y19D 4Z23A 3OB8A 3VNYA 1YMMD 5F1OB 4YJZL 4XPBL 4HJIA 1P2CB 1H0DB 1C7TA 4N90E 3B83A 1MRCL 2L8AA 4J4PA 4YAQB 1CYGA 5DI8B 1FORL 1P4BH 2J55A 2QPSA 4NQSB 3RVWC 5C97A 5EF2A 2F0CA 2Q9OA 1E28A 3JWDH 5HYFA 1JG9A 3LKNB 4PG2A 3OR6B 5F7DB 1IM3B 1PLGL 5KN5B 3VMNA 4DGVH 3UYPA 3ARTA 5IW6A 1MJ8H 3IDMB 3D0VB 4NKOA 1LGVA 4KJYB 3SKNA 2GFBB 2FJUB 2HWZL 4NQCD 5D1XE 3T0EC 1IC4H 1QO3B 4S1RH 3S35H 3KEHA 5TE4H 2YD6A 2LFEA 3HE7D 3MACH 3S96B 1N0LB 1N59B 1QNZH 4BUHA 1JGVH 1SN0A 4KKAC 3CFDA 1ADWA 3IPBA 3T0WA 3D06A 3E1ZA 4AGPA 1SJVA 3RIFF 3GMPA 3HN5A 3O2DH 4HT1L 3C9NB 2IEPA 3IFLH 4QXVA 2A9CA 3ETBF 1DVSA 3GXMA 3QPXH 1PLAA 3HNVH 4Z7IA 1UEMA 4B9PA 3AVEA 2QQLH 1HKLH 2YRPA 3MTXA 1LL1A 2A77H 3ZE2F 4A38A 2ARWA 2LLGA 5DJ0A 1CLZL 1G0YR 2WBJB 4O5LL 5CBEB 4AEEA 1OP5K 2ADYA 2BNRB 1UXWB 4FG4A 5CSZB 2R2CA 1FLRH 4AZ8A 5JNYA 3IJYA 1NKOA 2WGXA 4YXLL 1WFTA 1TF4A 1JZHA 2ZKYA 5IEHA 2A0LC 3OKMA 2OL3B 4M9OA 4PWEA 4MJ6A 1R5WB 1KYOJ 1DQLL 1JWSA 4N8VB 1L3WA 2DH2A 3OV6A 4B9ZA 2TSAA 2IMNA 4JKMA 2EYSB 2G9HA 1PSKL 2QGBA 2VDNL 1AD0A 4RISL 3F85A 5DVOA 3EJCA 1OEZW 2VNCA 5CN1A 4Z77B 3UPCA 1J05A 3RWHB 4ZOBA 3WLWC 2GITB 3WL9B 4ZUUB 3K81A 4AV0A 5HBBA 2FHFA 2QMKA 1KCRL 4U1NA 1VHPA 4LHUG 2O5ZL 1SGKA 4ELKA 5BOZG 4N86A 4XO3A 4HQQH 5BOPA 1Z5YD 1YO4A 4N8CL 3QZNA 2W94A 3L1OL 2DQUL 3GSXA 3MNVB 2JCCE 2RQEA 4N4YB 4EI5A 3VFTA 1L0XA 3SDAB 4OIAA 4XWGL 4EOWH 5DQDL 1I85C 1OF2A 2VIRA 4QY8A 3D48R 1NAMB 3NTCH 3SOBL 3ZE0F 4X4ZA 4PS3A 5CHNB 2WXOA 3DMMB 1UGKA 1ID5I 4X7FC 1DBMH 5TF1H 5JTWA 1F11A 1UQSA 3O2WL 2FLRT 4PHXA 1ES0A 3FQ2A 4KK9C 1CMOA 4M93B 2AXWA 3AB0B 3D7PA 3VFGH 3SGEH 5L2KA 4I9WD 4NQED 5GISL 1HU8A 4AE1A 1FDLL 5CAYB 3HG1B 3TF4A 2R0ZH 4YHOL 1N5YH 3GSRA 1FC1A 5KJ4A 3Q48A 1EZSA 2R2EB 1CZ8H 1N7MH 1TETL 3UTSE 1DL7L 5AB9A 4G6ML 3AY2A 3ZDYB 3ZZ1A 4ZZFA 4M00A 2G9KA 1ZLEA 4BK8A 4DK3A 1EA9C 4PYGA 5A6LA 4XCNB 2L0DA 2NY5L 5E0QA 3US9A 2O1AA 4Y4KC 2K7QA 5JIDA 2DWEA 5LNDA 1IGYB 2P5WD 1BXXA 1WYJA 2FWOB 1H15A 1W80A 3BPCB 4OLZL 4EBQL 2NOYA 3POCA 3HPJA 3DLQR 4C59B 5JOFB 3OHXC 4U05A 4Q9RH 3A6CH 5C0JA 1D9KD 3JVGA 4N24A 1FFPB 5I0WA 3B2VL 3E8UH 3EZJB 3FN0L 2HT3C 2VDQL 3HZYB 4GQ9H 3DX9A 1XXDC 2XKNA 4WNQB 5JQHC 3GZOA 1W6WA 3IMWA 3ECQA 5IFAH 4FFYA 4GBXA 1XFPA 1OCCB 4JFSA 1U2CA 4M7ZB 1IUZA 2LHAA 1YY8A 5CEYB 3VTTA 1I1FB 1B90A 4MBRA 1OTUC 2H3NA 4R3SB 4NBZB 1BSIA 5J1AA 1C9SA 3DOHA 4Y5YB 3MRFA 2GI7A 4NC1E 4UCFA 1OAUL 4U6XB 4UQIM 1E9PA 1G7IB 1LP9B 1VACA 2MRYA 1P0SE 2A4CA 4Z0BH 2FWUA 3KLDA 4ZT1A 2BVPB 3V4VB 4EKJA 4ILDA 4ELDA 1IV8A 2VOTA 3WCYA 3K91A 1ZAGA 4HUXB 4YUEL 2E8YA 1UB5B 4IOFD 4BCZA 4ODHH 3AY4A 5GRVK 2JI2A 4HC1L 4F9LA 5CJXC 2R0KH 4PJHA 1UENA 4XN9A 1FBIH 2VM9A 4LCYA 1J12A 4YFLF 2FHCA 1ODUA 2O6PA 1URLA 1VEMA 4I3RL 1U8HA 2WXNA 4TOYH 3ZYJA 5BRZD 1NSNL 3ZKMD 3VUAA 2NT1A 3VD2A 4P57B 2E6QA 5ESAA 1MREH 3ZQWA 1M6OA 4FYSA 2G75A 4L3EA 4GUOA 1G43A 3MJ8A 4D9LL 2ZOOA 4AK2A 5D7LB 1ID2A 1AD9A 1E8ZA 1G9MC 2R7EB 1CFVL 3L7FB 3BQUC 2DD8H 2ROXA 1H6UA 4O2FA 4M43L 2VDKH 1UZ6F 1DVZA 3CBRA 5KVEE 2IO5A 4KQ3L 3ALXA 4I3GA 4YZFE 5HHQB 3LXAA 4Q6IC 1LQSR 3BX7C 5HHOA 2GTZA 3NBNA 3H42H 5BS0D 3KPMA 4JG0H 4AYMC 2CA3A 3GZPA 4YSSA 2Z4QA 4JFOB 2H2PC 4NDMA 2J1ZA 4C47A 5B22A 1T3FB 1AIFA 2GSIA 3HE6D 4HV8B 4XP9H 1NCDL 2R23B 2ZIDA 1OSPL 4A2LA 2GCYA 3LB6D 5DEZA 4TLKA 5I66A 2YPLD 4OLXH 3QWOA 4NI6A 3AG1B 3HS0B 3STZA 4PBVC 1R6VA 3VTMA 5CXPA 4GW4A 5ITFA 2UVFA 5FW8A 4O02L 2BSBA 1FO0L 4IKKA 1L5GB 1U3HA 3WDIA 2UWEB 4Z7UE 3SDXE 2JJUA 1NFDB 2EVHA 3OKYA 4V1DA 4WU5B 2WN2A 2X4NB 2BIQA 3AREB 4JFXA 5EU3A 3RWEB 5EIIA 1G9MH 4GKOA 2CJUH 2WQSA 4URKA 1CG9A 3EOTH 1CFNA 3N85H 4FFWC 4A2DA 1NL0L 2HLAA 5B1JA 4QOKB 4E5XB 3RGVC 3F84A 3QZLA 2MEJB 1W72L 5IM7B 1G1CA 1KPUB 2P5PA 2VQ1A 3MCG1 5DSCA 4PB9L 1JV5B 3QIBD 4S0SD 4OUUB 1DQJA 2DKUA 4U1IA 4QRQB 3EH2A 2HJFB 1A6ZA 2F8VA 3BE1H 2VDRB 4LLYA 4HW6A 3ILQD 5C8JA 5DCCA 2AK4A 3F7KA 3Q9QA 2AABH 4QRPA 1LO3H 2UV3A 4JBSA 3UJTH 1QLEB 4LXFA 2DKMA 4BSWA 4J4PD 5T5NF 4PJ8A 1K5WA 3HE7C 1RZGB 4QRFA 5GIRA 3SGDI 4G7RB 4NWUH 1JPFA 1I7UA 3UJJL 1IX2A 2R51A 4E9XA 1XGYL 3NVQA 3TEWA 3U7WH 3CN1A 3EOBB 4YSRA 4RLDA 2IFGA 1J10A 3GM8A 1SQ2N 3MREA 4JREC 3UP6A 5HHMB 3HB3D 3TGXA 3ABLB 4HBQA 1XB6A 4U1GC 4Z76B 2D31A 1ZEAH 3ZDZF 3SKOA 1QVOB 3BEVA 4X6FA 2CRIA 5JO5B 4ZXBC 1HXYA 1T5WA 3DGDA 4DWHA 1KBGL 3WFZA 4Y16B 5BW7A 1RJCA 1FFNB 3WJJC 2R1XB 1KZYA 3V6OE 7FABH 3ZW3A 4WHDA 2Q10A 4HC1A 3AS0A 4GINA 3I75B 1A4BA 3QA3B 5H35B 4XODA 5J0BA 1F4XH 1ULVA 3AQYA 35C8L 3OAYH 3PU7A 4XBPB 3WDJA 1SY6H 2R0LH 1NLDL 2FEEL 4GI9A 4PRNB 1FNEB 2ATKA 5IQOA 1NC4B 3CC1A 4NNYB 2NXYB 1X5HA 3CVDA 5CWSA 3ABGA 1XR9B 5HSFA 1R0AL 1PD1A 4U2ZA 3SPCA 3P77B 1PFCA 1Z0NA 2ED7A 4MX7A 3MAWA 4BRJA 1CXKA 4RQQB 2VDLL 1TUPA 2J6EH 4QRAA 1AXSB 4HKZB 4NN6B 4X0KA 5G55A 2Z9TA 2HTLD 3EJTA 4F7CA 3V4PH 1XVSA 1C5CH 4IRSC 4PR5B 1X9UA 1T5XB 4L23A 3ZGHA 4GEJA 1MHPL 4RRPG 5E6IA 2YD9A 3MFFA 5EBWB 5AW9B 1JS4A 3D2UA 5FUZH 3F7VA 3INOA 5FYLD 1DJZA 3B7YA 2CHNA 2EC8A 4Y1AA 4FXKC 4JANB 4WFFD 4R9HA 2VISA 1XBDA 1OM3H 4PLJD 1MLBB 3FT3A 3K2MC 2PTVA 3D39A 3HVNA 1ACZA 4HHAB 5C0BE 4NPJA 2OTWB 2XFXA 1PNCA 4CJ1A 1IEBA 4J12A 1MW1A 1UZ6E 1WH0A 1VFAA 1Q9OA 1S7WA 4NNPL 1NIBA 5JW4R 2FATH 4DT2A 4PFEA 5AL0A 3NEEA 4J39A 1F8TL 3THMH 3BAKA 4YHZH 4EI5D 3VGFA 2LVCA 4ZX6A 4NXKA 4FXGC 3WIAA 1DP0A 1YEDB 2G3NA 5F8QC 5CNHA 1Z3GH 4NZRH 2R1WB 3EYOA 3KPOB 2EIZA 4QXUH 4D7BA 4GP4B 3QZWG 1KPRB 1PDKA 4P2CG 5K9JL 3RFRA 1GMEA 4PGBA 3N04A 3H9HA 3AW5A 5DJ2B 5J1TC 3P9LA 4F9PC 4X6BA 2K6YA 5GJTH 1D6VL 4U6HB 3WLBB 3QUZB 1W72A 1KACB 4N2LA 4WFED 3RAJL 5L2KD 1L9RA 2VQTA 3HC3H 2RQ8A 3LN5A 1A1MA 2MOGA 3MA7A 3RX5A 1QNIA 2D7OA 3DUSB 4LQ1A 4RGMC 2E9BA 3CHQA 1GCFA 1PX8A 4MJHA 1N19A 3KNBB 2VDML 1UVQB 4U1KA 4Z3TA 2CLRA 3BZDA 3KJ6L 5CEZD 3OB0H 1D9KC 2F74B 4OFYA 2WIIA 2X2YA 2J1XA 4IBLT 2K8QA 3NABH 4S1QL 3HRZA 4C4BA 3WU1A 4MD5A 5BJTB 4ZD3H 3K3QA 1XHHA 2PR4L 2E5EA 4TVUA 1OCOB 3BVVA 1KIUA 3QIUA 2O4EA 1T7VA 1TQBB 1KYOK 3FB7A 4RGNE 1W0WA 2D3LA 5EORH 3IVKA 2BS71 5CLTA 2NY7H 5AWNL 3KPSB 4JQXC 2H6PA 3UYOD 4IW4C 3X17A 3RDTB 4Z1PA 3IDNA 1YUKB 2OMYB 4KRNA 3UBXB 3FYEB 3OZ9H 1HQRB 4JRLA 3DO3A 3PABB 4ZMTA 3CHRA 1UT2A 4URTB 1NA8A 4R96B 2VDPB 4GBXD 4BK5C 1RUML 4UDTA 4LOEA 4L8SC 1P7QA 5E2VL 3U7YL 3C6LA 1HXKA 4AQ1B 3ECWA 2BY2A 2OKMA 1AJ7L 2GUOA 3D12B 4NO5A 1E5YA 1GZQB 1SHMA 1RUPH 4IOFC 4DGYH 2WK2A 2XQBH 5DQ9B 2BOBB 5I19H 4UI2A 3B3IB 2FX8L 3HVDA 1Y0LA 2ZAGA 2FJGA 4ODXA 1PZ5A 4QO1A 3QHZH 1MG3C 2F8IA 1CVRA 4PJ7E 2J4WH 4YSPA 3ZDXE 1WS8A 4CVUA 2W1NA 1A6WH 1AKPA 3ZKMC 3SY0A 3FHEA 2CUAA 3HS9A 2JMRA 5IBTH 1ZT4B 1MAML 2JVUA 1HS6A 2KT6A 2E4FA 4P2RA 3KYNA 4U1SA 4Y5VA 1I3UA 4QPEA 4X4MA 4XPHH 3LPWA 3OAZK 5G4MA 4FLSA 4PJGF 1HH9A 1DJIA 3RWIA 2A6DB 4YSQA 5KYNA 2XQ0A 1TVHB 3MUZ1 4F8LA 2AEOA 4GAAA 5KEZA 4G8IB 5MP6H 2WLLB 3UP1A 4CRPA 3CTTA 5G2NA 5IQMA 2IMMA 4FQPA 4QCIA 2JJWA 1F97A 3IF1A 5B7EA 4L3ED 1GS7A 5KVEL 3UBHA 5TFSH 2HJLA 2XXFA 3FXIC 2A9NH 1MQKH 4LCUB 4FABH 5IFJA 2OJEB 1XSKA 5MERA 2AEPH 1LXMA 3AWEA 1P9MC 2GC4C 3FF7A 4AQ8C 3LB6C 3LHPL 1VFUA 3WFEH 2YPKA 5D7SL 3HZ3A 3IAQA 5FGBC 4AT6B 1ACYH 4JFFE 1YEFH 1F45A 3BN3B 5DZVA 1PPIA 2KQMA 5HHOD 3ZHKA 2EYRA 2BSEA 3GDCA 1KEML 1S5IL 3LQAC 2MMXA 1D5MA 1XX9C 2BNUA 1JIBA 4OF3A 1A6AA 1HQ4B 1LEGB 3K2IA 4LL9A 4LBEA 4PY8I 1FFQA 3BPOC 4LSVL 4XN4A 3WN5A 4YEEA 1HOCA 5F1NA 4XHJC 2YLKA 1X44A 4ZPVA 3BMWA 3GI8L 3GKWL 4N2GA 1PAMA 1PQZA 4XCFH 4OM0L 2IGFH 5I1GH 4G1EB 1YEKH 3QEHB 1IBDA 5C0DB 5MEPA 4X6CF 2FBJL 1U3HD 3QIBC 1HWWA 5AVZB 4O51B 4KRLB 3SYOA 4OJEH 1PMYA 2UXVA 4V1DD 4JFEE 1HVXA 3QG7H 4N87A 3CIAA 3BVDB 5BUGA 3ILQC 1V7MH 4UTAA 2AQ3A 4LFHG 1JNJA 3FU9A 1DUYA 2LU7A 5EN2A 4CW1A 3W37A 3HLKA 3SPVB 2J72A 4J4PC 2E9GA 4N9OB 1OTTC 5KSAA 4JFZH 1P7KA 1E6OH 4ORGA 3OMNB 3WMQA 1NDMB 2H0JA 4XXWA 3TEXA 2FNWA 4NQXA 5TE6L 3ZE1B 5F93C 1EXUA 3LQAH 1K8IB 4AK1A 4BFBD 4K8RL 1U8CB 1IAII 4R4FH 5FK9A 2XG5A 4G8EA 2JB5H 3S3PA 2OA9A 4DZ8B 2AK4D 2J71A 3D50A 5DD1H 1D3CA 3O6LH 4QRPD 1MDTA 1R5IA 4GUQA 3HB3C 3HAEA 1KCBA 5C0NC 3GSWA 3IETB 3NA4A 4BK4A 4PJ8D 3WIFB 4LPYA 3JWOC 4JDZB 1E4HA 4L3AA 4HGWB 2C9SA 3L95A 3VMOA 1COBA 1SVZA 5FA3A 1E27A 4MCZA 2XWDA 4ELMF 3KEDA 4XAKE 3UPRB 3V4LA 5TDPB 1YQ2A 4B5ZA 2NXZB 1QPKA 1MRDH 1W2KT 4L37B 3D69A 5B39B 5F70A 3EGXA 1EEYB 4Z7VA 5CUSL 5T33H 1GGYA 4WEBL 4FCHA 1GCYA 2YEZB 2P28B 5FHAL 3VI4F 4WV1A 4X6EB 2K70A 4K23L 4YZWA 3LJ3A 4JPKL 5E7FA 3MCLL 1AYRA 2CKBH 4ZUTA 4HXAL 4PJDA 5MEQB 2CLVA 3GSVB 1SXSA 2V5TA 2DAVA 4N2KA 4NQUA 1IGCH 2V4LA 3L3IA 4DW2L 2AEIT 4QYAA 5I8CA 3SDYL 4AIZB 1B2WH 1FZOA 1ZTXE 5T1LA 4KNQA 1RK0B 4JG1L 2HTLC 4YGAB 3TJEH 3RNKB 3O3BB 3IRPX 3D1MC 4M1DH 2R8SL 3EUUA 4HHWA 4JLRB 5FHBL 1OOAA 2IVFC 1ZWIB 3JWOH 1UWGL 3BWSA 4EUPA 1EXHA 2PPCA 4JO4H 4BH8B 5AZ2H 2X6CA 5E94B 1NCIA 2X1OA 4PLJC 3LS5L 3QO1B 2IFFL 4WFGD 1NMBH 2ICEC 1IGJA 1G7HA 4M3HA 5T3ZH 3GSNL 5E6ID 5HYSG 3P73A 2X3AA 1N3NB 2Y1VA 3C6EA 1GS6X 4EAEA 3QARA 2DJUA 3LNIA 3D2UD 3H6AA 4YXHL 5IESH 3L6FB 2GBVA 2QPEB 2F1AA 3VXRE 4FXTA 4Y1AD 3UTPE 5DHDA 2XLLA 4EI5C 3BUQA 1K3IA 5EU7C 1JPTL 1KN2L 3LRSA 1R3JB 4UT7L 3D39D 2XICA 3LPOA 3TBBA 3PQYA 4W6XB 3CMOH 3HC0B 1GZPB 2J20A 5CP3A 2J5LC 5E5MA 1SVCP 4BQ8A 2EH7H 4X4YA 2ITCB 1S7UA 2W59A 2XWBA 5DJCA 1A5FL 2B08A 4JZNB 1KB5L 4IU2B 2M1KA 1A9VA 3ZMRA 2VITB 3VJ6A 5G5DB 1M7IA 3BWAA 5FYLH 3ILPA 1CE1L 2IH8A 3GGWA 2YPVH 5EHFA 4D9QE 3RIFK 4N0CD 2ADIB 1GAFL 3FJTA 3V0VB 4X7CC 4YPJA 2VLKA 4QR7A 5HDBF 1WP6A 3MV7E 1G7LA 4UAOB 4PRIB 4ICWA 4L4TB 5F3BB 2EIDA 3L4ZA 1BYOA 1MFAH 3VFOB 4P23B 4PJCE 4BV1A 1YEJH 4KJPD 3QNYA 4OCWL 1LO5A 2JELH 2JIXB 1MXGA 5F9WB 4A68A 1KXQE 5D7IE 2J57A 4JL2A 3BLPX 1UKTA 2VXUH 4K4KA 5E08L 1R3HB 3RILA 2MKWA 5I1HL 4M3KB 2P4AB 4MS8D 3ZTJG 1DSWA 4P2QB 3VD1A 3JWNC 4NHUB 4C57C 3JVGC 4OFYD 4WI0A 2ADJB 4NXSA 4RA0C 2HVJA 3GO1H 4TSBL 4NFDA 3FU3A 1GZHA 2FX7L 3QIUD 2C3VA 1J1PL 5DD0H 3RJQB 3T9WA 4DP2X 1M2VA 4DK6A 1YUHA 1QRNA 3N1QC 4N0UA 3FCTB 3OMZA 3VVVA 5EZIH 3GMQA 5PAZA 1NCJA 2D7PA 3FQYA 4IYKA 1AY1H 1E90A 3MOAH 1JHKH 2AKRA 1F3RB 4GRLA 1Y18B 4PP2A 3FBKA 2E6PA 4M62L 5CEZH 3RZWA 1KIRA 1C5BL 2FB4H 2IWEA 4I1RA 2DQIL 1S8DA 5DVKA 4FKEA 1P7QD 3C6LD 2NR6A 4CVZA 4D0CB 3VD9A 2ARJB 5JHDA 2Y23A 5KZCB 5I1LA 2E27L 3GEFA 1P4IL 3QJHB 3AY4C 3H56A 2DQCH 4P9HL 3UZQB 1QBMH 2WJ7A 4HWZB 4E9RA 1HJCA 3JWNH 2V7NB 4P2OA 3I02B 4W6WB 1VAHA 1S5HA 1FG2A 3MBXH 4Z78B 2ZICA 1NC2A 3T0EB 5JHLH 1RV6X 3PPSA 5AG8A 4KV5E 4OW6A 4ONGL 3MRDB 4FFYH 3RWJA 1TPXC 4B0MM 1M53A 3LN9A 4EI0A 4OSUL 1HL8A 5DFVD 4MNQA 4P2RD 5DA4A 3LEVL 4XNQB 3HG0A 4XMZA 2HA1A 2JB6A 2N3JA 4ZOAA 4A67A 3BZFB 4K94L 2WLJA 2R27A 3PHOA 3FQUB 5F0MB 1ZGLA 1G7MB 5KSUB 2MNWA 3IGUA 3JV4A 1OT2A 1UACL 3HUJF 3QZWA 1G4RA 2WZ5A 1OGAA 2J88H 4HPOH 4KTGA 1KCSH 3BUDA 1ZA6B 4J3SA 4U1MB 1B0RB 5GRUL 1Q1JL 2DIEA 1M1XA 4JGMA 1DVYA 4PPTA 1XF4A 1DDTA 3IDGA 2BSRA 1I8UA 4XC3L 3VH8B 2HFEA 1RZKL 4XMTA 5J8OA 4ZJ9A 3DGGA 4MJ5A 4IS6A 1L9MA 4HIXL 1IAKA 3MHZA 3VE0A 5ADPL 4ZMWA 2RTTA 5AW0B 4XCEA 1U58B 3X3FH 2BSED 2DYPB 4CKVX 5C08B 2ZKHH 1T2QL 4FQHB 3FCUB 1CXIA 2YUXA 1EO8H 5I8KH 1BF5A 4HXBH 4NQQA 5TDOB 1YDPA 4PJFA 4AYEC 4JRXE 2DMHA 4G42A 5IVZA 5K5YA 4K3DH 3VFUB 1RJZA 3AU1B 4X0NA 2XTJE 4BSVB 3NJJA 3M8OH 5B1JC 4NRZB 1YSOA 2W8CA 5C0CA 3EF4A 2C4FU 3Q2NA 5I18H 3W9DA 3PWUA 1GIGH 1XCTA 4Q9QH 4GUPA 1BEYH 3BRFA 1OCWH 3AM8A 2CBQA 4NCC2 3FUKA 2XXGA 4LNRA 5LUMA 3MUGA 5SWZB 4Q2ZA 5IB4A 4K3EH 4LCIL 2ZQKA 4JY4B 4OCNC 3JTBA 1A1OB 1TDQA 3BAJA 3NSCA 5KSAD 4G83A 2D4DA 4ISVB 2YJQA 4PJ8C 4G9FA 1GSKA 3ZYOA 3T08A 3VSUA 5IMMB 5FM8A 1TG8A 1I9RL 4NX0A 2ZPKL 4MD0A 1KFGA 5BO1L 5JYLA 1YNLL 3IJ7A 1CE6A 1E4WH 3PHAA 4XP5L 4RZKA 3RBGA 3A24A 4KKCC 4HOWA 1BBDH 4YH6A 5TGBB 2IPUG 1IBGH 1EEQA 3CQFA 1MWAA 4LEXL 3BXNB 2IV9A 3QEQA 3VXMB 5F96H 1A4JB 4Y4KB 1MY5A 1WLHA 3K72B 2P46B 4LPCA 5DMIL 4TF4A 3VFMB 5BW7C 4PJ7A 1Q9LA 3NT0A 3L2NA 3U0WL 5KYUA 1ZT1B 3RUGA 1DQDL 3V5KB 4BQ9A 4PVLA 3WS3B 4JGNA 5FA4A 2VLRB 4PJBF 5MENB 1DSYA 4AV4A 4GRMA 3CSTA 1DN0B 3OHXB 3IGAA 1UYWH 2JKNA 4PGCB 2X4SB 4KGJA 4PJXE 4U1JA 4Z7QB 4H5SB 1ZTXL 1ZJBA 2IAMA 4RIRA 1EHXA 2AXGB 1KNOB 2ZAHA 3Q6FA 5I1JH 3GK8H 4HJTA 1QTSA 2AQTA 5DUMH 4JRYA 5KS9F 2DLFH 2PWFA 1SFDA 2HX9A 1KLGA 4FA7B 3VCLB 1W9XA 1KZQA 4MCMA 3I9GH 5GGTA 5T1LD 2I25N 1JRHL 1JWUA 2CD0A 4TNWF 4NYLB 5DR5L 3RA7H 2RFXB 2YAOA 4QF1B 1EJ6A 5E6IC 4F2MA 1U8LA 4F24A 3MRHA 4FTVB 4R7XA 2DH3A 3EJZD 2HRPL 4R90H 3VXSE 5HGAB 4ERSH 5C3IA 3ZDWA 5JOPD 4WHYG 2VDKB 2NYYD 1X9QA 5EU6A 3BUTA 2YIHA 4EDWL 2IF7A 1BXUA 2VMEA 5DFAA 4JFFA 2C4FT 3E6HA 1CD1B 3BZ5A 3ESMA 4PJAB 1A14L 4I2XB 5F2FA 3O4LB 4PTUB 2VO8A 3W56A 1MEXL 5D7KE 1VGKB 2V5MA 3H9SA 2PP9A 4XO8A 1Q1PA 2QL1A 1D5ZA 3WMSA 2X7LA 3RURA 3KW7A 4YDJA 5DWUL 1KTKE 4HX1A 1J86A 3WTYA 4HPYL 5HHXH 4J5VA 2P52A 2EO9A 3VXTB 2J7LA 4ZOEA 5IJKA 4HCFA 3IMSA 3Q8AA 3FT2A 4XAWL 3NDYE 4W9KC 2PPEA 3PQYD 5EBMB 3S3JA 3U79A 2NZ1A 3ILEA 4ZQKB 1N8ZA 2NY2D 2VWEC 3SHSA 3WO3B 5I6XC 1MCKA 3DYMA 1XF3B 1WC7B 3VD5A 5IF0A 2IXQB 1S7VB 3P0YL 3QJUB 3BQUB 1QMUA 2WNGA 1HC1A 1KJ3H 1JDCA 3MRLA 4DP0X 4PWGA 3U30C 3VDCA 4Q6IB 1XGQA 1ZVSB 5FCSH 2VLKD 4PVNA 5D1QC 4HOZA 2IH9A 5KANI 2HJKA 3N1FC 2AQ2A 1QI5A 2YFNA 1CFTB 3OQ3B 4KJWD 3ZZLA 1FVCA 2X4QA 1MY7A 2VN7A 3CZSA 4WGWB 2BWQA 3CVBA 3ORJA 4KMLB 4KAQL 5B3JE 3DDGA 4GKZA 3HRZC 3SE4A 2ZNWA 3O8XA 3O0RH 5EUOB 4JCLA 4YHLH 2F54A 4RA3A 5TQ0L 4Y7MA 3QIUC 4CDGC 3S5YA 1YY9C 4G8GE 4HUNB 5BZZA 5DRWB 1RLBA 2MOVA 4ZUSA 1TTGA 2HFGL 3CFCH 3LV3B 4OLWL 5C09B 4DN3L 4RZCB 3HKFA 3EYFB 5ANMB 4IDJL 4Y19B 2SODB 1S9XA 4F33A 1I7TB 3VDAA 3WEBA 2DEYX 1PZ2A 2E56A 3KLLA 4HETA 5EUKA 5HY9A 5D2LF 2XZZA 2IPKB 1KV3A 1TJGH 3RGVB 2Z7UA 4Z8FL 1N6VA 4N2BA 5J12C 2P44B 3HI6H 1BGXH 3KPLA 1QRND 4PJBB 1MCPH 5DTFB 3KS0J 1EWHA 2B16A 3IFOB 1TZHA 4P9MH 5DD5H 3DOSA 5E1IA 5IUSA 1JTOA 4GRLD 3UZVB 2FWSA 4W4OA 2XETA 3F7YB 1JGUH 1T1YA 2YQGA 3PWJB 3CZNA 4LPTA 2XN0A 4FQ1L 2F6AA 3OM3B 5D5MA 1KFAH 4Z7WA 4R7VA 4BFRA 2X6MA 4OCMC 5CF3A 3HE7B 3W3BA 2NR6D 2GK0B 1MW2A 2D7TL 5JHDD 2WO2B 1BIHA 3X14B 1RURH 3WIHL 2VE6A 1KUMA 4A63A 2IWGA 3D4ZA 5DFVC 3VO0A 5A7BA 1Z7JA 4Y5VC 4PS7A 3V4PB 5I5RA 4JREB 3MLTB 1EO7A 1CUOA 5I8OL 4P2OD 3SBWC 1HTYA 4L29B 4EN3C 3ARFA 3TA3A 3LNFA 4U1GB 2HN7A 1NC2D 4KO7A 1BVNP 5I75C 1OW0A 3DX3A 4AUUA 3F7RA 4MQXD 2R15A 4ZXBB 1K2DB 1F4HA 2O6FA 2Z31A 2TRHA 3UFIA 1DJSA 4K5NA 1DQML 2ICES 3P0GB 3X2QB 2DQEL 2XVKA 1BQHG 4MNQD 1ET5A 1X5IA 4TQIA 3QFJB 2BSDA 3OBAA 4PH8A 4ZW8A 3C2AL 4XX1E 4FNUA 1ET7A 3QG6B 5DJZA 3ARGA 3RWDB 3P0VH 2G3MA 1ZANL 3IU4H 1BZ7A 2V2WB 3NOIA 5CCKH 4TTDD 4WWKA 2X3CA 1OAQH 4PV8B 2OMTB 1N4XH 1OGAD 3CVHB 3PDDA 5B38G 3QXWA 3K74B 4PI0A 2CBPA 3KLQA 1TITA 5EC2B 4CDHA 1QSFE 4KHTH 5FYJE 5H8DA 2WMPB 4W9LC 2ZX9A 3FUMA 5KVMC 2E47A 3EYSH 3T8XA 3E9TA 3DX4A 1TO5A 4IRSB 4MA1C 4UTBA 2CIKB 1MCNA 4L2YA 4Y89A 4OZ4A 3HI1A 2J6WA 5JIQA 5FKAB 1R4XA 3AXIA 4PJCA 4AUYA 1SJHB 3L48A 1LK2A 1KXQA 3FB5B 3LRHA 3NIGE 4NUGH 4FXKB 2B2XL 1I3GH 2VZ3A 3NP3A 3E6FB 5J3HC 3Q2LA 3BEWB 3ESVF 5DHMC 4POYA 4YHPA 1CLOL 2YA1A 4OZGB 4FQJH 4K7PL 5E4AA 3NFPA 1QR1A 3N1GC 2Y07H 3OX8B 4WTXA 3TWYA 1MIML 4KNUA 2WB7A 1E4XH 1FFTB 3CVIL 5ICZB 5E8DH 3FOLB 5C0CD 4H4NA 1UH4A 3HA0A 1KV7A 4NQEB 4XVJH 4QHMB 4XXWC 5IQNA 4FXGB 5HYQB 3LXBA 4EDXA 2YMOA 5IVXA 3ARPA 1L6XA 4AEIH 3VI3B 5AENA 3O45B 3M88A 4HIJA 3HHRB 4PJIE 4X8JB 5D2LB 4IEFB 4ES9A 1BJMA 2BJMH 3ZK0A 4IRJA 4GEIA 1I3RA 3CN2A 3F58L 4UQ2A 4G9FD 2NDGA 2ZAIA 1V3LA 2EACA 2LV4A 3MRGA 4G7YL 5C9KA 4XTRD 3MLWL 3ZRSA 4KXCA 2PWGA 4N9GB 5ICYA 4WNJA 4XNUH 1XF1A 2G2NA 1AO7E 3HCVB 4RGMB 5HJBA 2X89A 2P5WB 2J8UB 1FNGB 3L13A 1RKRA 2C7FA 1SHWA 2EIKB 2DM3A 4OJAA 5IW1B 1XAKA 4EIBA 3NFNB 1ZHBB 2ZCLL 2P8LB 1MRFL 1DFBL 7PCYA 3L7EA 4LEEA 2F8XC 4DAGL 1G84A 3T1FA 4IBVA 4JN1H 2J25A 3DPBB 3L4VA 5A2BA 4GNKB 3LEYL 5FM5O 1D9KB 3QEQD 3QS3A 2BERA 4X7SL 5FV1L 1ZVYA 1KIQB 4GO9A 4AMWA 4G6KL 5DJ6B 2DOCA 4GIOA 2D7QA 3ZL4H 4G43B 5I2IA 1BLIA 2YN3A 3IGKA 3BKCL 4Y5XA 2XX1A 3L8QA 3V6FB 5C7XH 3MNWB 5CGTA 4I18A 3RI5K 1XV8A 3P02A 4FLHA 2IAMD 3MRNB 3BW9A 2PN5A 4HEPG 2X40A 2XWXA 5C0AB 2XPYA 2FNBA 4DQAA 2W0FB 5IHUL 3MVSA 2VW7A 4HAKA 4AWJC 2NYYC 2X4UB 2XY1A 4JRYD 1CD9B 4L8SB 1JUFB 2PR9A 2V5RA 3G04B 1KN4H 3RVXD 2CLZA 1IEAA 3V2AR 5I6MA 2OJZH 3TBSA 3NCMA 1BJ1J 1J8HA 4FC3E 3T0BA 1AOHA 1KEGL 1Z6JT 1Z9SA 5K1VA 1KWGA 4ESKA 1LMIA 2F58H 3U4BH 1ETA1 3WELA 1KGCD 2ADGA 3NIFB 4M8QB 4WO4A 5DLMH 5EU6D 3NCYP 4BFKA 1S78D 1ZGLM 5D4HA 2QFPA 1D5XB 3FB6A 3OSKA 4JFFD 5IK3A 1C5DA 3DJZA 3M17B 1FIGL 4RESB 1AZRA 1EX0A 2DI9A 5BRZB 4YHNB 1INQB 2EABA 4QTHB 3QYCA 5KAQG 4P04A 4DVBB 4OZHA 3ULVE 1D5BB 3H9SD 3HN8A 1SF3A 4OD3H 2NY2C 5B8CC 1TCRA 4R0LA 5AOZA 2VZVA 3FO2A 4JRXA 3TPUA 2WP3T 4QGTA 3KR3L 2DIBA 4LGRB 4O2CB 1BXVA 3CV5A 1J9CT 4R97C 5DC9B 4EUPH 1JYXA 4GAYB 2OXGB 4V33A 2VZSA 3REVA 2WVVA 1YPZB 3G5XA 2OSYA 1BLNB 1LDPL 2PF6A 2X12A 4JZJA 2XV6B 4KMTL 2CK0H 5ID0A 2RD0A 1YMHB 2B59A 4YX2H 2FD6L 1XQ4A 2VMCA 3TL5A 2VABB 1MW0A 3OTTA 1AGFB 2PNDA 1TKWB 1EZLA 4PJEF 1QHQA 2YUVA 3F8UB 3EUDA 3BD4A 4WI7A 2YPLB 3DX0A 4UTCA 5L2JB 3EO9H 3HG1E 1J5OH 3DJTA 2VXTL 1UD3A 1EV2E 4G1MB 3WHXA 2DBJA 3D3VA 1A7PH 2H26B 4TSCH 4OCYH 5FYKD 5CLZA 1CTMA 4HS3A 4P05A 3DTUB 2JJTC 2V2XA 3KWVA 1XL6A 2I32A 2QT6A 3BPOB 3ZDYE 1TYRA 3RJDA 4NCDA 2IDUA 5DJXA 3A0OA 4ZFFA 3ZTDC 2D0GA 3O8XD 1V8HA 3T0XA 2F54D 1GZHC 1ZLDA 5JPNB 3IWUA 4F2FA 6TAAA 2WKOA 1IGIL 2CO6A 2HLFD 2VL5A 4ATWA 3PP4H 4TQEL 4K3GA 3ZHLA 2DIAA 3EYVB 1UZ8A 3G6JB 4M8UA 1IZKA 1W8EA 3UX9B 3T6VA 4GRLC 2IG2L 3UC0H 2JJVA 4HFUH 1MCOH 1DBBL 3FPYA 3PUUA 2ZXAA 4BHUI 1CFQA 2CKBB 7TAAA 4LU5L 5L7XH 2NR6C 3UBXI 2X70A 3LQZB 1MHCA 3FN3A 4JR9H 2X41A 1FZMB 1K4CA 1K9TA 4ETYA 3V52H 3UYPB 2E0PA 3AGWA 5CJ5A 3S0PA 3C5XA 1A0QL 2CO2A 2EH8H 1ONQA 1LP9E 5EOQL 4MQXC 3VXSA 3O11A 3MUY1 2FBOJ 2GC7C 3D9AL 5F97E 3CFDB 4E9WA 4YFEA 2EXTA 4QDGA 1SJEB 4L1LA 2ZCKL 3GMPB 4KI1A 5HHVH 2BRRH 2Q7YB 4U6VL 2F61A 5AALA 3T4YB 2LAGB 3ARFD 3TA3D 2OXHA 3IJSA 4GO6B 4R84A 1GHFH 2AI0L 1R19A 2Z31D 4ZNEE 4H88H 2Z4TA 4TTDC 4AYGA 4HKJB 4Q7DA 5E6ZA 4G9DA 4AZ8B 1HNGA 2D2CC 3IJYB 4J3OF 4H8WL 3KBFA 4WKZB 3WUWA 5JNYB 2AAAA 4IJTA 43CAA 4JJOA 1AZBA 4MJ6B 2A9MH 4OGYH 5D7LE 2I60L 1EVTC 1GVIA 1N64L 4YBLC 1BVLA 3TVMA 3ARGD 3WEOA 5FYJL 2AGJL 3DI2B 4B9CA 4N85A 1BPVA 2Z93A 3V7MA 2NY6D 3CPUA 4WWKD 1DHKA 1HCZA 1AD0B 1CIDA 2VMJA 3TNMA 1WVZA 1AS6A 4BFJA 1U93B 1GJUA 4NC2B 1WWCA 2CRZA 1SVBA 5T5FL 1F4AA 1FNFA 2BVOA 4D9QD 5A7EA 5CD3A 3PWNB 4JCWA 4W93A 4U1NB 3WXWL 1PZBA 2AJUH 1A2YA 2ICEB 1WWBX 4JHVA 4K7FA 3VXNB 5E8EA 1KCUH 4EVNA 2OPCA 4XN1A 2FR4A 3GSOB 1ECYA 5FOJA 3NMEA 3PRZA 2YS4A 2F53A 3MV9B 4QTIL 1AFVL 1W91A 4MB3A 4EI5B 3FW6A 3VFTB 1T7ZA 2YEQA 3LVEA 4BQ6A 1GGBH 1IIKA 1MHHB 3L5IA 2VIRB 3M1OA 1J9SA 4QY8B 2UWEE 2ZOKA 2AJXH 3AM8C 5IB5A 2X87A 3TV3L 1NFDE 2YSTA 4LP4A 4IOIA 2BW4A 5HDWA 3DHMA 3NESA 3U4KA 4KKQA 4MCYA 2J5LB 1I8IB 3FUEA 2WUCH 2YZ1A 1NGPL 3JT0A 4PS4L 5AW4B 4HS8H 1XSIA 2P48B 1EQWA 1D7FA 1CDBA 1ES0B 5CEXA 4QOKE 4Q89A 5L2KB 2PP7A 2MOQA 3DNKA 1IZJA 1RZPA 2DLIA 3H0TA 3IXTA 3MX0A 3MXVL 4NZUL 2OI9C 4XTRC 2ZUTA 5I1AA 2XWTB 3BT2H 4ZFGL 1H9VA 4FZ8L 3U6RB 3GSRB 4MGXA 3ULUE 5EN3A 5EOCL 4OT1H 5JIHA 1Z0MA 2Q7AA 4ODWA 1CGSH 3EXJA 4K73A 3H4FA 2IADB 2VERA 3CXFA 4N2AA 4Y4FC 3BPNB 4HSQA 4M7JH 1HEJC 4LAJH 4IRJD 4LQFH 3KPTA 1M3IA 2YD5A 1E7UA 1N6QH 3DIVA 3IFPA 4KZEL 4YO0B 3PNWA 2Z1PA 2R56H 3HPLA 2FEJA 4A7GF 4LVOC 2X3BA 2DWEB 3H3BC 3FKUS 4M5SA 2D3VA 2X89D 1U41A 3TM6A 3X3GH 4CC4C 4CSTA 3FQ4A 1ZV5A 3WI9A 2NSXA 1H15B 1DVFA 4YN3A 5HHME 2QPDB 3RWFB 3RL1B 5HP5A 2ZYIA 1GL4B 1EAOA 1KOAA 5C0JB 4WUKH 2IAMC 3A6OA 3UABA 1HNFA 4OLVL 5CILH 4RBPK 1DCLA 2XKNB 2ZF9A 4OLUH 1BVZA 2WUBH 1OQOA 1JHTA 2K4AA 3BKJH 3FTWA 1MJJA 1E6JH 2PPFA 5ILTL 4PAZA 4F3FA 1RPKA 1VLXA 1YY8B 2XNAB 3BSZH 1VEPA 5TQ2L 4TLTA 1A4AA 3SQOL 3SE9L 1RPUA 1R1CA 2H3NB 1SZNA 1E43A 2XWEA 3QHFH 3EYQD 4E36A 5J1AB 2JQAA 2WLNA 4TL4A 3FMGL 1QQDA 4XI5D 1MWAH 1XCQA 1E9PB 1CBVL 4U0RB 1F02I 1XEDA 4FNLL 3ME0A 5CZKA 4I9XA 1VACB 5I17A 3CPLA 2I9TA 2UYLA 3KPNB 2CHZA 3QNZA 2VL4A 4OLYL 2ENSA 1LO4H 3TIEA 2SEBB 4DNLA 1J8HD 3O2VH 5J11C 3C5SA 4GH7B 4OD1H 4PJHB 4XCYB 1B3IA 3Q6GH 4LCYB 4WTZG 4WO4D 2BVQA 4X80L 3ULVL 4NGHL 1FYTA 1FHNA 4NKMB 2G0LA 3FAWA 4WGKA 1U8HB 3O3DA 2G4GA 5EF0A 5IJKC 2DQGH 1TSRA 3L3OA 1C12A 4MJIB 4XE5B 1TPXB 1PZCA 1N10A 1ZOXA 5ESAB 3EH5B 1M6OB 3HI5H 2G75B 4L3EB 3F64A 4L8BB 5GGTH 5IMKA 2G2PA 4K3JL 4M61B 3MJ8B 4WY7H 5KTEH 2MPAH 4TVSa 2CIIA 3FCSA 3RWGA 1NAML 4JRXD 1AD9B 4NZTL 3SKJH 2HCZX 4F7PA 4XNAA 5KJRL 1SOXA 2XTJD 2YQBA 3BJLA 4XBGA 3WYRA 2KZBA 1OSZA 4O2FB 3SN6N 1NEPA 4BINA 3VXUA 3D4YA 3VSTA 4MA8L 1BQSA 4A2MA 2O5XL 5CFHA 1AQ8A 4Y9EA 1P4LA 3DV6A 2GY7B 4UDUB 1BZ8A 1FSKC 2CXKA 4XRCB 1YEGH 3T5WA 5HHOB 3V9FA 2WXFA 1RZJC 3KPMB 2I9LA 4OGXH 1U8MB 2Z4QB 3NCEB 3U82B 2QADC 4NDMB 4X9IA 1I1YA 4JPWL 4A6YA 2WO4A 1AIFB 2GSIB 5DWPA 3QDJE 3LH2H 3QT2A 3MGAA 2GCYB 1H0DA 4HUUA 5I66B 3SE4C 3I9AA 4YAQA 2WP3O 3NIDF 1EJFA 1YAZA 2ZXQA 4ODVH 3STZB 1LO2L 3D3VD 4NO0A 2Y7NA 4GW4B 2JH2A 1KTRL 2HLFC 3LKNA 4BYHA 4ICXA 2AEQH 5IB1A 5F7DA 2ZUQC 1IM3A 5KN5A 12E8H 4YXKL 5HGDB 4V1DB 1A3LL 5EZJB 3UAEA 4KJYA 3OKOA 2ADFH 2GFBA 1OZUA 1OHZA 1QOKA 1DQQA 4Y1SA 2OW7A 1CG9B 1CFNB 1FHGA 2HLAB 1WIPA 1UZGA 4P5TC 3S96A 1N59A 3T2NL 4RMRA 2R29H 2VQ1B 1OK0A 4AG4H 1PZSA 1RSFA 5DSCB 2Y7OA 5KBDA 1ESOA 4U1IB 1DQJB 4JJ5B 2HSIA 2BK8A 4HEPA 1OTSC 1NCTA 1JD9A 1RZJH 5MHSE 3GIZH 1A6ZB 3KPSE 1SLXA 5FYKH 3V8OA 4ENZA 3DOIA 3WKMH 2P3YA 3LMJL 4LB8A 1Q72H 2WBJA 3VSVA 4AYID 3GI9L 4O4YH 1TSHA 2B1AH 1OHQA 3TX4A 3OLEA 1X5YA 1BBJA 4MZ3A 4PJ8B 4GSDL 3VRLF 1KY6A 3HW7A 1J9QA 2CSPA 2ZYSA 2BNRA 5GIRB 1UXWA 2JJSA 5CSZA 2QQKL 3J7HA 1JPFB 4L05A 1IGTB 1I7UB 3MN8A 4ORZC 4BXSV 1SMAA 2WNXA 1EGJL 1I8KA 1T6VN 3V4VL 2OL3A 4N8VA 2K7PA 3D33A 1QZNA 1TXKA 2EE0A 1IKFH 2D9CA 2EC9U 1RZIA 2D31B 3F04A 2R4RL 1JNNH 1OW0C 3BEVB 4NT6A 4X6FB 3EYUH 3VXSD 3S3BB 1HXYB 1T5WB 1ZXQA 2BNQA 2C3WA 2Z31C 3JZ7A 3W0WA 4YDKH 4JMXA 1TYJA 2DEWX 2WWKT 1NOLA 1AE6H 3C5JA 1R3LA 3I50L 2WXIA 1GOGA 3RPIB 1CL7L 1SUHA 2YEVB 4ONHB 4JM4L 4M1CD 1GPOL 1NUNB 3ARGC 4M5YL 4WW2F 4B9JA 3F05A 3VYNA 1J1XH 1RIUH 4KXDA 2TAAA 3C6SB 4W68A 2ATKB 2NY6C 4WWKC 2HH0L 1XF5B 1YAIA 5T3XE 1NBVH 4B0MB 1OSYA 3GLEA 4MX7B 4U1LB 2GABA 5DXWA 3ARXA 3TVMD 4X0KB 2E7BA 4JPVL 4F7CB 3DMMA 1KBWA 5E6IB 2KL6A 1BZOA 4NLHA 3UZEA 2YLHA 1Z5HA 3MFFB 3D2UB 3EJPA 3F7VB 4LVEA 3L4CA 4X2UA 3ZZQA 1RZ7L 1LTXA 1U6AL 4Y1AB 3L5HA 3I3EA 3ARWA 2VISB 4JFDA 1OANA 3FT3B 2F5BH 4KTDL 5I0XA 4BZ1L 4QMEA 5DUPL 2XFXB 2P5EA 5BRQA 5CBAA 1IEBB 1LQBC 2V0AA 4ZNCD 4KZDL 4MZRA 2C3GA 1Q9OB 4DO4A 2F53D 3ERXA 3NJHA 1BFTA 4KWUA 4XCNA 1NLBH 3RE0A 5A16A 5F21B 4MWFA 1IAIM 1OZTG 4X6DB 1IGYA 3MXWH 4UM8A 2P7TA 2O5NA 3VWJC 3EYOB 4DN4H 2XY2A 2EIZB 3MLVH 3OC8A 4DGIL 5ITBL 1U91A 4YWGL 5I6XB 2XN9B 2ZZUT 4PGBB 3BD3A 4XP1H 3H9HB 3QR0A 3ULUL 4FG2A 4GG6F 4UTBH 3P9LB 4X6BB 4M6AA 5F71A 2VDRL 2YJLA 1FFPA 4IRJC 5JDSA 4F58H 3NPZB 3MJ9A 2XUWA 3HZYA 4HJJL 2BS8A 1H3GA 2EC9T 3IFNL 4WNQA 3BAEH 4GRWF 4PWIA 4BQBA 2OW6A 4TNEA 1QLEL 3LN5B 5ES4B 3MA7B 3ZTJH 2CHDA 5SWSE 3U30B 2WNKA 3ZE1E 3QQ3A 3IDIB 2R9HD 3S3DB 5CEYA 1I1FA 1LK3L 4HEMA 5D1QB 4F27A 4MDRA 3VACA 1F4YL 3EFDH 3LOWA 4NJ9H 1QATA 4FNTA 4RDQF 2G60L 2CLRB 1RUAH 5E70A 4TNVF 3QEGH 4AJVA 5LWYL 1IC7H 4IKJA 4AGLA 1X5ZA 5AVYB 1G7IA 1LP9A 1RZFL 2FVNA 4MD5B 4MXWL 2IDFA 4R5TA 4V11A 1F5WA 3V4VA 1KIUB 3QIUB 3N5AA 3N42B 2W0LA 2WZ6A 1DVFD 1UM6L 3EG9B 2DB8A 3IVKB 2P8PA 4RMVA 4LSUH 1QHPA 2H6PB 1IBHA 3KAAA 3H3PL 5KG9B 2GG1A 3BKYL 3EYQC 4HF5L 3S8GB 1N9PA 1NUGA 3N91A 2PWDA 4LOUD 2L3BA 4XI5C 2AV1A 4OZFG 1NAKL 3MCKB 3NSJA 4BA0A 2CJTA 3S5LG 1WZMA 1BQRA 2KERA 5J12B 2IDTA 1SN5A 1N26A 2GUOB 4NM8H 5LGHH 1CGWA 3U83A 2F9BT 4DCQB 4B9YA 2BP0A 3FYIB 2PWEA 2UUDK 1AHWC 5EWIL 1UA6H 1TZGH 4ZTPH 3L7FA 1G1YA 3UEQA 2FJGB 4ODXB 1PZ5B 1KTCA 4QO1B 3RIAF 4MNHB 1B3JA 1T04B 3OC5A 4PW3A 5E7BA 1Q0EA 1XGRA 3JV0A 3GUTA 1FL6B 3MNZB 5KW9L 1P5UC 4TRPH 1G1KA 3EJUA 4P2RB 4U33A 4Y5VB 2X0UA 3GFUA 5AOKA 1HH6B 4H20L 3KWTA 2BXYA 4GSXA 3ZKQD 4EN3B 1DSFH 1HH9B 5CZVH 1FYTD 3L17A 5I0DA 5I75B 2I7SA 4ABQA 3BVXA 15C8H 3DTDA 1VZHA 3NGBC 2QHRL 3ZBMA 2XQYG 4QCIB 4KNTA 4GKSA 2FJHA 4QRSA 1ZLUK 3BZEB 3IF1B 5E2WL 1L5GA 1DBAL 4WI5A 4JZJC 2YKKA 3N06B 4DUXA 1QYGL 2OP4H 1W16A 2HFFB 4WU5A 3BIAX 3CDFA 5JZ7C 3FPXA 3WNKA 5IFJB 1JTTA 2IBZX 1D7CA 3BP6A 1O0VA 2H41A 3K5RA 4AYFB 3AREA 3RWEA 4RX4A 3U46B 4BBWA 3FTZA 5DUJA 5AQ0A 2PO6C 1H6TA 3VXUD 4E5XA 2Y1YA 4E2OA 5I24A 5IM7A 2YPKB 7CGTA 4AL8C 1BP3B 4GAGL 4OCRL 1T0PB 2MH4A 4YSCA 2EYRB 5GSRB 1NH6A 2BNUB 3DHUA 3I74A 1A6VH 5DJDB 5AW3B 1A6AB 4IRZL 4PRIE 1F41A 4L4TE 4LPWA 4LBEB 4MA1B 4YHYC 4XVUD 2GAZA 4KRPD 3PXJA 3WHE0 1OVZA 4DKDC 5F1NB 4PU2A 4M7KL 4ZPVB 1P1ZA 5FM5M 3NCJL 1IJNA 2V8MA 1QUNA 1R34A 2JTDA 3QCTH 4BGDA 4B9IA 1RZGA 3ZPDA 4NO0D 3WKYA 1KBVA 4HWEL 5IROC 1AQMA 2KPWA 2YA0A 3CFJA 3O3AA 3UMTA 4O9HL 1IM3D 5AYQA 4GUCA 3KE0A 5GRJH 4P2QE 3ESUF 1UD6A 3ISYA 5L4IA 3DRTB 1UGNA 1E4KA 4J1UA 4B5EA 4KVNL 5DURD 3N43F 1EMTL 3TBWB 1DUYB 5EN2B 4CW1B 4D3CL 5JO5A 4FLRA 1TU2B 1XH1A 1UWFA 1EJOH 3S36H 4Y16A 1P7KB 4J2QA 4ZK8A 3TZVA 4QNPF 4AL8H 3T1WA 1OWRM 1IAIH 1FFNA 2R1XA 4UT9L 2IBBA 4N6RB 4KX8A 2VDPL 3JV6A 2ZKWA 1EXUB 1PY9A 2P1YA 2UZYA 2ZSVA 3O9WC 2V2TB 5DZNA 2APWA 1Z3RA 2A9AA 2XG5B 4G8EB 4H1LG 1BD2A 3QA3A 4JFHD 5CJQL 4ZMPA 2WBJD 1PBYA 1R5IB 1SRDA 3T2QA 5HGBB 3WNMA 3KD4A 3GSWB 2NZ9D 3NJMA 4HBCH 1FNEA 2IH1B 4XPFL 2BNRD 5E9AA 5J7CC 4MA3B 3PP3H 3L95B 3ZJAA 3B5TA 3CGTA 1E27B 3P77A 3GC3A 4MCZB 1A7NL 4X9BA 3SQBB 4ABWA 4UQDA 2DJSA 3B9KA 3TS8A 4WTZA 4JM2F 3D69B 3DX6A 1S9WB 3GEWB 1U8KA 2HKAA 2HTKD 1FGNH 1CDUA 4PR5A 1YHPA 5H94A 1T5XA 2WSDA 4M1CC 5L8LB 1QAWA 4CSZA 3T0EE 1GW0A 4GSUA 2BNQD 3W0WD 3OZLA 1I8MA 2QFRA 3JVFC 4CAGA 2WPGA 4ZUTB 1XSJA 4PJDB 2CLVB 4KPHH 1OAZH 3L3IB 3GNML 1YEEH 3T3PF 1MLBA 1YNTB 1E8WA 4PRDA 3RNQA 4DVRH 5T3XL 2BIIA 4HHAA 1A7RH 2B5IC 3DPDA 2OTWA 5T1LB 4G80A 1JGDA 1II4E 2VSMB 4GAJL 4WHYH 4JFWA 4QHKI 2Y6SD 1L9NA 1NFAA 4NEHB 4OJCA 4ZDHB 3MO1A 3W2DL 1JZ6A 4ZS6D 2HT4C 3AT8A 4OJFL 4EUPB 4HU8A 5CLWA 3OAUL 1UKSA 1YEDA 3GJFA 5EZOH 4G5ZL 3OJVC 4NAQA 2C1PA 2WWKO 3KPOA 4JO2L 2E6JA 1EHLH 2NTFB 3DMMD 1IGJB 4NOBA 2YHGA 4R7DB 1CBJA 4YS4A 1G7HB 3RVUD 1OSEA 3P73B 1BAFL 1AXTH 1O75A 1WBXA 3AAZA 5K69A 4U6HA 5CINL 2ZXEB 4FQ2L 1LEKB 1JK8A 5C2BH 4RMUA 5FYJU 3WY3A 3A3YB 3QGVA 4B3EA 1HFUA 4JFDD 5C08E 3V0IA 1TOXA 1NGWA 4GMSL 1CGTA 1JN6B 1BA9A 1E9QB 3PQYB 1Z2KA 3FCGA 2ZUSA 1XB3A 2P5ED 3LXCA 5EV7A 5B8CB 1FUNA 3O0LA 5E5MB 2NY2B 1SLVA 3CZEA 4NWTH 5FCUH 4I85A 2XWBB 2Z8SA 4KGLA 5CIPA 1YEHH 1KIPB 1PD0A 3MJGX 3E2HC 4ZMVA 3BCFA 4ZTOH 3VJ6B 5TF0A 1MDAA 1I7ZA 4R97B 1L7IH 3AG4B 3PGFH 3GGWB 1WT5A 2H3KA 3RY4A 2VLKB 2BMKB 1HL4A 5SWZE 4LVHC 1YYMH 3NA9H 5GZNC 4ODUB 1C16A 3FH8A 1ORSB 4BHUA 3AU0A 5FX3A 2DM4A 3UBXA 2GJZA 1HQRA 3BDBA 3SSGA 3PABA 4XP4L 1EHNA 1MCHA 1QABA 1DCEA 5E5RB 4UT9A 4R96A 4EN2A 2Q8AH 1T0OA 1RHFA 4TNFA 3FRPG 4WK0B 1AQKL 4UT6A 4AQ1A 4NN5C 4QTFA 4XPGH 1NGQH 3KPRA 4WEUD 3G6AA 3IBEA 2B4CC 1QWNA 4NJAH 3ZLQC 2KS0A 2R69L 3EBHA 1R33A 2YD3A 3ARVA 3MGOA 2CGRL 1GZQA 3UJIH 2UZIL 5CKAA 5I15H 1SF5A 1YJDL 1D5IH 3AFLA 3LPPA 3NK4A 5DQ9A 1FF5A 2BOBA 3VXME 4FI7A 3B3IA 2I7OA 4LOUC 2HVJB 3CXDH 4Y2LA 3C8HA 4L5FE 2Z0UA 5AAMA 2C3VB 3ZO9A 4IIQA 3X1NA 3LPGA 1PF3A 1WGOA 3FT9A 5E1QA 4N0UB 4TVPD 4NPYA 5MENE 2N56A 2R4SH 1ZT4A 3GMQB 1QWHA 2Y2TA 2ZXGA 3M07A 1DJHA 1B0GA 1HHGA 2BM3A 4PP2B 3MLRL 4M48L 1TVHA 3PS6A 1KIRB 3LZQA 3PWPE 5LNEA 2Z92A 3IK2A 2AS5M 4G8IA 1S8DB 5HHPA 2OYLA 1PIFA 3QWQB 1RVFH 2N7SA 1PZUB 4CVZB 2OR9H 3GXPA 3NCXA 5IR1A 5F44A 4AI7A 5JHDB 1TEGA 4LEOB 2B4CH 5I1LB 3F7LA 4ZRGA 2XN1A 2GBAA 4XBEH 4IHOA 1XMEB 4NNXA 3RX8A 3DTXB 2X6AA 1MFEH 2Y36L 4LCUA 1SHXA 3MBEC 1ICTA 5TPWL 4FTVE 2EO7A 4B97A 1S5HB 1FG2B 2Y1AA 5ETUB 3TT3L 4XZ4A 1NZRA 3VFNA 3P30L 3VYOA 4ANXA 4OV5A 5JQ6H 4AT6A 1NGZB 4LKCB 1AI1L 4RETB 4F5CE 2DF3A 2RGSA 4I2XE 3RU8L 3O4LE 5AB1A 4R8WH 4PHZA 1LEGA 2HUEA 4HLZG 5FDWA 3TWCL 4W70A 2NLJA 2JB6B 4JY5H 2CCVA 1U33A 4B9KC 4H13C 1BZ9A 4HWBA 4M43H 3PHOB 4QAWA 1ZGLB 3GJEA 4PREB 4U7SA 3JV4B 1F90L 4D0DA 3DURA 5ADOL 3QZWB 1WFIA 4N0YL 1OGAB 4TKWA 1S9YA 4A37A 4G1EA 3IN0A 4RFNC 4KVCH 4MB5A 5C0DA 4HCIA 2BFVH 3EIFA 4G7VH 3L08A 3C08L 2CU9A 4EJ1C 1PVHA 1N8OE 2FT8A 3X13A 1XF4B 2EKSA 3IDGB 4M6ML 4YBLB 5IMLA 2HFEB 1TQVA 2BIPA 3ARED 3D25A 2KDYA 4RWHA 1RJYB 3GTVA 4KRPC 4NLAA 4RX4D 4XVUC 5F9OH 1PG7H 3BWUC 3MRBB 4KHXH 4MJ5B 5D1XC 3PV7A 1IAKB 5ESQB 4Q4EA 2BZ7A 4IU3A 1MI5A 2NUPB 5F1KC 5F0JB 4XCEB 1PKQA 2EXYD 1P4BL 2C4XA 1OP3H 2E8ZA 3ULUD 5FW6A 1ZS8A 1HT6A 3REWB 25C8H 2DJ4A 3JWDL 5E4OA 2CDFB 4DZ8A 3DVFA 4F8PA 2FZ3A 2BIOA 1A6UH 1F4WH 2HT2C 1MIEH 3BLBA 4PJFB 4F8OA 4G42B 1NCCH 5IVZB 4DGVL 5CR1A 1RJZB 3NCYS 1D7BA 2HX8A 1MJ8L 4YSDA 4D9RE 2DMBA 3D2TA 5EUOE 3A4EA 5C0CB 3WIFA 2EIEA 1IC4L 4S1RL 1UOWA 5TE4L 3PWUB 2R69A 1QNZL 4H0GA 3TJPA 1JGVL 4GUPB 4M3JA 1MFDH 3UPRA 3LKOB 1QFUH 5C09E 1A4KA 1J8RA 1V3KA 4L37A 1P4UA 1AR2A 1BG9A 3O2DL 5ANME 1EEYA 4Y19E 3HG4A 3MUGB 4NENA 3IFLL 3S48A 4HAGA 4G5AA 1B4JH 4HUKB 4S10A 4A6YH 3QPXL 3HNVL 4HMCA 3T4AA 3JV5A 2QQLL 1HKLL 4X6EA 1WA2X 2A77L 1CS6A 2NZ9C 2XPGA 4G9FB 4Y16D 3TZVD 4B50A 5DZPA 1WAAF 1YG9A 5MEQA 3UJJH 2JJSC 2OI9B 2MHAA 2WKGA 1WTLA 3B3BA 1MFCH 4MD0B 5SX4H 1BAWA 1FLRL 4U3CA 1MAJA 3QUKA 1BD2D 1IAOB 4PJGA 1KXTA 1MCIA 1GS8A 4Y4FB 1AZUA 2HTKC 5DHEA 1S3RA 1N0XL 3O3BA 1QX1A 4MHHG 4KROC 4GIAA 1MWAB 1OB1B 4NRYB 3QEQB 3T2OA 2OZ4H 2FT7A 1CTNA 4PB0H 2WLZA 4LMQI 1QA9B 4J3BA 4DFIA 1UH2A 4BH8A 1Q9LB 3B9KD 2AANA 5E94A 3KCWA 2UZPA 3PFUA 5KYUB 1GJIA 3DSFH 3RUGB 3QO1A 4IMKA 1KJ2H 35C8H 1DQKA 2GIMA 4OTXH 2DMGA 1QEWB 1IFHH 3G5YA 3DJ9A 3Q01A 1UWXH 5I1EL 3M46A 5BOJA 2IAMB 2AJZB 4N1EA 3VDBA 4QUOA 3FTSA 1I1CA 4PSRA 3BAIA 3UH8A 4HQQL 2LGNA 2YWZA 4ZS6C 1MLCA 3KVDD 5KVDE 2VDLH 1R3JA 3ZHNA 1CF8H 3VFSA 1KLGB 4Y9FA 1KCLA 2R2BA 4EOWL 1VENA 2OL3H 2WVUA 2CDEB 2CGYA 3V8CA 3VW3H 1FP5A 3DMMC 1WE5A 3T6WA 2RHEA 3NTCL 3S6CA 3RVUC 1HEZB 3R4DA 1U8LB 1NKRA 3UZEC 4FEMA 1DBML 5TF1L 3STLB 4JZNA 4IU2A 2AP2A 1NGXA 2VITA 4X6CA 3QQDA 3FFCA 4Z7OF 4AGMA 1J1OH 3DV4B 3GT6A 1M7UA 3VFGL 5I5IA 1IL1A 3ZT5A 2NZIA 3E6HB 1DYZA 2EIBA 2R0ZL 2VJXA 4J6IA 3RY5A 1N5YL 2X28A 5IW3A 4LPVA 2WC7A 1VJSA 3O3EA 2UVEA 4PW4A 3QAQA 5F3BA 1CZ8L 5IBLD 1M05B 3OR7B 2ESVA 2AVFA 3S8WA 4GQRA 2X7LB 4JVUA 4L9LB 4P23A 2C9RA 4HX1B 4LE8A 4LSSH 4MQ7B 3AROA 1T6WA 4RAUB 4NO2A 3FT2B 2W38A 1B9ZA 2BVTA 4OZGE 2ZF8A 3UG5A 1W8NA 1JYVA 3CK0H 4M4RA 4MXVE 1N8ZB 5H4ZA 1IC5L 3BLKA 3ZVVA 4NHUA 2ZKXA 1UFUA 5IF0B 2HRHA 2WAHA 2EXWD 3LRGA 2ADJA 4F8NA 2KHAA 4TLUA 5LCVA 3WNLA 4OGQC 4Q9RL 3A6CL 4NC1C 4ELMA 4I9WE 3E8UL 4NQEE 3IPFA 4GQ9L 2XA8H 4H1LA 4FAAB 4OJDH 1QR4A 3JXAA 4GYBA 1XGQB 2VXQH 1KCVH 5IFAL 3VI3E 1TZAA 1PYWB 1RZQA 3FCTA 2MKLC 2HJKB 2YA2A 1U8IB 3OG4B 3H2QA 5G4NA 3VI4A 1M2OA 1JZ2A 1OK8A 2QADB 1MCRA 1FVCB 4GQZA 4KH9A 5GXBB 2EVJA 4HIHB 1VF5C 4IKNA 3LNEA 1MFMA 1J8SA 4MVBD 5KOVC 5FFGA 5FR3A 9CGTA 4GKZB 5FO2A 4YL4A 2WOBA 2Y7QA 3Q9PA 1MELA 2F54B 3SBQA 3KPRD 2OBGA 2P5WE 2J8UE 4XN7A 5LNGA 2ARJA 4ZO7A 4Z0BL 5AWNH 1WGVA 4F7MA 4FS0A 2ZUQB 2KZ1B 4ZO9A 3F6JA 2NCEA 4L0PB 2O6DA 1S9XB 4F33B 4ODHL 2AJYH 3I02A 1Z9OA 1TYEB 4N25A 3G6DH 4NS0A 5HY9B 3MJ9H 2R0KL 3QUXB 1FBIL 4DEUA 1KLUA 4P5TB 4XVTH 3MRDA 4MBOA 4TOYL 3VFWB 1DZBA 4XNQA 3S5ZA 1MREL 3ZIYA 3DOSB 3S9DB 4IBQA 1T1YB 1WG3A 3BZFA 2XI9A 3A47A 2DQMA 3QFDB 4YFDB 3RTQA 5D5MB 2CDGA 5HTSA 5ACMA 1G7MA 4NUQA 4QHKJ 5AKRA 4Z7WB 3PJSA 4OY9A 2DD8L 1PZAA 1USZA 2WWMD 1JMZA 2VDKL 4N2FA 5E00A 5HYSB 4U1MA 1MAMH 4LAQH 1N2RB 6FABH 2OMNA 2X9XA 4GO8A 1UOKA 4TVPH 3MRQA 1NUDA 3H42L 4JG0L 3VH8A 4BKSC 2JKTM 3QXTA 5I16B 2HN7B 3NIFE 4WAFA 2MSPA 4Y4HA 5IB2B 2NMSA 4XP9L 1XBRA 4AH2B 3CDCA 1XIWA 3MNMA 5BRZE 4L1BA 3QCVH 4OLXL 4ODSH 4TUOA 2A4ZA 2Z8WC 3EF7A 2UX7A 1CDYA 4FQHA 4NHCH 5JIPA 4NC0B 4JPQA 4YVUA 4Z5RA 3V6ZB 3K6FA 4Z7OE 2Y6TE 3ARGB 5IKCA 4PI2A 3QHTC 3VFUA 1SUJA 3LHPH 4JVWA 2NY6B 4WWKB 1FL5B 4G72B 4NRZA 4JO5A 2OJ1A 1G9ML 2ID5A 2CJUL 2MTAA 3UPAA 3EO1A 3EOTL 3N85L 3M7FB 1E7VA 2F2HA 5F6HJ 2ALWA 4ABUA 4LSQH 4WU7A 3E38A 3GMMB 5EO1A 2AVGA 4WFHD 1I85A 1YPZE 2EXYC 4KKNA 5IJVA 5DK2A 5BS0E 5L8JB 1LO0H 2E3VA 1INEH 1RI8A 1UCBL 2VDOL 3ZTEA 3G5WA 3T8XB 3PDOA 1RFDL 4YHMH 4AIXA 1NKGA 4DKEH 3C87A 4QRRA 3BDYH 3BE1L 2APVA 2B20A 1NWOA 1AGDA 1EO5A 3HI1B 4W9ZA 2LU4A 5CCJA 1WUNT 5HI4C 2AABL 4RCAA 1MI5D 2YPLE 1LO3L 3QDHA 3AQDA 3SYAA 4Q6KA 3UJTL 4JQIL 1LK2B 4P3CL 3TO4A 2D8KA 1DLHA 3VFPB 4KXZI 5T1DH 2AW2A 1H5BA 4NWUL 5E1AB 1WD9A 1EEZA 5I0VA 5IHLB 3NFPB 1RUKH 4G6JH 3TEZA 1QR1B 2B1HH 3U7WL 3K6SB 4IIZA 1E4KC 3CZFA 3ZTNH 1P6WA 1BZQK 3BXNA 1JXDA 4Z7NB 3VXMA 1CXLA 4FYRA 5IZ7A 1ZEAL 2KUTA 1GMIA 3RIAK 3TZVC 1A4JA 5FUOH 2X10A 1YEIH 3QXVA 5DEFA 1DUZA 4G6AC 4X98B 3TN0B 3VWJB 2NY4D 3G6JE 4X5XA 3V5KA 3WTSA 7FABL 5ALBH 3QUHA 2VLRA 1RK1A 1V27A 5MENA 5TDNB 5HPMA 3SGKA 3AMLA 1WAEA 1SMDA 4K7PX 1QLRA 2X4SA 3T71A 4H5SA 3D87B 3ESNA 4IRJB 1F4XL 1UA7A 4LNVA 2ZUVA 4UQ2B 1DQTA 1SY6L 2R0LL 3MRGB 5C0EB 3LKPA 4GIPD 5ICYB 1ETZA 5DJYB 1ZT7A 3MRJB 4LP8A 3B9KC 5M94B 1S7XB 4Z9KB 3VCLA 2CJ3A 5J5EA 2F7QA 2NNAA 4V2CB 4K9EC 2J6EL 4YSOA 3L7EB 4OZIF 3T1FB 1T5KA 1J8KA 4QF1A 4GFXA 3V4PL 5AB0A 1C5CL 4F2EA 3PXHA 5DEJA 4W9EC 5HGAA 3K6IA 5CN2A 3R8QA 3EGDB 2A5UA 3VG0H 2K9FB 5FUZL 4AEFA 4G82A 3CDZB 3IKKA 1T21A 4HK3N 4R4NC 1NIFA 4PJAA 1OM3L 4PTUA 1ZPUA 5T3ZE 1VGKA 3DRQA 1RIVH 3ZSTA 4WI6A 1K8DA 2VR8A 5DO2D 5J13C 3BW9B 3GXNA 1PLCA 1S7SA 4ENEC 3B56A 2NX5B 2XFGB 3IS0X 2H0FA 3SODB 5F1IB 2FATL 4JKPH 1H3PH 2QSCH 3THML 3JQOB 4YHZL 1DLFL 5AW1B 3D85A 3L9EA 3ARUA 4K0OA 4XMPH 3D8MA 2PW1B 2Y3AA 3FC8A 4N1CA 5JIKA 2CLZB 2YAMA 3GSNH 1Z3GL 3EFFA 1IEAB 4NZRL 4ZQKA 1A3QA 4QXUL 2WXPA 4K9EH 3TBSB 4CN6A 4MZIA 5A2JH 1AHWB 4TTGA 3FTYA 1Z9SB 2IXQA 1S7VA 2MPVA 3RGHA 5HVGB 5IBLC 1NMCC 1Y07A 5EO0A 5GJTL 5EFIB 3FFCD 3LCYA 5FYLE 4CA4A 4OH2A 3WFCH 3EJRA 3QR1A 1C5DB 4WFFE 3HC3L 4Q6IA 4MQTB 1ZVSA 4JFUA 4PJ5A 3ZYIA 1P5UB 4ZYKB 1MNUH 4OZHB 1CFTA 1LMKA 3ML8A 4RWYH 5DJAB 3UGUA 1TCRB 2XG4A 3OKLA 1OXYA 3T3MF 1H8LA 2ESVD 1I9JH 1QI3A 2BC4B 3TPUB 4P23D 4JPIA 5IWLA 4YVNA 2EXWC 4Q74A 2BSSB 4WJG3 1KB9J 1PLBA 3PV6B 4PLOB 4WTWA 5EU7E 3NGBB 3KCPA 2C3XA 3WS6A 2F7RA 1GAFH 4ZD3L 3B7RL 1IRAY 2KMWA 3GJFH 1HWGB 2C9VA 3KWWA 5DRWA 3ZX1A 5T1MA 3TFBA 4JZJB 5HD8D 5HI5D 5ID0B 3RY6C 4LLQA 2B59B 5EORL 3RDJA 3U4AA 4IBUA 1I7TA 2NY7L 2YBGA 3VD3A 3P2BA 4MVBC 4N28A 4WFEE 5L2KE 1DJGA 3OSVA 3R0MA 1C1EL 2PO6B 3RGVA 4BDVB 2VRQA 5ICXA 3IMUA 3FT4A 3N41B 3QDMB 2IV8A 3QRGL 2L7JA 3D3VB 4ZFZA 4PJBA 3T0DA 2QEJA 1WRFA 3B4NA 3ZHFA 3EADA 3IFOA 2APSA 1JHLH 4HZAA 4ZX4A 4YHYB 3LXUX 2E86A 2VC2H 3PWJA 5C6PB 3GBMH 1RUPL 4DGYL 1E42A 5CEZE 2XQBL 1OARL 2ZUUA 5CIPH 1ZVHA 2LT9A 3NCWA 4ZFFB 4WZ9A 2VRKA 3GZQA 5KS9A 2Q3ZA 5FLVA 3ISRA 3GQFA 5I19L 3OKKA 4FULA 1FN4A 1SYSB 4WEEA 3QHZL 1EFXA 3PUCA 4IIQC 4NUMA 2VL5B 3LD8B 3X14A 2J4WL 5KZCD 5LN8A 1NCHA 3DVGA 1EBPA 1A6WL 1EUUA 4CKQA 1KELH 3JWNE 2D0HA 1ZV9A 5IBTL 4HOMA 1VEOA 1OQXA 1Q94A 5D2NB 4XPHL 5DZ9A 1BOYA 5IHHA 4ZXBA 5DC4B 4KKAD 1ZA3A 4UNIA 5CU5A 5E6YA