3L9EA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
b'MPAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDSGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGHELSKTTGNAGGRIACGVIGLAKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Bombyx mori
publication title Crystal structures of holo and Cu-deficient Cu/Zn-SOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
pubmed doi rcsb
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9eA00
1CB4A 1E9PB 3H2PA 2WZ5A 3F7KA 3K91A 3KH4A 2Z7UA 1UXMA 1RK7A 1FUNA 3CQPA 1E9QA 1IBBA 1PTZA 1XTMA 3RE0A 3MKGA 5KBLA 1B4TA 4OH2A 1YAIA 4BD4A 1YSOA 2C9UA 1F1AA 5KBMA 4L05A 2VR8A 4A7SA 3GZOA 2WWNA 1DSWA 3KBEA 3L9YA 4A7GF 1ESOA 5KBKA 1F1DA 3HOGA 2XJKA 3T5WA 1PU0A 2AQTA 3SODB 3HW7A 2WKOA 1KMGA 2ZKYA 4OJAA 1QUPA 3S0PA 1B4LA 1SRDA 1IBHA 1CBJA 1Q0EA 2AEOA 2SODB 1SOSA 1OZUA 2AQPA 4A7QA 1P1VA 2WZ0A 1JCVA 2V0AA 3MNDA 1F1GA 1U3NA 2WYZA 2WKOF 5CU9A 3GZPA 1L3NA 1XTLA 4B3EA 2AQRA 1N19A 1SXZA 1SDYA 1SXNA 2E47A 2XJLA 1E9OA 4N3TA 2GBVA 2JLPA 1SDAB 3GQFA 1OZTG 1SXBA 3GZQA 3H2QA 2ZKWA 2VR6A 3CQQA 3PU7A 2ZOWA 1EQWA 2AF2A 3ECUA 1IB5A 2Q2LA 2Z7ZA 1SXSA 2GBTA 4BCYA 4A7UA 2AQQA 2AQNA 3KM1A 2WWOA 1Z9NA 1E9PA 1TO4A 3LTVA 4BCZA 1HL4A 3HFFA 4A7GA 1JK9B 2WZ6A 2E46A 1SPDA 2LU5A 1AZVA 2GBUA 2C9VA 2VR7A 3QQDA 1OEZW 3CE1A 1BZOA 2JCWA 2ZKXA 4A7TA 1IBDA 1OAJA 3GTTA 3KBFA 4U4IA 3F7LA 1TO5A 4FF9A 1PZSA 1COBA 1N18A 3QQDB 4N3UA 1SXCA 2C9SA 1S4IA 2Z7WA 3ECWA 1UXLA 1JK9A 3KH3A 2NNXA 1SXAA 2APSA 1MFMA 2AQSA 3GTVA 1Z9PA 4MCNA 2K4WA 1EJ8A 1YAZA 1E9OB 1BA9A 1XSOA 1F18A 2Z7YA 1HL5A 1IBFA 1OALA 2WYTA 3L9EA 1DO5A 4A7VA 2R27A 1E9QB 3KM2A 4MCMA 3ECVA
chains in the Genus database with same CATH superfamily
2F68X 5DEGB 2EYRB 4BSVB 5BZWB 3WN5A 4YFEA 3OF6A 3OKMB 2A77H 4YXLH 4NERA 4WWKB 4S11A 1A2YB 5J7CC 4IGBA 4LPVA 2BSCA 4U1MB 1N6VA 3ZTDC 3O8XC 1LDSA 4PCTA 1LQBC 3P40A 5DJ0B 4EIGB 4L4TB 1AS8A 4KK5C 4Z3GA 5EEXA 4ZD3L 5CBEB 4LFHG 4L3CB 1Z7JA 4H20H 1DQQA 4LVOB 2FLBT 3BZ5A 2FE0A 4PJ9A 1E28A 3R7QA 4D9LH 3DHPA 4AV5A 4KNQA 2W65B 3OKEA 4IHOB 3KR3H 1CBJA 1JMZA 4Y9FA 1BBJA 4PS8A 5CZKA 4YHZH 5EU5B 5JQIB 1BYNA 4R3SA 4J8RB 1X6LA 4JEGB 4A2FA 2WYZA 5CJXA 2KHAA 3NDZE 4KKCD 4U6HB 4D8OA 1XDTT 2JIXD 2Q76B 4JZNB 2AW2A 3BH4A 3QEHA 5E6RB 5J1SC 3H7BB 2LFGA 4H2CA 4WUKL 4Y2OB 5I9QB 3WMSA 4KI5C 2R0LH 3QXTA 4WI3A 4IK6A 3LQAH 4OLYL 3JTSB 4LRNH 1TTFA 4M7LT 1R46A 3LZFL 4A7UA 2N01B 4UDTA 2WCPA 3VXME 3ZQWA 2JKNA 2PF6A 2ZJSH 4TUUA 1OK8A 2HMIC 2F19L 3VXPB 1DQQB 1JMXA 2DV6A 3IN0A 4JKKA 2JIXB 2APWA 4N6QA 4JQXC 3TH3T 3FMGH 1QBLH 4M7JL 2IF7A 3QJTB 3K1DA 4RFNB 2FEDD 3EG9B 3T0XA 1CG9A 2P8LB 4NQXA 4TQ8A 3VI4E 4PR5B 4YE4L 1COBA 1JV5A 3K2IA 3HJ0A 1ZHKA 5JPNA 2P7TA 3CPUA 3MV8D 5DA4A 3LRKA 4WUUA 2ZP9A 1IEHA 4F24A 1LK2A 5E94B 3FRPG 3INUH 3DROB 1GH7A 3BKML 4U2ZA 1R3HB 3JQOB 4ALAC 3U4KA 3QJRB 4R0LA 2IDSA 1AXIB 1CLYH 1GGUA 2Y06L 2QZQA 3VDAA 1DSFL 1TTCA 2BVQA 3CVHA 4AM0B 3Q1SH 4ONGL 1CWVA 4FTDA 3ULVE 4KMTL 1A9BA 1UQSB 5TPWH 3MUGB 4UZGA 1FO0B 4R26H 2EVHA 3B6SB 2AEPL 1TZGH 4F1SA 1U8MA 1S7RB 4JM0A 4BBWA 3FKUS 4AQAB 4WHCA 5IB4A 5K9OB 4YFLI 1A14L 2TRHA 1T6WA 4R2GD 5E5LA 4GRWE 3GMQA 2X9WA 1TEYA 5EU6D 4G5ZH 1BLNB 1E2WA 1A7NL 3SQBB 3TA3A 2NUPB 3AG1B 5KBLA 3BP6B 4WQOA 1CN4A 1X5KA 3MRRB 1CYWA 3WUZA 4BQ9A 1AQHA 2Y1AA 2YGNA 1J1XH 2PWEA 5CCJA 2Q76A 4JZNA 1CQKA 4YSUA 4NN5B 3E1ZA 4OM1H 3P77A 1YN7B 3O6MH 4TM9A 2P80A 4GIAA 3P0VH 5T1DH 1GOHA 5FUOH 1S7VB 4XNDA 2NSXA 2B0SH 4TL4A 4UINH 5DK0B 5FM5O 1YJDC 1XF4A 1XZ0B 4R5VA 3W0WB 3N9GH 1M4KA 2NY6B 1FZOA 2UY7A 4TLTA 1QASA 1JZ2A 4ES8A 3NSFA 3CZNA 4HPOH 2DQUH 2XXFA 4BZYA 4YGVB 4PRDA 4I9WD 1A6UL 5F70A 2OSXA 1NLDL 4I0PD 3UBXG 1ADQL 2P48B 4FNUA 3WHE1 5FW6A 1NBVL 3GMNB 2BDNH 2ZOOA 3AMKA 4K3EL 1JNLL 1PD6A 2OTPA 1YPZB 3IDIB 5K1NA 4P2RB 2APTA 1KLUB 3SB3A 2V5RA 2WLMA 3IYLW 4M29A 3A22A 2BFVH 2GBUA 2Z31A 1K8DB 3O8XD 4JFFA 4U1KB 5JHLH 1S7SA 2WN3A 4Y5VA 3PWPB 5E51A 3VFRB 1I7TB 4PJEB 5IEHB 4B3VA 2I26N 3ALWA 1L4IA 1DSYA 4MNGB 4U1LA 2GBAA 2X3CA 4UOW0 2BSTA 3MJ7A 3BT0A 3ZKND 3HMXH 1SXCA 2D3NA 1OHZA 3O2VL 3DGGB 5CJXC 3N40F 1ZCRA 4Y1AE 3FN9A 1UWEL 4HUCA 2BVPB 1K4DB 3KH3A 2P5EB 3RGBA 1Q0XH 3MLZL 3N6YA 1U2HA 4Y4KC 2Y5QA 2K78A 5DLLA 5HYIA 4HCRA 1N4XL 2B9BA 1FZMA 1E4HA 3K2MC 3F8UB 4ZFOA 4PLKC 4AEIL 5HGDA 2DI8A 3KVQA 3T4YB 1A8JH 3EO0A 3V6ZA 2LAGB 1NGQL 2AJYL 2PCFB 1U3ZA 3H7BA 4F7EB 1OXYA 3HR5A 1W2KT 2DQTL 1UJ3A 2V7HA 2IOMA 3INUL 4WHYH 5D70H 2VXSH 5EOCH 1D5MA 4K4KA 3MRKB 1ROWA 1UD6A 3KXFD 1G7PA 5BO1L 4JZJA 2CLRB 1OLLA 5HGAA 1DBKL 1P9MC 2MIZA 4KVCH 5AZEH 1KLFA 4DFIA 1EXHA 1S7RA 4YOKA 4AWJC 1HX0A 3DSFL 2X2YA 5MI0B 5KW9L 2KZKA 5A6LA 4TNVF 2AEWA 4I77H 1NC4A 4QCIB 3GRWL 2AK4B 2DYPD 2KPNA 4DVBB 2JE8A 1AQKH 1M2VB 5AW4B 2HVJB 4B6ZA 3IFLH 4BELD 5CJQH 4X5LA 5A2IH 4WVRA 4ZMTA 1YG9A 4HMCA 5FPIA 3ARDB 1F3RB 1GHFL 4ODSL 3RWDB 1DBBL 4RZCB 2J1WA 3SIKA 1OLZA 2N1KA 4ZQKB 1U21A 3GLZA 5GS1C 3OKMA 5HBBA 1JI2A 1XB8A 4WUUB 1N6UA 3T0BA 1M1XA 2FQGA 3I84A 3KXFA 4CU6A 2IQ9H 5LN8A 3MNVA 5ANHA 3MV7D 3RTQA 4HIEA 1OT4A 2W59A 4UQ9A 3W81A 3J8F7 3IEAA 4N8UA 1ZLSL 3C6SB 3BRFA 2A1WH 3CBRA 1YY9C 2OR8A 4K7PH 3WU1A 2R23B 5HYJD 4LPUA 3BP4B 4GT0A 3MMEA 4JKNA 3L45A 5BRZD 4UB0H 3PU7A 1VERA 2ZCHL 4J6IA 4LPTA 4LQ1A 1U3HB 2NXZB 4QRUA 5DMGD 5H37H 5C3LD 5D7LD 2EIEA 2AMGA 3OF6D 1VFOA 4PJAB 4Z7VE 1CLOL 4I48B 1NBYB 3JTSA 4NQSA 2QQNH 1DL7L 3IDUA 4FNQA 3CLFH 2G75A 5FO7B 1DDHB 1S7QB 1S3KH 4N2BA 1MDAA 2COQA 1BAFL 2XWJA 3CZJA 1JPST 4HWEH 1ZS8B 1FL5B 1QI4A 3OD3A 4Y2OA 3ARUA 4FL4C 4AE0A 1JPFB 4U4IA 3P02A 1BXAA 3KPSA 4MA8L 4OD1L 3U1QA 4QPEA 2VZSA 1L0QA 3MX0A 1O9WA 3SE4A 1S9XB 5LGHH 1ZT7B 2NT1A 3O45A 3R0NA 4HYTB 4HS8H 4PWFA 4I85A 3AG4B 5I1IL 5JHLL 2QT6A 5JORB 2VLKB 5DC0A 4E42A 4Z7AA 1IFGA 4UOW1 1K6QL 2VM4A 5MEPB 4ZOBA 3HVNA 4GJTB 5F7EL 4GXUN 4AQOA 4KY1L 3PDGA 5AWNL 2ESVD 2WXQA 1CVSC 1U8HB 3I02B 3NA9H 3SE8L 1WBZA 3ZE1B 1BGXH 3MCLH 4C55A 4DETA 3CFBA 4XCYB 3FZUC 4R90H 4C4KT 4N0UE 1MI5A 4U1JB 1OP5H 5GXBB 1AP2B 5F1SA 3VD3A 1U8NA 5DWPA 2Q8AL 2WZ5A 3KS0J 4P0DA 3O6LH 2PTVA 2YIHA 1HYRC 1C9SA 3MKGA 2EVGA 5KSVB 1H0DA 5B38A 4G8GA 1IO4C 1ZPUA 4DGUA 6FABL 2V17H 1ZWIB 3IGKA 1NDMB 2FYYB 5MERB 1KTKE 3N41F 4E5XA 1QTYT 5F1OB 3PIQA 5ESQA 5FIEA 3H56A 2HFGH 1O9ZA 5GGRY 4XMUA 4P2OD 1EHAA 1PU0A 3F5WA 2QKIB 1X9UA 5G55A 3RZCD 2ZSWB 3F05A 1XZWA 2ZKYA 4N1CA 3QZWB 1TLKA 3NEEA 5KVGL 2VDQB 2LE9A 3MLSL 3V52H 4ZI8A 3HR6A 2NXYC 5I1CL 2YN3A 4TNWK 4ZMWA 2XBZA 1BJ1J 4WSGA 3Q6FB 4K23L 4OBRA 2X12A 5LJYH 4LEXL 5E23A 2MCG1 3U46B 3QFJE 2Y25A 5LCVL 2XPYA 4ABUA 2DMGA 1ES0B 3B1TA 4G9FD 4PRHE 3RTQC 4GMSH 1KENL 3KPRD 5DRZB 3IKKA 3B5GA 3CHPA 3HBQA 4ISVA 3N40P 3QWRD 3HMXA 1S9YA 2DDQL 3CXFA 3LV3A 4ZRGA 1RJLA 2B08A 2ARJA 2BXZA 4B5ZA 2H32A 3FQNA 1MCWM 4I3RH 3VVVA 1P6AB 5K9JH 1VACA 2ZSWA 4K7PL 1KXHA 2GIYA 5DR5L 2WQWA 3EYVA 1OAQH 3QULA 2VAAB 3WLWD 3ZKMD 4FLOA 4RFEA 3OV6A 4N87A 3PGCA 1C08B 1KY6A 3RIAK 5F7BA 3MRIA 2XA8H 4AIZB 2YA1A 1DO6A 2EE6A 3H6AA 3NN8A 1KELH 2WQ8A 3IETA 4LF3A 2XV0A 4H1LH 2R0ZL 4X7TA 3GM0A 3WFEL 2YAMA 4BZ2L 2VDRB 3DHJA 1ZE3H 5CP3A 1TF4A 2W0FB 4B7IA 3BVWA 3KLHD 3UJTH 4GRMB 4YHLH 1RZIB 1XGTA 2PMZA 1WVZA 1ML0A 3T6ZA 5EMYA 4O9HL 4OD3L 1EJ8A 2Z6FA 3IU3B 5DTFB 1MIEL 2KYIA 4J6RH 1I3UA 3EFFB 4WHDA 2DL9A 4FTVE 4Z7OB 1DCLA 5DT1H 1RPKA 2ZOKA 4HETA 4HHGA 4BWUA 4XGZA 3WNMA 2KH2B 4MCZA 1JS4A 3T2PA 2VSMB 4YBQD 3B2VL 1UOLA 3LNGA 4L9DA 1D6EB 2HN7A 3QRGH 5J57B 2CDFA 5AW2B 3P54A 4JR9H 1RK7A 3V9EA 3JWNC 3Q13A 3P0YL 2C3VA 3K71B 2OM5A 1FNFA 2J2ZA 3L1EA 3MBEB 3ABMB 4OZFG 3MODH 1M9SA 2G2RB 4IRJC 4B97A 2Y6TE 4KKAD 3QFDA 4QF1B 4XCEA 4X9YA 4MA1B 1F13A 1JGVL 4NNXA 1X4YA 5M7QA 4ZFZB 1PLGL 2IPUK 4NHCL 5IBTH 2AC0A 4AJYV 4NQEA 1GY1A 3SODB 4QRTB 3TFKD 1MFBL 1V7MH 2HB0A 2XV3A 5FO7A 4K8RH 4Q4IA 4UTBA 4L8BA 4NQDB 3L4VA 4ZO8A 1UGNA 2MKWA 3EUUA 1BQHG 4ODVH 3WTTA 3M1BB 2ZZUT 2Y3AA 5I6XB 2FCBA 3ARGA 4MDIB 5E4AA 3ULUH 3FZUD 4AYDC 3O6KH 2VXVL 4RAVA 3A3YB 1QHPA 1YNKL 3ATEA 4O02A 4PRBB 5I1JH 4OGQC 1FJ1A 3D48R 5AEAA 4KHTH 5D7LE 1Z3GL 1J10A 5I1CH 5KYWA 4MA7H 1N5YH 3LB6C 2DQGH 4MNHB 5IF0A 5F7MC 3HA0A 4L3EB 3B3IA 1A4AA 1PS3A 1EO7A 3U9UA 4N2MA 3CVCA 4F7PB 3IFNL 5FCSH 2CA4A 2ENJA 2VRQA 3P30L 4OFYD 1S7TA 3KJ6L 2XZCH 3OKLA 4ZQKA 5DZVA 4NKDA 3GDBA 1R5IB 1J86A 5AVZB 4LCUB 3JWNG 3QRFM 4MD0B 3TASA 1WBXB 5DEFB 1I1FA 1MFEL 1W0VB 5JIHA 4IMLA 3H53A 4NCDA 4TSAL 2AK4A 1WEJH 4N8VB 2OP4L 3Q5YA 3RBSA 3QHFH 1KNOA 4R2GC 3NIFF 3QR1A 2CALA 2DQJH 3S8GB 5JTWA 2O93L 1JP5A 3TZVA 3JVGA 3EYUL 4RMBA 5DO2D 4K9EL 3BJ91 3QXAB 1BEXA 2UWEB 4OCYL 4B53A 5I6OA 4LOVA 3HLAA 5L8JB 4JE0A 3OHXB 1R3KA 2ZICA 1UCTA 4KBPA 3LHPL 4L0PB 5ITBL 2FJGB 3MLUL 1RZJH 2A83B 1HHJB 5FKAB 1OAUL 4CC4A 1RHHA 5HHOD 5GS0H 1UXWB 2P5EE 2ZXQA 2UXVA 5KANI 4QWWC 4HXAH 3PQYE 4U3XA 2ZCZA 3GBLA 1FYTD 3FULA 4JPQA 1PIFA 2OXHB 1VFUA 2GEEA 2IFFL 5IHZB 1KIQB 3K72B 5E5MA 1ZA3A 5BOPA 4N68A 3T8MA 3MYJA 4HGWB 4QXUL 1T04B 2WQUA 3JBG7 4NQDD 4EKXA 4JFYB 2KQMA 3DX8B 4DW2H 2AK1H 1DSWA 4F7TB 2QQKL 3BD5A 1KGJA 1I8IB 1OTTC 1MJ8L 1XSKA 2V6HA 4M6NH 2NZ9D 4LOUC 1RZ8B 1CD0A 2B0SL 4P57B 1UACL 4Y7OC 3MUZ1 4QIRA 2P8PA 1G1OA 3B3BA 3ZE1F 2EO9A 1PY0A 4MNQE 1A9EA 5AW7B 5KN5A 4I1PA 4N9GB 2FEJA 5I6KA 4V2BA 5IBLC 1DDTA 3NMEA 1YEGL 5BUPA 2FGWH 1F42A 2DM7A 4G6AD 2R7EB 4A66A 4IOSA 3TM6A 3MGOA 3B7UX 2MOQA 1VCAA 3EYSL 5JW3L 4FP8L 1JAEA 1E3FA 5DUMH 5JPMB 1M3JA 1A7RL 3RGVC 5DD5L 1R5WB 1E4KA 2O61A 3RDTC 4Y4KD 4TQHA 3S35H 2ADFL 3CG8A 1ZVNA 2VZUA 1T80A 3PE9A 4P9HH 3WXVL 1YN7A 2V9RA 2CHNA 2IBZX 3AT0A 4FJ6A 5IJBC 5KBDA 2YD6A 1W72B 3NA4A 4LIQH 2HLAB 4XMWA 3MUJA 1Z9SA 3I6KA 4I2XE 4JFSA 5EIVA 3D12B 3UEQA 1QFOA 2JJWA 2NMSA 1A6AB 3KL3A 4MA3A 5BVPH 3ZQ9A 5I1DA 1BIIB 3MXVL 4WI5A 2ZX9A 4WKZB 1S7XA 3IF1B 1T4WA 4GAJH 4GT7A 4QD2E 1T1WB 1TVHA 2Y3NA 2APSA 3GPEA 3QXDB 1LEIA 3HPJB 4JG5A 3T2QA 1PDKA 4MMXA 4OFQA 5CF3A 4A63A 3PWNB 1FFOB 2OKMA 3BP4A 1KGUA 3I6LE 3RJQB 3QA3B 3GUTA 3LNFA 4OR1A 3VE0B 2J1XA 3RUGB 1ROCA 2EYSB 1JXDA 3P4OA 4X42A 4XE5B 1P84K 1HHKB 4HCRL 1T7ZA 3AADB 3NIDE 4TUJB 1FNSH 1RZFL 5EZPA 4JPIA 1AFVL 1R3HA 2KZBA 2OLDA 1N64L 4U7SA 4JRWA 43C9A 5EZIH 1R5WA 4DN3H 1KZYA 5E94A 5F7HA 1D6EA 5DYOA 2F54A 2WAHA 3APCA 4G8FB 2BOBB 4LMQE 5HHXL 4P9ML 2DBLH 3MGOB 5ALCH 3V6BR 2YZ8A 4YHNB 2CKBB 2ED8A 3C5JB 1QZNA 2F0CA 3IFLL 4KKLC 4HXAL 2A99A 3MRBB 4KJWC 4TKWA 2GQHA 3CZGA 2A74A 1A21A 4S0HA 2CXGA 3DX2A 1RERA 3UC0L 4PJ5E 2FHFA 3VXPA 3OB0H 1RZJC 3WFDH 4DZ8B 5FHBL 4NPKA 2JELL 4P4KD 1WA0X 1KIPA 2DS4A 2J6EA 4AJWA 4CJ0A 3PWPD 4LCCA 3VGBA 4ZUTA 1XH2A 1IC5H 1XHHA 3MBWB 3KEDA 4PREB 3Q7JA 4X7TB 1IZKA 3I50L 4GEJA 3L4WA 3KPLB 4GXFA 3MV9D 4L4VA 2N1TE 4IIQA 2NQ3A 4N2DA 4JPVH 4HWZA 5EBLA 1I8IA 2XFXB 5CZXD 3WUWB 3ZKQD 3S36X 3JSSA 2QVFB 4LSVL 4O5LH 5JQHC 1A3RH 3UZVB 4DGIL 2APBA 3U4EA 3FS9A 4F8PA 1TJHH 3HAEB 1JNNL 1OY3B 1A7BA 1QSEA 3HNSL 4PJBE 4XOEA 2JB5L 3O9WA 4XP5L 3BAEL 4HHAB 5D5MA 3BI9X 4HEPG 4JPKL 3V6FB 1I53A 4MZ2A 5IOPA 4PRHD 4CVZA 3FPYA 5KVGE 1DANT 4KO6A 4MA8H 3D9AH 4WW2B 2PTUA 5KAQF 4ZW6A 2YD5A 3QH3B 4UYPA 4HUVA 1SOQA 1MY5A 1BP3B 1OE3A 4IGBB 2G0KA 1WD8A 4RIRB 3SOBH 3WFCL 2E86A 3JV4B 1G5AA 1JVLA 3KR3L 4OFIA 4RAUB 3W3BA 1KYDA 5BRZA 1CDBA 3AQDA 5M95B 1TT6A 2WCGA 2YBRA 3E2HC 4YR6A 1IAOB 4FFZA 3N42F 4JHAH 1GKEA 2Z9TA 1CZ8H 3HNVL 2F1BA 4KMQA 4FKEA 1DQIA 4GI6A 3G6JA 1OTSC 3RVVD 4LT7A 3SCMA 4NUPA 5DS8B 4E5XB 1DQKA 2EC9U 3UTZA 3WKNA 5B3NA 4QXTA 3ARBB 3DIFA 3CU7A 3KDMA 2CRYA 4PPTA 5E8PA 3L3IA 1R5IA 1PCSA 2L4OA 3CSYA 4AL8L 2WM0A 5D7IA 5ITFB 1J05A 4XVSH 2A4EA 2UY7B 4GP5B 1MJ7H 1PD0A 5DUBB 2X0VA 3G7TA 1U93A 2NXYB 4PJDE 5HGBA 4GG6E 1XD0A 2RFXB 3NCWA 4AY0A 1BECA 2P5WD 4CNIA 1DQJA 3L5XH 2ZCLH 1NWPA 2NY4D 1S9WB 4UQDA 1H3PH 1AIFB 4ZW7A 5F6HI 5CUSL 3VXOB 2X6VA 3Q06A 1TKWA 4IJ3C 3QWOB 4TOYL 1N64H 4DSYA 4I9XA 3PFUA 3SE9H 5G5DB 1U42A 5ESVA 2CXKA 1I8LC 1J9RA 5EU4B 1LXMA 2WBJD 2VITB 3IJ7A 3MRMA 3VYPA 4NQDA 3MJ9H 4W68A 4MAUL 3Q1EA 1P1VA 3EUDA 1KCLA 2GFBB 4QXVA 1S9XA 5AVRB 3VXUD 3A67H 4ZFQA 1KENH 2BCKA 3GBDA 1XH3B 3HVDA 2IWKA 4MAYC 4YHOH 3ZL4L 2A6DA 1KCBA 1XCXA 5D1ZC 5EZLB 3PWUA 2VW4A 1BWWA 2X0UA 2UZYA 3W5MA 4ODXB 1DDHA 1S7QA 3IDMA 1BFVL 1H6UA 1IKNA 3UP6A 4BH8B 4BCYA 3ARFA 5T1LA 3QR0A 5K39B 4PY8I 4G5ZL 1P4LB 2R15A 2HRPH 2UXTA 4I5BB 4G7VL 3I9AA 2D0HA 3IRZA 3TBYA 4URKA 2HVKB 2ZKXA 5KEZA 2X2IA 4KFMA 2FJFA 1XGQA 4WFED 2FRGP 4KKZA 3K6IA 1ETJA 2XY1A 3EH1A 5C0BA 5ACZB 5C0BE 3H4FA 4X9HA 2ZOUA 1K72A 4ZOCA 4ZAKD 1RUKH 2BVTA 5D4QA 2D7NA 5ICZA 3EW3B 4JPKH 3V6OE 3GYRA 1AQDB 2R2HB 2W0PA 4XVUC 5D1XC 3UBGA 3CX5K 4FNLL 3WKPA 4EI6A 1I7UB 1UCBH 2OFQA 2PP9A 3ZN6A 3QFJD 3I9IA 4HAFA 4D0CA 3FSZA 1BJ1H 3L1FA 4GMTL 4JPWL 5ENWA 4K9EC 2DMBA 3F58H 3W9DA 3KPRE 5D2NE 1C5CH 2OXGA 3MVSA 1BEYL 1QLRA 3S97C 2GTWB 2RAMA 1EEUA 2MQ3A 2LAAA 3BKCH 3N06B 2M26A 4ZMQA 5DA0B 1T3FB 4E9TA 4TNEA 4M6MH 3DOSB 1L0PA 2RIKA 1E4XI 4ZAKB 3TO4C 1THAA 3QQ9C 1ID2A 3MOAH 1V3MA 5FK9B 5ILTL 1PKQE 1IBGL 3WIFA 1NAKH 3FT1A 5IQMA 5C0CE 5CD3A 3G5WA 2YMTA 2ARJB 3ZDZE 1G7PB 1I1AD 3T1WA 3ILQD 1INQB 1L9OA 3UIZA 4LLUA 3D3VB 4YIQB 1JYXA 2WO4A 1J1PH 4RGNB 1K8IB 4ABWA 1FYTE 4QT5B 5AW5B 4OF5A 5HGDB 3S88H 3FCSB 1CDJA 2DTML 1KJ2L 4P2QA 3BDXA 1NFIB 4WTQA 2XNAA 5T1JA 1MDTA 2X88A 2HT2C 3QUMH 2XHNA 1CYGA 3M45A 1CDHA 1G4RA 1V7NL 4WDIA 4WWKA 4NI3A 5DFAA 5DSCA 1ZK9A 3JWDH 4JY4A 4AC4A 1BVNT 4KFZC 4AT6A 1EXGA 2JQZA 2XVLA 3ARFD 4RRPG 1X7QA 5E8EB 5T1LD 3T1FB 3X14A 4EI6B 1FH5L 4AENB 2AQPA 3ULUL 2F5BH 5CP7B 1G94A 4FZ8H 4K3HA 4HSCX 5FO9B 1YNKH 4QRBA 2NY2D 3IAQA 3UBXI 3HKFA 4IDLA 5HGGS 4APXA 2FJFB 2Z1PA 3JT2A 4XH2B 1Q0YH 3K4DA 5D7JB 1N5YL 3ZKSD 3BVNA 1OSZB 3DVIA 3WE1A 3HE6D 1ORSA 3FO1B 5IHHA 2IAMD 3ELAT 4XAKD 1JXKA 1UZ8B 4MNQA 1RJCA 4OLZH 4KK8D 1AGDA 4WI2A 1C5BL 4JCMA 4HOXA 1U33A 3VXNA 1MRCL 4IBVA 2PXYD 1TFHA 1VFAB 4NQEE 5CINL 2BC4A 4B95C 1Q9KB 3IJYB 3IXAB 4J27A 2XWTB 3OPZH 4HP5A 1SBSL 1GGYA 2JVUA 1D2PA 4HJSA 2VO8A 4LHUB 3I02A 4QHUB 5H94B 5TDNB 2K7QA 3RIKA 5FWRA 2X4OB 1TZIB 3TT3L 1HHIA 3IS1X 3TT1H 4GW5A 4MQXC 3T0WA 1KGIA 3RAJH 1G7IB 4HUWA 4B7LA 5AAWA 1A5FH 1KBKA 1XF4B 4YE4H 1UT9A 3R06B 3G5YA 4H8VA 4PJGE 5DJDA 3PJNA 3KPOA 1BM7A 4Z76A 3BGAA 6CGTA 1RZGB 2NLJA 4G83A 3VXTA 3ETSA 5CD5C 1JDAA 1CFBA 1SQMA 1XF5A 4DTGL 3P4MB 5KAQG 1UZGA 2YO3A 3MLYH 3DUUB 3BVDB 4F9PA 1ZEAH 4ZMZA 4ACTA 1U8QB 4LARL 5ISZD 2BC4B 4KC3B 2L04A 2PTTA 1NCBH 4NGHL 5E00A 1KN2H 4JPWH 3NACL 5D1ZI 5KYYA 1FFNB 5IB4B 3WSQL 1N0LA 3GIZL 4BWTA 1R33A 5KTEH 2VDLB 2Y1YA 4G1EA 4UWQB 5FFLA 1U3HA 2H6PA 4FFVD 1WFUA 4PJ5B 1UQSA 2CBMA 3GMLB 2HKAA 4G8GE 4KJQD 1OSZA 1IAII 4MJID 4XN8A 1AKPA 1U4EA 1ZD6A 2VN6A 4XR8C 4WJKB 4XH2A 2H8PB 1L5GA 4A7SA 2FDBP 3GZOA 5FA4B 4PI0A 2X6MA 4Q6YA 3SJVD 1T2JA 2WWMC 4U3SA 3GS7A 1QFWL 2BFGA 3MRNA 1FRGH 3H3BC 3RGVD 4G80A 3PFQA 4HUXB 5AB0A 2XG4B 3RWIB 4GW4A 1MH5B 3MZTA 4AIEA 5IHWA 4KQ4H 1BAWA 4QRQB 4NZRL 4PWJA 1MHPH 2QKIC 1YEGH 3FUFA 4IRSA 2PETA 2XX0A 4FYTA 3RWDA 4OLUL 4E9LA 5GZND 4XP1H 5E6UB 5GJTH 2X4PB 1J5OL 1ZGLP 1E30A 3UJJL 3IDNA 2YEZB 1KG0B 5CIPH 2XDHA 2R29A 3LH9A 4KQ0A 1TU2A 3SYQA 2Q5BA 3VFPA 3MLPA 1A6PA 5T3XL 4M4PA 4FQPA 1FFPB 1HQ4B 1TDQA 1RURH 2WXOA 3MRGB 3P9MB 1FGNL 4FFZH 4LRIA 4PB0H 1LEKA 1KPUA 3IMWA 4FZ8L 3ILEA 3WIHA 4PJFE 4UQCA 5I5RA 4PJFA 1MAKA 2WXKA 1BZ7B 2MPAL 4HHAA 3GSUA 4L8DA 1FG2A 3VWKD 2WLIB 3MV7E 5DWUL 3B4NA 3MRMB 5A7EA 3STLB 1ZDSA 3ZU8A 3AB0B 2FECI 2YPKA 1HIML 2BW5A 1X5MA 3T3PB 3ILPB 5DJCA 1CJYA 4BFEA 12E8H 1XX9C 4X5RA 3EGSA 4KJQC 3T4YA 1LE9A 4BDVB 3T77A 5TQ0L 1AZRA 2OXGB 3RU8H 1KBGH 4OTXL 3FN0H 4UIKL 3RL1A 1V55B 4AJ0A 2I32A 3HS0C 2XN2A 5ENWB 1C5BH 4IS6B 1EZVY 1DQJB 3O11A 4K23H 4Z7QE 5AVSB 2OJ1A 3WJLC 1CS6A 1Q9OB 3FT4B 2XCMC 3S5LG 2IG2L 3FDWA 4M61A 5JHDA 1G7JB 1T0NB 2C9XA 1N59B 2YUWA 5IEHA 4NKIL 1IKOP 1HCVA 4U1GB 3TO4A 4AEIH 3RWHA 1T83C 2DH2A 4S1SL 3V9CA 4A6YB 1I9IH 3MRJA 1JHKH 4BHUI 5IT2H 4ETQB 4LQFH 3ZDXE 7PAZA 1UYWH 4JFDB 3PNWB 4TQIA 2GUOA 2JKSA 2R4SH 2XQ0A 1U36A 3UAJD 3TPUB 3GMNA 3VXQB 1R0AL 1PPIA 2IH3B 4PJ7B 5EZLA 1YZZA 2EEAA 4H1LB 3KCPA 3RUGF 3GSWB 3QA3A 4RMSA 3L48A 3WGUB 3FK3A 2VDRH 3ZKMC 4LE8A 2BCKB 1FYTA 3TBWB 2VL4A 4GBXB 3NFPB 3UXFA 4D9QD 3PHSA 1HILB 4APQA 4LFHD 4QI3A 4P5TA 4K94L 1KT2B 3SGKC 3EJJX 1ACCA 2BIPA 1S7XB 3PCYA 4F5CE 4RWYL 5C3IA 1CFMA 3D0VA 2D7TH 2AJZB 2K4AA 3QC6X 4AQ1C 1GYVA 4ONHB 4KHXH 4EEEA 4MSWA 2ZXCA 3FFCE 1ACYL 4AYID 2VWEE 1Y1UA 4BFBD 3C5SA 3E3QC 4L1BA 3P3TA 1OQXA 3GRBA 5IFJA 1HCZA 4JQIH 4EKJA 2QSVA 4LSDA 4CBPA 1L6ZA 1DANU 2Z8RA 1G6RL 3MREB 3NP4A 1SMAA 4P59H 5D4IA 1JV2A 1KXQA 3FUNA 4YNYA 3U79A 4YLQT 4WNQB 3BO8A 3D9AL 3MN8A 5HJGA 5KSAC 4KV5E 1ILSA 4F27A 5SWZB 3FN3A 1NL0L 1M9WA 1RJYB 1G7QB 1MFCL 2IBBA 1Q4NX 1UVQB 4AGOA 4NX0A 1USQA 1FGNH 4Y16D 1OL0A 1MCSA 4ZQTA 4IBLT 1UOWA 3MRBA 1IQWL 4FMKA 2EIJB 4N3UA 4IRJA 1JRHL 4JDVB 1AACA 2D7PA 3LKNB 25C8L 3LZRA 1ZSDB 2ORBL 2RHEA 1OT2A 3SDCC 4YR6B 4NN6B 1T4KB 5BNXD 2BP8B 1XGUA 1QLFA 1SXAA 2MOGA 3QNXB 1J88A 3OKKA 4TQEH 4CSPA 4HZ1A 2P7TB 4ELMA 1FVCA 3AROA 2W5PA 2P8LA 4KH9A 4NQXB 1J5DA 4F7TA 1WO2A 4ANKA 2NTFA 2G9HA 3N0AA 4BJLA 4QJ3B 1N12A 3MLTB 2ZUYA 1Z5LA 2ARWA 2PPEA 4RNRB 1M53A 2ZYIA 4GB9A 4M1DL 7PCYA 5FGRA 2OQJB 2H3NA 3CQFA 2ATKB 1QPXA 4UUJA 1J0YA 1QO3B 3CVHL 3LN5A 3ULVD 3K2UL 5HP5A 4G9DB 4MHHG 4K55A 3BJLA 1C8QA 2RCSH 1BD2A 5I0DA 5I66A 3GGWA 1I9EA 3BQUA 3UACA 4ODTH 3C5ZA 3V4PB 2I07B 3ZHLA 3RYMA 2X38A 2W88A 3BZ4A 3MROA 5JO5B 4OM0H 4L5FL 3N1GC 2H1PL 3NCMA 4L1DA 3GI8L 3W9EA 3MR9B 3AT9A 3CDCA 1NCJA 3A5VA 3HBPA 1EFXB 1SEBB 4J3XA 3B8SA 2AFNA 3QAZC 4J8QA 4DVRL 2MPVA 5C7ZA 5BV7B 1BBJB 4OCYH 2W65A 3OKEB 3O3DB 2C4FU 3NIGF 5E8DH 1SN0A 1SJVA 1MVYA 2VL5B 3MRLB 5AD0A 3KPQB 5DQDH 2OTUB 3AJ7A 3C12A 3LPPA 4PJCB 5GS0L 1NANI 4LEXH 4W9HC 2MOVA 1Q9WA 3JWOH 4ODUA 2X4UB 2ICWJ 3Q44A 2IPTL 2BHYA 2NYZA 3D85B 4TUOB 5DYOB 5T5FL 5DF0A 3RVUD 2GBTA 5JHDE 4F7PA 2V7NA 5G4OA 3QDMB 4E9RA 3HEIB 4LLMA 5TE4L 3CFCL 4JLRB 3HN5A 1EGJH 3LQMA 1V05A 3RL1B 4A7TA 4YXLL 4AZUA 3L3DA 3MV8A 2BM3A 2DF3A 4OCRH 1YEIH 1TFPA 4JFYA 1K5NA 3VD0A 1U8CB 5IK3B 3RURA 2WZPD 1KPVA 4NS0A 1CDCA 3IGUA 2RR3A 5TE7L 2XN9D 3CCHB 1O6SB 2VCOA 2OTWB 2LR4A 4OU3A 3BYTA 2GHWB 1T5KA 5IB3B 3KYKH 3REWA 1E42A 1MCPH 1KPUB 3UJTL 3S8WA 2KQNA 1EXUB 4M6ML 1T21B 2NT0A 4JFOB 1XR9B 2IV8A 1UXWA 3ZR5A 3ZIMA 2GCYA 2ZD0A 3QI9D 4ZXBA 4KITB 5I2IB 1BD2E 2WNWA 3FT9A 5HPMB 3A6BH 1B6UA 3UJIH 2D3JA 1A8ZA 3D87B 3IJEB 5DC2A 4F8QA 3ARFC 3BZFA 1P4BL 3ULUE 1MN4A 2UWEA 1UM4L 2FWOA 3NJHA 2OMWB 4OF3A 2J6WA 4P9HL 3WXVH 1W80A 2X4SB 2HRHA 1BZ8A 4HIJA 3QXVA 4Y2DC 5SWSB 5JXAH 3C09B 4PJFF 4S2SA 4MJ6B 4P5KA 4M5SA 1W0VA 3QEQA 4LL9A 5KJ7E 2Q8BH 4AQZA 5FA4A 3KBEA 4TVPH 4KUZH 2HRLA 1CD8A 1JPTL 5TF1L 3ZYJA 3QNZA 1R5VA 4DQOL 4D0BA 1LNUB 2AI0L 3EGXB 2WSDA 4B96A 1NAMH 4AV4A 4HFWB 4E9QA 3V9FA 1FO0H 2YFNA 1G87A 4BK5A 1JCVA 1B2YA 4JANB 1F6AB 1NFDA 3QORA 1H8SA 4R4FH 1ZLDA 5KYWB 2Z65C 5D2LF 1GJIA 3BKMH 5ETUB 2VRAA 1IGIL 1U8LB 4O2EB 8PAZA 3DX8A 4ZTPL 3PL6C 3WMQA 4MYPA 2QSCH 3QUYA 1P4UA 4N3TA 1PG7L 3VXSB 1G4MA 2ZCKH 4N2NA 5C0CD 4JRYD 1AHWA 4PRNA 5IFHH 1J18A 1KTLB 4OVUA 5E5MB 4F8TA 3D0VB 2YA2A 5I1AA 3JTTA 3U6XA 4LGRB 3P1VA 5AW6B 4U31A 4ONFL 4Z77A 1PG7W 1QPPA 4FEIA 3I75A 5CGBA 1QNZL 2AERT 2FQDA 3C08L 1CDYA 1KC5H 1PNDA 1XR8A 3KBFA 1J1OH 3FB5A 3W5NA 4LMQI 4DP4X 3RILA 3P73A 4I2XB 4CGTA 4NJ9H 4UQEA 2E4TA 5FYLH 5TQ2L 3V4VL 1YVLA 4OZFH 3SKNB 1OGAB 3WG7B 4KZDH 1WEJL 1MZYA 2VISB 1L9RA 4JFED 1MFDH 3FH8A 3O6ML 4F37K 4XC3H 2YGOA 2W81C 4MMXC 4HZLA 4HMDA 3IM1A 3D0AA 2ZP0T 1M6OB 1WSST 3ROLB 3MRFB 4QNPE 2EDXA 4M3HA 3VFNA 3KBPA 3SYPA 1N59A 3A4FA 4MD0A 4PIRF 5JOPE 3IJSA 3MLUH 3O2WL 4APXB 1X5JA 3LRSA 5BXFA 3HPLA 3UTPD 4WGVB 1VCBC 1BZ9B 2EADA 1DJWA 2NR6C 1GCFA 5E2TL 1ID5I 4YO0B 3F7KA 2FIKA 3UFIA 4YDLC 1IKFH 1KEGL 3UYRL 5L2JB 1Q1JL 3GXMA 3Q05A 3CQPA 1MUJB 1Q9LB 3RE0A 1AGBB 4JFZL 4YQXH 4XNYH 2GAZA 5AYQA 2WLHA 3OLEA 4UQAA 4OJYA 1LO2L 2WZAA 5IB5B 1P4BH 3BN9D 3QJQB 3D39D 3TBTA 4N0FA 2O5XH 1P7QB 1E27A 2OMUB 5IQOA 1BZQK 3CX5J 3U0TA 1U2CA 2V9UA 4GFTB 5DVKA 1P5UB 4Z0XB 4E0RA 3P3UA 4L8BB 2G2NA 2WLIA 3WJMB 5CGYC 5L6YH 2MHAB 3ARSA 1JFQL 4A68A 1MW2A 3K6SB 4JG0H 1OOWA 4XBEL 5DI8B 3EGDB 3P73B 1UASA 5AAMC 3DX6B 4X6CA 5HJDA 1JPTH 5IB2A 4LSPL 2PO6D 2C9RA 4S0TD 5FYKE 2XC8A 5FF6B 2PP7A 1RU9L 4AGQA 3FU8A 1XXFC 2HKFL 1YN6A 1QFUL 1RY7B 2A6KB 3DVNA 4RBPH 5T3ZE 43CAB 1XGPB 4G7SB 4YXHH 5KVFL 1AHWC 5CJ8A 3NZ8A 5F93C 4L2YA 5T5NF 3KS0H 5I1GH 4C54A 3GSQA 2YKLL 1T7XA 4UQ3A 5DD5H 4IDJL 4G3YL 5IIEA 3NCBB 3QZWA 4UT6A 4WUKH 1WG3A 1DBAH 2F1EA 1YEKH 1ANUA 1NOLA 3CN3A 1CDGA 2WXJA 1OAJA 4KTEH 1B4JH 3W11C 4R4ND 5GGUA 1QACA 2BX5A 1UB5A 5E1QA 2WVTA 3B7TA 3P2DA 3ALPA 2HVKA 4ZFGH 1AI1L 1S5IL 2H26A 4NUQA 2QHRL 3DO4A 4AVKA 1D6VH 3KBHE 1RPQA 2QGCA 4RMUA 1L9SA 2EDLA 1OF2A 3PHQB 4MJIB 2QELA 4OB5L 2ITDA 5GRJL 1F00I 5BPPA 1A7OL 3TO4D 2QEJA 4OIIH 1OP4A 4HUUB 1MHCB 5HHMD 3ESVF 2X41A 2AXHA 4DO6A 1LEGB 4FJYA 3AT8A 3AS0A 3P11H 4I1RA 4WO4C 2PTTB 3W1ZA 3FUHA 4EN3D 4Y2NA 5CEXB 3ZOAA 5DURD 1I9RL 5GRVL 5LGYA 3NIGE 5I74B 1G9NL 4JGUA 4UM8A 1QEWB 4ZUSB 4KPHH 2ATAA 4AZ8A 2ADJB 4K9JA 1N8ZA 3EOTL 5LNDA 5BS0D 2ZYSA 1XGYL 3BUQA 5AOJA 3RWFB 5HPOA 5MEPA 1W6LA 1HHGA 1YRKA 1L0YA 5J1TC 2V2WA 3G5YB 2UYLB 4LSRH 3DIDA 3V5KB 1JZ7A 5CEYA 1E5UI 1UTDA 1NCIA 4NP4H 2XZZA 5D6DC 1RLWA 3SJVA 3H55A 4QY8B 3KYOA 3VH8B 2C3XA 1KTBA 4J39A 3UX9B 4OV5A 3Q2CA 3CLFL 1Z66A 2VKXA 3DVGA 1NMCC 1T21A 4JFOA 3GINA 1NGYA 4KOBA 3FQTA 3FOMA 2G3ZA 4WO0A 4JKWA 5C0JB 5JA9A 4Y4FB 3O81A 5K69A 1KEGH 5L0QC 4LEOA 1OCWH 1HYSD 5HYJE 2WN2A 2C9PA 4GMTH 5KJ4A 1OCOB 1ITBB 2CDGB 3TN0A 1M6UA 1K4DA 4PRIB 4KHXL 5JW4R 2RFXA 1MJJA 4Q6IB 2IWEA 1EDQA 5SWQB 2I7OA 3U2JA 2IGFL 5JIKA 2DQFB 5CFAA 1MCNA 3L7EA 3VMOA 2FSDA 3FCTB 4I13B 2YEVB 5EBMB 3HC3H 3KDMB 2EEBA 3L13A 4PBWD 5E8PB 3QDHA 2NR6A 3U7YL 3NCJL 2TRYA 3W2DL 4DF9A 1J0ZA 3VFNB 2VLME 3PWPA 3VFRA 1J8HD 5J6HB 2MMXA 5B38B 5EA0L 4YUEL 5IJCC 5E7FA 5LBSL 3SCMB 3D05A 2EKSA 2HT3C 5DO2C 2IOIA 4JG0L 4XBEH 4NPYA 4P46B 3HB3D 3M17A 5C0DB 4NN6C 2EH7H 2OZ4L 4TLSA 4U33A 4WY7H 2GSIA 4LLWA 3BEWA 3LTVA 4P2RE 1BPVA 3VFGH 3KCWA 3ISRA 1J0HA 4PAZA 1TPXB 4TUOA 4XMLL 5IMMA 4WHTB 3DI3B 1Q90A 4U1JA 3C75A 3UZEC 2EVIA 2P8MB 5GGVL 4LIQE 2X05A 1NFIA 2DTMH 3K6DA 1OW0A 2EDEA 2OMYB 3BAKA 3DTUB 4NM4L 2CUMA 5EO9A 1ZLEA 2CHXA 2DD8L 3DJRA 5EULV 1FPTH 5DJYB 3NPZB 2OYPA 3SD5A 2EXSA 2ORBH 2AGJL 3KG5A 3Q48A 5AD0B 3TLRA 2CKBL 5FAAA 3SBQA 3BRGC 1Z5HA 1LDPL 1H6EA 1D9KD 2ZWZA 3GBMH 4Y1AB 4FS0A 1CLZH 3L3JA 4FQCL 4OGAC 5CO1A 4AC2A 1M7IA 5DZJA 1KTLA 2QLVB 4IKIA 3X3GH 4F9LA 5I75B 5AB2A 1YDPA 4Y89A 1X5GA 5C0FA 3VXUA 32C2B 5D5ME 2YS4A 4BQ6A 1ZLUK 2CCLA 1QA9B 3OKNA 3UTPE 4GH7B 2ED7A 5CJ5A 3WELA 1GGBH 3BGFB 3OAZK 3BSHA 4ZS6C 5HD8C 4D8PA 3AWGA 1L9QA 3CXHJ 1MWAA 2CO4A 4DWHA 1E9PB 3MO1B 4JG1H 2VXTH 2XQYA 1Q38A 2OMXA 2Z64C 4JB9L 4PW9A 5GSRB 3WMPA 2P5EA 1HKLL 4UOQA 3RIFF 4M03A 1CFTB 3UJIL 4CW1A 4NFCA 2AJYH 2F58H 4FFWC 4RGNE 4AJVA 4XHJD 4BQBA 2BERA 2BRQA 2O6CA 3CVHB 5AKSA 4JJOA 4FCAA 2XA3A 2CAKA 5DVMA 5JLZA 4JVPA 3TS8A 4RGMB 4WK4B 3T0EB 5AAPA 3ARXA 2JJTC 2BOBA 1ZIAA 2B1AL 3DROA 4OJAA 3S3PA 4I8DA 4NQQA 2ITCB 1RFDH 4IMKA 2Q6WA 3T6WA 3ARTA 2Q6WB 3IE4A 3NP3A 5AVXB 1NCCH 4YDVB 4HU8A 1R3JB 3FO9B 1AQKL 3DRTB 4QKXB 4EXPX 1E67A 3VACA 4FG2A 4XC1L 1L3NA 1QPKA 1QSFD 4HQQH 2JKLA 3IB4A 4YDIH 2E76C 3GTNA 4UI2A 1W0WB 5LGJB 5I71B 4YHOL 3ZL4H 1NAMB 1Y18B 4B9IA 4AQ8C 1OZTG 4LEBA 1JN6A 4JFVA 1EQWA 1XEUA 4XNBA 2BIIA 1AGCB 2BSRB 3CLEL 1BFVH 3MO1A 2W07B 2CWRA 2WBXA 5DK0A 1TNNA 1TUPA 1OP9A 1NTDA 1QQDB 1XIWB 4HIIA 3QIUA 5FHAL 2BNUB 4NRXA 5DK2A 4LASL 2IOOA 4H8UA 4N2AA 3MHZA 1KCVH 1LWJA 5DYFA 4PTTB 3MCKA 4FQLH 2ZCHH 4F37F 4WEMB 3BXNA 3AM8C 1JZEA 1JPGB 4HD9A 4K7PX 4KQ3L 2A6IA 3MNZB 1M1SA 3CZUB 5IWLC 5AYTA 3DECA 4KQ4L 1DN0B 3F04A 3DX0A 5LWYL 1TZHA 3BPOB 4HFUH 5DJAA 2L7UA 1MCPL 5JW4Q 1S78D 2WXNA 3VGFA 1G1YA 4XBGB 1J5OH 4JFQB 2F74B 1QR1B 1I1YB 2EXTA 2WQXA 2B2XH 2H3XC 1RUPH 4PMFA 1HS6A 2GJZA 1KYAA 1KTDB 3WO3B 4ODVL 4X6EB 2WYHA 1YPZF 2G5UA 1DVFC 2F54D 4PJEA 3CHRA 3FB7A 3OL2A 1PX8A 5FLUA 1PEZA 1TR7A 4UBDD 4X6DA 3T9WA 4Z7WB 2WQSA 5B4MD 2Y1ZA 3S2AA 5E9NA 4P49A 4DGVL 3EH2A 2YAQA 1SLWA 1NMBH 4N8CL 4XPTL 1A02N 4MNGE 2HRGA 4RBPK 1MCEA 4P46A 1DUYB 1JL8A 4LPYA 2YBRB 1YPZA 2DQGL 2Z3FA 3ESNA 1S7UB 4NZFA 3I3EA 4OGXH 5K59E 3J27A 2CJ3A 5DD6B 2WLLA 1L6PA 4KK6C 4L05A 1CG9B 1CR9L 3THML 1E3XA 3CXDL 3L9YA 4AUUA 4AVJA 5D7KD 3U6XS 4O2CB 4R97C 3GB7A 2AQTA 2FL5B 2AV7A 5SWQA 3ZHNA 4F9LC 2H9GB 2F19H 4CVZB 2M2DA 3BQUB 3MV01 4FE9A 3IMVA 3B37A 3WNNA 1MPAH 5FUCE 3GSOA 2WP3O 4NBXB 1GGCL 5C07A 4RDQF 3BW9B 1MCQA 3PWJA 3B5HA 5E8NB 4NKIH 2BZCA 1I85C 1YMHB 1AZCA 4KXAA 4MXVF 3UTOA 2G2PA 4P2YA 2IQAA 4FQXC 1IEAB 1U95B 2F1AA 1P2CB 2P5WE 3HUJB 3E7JA 3D3VE 4O4YL 4U6HA 1X4ZA 3OHXA 1FVCB 2UZXA 3O4LA 5GZOD 4OJFL 2GK0A 2D73A 3FTSA 2CR6A 1KFAH 3KPLA 2FJHA 1VEPA 3H0TA 2BWIA 1GGTA 3Q6GH 3IDYC 2YMOA 3UO8B 1GSKA 4PY7B 1QNZH 2ICWA 3ZW3A 3MUGA 2N7BA 3NVQA 4X7DC 1UADC 2O26U 5CBEA 4BIKA 4KROD 1MFUA 2YK1H 5JW4N 1T2QH 5AQ0A 2E0PA 2Z93B 3NSCA 4FQJL 3IDXH 2YEZA 1QABA 3QCTH 2EE0A 5DEFA 2PLTA 1OCZB 3KNBA 3R18A 4WWOA 1TQBC 1RJYA 4I18B 4A6YL 3IKCB 2GJ6E 7FABL 1NFAA 2P5ED 4HC1A 4IRSB 2C1OA 4TPRL 3GBNL 3TT1L 5HYSG 3MNWB 4C58B 4Z7WF 1BQHB 3DUHA 5KS9E 2DQEL 5JPNB 1U92B 1BM3H 3K7UA 4G80B 4H26A 3TC9A 5GGQL 3SKOA 1V3JA 3V4VA 2B1OA 2E7BA 4FA8A 3ZDYF 4KROB 1YAZA 4FTVB 4KKPA 1B88A 5IFJB 2VRKA 5I6MA 2NY6D 1L5GB 4I3GA 5C7XL 1QHQA 3VXRB 4OJDH 4UINL 3U0PB 3DURA 4BKSC 3WNIA 3VXMD 4Q9RL 1ZEAL 3EYQD 4PJHF 1Y6NR 4PRAA 2EDJA 4XWGH 4Y19A 3APMA 4F91B 1QOKA 1TCRB 4FNSA 4S0SD 4X8JB 3ATBA 3VWJB 5F7UA 1ZGLM 3QFGA 1QFWI 2VZOA 3A4AA 4YQXL 5DUML 2ROYA 1M05A 3GIZH 5EOCJ 2RH0A 5IROA 4QRPD 1ASQA 1QFHA 4PJGB 1I8UA 1JNLH 3NJFA 3X12A 2Y72A 1NMBL 4XPTH 4Z7UE 4F20A 4Z7UA 3SDAB 3SE3A 5B39B 1EAPA 4KK8C 2ZSVA 4M93C 3ZTJG 5DJ2A 3NSXA 2VDKH 3S3SA 2BP0B 1P5UA 1P1ZB 4PG2A 1FVEA 4Z0XA 3MPCA 3MXVH 4E0RB 2H6OA 3FFCB 2ISDA 1CR9H 1CICC 1WS8A 4LSPH 4AH2A 4XNUH 3MFFA 2IFGA 3L4YA 4XXWC 3E6HA 3UMNA 3NIFE 2A2QT 4XXCC 3IFPA 1SXZA 3GSVA 5DEJA 4NRZB 3HZYB 4YX2H 5DDHB 4ZOEA 2XN0A 2AANA 2P8MA 4BQCA 1QAWA 4FQXA 5PCYA 2O72A 5LUMA 5D7LB 5EU3A 3L5IA 4UAOB 5IB1A 1FFTB 4DH2A 5ADOH 2Y4SA 4NENA 1MCFA 3ES6A 1JGLL 3GMMB 4OZGB 2BSSA 4HOMA 3VI4B 5I16A 4LSSH 4L3EE 3ULVC 1R24B 5EO0B 3EYOA 4MZRA 3OSVA 1RVFH 4D0DB 3EO1A 2AXJA 5INDA 2BJML 2P4AB 3VG9B 4B9CA 3BKJH 3GTTA 1ZVSA 4BDVA 3MJ8A 2FO8A 3G5ZB 4LK4A 5TPWL 4PJXA 3QNYA 1C5DA 4JN1L 2M83A 3DX9A 4KJYB 1MRDL 1WYJA 4PMEA 3KGUA 3IFNH 4A2DA 4HS3A 2BMKA 3UC2A 4HZLB 3OQRA 5FYKH 4AENA 5F88A 1CGXA 2QVMA 3HAEH 4X6FA 4YWGL 2MCPH 5EOQH 1GSMA 3I3BA 5GS2H 1YMME 3LVEA 1TLMA 2ZOLA 1PIGA 3HRZB 4I9WE 2B59B 2VERA 3RL2B 1M2OA 4FLSA 1MNNA 1J9QA 3CSGA 4P2CG 4PWHA 4F7KA 3EF4A 3PGDB 5IQ7H 2KC0A 1MCOH 4RX4D 5I5IA 2BINA 5FKAA 2D4DA 4JPVL 2HWZH 4H25B 2VE6B 3BISA 4DPCX 2H7WA 2QV4A 4XCNA 3RVTC 4XCCH 4Y2LA 4ALAH 1ZA6A 2VLLA 2LVCA 1GJUA 5AYUL 3Q2LA 3S5LA 5IT2L 5JDJA 4KXZH 2YRZA 5MEQA 2G4GA 3UBXB 1YEHL 4LSQL 2AJ3A 4F2MB 2G5BB 1GTNA 3VXSA 4X83A 1TEFA 2ICES 3BAEH 3D6GA 1MQKH 5JNYB 1NLDH 3LKSB 3QB7C 3ETBJ 2D7QA 3US0A 2HKHH 3OVUB 5IQNA 4CKQA 2BDNL 2GY7B 4PN6A 1H8LA 5EORH 5A2JH 4Y2DB 4ZZKA 2JSFA 1OAKH 4KNSA 5H8DA 3OZKA 3I6GA 3NH7H 5FC9A 2DIBA 4XTRD 5H4ZA 4JDTL 3RGHA 1NEZG 3NFSL 3UPRA 3UROR 3FO2B 3ZT7A 4JKLA 3VI4A 2SODB 3UERA 4HWEL 1ZMYA 3OKDA 3BLBA 5FW8A 2WZ0A 1MKFA 4KOCA 5DZOA 4I1NB 1WITA 3ORJA 4M9OA 4IU2A 4ZPTB 5F8RC 1ZLWK 4JO1L 1F2XK 4HGMA 5MP6H 4G9FB 4RWYH 4B9GA 1XBDA 4G8EB 3E1F1 1ZTXH 5ACZA 5FX3A 1L9MA 4XXWA 5AL8A 2XG5A 1A3ZA 5C8JA 4XPHH 3CWGA 2HZHA 3P4MA 3EADA 3VFMB 4JJHA 5D71H 4RLDA 5A2CA 3H2QA 5I1IH 4NC1E 3CQQA 2H3KA 3F7YA 4R8WL 4GAGL 3S36L 5HSFA 5LCVA 3ECUA 4Z76B 4U3CA 3V0WH 3VWKB 1PD1A 3QQNA 1T89C 1MZZA 2CPUA 3O4LE 3UABA 5IREA 4WTXA 3ARYA 1UOKA 3H54A 2F7QA 3BUPA 3S4SB 3SE3C 3LAFA 4FERA 5MHSD 1KIRA 4KUZL 4KRLB 1GJWA 4ZXBB 5I2IA 1FDLH 4UT6H 3WGVB 1DQDH 3DXAA 3KYNB 4K7FB 4H8HA 4L4JA 4NUJB 5FKPB 2P43B 3IJYA 3EOYG 3IXAA 4OFYA 4ZMAT 2A9DA 1CE1H 1AAJA 1NGXA 3F83A 4NQVA 1H3GA 3QUYD 4AQ1B 4PW3A 3C87A 4R6UA 1U9KA 2BVOA 1T66C 4PCKA 3VCLB 1E6JH 1CFQA 1YC7A 4PRAB 1UZ8A 2AQSA 4HG4J 5G5DA 1AXTL 3DX9B 4Y9GA 3WHE0 5GGSB 1C5DB 2QSCL 2R9HC 1RSYA 5EDXA 5D7JA 1Y0LB 1THCA 4AGLA 3HKZA 3BFOA 4N8PA 1UHVA 3DBSA 3TNMB 3D18B 3E8UL 5E6ID 3GSXA 3LZFH 3B7SA 3L16A 4DKFL 2EDDA 2VM3A 1AKJA 1RK0A 3VFUA 4LZKA 1KLGA 1QYGH 1IFHH 1U93B 4QHKI 4FHKA 4ZUVB 4YZFE 3U83A 3V8CA 1J8SA 4N0UA 3X17A 1CURA 4N2CA 2R4RL 4DP9X 4OCSH 3BWUC 2E4FA 1ULVA 2X87A 5SV3A 2GJJA 5KBMA 1S7WA 4LPXA 4ERSH 3FCSA 4JFHE 3TYFA 4QT5A 5CWSB 4IRJD 4JN2A 4NPJA 2Z93A 5AYUH 1FQ9C 3H9SB 5FM5M 3SOTA 3G6JB 1Z0NA 4XPFH 1WICA 1S3RA 3H85A 4JZOA 4N86A 5KSAD 5K9JL 2ZXDA 1XCQB 1TZ8A 1SFHA 4A2HA 1OAQL 1KLFB 4HUMB 4JAMB 4HT1L 1IT9H 4Z7NB 5F9JB 1S5HA 1LO4L 1UGKA 4FNLH 3L4ZA 4YK4C 5FO8A 4F58H 3V5DA 3AREC 4BRJA 3LY6A 4XO3A 3LQZB 3BT2L 3SY0A 5ICYB 2Q9OA 3HR5B 1F4XL 1Z1WA 4HVBA 4NI6A 1EJOL 1BOGA 3MROB 3WJJC 1C5CL 4GQRA 2W0KA 2XWXA 5CZXC 4OT1L 3CDYA 4PRID 4TS6A 5TFSH 4Z3EA 3GPSA 3KGRA 3GWJA 4HX1A 2AKRB 3QXUA 5GGTL 4ZDHB 2BP5M 2AHIA 3BZEB 1TCMA 1BF2A 2CIIA 3MXWL 3O9WB 3TONA 1RUQL 1DBJL 3B2UC 3CFQA 4Y19B 3WJJA 4U6TA 1IBGH 2NY6C 1MAML 1AHWB 4FFYA 3WEMA 2OQJA 3N50A 3STZB 3F6JA 4XP6H 3SCMD 2K7PA 3TYGL 4O2EA 5B4MC 5E08L 4G11A 2XVKA 3SGDI 4IBSA 3Q5TA 1ZKAA 1RZKH 4GRWF 2O5ZL 3BUDA 5A7BA 4OCMC 3CFDA 3RKDC 1TQCC 3OR7B 3SGEI 4TSCL 1V8HA 3UAJC 5I15L 2DLHA 5EO0A 3S5YA 2FVNA 2B2XL 5FM8A 1NLBH 5D7EA 4NO3B 3IKCA 1I1CA 2DAVA 4BZ2A 5IB1B 4PTUA 4RMQA 5F96H 3LKOB 1XF2B 1E50A 2C8NA 5I23A 3PPEA 1MI5B 1RCYA 4QTFA 3BE1L 2VSCA 3QUMB 4L2LA 3FTGB 2HJLA 2YGVA 4R7DB 4K8RL 2YXFA 3BFQG 1ZLWH 5BQ7A 4XX1E 3L2LA 4OAWA 1EBPA 4WSKA 2UY6A 4YSQA 2F54B 5D55A 5KVDH 3MA7A 3GSNA 5I74C 2YKLH 1UEMA 2OMWA 1YEFL 4FFVC 1IM3D 2XTJE 2Y69B 5KVFE 1QTPA 2WYIA 1DBAL 4Q9QH 1CF8H 4KNUA 5ABZA 3C9NA 2AITA 4FYRA 4LBEA 4ELDA 5HYSB 4F33B 5DLML 1HXYB 5KWYC 4JM4L 2UZIL 4U6XA 2JCCE 2IJ0C 3EJQA 1DQTA 3X12B 1FFOA 3FQWA 3RJDA 1JGDA 2EH8H 2W1NA 1BMZA 4YBHA 3CZEA 3LJ3A 4HIXH 1ZJBA 2NUPA 2BNUA 4NRXB 4JFTA 5LQBL 3TOPA 1WLHA 3H9HA 5JR1L 2XZCL 1QUNB 3OC5A 1QUPA 1NBYA 4V33A 3HZ3A 4P48A 5HYQB 2XBDA 5AVYB 4KTDH 2W94A 2E3VA 3IGFA 2AJXL 2AV7B 3G9AB 3PDDA 3TL5A 3B6SA 4E9WA 1MFEH 2C3GA 4J28A 3BH8A 4NKOA 4KRPC 5K1JA 3VFTA 2LLNA 3WS6C 1HU8A 1Q72L 4Q6IC 2OP4H 2BVQB 3QG6A 2E56A 3EO9H 3VI3B 4IRZA 1PBYA 1NJ9B 4YHYC 1JZGA 1UA7A 1PAMA 2F08A 2WOBA 2A73B 3QORC 4UIMA 4PRPA 3MNVB 5AW8B 3FO9A 5CNHA 2AQQA 2P45B 4J4PD 2K8MA 1DQLH 3NIFB 4XX5A 4JFDE 5DMIL 5DHYA 1CQYA 2XYCA 3S7GA 1ZDQA 2YK1L 3E0GA 4IGBD 1C16A 4LHUG 5BRZB 4Z7WA 1TQUA 4L37A 4E9VA 2XKUA 2XZAL 4RZKA 4ZOAA 1JV5B 4NLHA 1JZHA 3WNPA 4JKPH 2G3NA 3ML8A 3QIWA 2HJFA 3QDGA 2ALWA 3NUKA 3UTSE 5IR1B 3UTQA 3PS6A 3WIIH 5BOJA 1AKJD 1S8DA 1DFBH 2F53B 3R4RA 4XPAH 2KUTA 4ZSOA 4FGMA 5KN5B 1C8PA 5IOPB 4U6YA 1DUZB 5GPRA 2Q2EB 3KWWB 3NEXA 5GGQH 2YD8A 5IKCB 1TJGH 4UDTB 3KLAB 3U4BL 4I0CC 5TF0A 3CSBA 3FTUA 2F7PA 1L7IH 2OK0H 4YHPB 1JXJA 4YSDA 3U4EB 5L2KA 4GSUA 3ROOB 3QIBC 2GB2A 3EGSB 1DQML 1I3RB 1MFBH 1V7ML 4ZW3A 3PXHA 5KSUB 1F56A 5EOTB 2ZF8A 4P5SA 4Y88A 3B9KB 1UOVA 3HUJE 1E43A 3CH8A 3EBHA 5GRWA 4JVWA 2OZ4A 1ZHLA 4OSUH 3KWUA 4D9LL 1BAFH 3OZ9H 4Z0BH 4Q7DA 3SBWA 3GJEA 4BZ1L 1LEKB 2VZVA 1A3QA 5CJOL 2FL5A 4Y5XC 3BIKA 4HULB 1T22B 3ZTNH 4HIHA 2QL1A 5JIQA 3IMRA 3OAZH 4MNGA 4KTYA 1SM3H 4JW3A 3KPPB 4DP7X 3U0WL 5HDWA 5KS9A 2VO5A 2P5PA 2VDKL 3D2UA 3L1GA 4NNPL 3OAUH 3HLAB 1BWMA 4FLQA 4JFFB 1RHFA 4U1KA 3U1SH 1LP9B 1TQVA 3DIVA 1NEZB 5EN2A 5C07D 3W56A 5C09D 4RGMC 3AS2A 4TSBL 2BNRA 2GJ6B 1KCUH 2D7MA 3X3GL 3BWAB 4PFEA 5DEGA 5HDBE 2W60B 2DRUA 3KVPA 4NPYB 4OY9A 1MW1A 1UM6H 1JGEA 5IMLB 2R83A 2VMJA 5E1GA 1TQTA 4GUPA 4QEGA 5CCHE 1OT1A 4O58H 3L3HA 4NN7B 1WGVA 2ZXWB 5BJTB 5JR1H 3ZRFC 4V1DD 5DQJA 5I1HL 3GQFA 2X2HA 3IN2A 5AOLA 3NBNA 3KLLA 3FH5A 2XQYG 1S7TB 1CFSB 1YY9D 5IM7A 1R17A 2CLZB 2DMCA 4W4NA 2NY0D 1OAZH 2AQNA 4MB1A 4UT9L 1MVFA 3N41B 4A7GA 5CGMA 4ANVA 4Z3HA 3E9TA 1I1AA 1QLEH 3GHBH 2ZWYA 2X70B 4CU8A 1OHQA 2CK0L 3FOMB 3OKNB 3Q8FA 1RXLA 2HUEA 3I74A 4EN3C 32C2A 3KLDA 2X7LB 4YZFF 3T71A 4DZBA 2VW7A 2A74C 3CFTA 3U9PL 3CV5A 3O4LD 4QY8A 1SHWA 5GRUL 1ZGLA 3ZT6A 3K8LA 3SQBA 3UAJA 4DPRA 1ND0A 2QHRH 4JRFA 1INEH 4WI6A 5GS0D 1SLVA 1YMMA 4KAQH 5FDWB 3SPJA 4EUPB 2YEQA 4GOSA 3HE7A 3CFEA 5E4EC 4OB5H 2CRMA 3GSNB 3NOIA 3SDAD 3TBWA 4WJ5B 5ANMB 5DJYA 5FA3B 1Q8MA 3NRFA 5EH1A 3FJTA 3MAWA 1ORQB 2GITB 1JZ6A 2OJEB 4XTRC 4UTAA 3QUKA 3V0DA 2B39A 1CC3A 4MJ4A 2ZTBA 2GSGA 1RUAL 5IMLA 4TNVK 1QKZL 4JDZA 4KZ0A 4NO3A 3UTTB 3K4AA 2G5RA 5LN4A 3VO0A 2FSEB 3SYAA 5T1DL 4WWNA 5DR5H 4EDWH 1MQKL 4RMWA 4BFFA 2WPGA 3EJUA 1CXKA 3FQXB 2BIMA 4UQIM 5EEWA 1E4WL 2QLYA 4H8WH 1MREL 5IGXH 5B1AB 1RZ8A 1N26A 4G5AA 4W6XB 5HDOA 4TTGA 2IXQB 3MTRA 1DLFL 1IJNA 4YSEA 3EYSH 3EJYD 4FQ2L 2J4WH 2RB8A 3QWRA 1NSNL 1A7RH 3FT3A 5JDSA 2BS71 5L88H 1QVOA 4GRMA 4YBLC 5E9DD 4K3EH 3QUXD 3O11B 1JRHH 2OMXB 2WWKO 1DBML 4FZEL 5EN3A 5GSRA 3SDXE 2EDRA 1ZVYA 1MLCB 1L7TL 4E5XG 1EAQA 3TIEA 5D4HA 4LU5L 5DT1L 2EVFA 3V8OA 1HWWA 3GKWH 3FUKA 2KL6A 3GHPA 3QQ4A 5C08A 5DJCB 3QULB 4AKQA 4PS4L 5LKNA 4FULA 2YPKB 4CMHC 1O6VA 5HI3C 1JG9A 5DD1L 2ZWKA 4DKAA 4J8RA 2V4LA 4PBXA 2PNDA 2DJSA 4KGJA 5GJSH 4PJFB 4LLDA 3TEXA 5AVVB 3K0YA 3FU7A 5I6XC 1T2XA 3NABL 4UU9B 2KS0A 1NIAA 2G3XA 4JZOB 1EMTL 3W38A 2XWEA 4OQTA 1S8DB 4LNVA 1J11A 1ACZA 3STBA 1H5BA 4PGDA 3ZKXC 3IDNB 1JZ5A 4FF9A 3L4CA 5HY9B 2PW1B 1MCRA 4QXGL 3CDZA 4G72B 4R83A 4OFPA 3LZLA 1MUJA 4WU7A 3CNKA 2PYEA 1GKOA 3PWVB 4ZUVA 3RUGE 3OGCB 3ULUC 1M42A 2NX5E 3M1CA 1T1XA 1YQVL 3RNQA 1RIHL 4BFJA 5ALCL 5D7IF 1OCCB 4Z7QB 5GGTA 3N43B 4NT6A 1G6VK 4UIMB 4LHQB 3FT2A 1QW9A 4W9ZA 3IFOA 2FATL 3HI6L 3KMDA 5I76A 1A65A 4G7RB 4FG6C 4I77L 1T20B 4DEWA 3HE6A 3GMRB 1MQ8A 5IW6B 1J0IA 2IH8A 1WHPA 2JELH 1HEJC 5HGHA 3FQXA 3NZSA 2TSBA 4DP6X 4LCYB 2MCMA 4FI6A 1PY4A 1CB4A 2MQGA 1A64A 4Q97A 4AGPA 4DFHA 4JDZB 3NZ8B 2V9TA 2W9DL 5C6PB 4YSOA 5DJ6A 2JK5A 1OGAA 3OHXC 4ODXA 5EF0A 5DMYA 3AGWA 1I7RA 3IDXL 3DGDA 1SDDA 4HWBL 3QUXB 4TVUA 4Y4FA 4QOKB 5FCUH 4N2OA 3IVKB 1TJHL 4L1SA 1YC8A 4MJ5B 2ID5A 3FB8A 4JG9A 2FX7L 5T1KA 4WAFA 2C3HA 2JB5H 1I82A 3NRQA 2I9TA 4PGCB 3U25A 5I75C 4OUUB 4QR7A 3NCEB 2YWYA 4LP8A 2AV1B 4P4KB 2QGEA 2ZUXA 5TK2A 5GS1B 4F92B 2AXFB 2DKMA 2AQ3A 3CFKA 4M93B 1NCNA 1HHGB 4HJJH 4I3SL 4EBQH 4LEEA 5ITBH 3WKMH 3GZKA 5EZOL 1EJOH 3GZPA 1OAUH 3FU5A 3HG1E 5IHLB 2JTYA 3W39A 4LHUA 1OTTD 4QHUA 4OCWH 5TDNA 1QEWA 3MTXA 2C4FT 3N5AA 4ZUSA 3QUYB 4LLYA 3SKJH 1CU4H 4XCFL 3MRHB 2Y7QA 1QX1A 1FL5A 2B4CC 5MEND 4X5PA 4YDKH 1JNHB 4FG6D 1BVKA 3PV6B 4CAGA 4WSJA 2AK4D 2P5WB 1UURA 3BKYL 1A6WH 4JANA 4AVHA 3ZUNC 1OP3K 3KWTA 2P80D 5DVLA 2WXGA 1G7LA 4GG8B 3MV9A 3CAFA 2OMTB 2R1WA 4UAOC 4MJIA 2F53E 3V4PL 4TN9A 3HC4H 2NY7L 1T03H 4AG4L 4DW2L 3TEWA 3MMEB 5CHNA 5HYEA 2PXYC 3IJSB 3T0EC 4APQC 1ZXQA 1DEEA 3QWNA 1AGFA 3PP3K 3FONB 4GKSB 4XVSL 3OJMB 1LO3L 4U6VH 3C8DA 5IVZB 4GUPB 3R1GH 1M6OA 4RETB 3WAJA 4PRPE 1BGXL 1DVFD 2X6UA 3MCLL 4NT6B 2OBGA 2W92A 4FLRA 3K80A 4FX5A 5MENA 3OJDB 5LAXB 3TU6A 1XXDC 1NLBL 1E5YA 1IAOA 1KSRA 5EU7C 4XNAA 4TXVB 4R7LA 1NEZA 3EIFA 1N2RB 3AU1A 1MFMA 4WDIB 1YNTF 4TRPL 5DUPH 4GSRA 4AYSA 5AW0B 4ZX3A 1P5VA 3NJNA 1ED3B 5HHME 3OMNB 5DVOA 4H25A 4N5UA 4PV9B 4E2OA 1SY6L 1F18A 1XR8B 4EO5A 1M71B 2GCYB 3BN3B 4PB9L 3D4GA 1YJDL 1JYVA 4NO0A 2BPBA 4OZ4B 2WNXA 4KUCD 5FYJD 4ZUUB 3ZKNC 3U6RA 2BSEA 1RZKC 3F7VA 2BH0A 3QO0A 2EKJA 3BP7B 5IFHL 2UZIH 4J4PA 5F9WB 2FBJL 5FK9A 1AR1B 1KB3A 4KRPB 1I9JH 1XMEB 3IE9A 4HPYL 3UZVA 2IDCA 2ADIA 1SUJA 1FFRA 2EIKB 2ZUVA 3KYMA 4JO2H 4KY2A 2HT3D 4RAHA 4A7GF 2FD6L 3RGVB 3RFZC 5ANME 3HB3C 1NFDB 3QORB 3WTYA 2R1YB 1E8ZA 2W9DH 2AAVA 3D07A 4KTDL 3QZLA 3GUFA 3LHAA 4JFWA 4G82A 4HFWA 3H2WA 3S34L 4Y0GA 2JQAA 4QRPE 4OM0L 4D0BB 1KJMB 3S37L 3VYNA 1Y6MR 2YQ2A 1G9HA 2JI1A 3D18A 3GMOA 3DI2B 5E0QA 2DLFL 4Y9EA 2UXGA 2DZEA 4LCVA 1FN4A 1T5WB 5F21B 5J9PA 2LFEA 4Y5VB 1P7KA 1DZBA 3K1KC 2V9QA 3CZKA 3H9YA 1OTUC 1LD9A 1IB5A 3ABGA 2XVGA 3QAQA 3VCLA 4C4UA 3E3QE 4HF5L 4JGMA 5DZAA 2J5LB 2WZ6A 4JKPL 1OP3H 3VWKC 3AGVA 1MCIA 2HKHL 1TZOA 3NIDF 4P2QE 1HDMB 4WV1C 4AK2A 5I28A 4FABL 5IZ7A 1FC2D 4Z7UB 3VI3F 2GTZB 1OANA 3FSAA 1NDGA 5EUKA 3HG4A 3WLWC 5B7FA 3UO1L 1KIRB 4R0LC 4WJ5A 1KJ2B 5DRNB 1FZOB 4NO0D 5GRZA 4GRLD 3GXPA 2WQAA 2CZNA 3HCVB 5D7SH 2G75B 4GI9A 2CU9A 2GVYA 1LMKA 3IMUA 4EUPA 3EOAA 1UT1A 2ESVB 2FH8A 2OK0L 3HZMB 1IM9D 4WO4D 1GY2A 3EXLA 3AAZA 5JIMA 1ZGLB 2DH3A 3K6OA 4M43H 5T3XE 3OX8B 3UG5A 4DGIH 5FYLD 3N9GL 3VXRA 1W72A 2LGNA 2DQIL 2GJPA 2IAMB 1X5FA 3D25A 5KSAA 1G84A 4NQUA 2W95A 1U6AH 4B0MM 2KPWA 2IPKB 4CNIB 4X6BA 4WI7A 4UZSA 2EC8A 1HVXA 3OKDB 4HCGA 3BIAX 3VGHA 4AQAA 2NNRA 4YS4A 4FQHA 3ARBD 4RMRA 4F7MB 4W9FC 3UPRB 2RJMA 2FT6A 2CO7B 2QTVA 3KGTA 5C0RH 1A1MA 4OVVA 4JDVA 4QJ4B 5ACLA 2WGNB 9CGTA 1YYCA 3QIWC 3NZHH 2A9CA 2Z8SA 2ERJB 3DX1A 4HJUA 5BJTA 2OV0A 3QZNA 4GO6B 2DYPB 2J88H 1KCSH 2DQDH 2HVJA 4IOIB 3HMWL 5A2AA 4IOIA 5EU7E 4C83A 1CE1L 2FR4B 4EI5C 5A40E 1TYJA 3TV3L 5J06A 4G1MB 3TN0D 2JKIS 1CO1A 4CILA 4NWTH 2YOCA 3BQUD 2WVVA 3B34A 5JPNC 2ITEA 3UBXA 1SNRA 4ATTA 3MJGX 3IPBA 3JWNE 4N5ED 4PJ9C 4PJEE 4WW2C 1D6VL 4JFFD 3WFBH 1WIUA 3LN4B 1VGKA 4HSAC 2IPKA 3HNTL 4J1UA 4JHVA 3HUJA 3FN0L 4UIKH 2WBJB 2AQRA 4I87A 1LO5B 3MGAA 4DQOH 2J8HA 3BZ4B 1N4XH 3FB6B 4EN2A 4WW2A 2VDOB 3C5ZB 3MYJB 4HGWA 2NX5D 3TJEH 3V4PA 5F7DA 2R2BA 4W1TA 3POHA 3ZL1A 4DIXA 5EF1A 1KULA 4ZMNA 4NFDA 4JUSA 1WUZA 4L8CA 5I73C 2EILB 3HZMA 3LB6D 2LOEA 3QHFL 4F2ME 4W9IC 1HZHH 1UWXK 4ABQA 3R8BB 5KVEH 3QHZH 1WZ1H 4YXKH 2JWYA 4PP2A 1A3LH 1ZOXA 3NFPA 3ARBC 5AZEL 4BZ1A 4DAGH 1EJ6A 1YMMD 4IOFD 1PG7H 4W9DC 1DVYA 4L1TA 2HPOA 4X4YA 1DVSA 1MJUH 4KZEH 2GTZA 3K5RA 4L48A 1R3LB 5C07E 3SHSA 5A16A 5F3BA 5D2NC 1WAEA 3P4LA 4D0DA 3QJHA 1H3WM 2CNZA 3MJ9L 4ZK8A 3LXBA 4JAMA 5TDOA 1MRDH 2EEFA 2VERN 3ARWA 4KDTC 4ZUTB 3PJSA 3U7AA 5GRXG 3QDMA 2YJLA 1X5IA 1RK1A 2R51A 3D85A 5DK3A 4M5YL 4EVNA 1U58A 3O0RL 5IR1A 2OSWA 1FN4B 1T5WA 2F18A 2IQ9L 3KXFE 1NGWB 2D8KA 1JOIA 1F4YH 5SX4H 4JY5H 3UYPB 1K2DB 4U1IA 1EHNA 5EC1B 4BKLA 4OZIE 5CEZE 2NY5H 4LNRB 1CFNA 5DGQA 4K5LA 3AW5A 4YJZL 3PWLA 5SWSD 2F74A 2XUWA 1QR1A 3QZWG 2NY4C 3ILDA 2J8OA 4WTZA 3MBED 3L95A 4PRPB 2QADB 4PLOB 5D1ZB 4Y5YA 5DZNA 3VXRE 2XOTA 3TESA 2DWEB 4ZYKB 4HEME 4M5ZH 4FQ2H 5B39A 4OFVA 4HK0B 4IBYA 4XMLH 1JGIA 1FORL 3QZBA 4X4YB 1H5BC 3IMSA 3MCKB 4OFDA 5JHDD 4XBPB 4ZO6A 1EUTA 3H1ZA 4CMHB 2C7UB 2JV6A 5KYNA 1J9TA 1Q1JH 1KBBA 4KZCA 2MNWA 2KMWA 4HCFA 4FP8H 3ZHFA 3ILQC 1FSKB 5GZNC 1NL0H 4DP0X 2BHUA 4MQ7A 4QGTA 3NFSH 4RRPM 5F8QC 4EI0A 5EB9A 5D1ZD 1U3NA 1ZHNB 2IADA 1Z0MA 3TV3H 1FFPA 3P9MA 4FQCH 4UT7L 1AGEB 3SGJC 3OXRB 1Z5LB 4P5RA 4RNRA 4E9XA 3GSWA 2J21A 4F2FA 3T3MB 3JXAA 3BOVA 5LXGH 4KKBC 3P2TA 5IFAH 1OARH 2VW6A 2DWEA 4ZYKA 2JNZA 3Q0HA 4TMPA 2CUAA 5HYSA 2JI3A 4R96B 1HOCA 1R3JA 4WENB 3NABH 1T4KA 2YAOA 1Z9NA 3KPSE 3TF7C 4PJIE 1ZRUA 2HN7B 5DHMC 3ULSA 2K8QA 4J3OD 4OKVA 5G4MA 2LU5A 1U0QA 5EUOA 5FYJU 4F9PC 2DWDA 3F7YB 1G0XA 3DX3A 1OK0A 3GRWA 3LS5H 1NUGA 4IBTA 2XFGB 3AXLA 1X5HA 4QRPA 2AK4E 1NM9A 3V7AE 2OZNA 4BK5C 4PGEA 3L3OC 5B38G 1JHKL 5LG6A 4OZGE 1P4IH 4B0MB 2CD0A 1BAGA 2BY0A 4M56A 2YSSB 5ACMA 5ADPH 1Q9OA 3FT4A 1JK8B 2PN5A 2ICWB 5AAWC 4XXDB 3TZVC 2DLIA 2GJRA 4G8GD 1JV2B 4MJIE 4NOBA 4ZS6D 3VMNA 3Q2VA 3ZO9A 5C2BH 1AOZA 5EF3A 4KTEL 4X6BB 2GK0B 1PZUB 2FHBA 1MI5E 1RFDL 4PCSA 3QJOA 5F3BB 1RL1A 5JIPA 1E5BA 3EOBB 1W0YT 3KJ4C 1RI8A 3P3SA 1FNEB 2AEPH 2XIBA 4QLWA 1A25A 4OGYL 1IV8A 3C5SB 1YMHA 1A7OH 4I0PA 4POZD 4GMSL 3GXTA 5F1IB 3RWCB 3NJMA 3FRUA 3FC8A 3E80A 3AAZB 2CIIB 4P9HC 1OM3L 1J7VR 2DQCL 1P84J 3S5LB 3ZMRA 3KH4A 4M8VA 4ETYA 3O0RH 3BLKA 1GW6A 5FEBA 1E28B 4YFDB 1HOEA 4Z7NF 5CIPB 4Y16B 3ZDZB 4EUPG 1CGVA 1HQ4A 2JKTM 3CLEH 1I3GH 5HI4C 3GJFA 4ISVB 1UG9A 1TYRA 2HT2D 5H94A 3AM8A 3CVIH 5FHAH 2DKSA 3FYIB 5T5FH 1XGYH 4HJ1A 1KCRH 2GHZA 3HOGA 3KPNB 2YMXH 1J12A 3O3BA 4FAAB 4LCWE 3CXHK 2YQBA 3U46A 4LSRL 2CMRH 1OOAA 3AREA 3QC5X 4QWWD 4G6ML 4XPFL 5I30H 2WNGA 2XWCA 5E99L 2EE9A 4QTIL 3ZDWA 3CC1A 2GUOB 1CTOA 1QP1A 2J55A 3N42B 4LCCC 2VLRB 5AZ2L 3P0VL 2EDFA 3FHEA 3MSPA 2BWDA 1LD9B 5B1JC 2WKOF 3BPNB 4U3SB 2OX5B 3GHEL 4FXKC 4F58L 2AVGA 2FX8H 4XO8A 3LS4H 1GZQA 4XNXL 4XMPH 1OCWL 1S7WB 1SXNA 4J3VA 5INDB 2GBVA 4KO9A 3JWNH 1JSYA 3S3BB 5C70A 1D2OA 3CD4A 2BIQA 2QPFA 1RIVL 1MHEB 2H1LM 4FQQA 1NGZA 4G1EB 3WFCH 3TGXA 1HTYA 3TBSB 5C0EA 1REIA 2VDLL 3M8OH 4PEEA 4BZ1H 1OPGH 1X9RA 3MI6A 5E8EA 5DFTA 1IGYA 2OYKA 1W8NA 3CMOH 3DMMA 4YPGA 1N67A 3Q3GA 2FEEI 3SO3B 3TNMA 3VQLA 4CVXB 1HZLA 1QTSA 4JR9L 3HG1A 4KWUA 3BAWA 3I2CL 5HY9A 1OARL 4GQPH 1WDAA 3GI9L 3LH2H 1A4KA 5CXPA 1VAHA 2O5NA 3K4ZA 3QPQC 3BCDA 4PG9B 4KRMB 3ARGB 1IGMH 1IGCH 4MDIA 4Y5XA 3ILPA 3D30A 4IKLA 4P46D 3WNKA 3F12A 3S96A 1GTFA 2F15A 4R84A 1BFOA 3B2XA 5I8EB 1QSFE 3EOAB 1GXEA 2PCPB 1A6VL 3QO1B 4TRPH 5DUPL 5DJ2B 4WEEA 4NM8L 3NQKA 4YSAA 3HCVA 3UJJH 1AR1C 1NFKA 3FH7A 1HH6A 2H1PH 1A4JB 2YD0A 4GQZA 5C0IA 4MS8D 2B1HL 2YQ3A 4PB9H 4AGMA 2A5UA 1S46A 1UUNA 1T3FA 2X4NA 4PRHB 1ONQA 4IKKA 3EYQC 4OLXH 2VH5H 4P5TD 1Q9KA 4UV4H 3OR6A 1FL6A 3HS0B 3GBML 3U7WL 5E1AB 4YHZL 1OB1A 2IMMA 5IG7A 3CHQA 1N7MH 3TVMB 4Z78B 2HMID 3ELQA 2BP3A 4UT9H 1IKNC 1CFVL 1QSVA 3MRDB 3PP4L 3H2PA 3ARED 4FXGB 4WI4A 3VWJA 4LAJH 2EDHA 1UXMA 2VXSL 2HFEB 3QEUA 2QTEA 5EOCL 4BFIA 1BX2A 4C56A 4JREC 4OJFH 1IGIH 1FHGA 3QQ3B 3WE6<