3L9KA

Insights into dynein assembly from a dynein intermediate chain-light chain roadblock structure
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'QEVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPDKDFILIVIQNPTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RE64145p
molecule tags Motor protein
source organism Drosophila melanogaster
publication title Insights into dynein assembly from a dynein intermediate chain-light chain roadblock structure
rcsb
total genus 22
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3l9kA00
2PBDP 3MSHA 1CQAA 3LEQA 5EV0A 2V8FA 3T1QB 2PRFA 3KYEA 1SKOB 1SKOA 5FEGA 1G5UA 1J3WA 5FEFA 2PAVP 4FTXA 4FUWA 2BTFP 2HZ5A 5FDSA 1VEUA 1YPRA 3MS6A 2V8CA 2ZL1A 2ZL1B 4X1LA 3U4LP 1Z09A 5EM0A 3T1XA 2ACGA 3D9YA 2E8JA 3T1SA 2JKFA 2VK3A 1K0KA 3LGOA 1VETA 5EVEA 3CPTB 3T1RA 3NULA 4D60A 1AWIA 2B95A 3NECA 3L9KA 3L7HA 1VEUB 1HLUP 1D1JA 3CHWP 1SZVA 4X25A 1CF0A 1F2KA 4ESPA 3UB5P 1ACFA 1PNEA 4QWOA 1PFLA 5EM1A 4X1MA 1FIKA 3T12B 1PRQA 1Y4OA 3CPTA 1A0KA 1FILA 3DAVA 1CJFA 1VETB 2JKGA
chains in the Genus database with same CATH superfamily
3HLCA 3QP8A 5FQKA 1KDWA 2PU2A 1HD8A 1JVJA 2W3FA 4IVKA 2Z2MB 4HH3A 4OP8A 5FI6A 1WYBA 4G3VA 1VEUB 2X71A 3I7JA 3G4PA 2WAFA 4GOGA 3W2ZA 5G4ZA 2KX6A 1CI9A 3KO6A 3MF0A 2W3GA 4PM5A 2QKPA 4E04A 3NOPC 2Y59A 4GZBA 1FSYA 3ZG9B 2W3EA 4E3OA 2Y2HA 3V3RA 1Z09A 4OPYA 3GRJA 3QNBA 1S0WA 3P98A 4FSFA 4WF0A 2Q9NA 5KSCA 3N8SA 2OWHA 4QD4A 4LPZA 4X55A 4ETXA 3T12B 4HY8A 3DTMA 5HARA 2J3TD 2ZQ8A 5EFWA 2Z6CA 2Y8HA 2O9AA 4NXFA 2EA9A 3OPPA 3OBFA 4P6ZM 3G2YA 3K3CA 1ESIA 2EFXA 1S4RA 4PM6A 1ZC2A 1ACFA 3VOYA 2QWSA 3HL9A 3OPHA 2VV6A 3LEQA 1VB6A 4Y0OA 1XX2A 1L0FA 2EX6A 2YKFA 1BSGA 4UQIM 3EGXC 1I2WA 1K57C 2KDKA 2J80A 2Q9MA 3FPVA 3M6BA 3AGEA 1YSPA 2GJ3A 3DAVA 2H10A 4OPQA 3C2WA 2HPBA 3F1OB 3IX3A 4UQIS 1V9ZA 1XKZA 2PD7A 3HJIA 2PD8A 1P9RA 4MN7A 4L9FA 3QP4A 3ZYTA 4DMZA 4QY5A 5GLAA 4X1MA 3CI6A 1NY0A 3VOLA 1S66L 1G68A 1GSXA 1K54A 3HLEA 1DP8A 3BFCA 1OT6A 4IHQA 4GHIB 5FA7A 4AFIA 5CEBA 3CG5A 3D9YA 3T4QA 3N8RA 3A0SA 5M19A 2V1AA 4LLOB 2ZLYA 3JPUA 2VKSA 2J9PA 2P04A 1PFLA 2K7SA 1FR1A 2PYPA 4IJGA 1ZHHB 2ZJ9A 5EVID 1TS8A 3IXDA 1W63M 5EVLA 3CLOA 4U3TA 3S7NA 5F5YA 3IHBA 4LRXC 2R78A 5DTTA 4DDSA 3LCEA 3LFVA 4R3JA 3UDXA 4ARZA 2P9VB 3PBQA 5C5KA 4MN5A 4DE1A 4X69A 2P7JA 3HLGA 3TOIA 2JE5A 2XK1A 1E4DA 2OAP1 4GNUA 4QHCA 3W4OA 2VEAA 3QP6A 4B9OA 2OWJA 4KZ7A 1UGUA 2D01A 1G6OA 4WEJA 2V0WA 3TG9A 5A91A 1WE4A 5FI7A 2IWDA 2HP6A 3E0YA 4GKUA 3OCNA 5FQQA 4JF5A 5CGXA 3LI9A 3GVBA 3PBNA 3ZVWA 2WUQA 3Q81A 3B47A 3S4XA 3ITAA 4H6JB 2HF6A 1M40A 4MBHA 3MBZA 3MS6A 4WUJA 1SDEA 4EUZA 1RP5A 4ZJ2A 1SHVA 3IWOA 2EX2A 5HAQA 1TS0A 1NXYA 2VZWA 3QHYA 4ZJ3A 4E3IA 1PW1A 2OOLA 5EM1A 4KQOA 3MSHA 3JVUA 4GS9B 4EBNA 3DTIA 1S6RA 1K57A 2PHYA 4MBFA 4UA9A 3MFDA 2BASA 3CMZA 5A93A 1CK3A 1W7FA 4WYYA 1DJCA 1LHYA 1S4SA 4QWOA 3D72A 2VGLS 4HP4A 3CPTA 2JBFA 3G35A 5FEFA 4YINA 3SW1A 3NDGA 4OLGA 5A92A 2J3WA 2HV1A 1H3QA 1OTAA 4FH4A 3KSGA 1JNUA 3ZQ5A 5BOHA 2PDRA 2FZ0A 3NJAA 4K0XA 1ES4A 5I94A 3FZCA 4MBKA 2H0TA 4LRZE 2XQZA 3WS4A 1Y54A 2YKHA 3FC7A 4R3BA 2E8JA 2L4RA 2OLVA 5EOEA 4GDNA 2WKEA 2CC1A 2GNXA 1KDSA 3BECA 4N1HA 4K08A 1NLZA 1PRQA 3ULFA 5G18A 3T1QB 2WYXA 4LV3A 4WBGA 2C6WB 4ZDXA 5AQ9A 5I5LA 3UPOA 3A3DA 2C5WB 1KVMA 4O01A 4ZTKA 5E2EA 3CHWP 2J7VA 4EUVA 3MFXA 1PNEA 4I39A 3MMHA 1Y4OA 3ZG8B 3VP4A 1NZOA 1EROA 4G3KA 5HWTA 1MPLA 3VMAA 4HHDA 3QNCA 4KUKA 1GSVA 3DWZA 4CJNA 3IX4A 2ZC3B 1E25A 4CLCA 2XD1A 1I2SA 2W1RA 1D7EA 4PAUA 2G7UA 3UB5P 3LIAA 2ZD8A 2V1BA 1WA9A 2ZOHA 4U0XA 4S2LA 4F94A 5DF7A 1VETA 5CGWA 1XPBA 1LI0A 1DJAA 4GS9A 1JWZA 4JF4A 3W4QA 1W5DA 4RA7A 4P6BA 5FI2A 1FCOA 3NC8A 3WS2A 3VOZA 3C7UA 3TRCA 2VV8A 1K54C 5EVIA 2DCFA 5HSQA 1MWTA 1Q2QA 1Y28A 3BY9A 4E3MA 4EERA 3Q7VB 2I72A 4JF6A 3LI8A 1IYOA 1T19A 1LSWA 3OC2A 3ZNYA 4I3AA 4Y17A 2Y4AA 3UMEA 4S2MA 4GW9A 3VP1A 1N9OA 3IH8A 4HEFA 3ZVTA 4HBUA 1TF1A 4E3KA 4NXGA 3IBJA 5HL6A 4Z9QA 1FQGA 4QU3A 4JGOA 5FL3A 2HDUA 4EBPA 4UHUA 3CITA 3OPLA 5EECA 2ZMVA 1XJ6A 3IWQA 5TR7A 1H5XA 4Y0UA 4HOIA 3HJKA 1K56A 3BM6A 1K0KA 1TEMA 3VFHA 3NCKA 1ODVA 3B3XA 4ID4A 1W79A 5AVEA 3E4QA 4HH2A 2VJWA 1CJFA 2WGWB 5AQAA 2HJ9C 3LY3A 5DFXA 1GHPA 1GA9A 2BTFP 1ZTUA 2P9VA 2XF3A 5F69A 2V0UA 1KE0A 3BY8A 4KUOA 1SKFA 2UWXA 5L2FA 3KSFA 2P74A 3C4OA 5FSRA 2OLUA 2WZZA 1ES5A 4Y13A 1VETB 2IWBA 3NECA 4S2IA 1SKOA 1O7EA 4EEUA 2I9VA 1DY6A 5L10A 1MY8A 1YPRA 3FG8A 5FDHA 2ACGA 3BRMA 4KZ4A 4GLQA 2V2FF 4FH2A 2JKTM 3KYZA 3WS0A 4XT2A 4F3LA 3CWFA 3DTKA 2FH5A 3PBRA 4LV2A 1ZG4A 1LL5A 1IKIA 3GDIA 3WRTA 4Q0IA 1IELA 3P01A 4ARZB 3GMWA 3O3VA 3VSKA 1YLJA 2Y2OA 3E2LA 4U0TA 1VHMA 3EQUA 4ETZA 4UA7A 3V50A 1BLCA 4HP9A 4OOLA 4N92A 2HDSA 1GA0A 3CAXA 4XUZA 3H9WA 3VFFA 3ZFZA 1MWUA 4OH0A 1OPXA 4CLCC 3FV7A 4BQMA 3HLBA 1HTZA 3PAEA 3BYDA 3GECA 3Q1FA 1HLUP 1RGZA 4HJ6A 2RL3A 3ISGA 1FIKA 4DXBA 1H0MA 1JWPA 4WZ5A 5CX7A 1N9LA 4O8GA 4MLLA 3MQOA 1NWZA 1ESUA 1MBLA 3C8CA 1P9WA 4NEED 4EV4A 1BZAA 2VV7A 3T50A 3K2NA 5CEDA 4EEPA 1D1JA 1F98A 2LB5A 4KG2A 3NOTC 4OOYA 2EWWA 4EESA 3BLSA 2G2UA 5FEGA 3OLOA 3SH8A 5IU1A 2PT7A 4S2NA 3BEBA 1S1ZA 3T1XA 3D3OA 2Y2PA 3IXGA 5K5BA 3VE4A 5HZHA 2XFTA 3WS5A 2XGNA 2OSUA 3ITBA 1F2KA 4I3IA 4OOMA 5GLDA 4NETA 1E3UD 4EBLA 4Q0HA 2A24B 1L0EA 1BLSA 3FPWA 2O99A 3LR3A 5HWVA 3EEAA 2V9AA 1XJ2A 1XFQA 4PM7A 1OMEA 3PBTA 1BT5A 4N1XA 2XLNA 4DRTA 5TGFA 2Y2GA 1LL8A 2ZQCA 4KZBA 4NXEA 1BYWA 1YLZA 2HGVA 2GDNA 2ZMFA 3O87A 4P0MA 2J3TC 1XA7A 3AGFA 2RCXA 3GTCA 3Q07A 4A5RA 3G2ZA 3PHYA 5EV0A 1BTLA 1FOFA 5DJTA 3S7PA 5HWWA 4Y7PA 4JXWA 2JN7A 3UO9A 3WS1A 3V39A 1LT0A 1GCEA 3RJUA 1XFNA 3UPPA 3NOUC 2ZM8A 5F82A 4Y0TA 1S67L 2H0YA 1IOUA 4Y15A 3LEZA 4KZAA 1BUEA 3P7NA 4EQ1A 5HDDA 1ONHA 4LRYC 4BL3A 2Y91A 2W0NA 2M7VA 5KIZA 3LICA 1KE4A 3U4LP 3RFBA 1KVLA 5AQ7A 3WRZA 2O9CA 1EWZA 4GN2A 5HW3A 4BLMA 3UPNA 1YAXA 5J4EA 3HVFA 4R38A 2W27A 4XUXA 4PM8A 2QPNA 3DTEA 5F1FA 1SCWA 2XDMA 4X53A 1JWVA 4IUHA 3V3SA 2ZQDA 2B95A 1LI9A 4LFUA 3UDFA 1T1AA 4DE0A 2WKQA 1ZG6A 4OQGA 2A49A 4Z1WA 5GLCA 1X0OA 3H82A 3KYEA 1SDNA 1FCNA 3MQ0A 3OPRA 2G2WA 2KOIA 2OAQ1 3T1SA 2IWCA 3PR6A 4QJGA 2B5RA 3AGDA 3N4IA 4S2PA 5E2FA 1W8QA 4JGQA 3LR0A 4C75A 1XGJA 2QHKA 3S1YA 1AXBA 4K0WA 1O07A 2H28A 4G3WA 5EVIB 3PAGA 1K6RA 4LENA 2WGVA 4OPRA 1H8MA 4R4SA 3HUNA 2QJ5A 3SH9A 1XA1A 4EU0A 2Y2KA 2PU4A 4OPZA 1DJBA 2EXAA 3BFDA 3SS4A 2X02A 2AVXA 3UE3A 2XSSA 4KZ6A 3A0RA 3G6OA 5GHZA 3VP0A 4I5SA 5IHVA 3G30A 2WZXA 4P87A 4YFMA 4KQQA 3UE0A 3UY6A 2J9OA 2WGWA 3FKWA 3MXSA 2W1TB 2PRFA 1YSQA 3FWLA 4B93A 4HESA 4LGWA 4S2OA 4Q8IA 3UDIA 4DDYA 2ZQ7A 4BENA 3O86A 4BMWA 1KOUA 3PTEA 1ZKJA 2QMIA 1FR6A 1NRJA 3BJNA 3EGDC 4JXVA 5HAIA 3PXPA 1W63Q 3MZFA 2PR5A 4FUWA 3IF6B 3IH9A 3CUEA 5HPFA 4KENB 3TSGA 2DNSA 3IT9A 3SZTA 2Y2MA 2B18A 5L07A 4DE3A 4PPRA 3HBRA 3BW6A 3BQAA 3DW0A 3ZG5A 4Y2FA 1VEUA 3IXBA 3O5YA 1YT4A 3N7WA 5F83A 4L9EA 1GSWA 3TE8A 3Q7ZA 1XJ3A 1K55C 2MJ6A 3M6HA 2ZC4B 4DF6A 2JKRM 1T18A 1A0KA 4BBTA 3LY4A 2VX8A 4HJ3A 4MN6A 5DTSA 1PZOA 4H8RA 3T4JA 1NYMA 3WWXA 3CZDA 3ZHHA 2ZOIA 5TBMB 1YMSA 3EEHA 3F1PB 2CMNA 5DF9A 3HUMA 3UB7A 5GL9A 5TFQA 1K38A 2JKRI 1DP9A 3PYPA 1STZA 4GJ4A 5FDSA 2ZC6B 4IBXA 2A3UA 1MWRA 4HI4A 5MC7A 3F1OA 2JHEA 5CTMA 4L9GA 3V5MA 1DRMA 5CGSA 3OOVA 4R70A 4GDBA 1PI5A 4NKPA 3SH7A 2HP5A 2HDRA 3IWIA 3IS2B 4LV1A 1T1BA 1VQQA 4DN0A 5IT5A 1ALQA 3HLDA 4CQHA 2XD5A 3ZDJA 3EWKA 5EVEA 3R4KA 1JTDA 3L9KA 3OCLA 5A8BA 4M4XA 3IQAA 1ES3A 2W3DA 3IBRA 1K4EA 2W3HA 4IBRA 2KLIA 3IXHA 2XA7M 4MNRA 3A3EA 3RH8B 3N8LA 3NBLA 1L0GA 3HLFA 1CI8A 1N9BA 3BLMA 3FYZA 5F1GA 1L2SA 5CXWA 4R0QA 3RXXA 4GHIA 1K25A 2L1MA 1GHMA 3LUQA 1G6AA 1CQAA 1MC0A 2A24A 2XRNA 4OQIA 2FFFB 4N9KA 2XROA 3LGOA 1ERQA 3LIBA 4RX2A 1F9IA 4GD6A 1KE3A 1Q2PA 2WADA 5FQJA 1PIOA 4C3QA 4CPKA 3GQZA 3G32A 3Q82A 1YLWA 4S2JA 1K6SA 3IX8A 4HIAA 5U47A 5HPIA 2X01A 3BFFA 4DJ3A 1P97A 1UWPX 5DKLA 1NLYA 3M2KA 5M1AA 1OTIA 1LLBA 5AVFA 4E6XA 1YM1A 4FD8A 4X56A 2PYRA 1N4OA 3A3FA 3S22A 5L09A 3LIFA 5E2GA 1MKIA 2XFSA 2EXBA 3BFGA 2NUTC 4S2KA 3M2JA 2UV0E 4L0LA 1U60A 2EFUA 2Y2JA 4HJ4A 1MXOA 1NJ4A 3NY4A 3Q7VA 5HX9A 5D3OA 5J8XA 2PBYA 4KZ3A 4P6ZS 4PKYG 3RXWA 5KSHA 3P09A 4WZ5C 1ONGA 3R7WB 4EQIA 2IA2A 4IUKA 2K2NA 2Y2QA 3C30A 4OP5A 3E4PA 4E3LA 4B4ZA 1PWCA 3U2AA 3LIEA 2HJEA 5DJUA 3C38A 3UB9A 4WL9A 3KX0X 4HNBA 4KQRA 3UE6A 3SOIA 3HREA 2ZQAA 1BULA 4KG6A 5CRFA 4OKPA 5FATA 3UN7A 4O7DA 2ZM2A 1YLTA 5DF8A 3GSGA 1QMFA 2VLGA 1EI5A 4CLCE 3UB6A 5HDSA 3ZGAB 1T1CA 3NHQA 4E3JA 1RGYA 5IS1A 1YLPA 5CECA 5TJJA 5FQ9A 2XH9A 3T4KA 1DP6A 2P08A 3H82B 2VA0A 4CLCB 3E2KA 4FTXA 4JKTA 4II7A 2PR6A 1JTGA 4JBFA 3CPTB 4KZ8A 4QPRA 3CUEC 1KGFA 1XXMA 3SS3A 4DE2A 3F1NA 1SKOB 1TS7A 2NUPC 1IYSA 1LL9A 1MWSA 1NYYA 1RCJA 2DMWA 4PKYA 4EXOA 2VK3A 3LIDA 1YKDA 3H7WB 2INWA 4IVIA 4ZBEA 2VGLM 4WM9A 3JVVA 3MQQA 3B42A 1E3UA 3EQVA 5CHJA 4YWZA 2V1ZA 4MMNA 3VV4A 4JXGA 4RX3A 4C6YA 4K91A 4O0PA 1AWIA 3ICYA 3BQ8A 4XXRA 1XP4A 5EE8A 4UA6A 4JPMA 2Q0OA 3S7OA 4GD8A 3FKVA 4OONA 2W1TA 1IYQA 4HQAA 3DWKA 4Y5FA 2WKIA 1IKGA 4NG2A 2ZL1A 2OV5A 3IF6C 2WGIA 2JKTI 4B4XA 1WYCA 1SZVA 3JYIA 3NIAA 4R6LA 1HZOA 1ES2A 2FFYA 4H6JA 2Z6DA 5A90A 4R3AA 3HLWA 5DKKA 3IF6A 3GV9A 4MEZA 4MCWA 3QP1A 4R4RA 1YLYA 2B02A 4BD1A 4WN5A 4WELA 1G28A 1QMEA 4FCFA 2JC7A 5L8MA 3MXRA 5GHYA 4YNRA 2GZAA 4FOFA 4RVAA 1FILA 3UB8A 2DRWA 4QY6A 1D06A 2EX9A 2Y55A 4E3NA 2K31A 3IS2A 4BWIA 5CTNA 1XGIA 4Y3IA 2XA7S 4R1GA 1I5QA 4BBVA 5E43A 1MKMA 5EVIC 4PM9A 3T4OA 1OTBA 4ZJ1A 1BLHA 4WEKA 3LR5A 3A3IA 5GHXA 1W8YA 4KQDA 4X6TA 1PWDA 3IHAA 2PAVP 3MR0A 2WK0A 2ZL1B 5JYPA 1V9YA 1IEMA 3LR4A 1OT9A 4NXBA 4WMCD 2H5SA 3C4PA 4DXCA 2M1CA 5EPHA 3A3JA 4N9LA 3C7VA 1FSWA 3VP2A 2ZC7A 1OJGA 2O0YA 4UAAA 3T4LA 1G5UA 1L3LA 1YQSA 4B88A 2BLSA 1J9MA 5M18A 2WKRA 2L0WA 2ZMAA 3KYQA 4IEDA 4EW7A 3ZG0A 3SS5A 3O88A 3V67A 3C5AA 3KSHA 1PYYA 2ZBBA 5DTKA 4YOFA 1CEFA 4E6WA 2QZ6A 2ZC5B 5HAPA 2O9BA 1CEGA 5CHUA 1Z6FA 4OVDA 4EETB 4ZAMA 1OTEA 3MKFA 4BL2A 2R9XA 3RTYA 2VGKA 3DBAA 3G34A 1IFQA 5G4YA 1KGEA 3W8KA 5E2HA 5AQBA 3VSLA 4HBTA 4RYEA 4KZ5A 5JYOA 2HZ5A 4R23A 4CLCD 5KMWA 4LCLA 4M3KA 1L0DA 4JLFA 3PBSA 1ERMA 4GCZA 3IF5A 1MZUA 3R7WA 4BJPA 3T4SA 5HD5A 2JKGA 2QJ7A 2V8CA 3UNWA 5LBRA 4D60A 3CJMA 4PHTA 3W4PA 3A0VA 4DJ2A 3TW8A 2JCHA 2GX5A 5HL1A 3PBOA 3NULA 5CERA 1EW0A 3D4FA 3GR2A 2Y79A 2XR0A 5AJGA 1C3BA 4MDZA 4RQ9A 1OJ5A 5HD3A 3B33A 4OQHA 4KZ9A 5HFOA 1S1YA 3MZEA 3ZNTA 4KG5A 4PMAA 3HCYA 5FQIA 1TS6A 4ZRRA 1KGGA 3VE3A 4ME4A 2E8IA 1FCMA 2D02A 5DVAA 2V20A 4LV0A 4X25A 2M7UA 4WLAA 4D2OA 4UEYA 2EWVA 3S7QA 3BWLA 1H8YA 1J3WA 5HDCA 4X1LA 5EM0A 4LCMA 3MJQA 1H8ZA 4BBUA 1PW8A 5EUAA 5CHMA 3E4OA 5DFYA 2XEPA 4QB8A 2V8FA 2VGJA 2Y2NA 3NI9A 2R9WA 3TJZC 4I38A 4I3JA 2LB9A 5FAOA 1VM1A 3BFEA 3HUOA 2WAEA 1LSVA 3T1RA 4JXSA 2QYBA 3G31A 5F68A 3EOIA 1CF0A 1K4FA 4ESPA 3NDEA 4EWFA 5J7EA 3UMDA 1TD5A 5FAPA 1PI4A 3QP2A 4OLDA 2ZQ9A 2ZM0A 4JGRA 1F5MA 3UE1A 1OTDA 3F1PA 3L7HA 1TDLA 3VP3A 3MXQA 4WMCA 4NK3A 4P85A 1XJ4A 4JGPA 2WKPA 3F1NB 3T4TA 3KSIA 4DKIA 1TDGA 2Y2IA 5FQMA 2Z2LB 5FASA 1PZPA 1GHIA 1UWNX 5FAQA 3H7WA 1BLPA 2A2LA 1LSXA 4XT2B 4F3LB 1HVBA 3OZHA 4X68A 4OQ0A 1NRFA 2HDQA 5EOOA 1K56D 3ZCZA 1TVFA 2J8YA 5J3WA 5F6AA 1PWGA 3MZDA 5TBMA 4S2NC 1M6KA 2EX8A 3LO7A 2HP9A 4Q0JA 1K55A 1IYPA 2WKHA 3N6IA 4WZ4A 2PBDP 3LYXA 4GB7A 5KZHA 1YMXA 1N9NA 2JKFA 3ZG7B 2Y2LA 3E98A 3K3DA 2BG1A 1NZUA 5GLBA 3MKEA 3QP5A 4BD0A 1P0ZA
chains in the Genus database with same CATH topology
2PBDP 3MSHA 1CQAA 3LEQA 5EV0A 2V8FA 3T1QB 2PRFA 3KYEA 1SKOB 1SKOA 5FEGA 1G5UA 1J3WA 5FEFA 2PAVP 4FTXA 4FUWA 2BTFP 2HZ5A 5FDSA 1VEUA 1YPRA 3MS6A 2V8CA 2ZL1A 2ZL1B 4X1LA 3U4LP 1Z09A 5EM0A 3T1XA 2ACGA 3D9YA 2E8JA 3T1SA 2JKFA 2VK3A 1K0KA 3LGOA 1VETA 5EVEA 3CPTB 3T1RA 3NULA 4D60A 1AWIA 2B95A 3NECA 3L9KA 3L7HA 1VEUB 1HLUP 1D1JA 3CHWP 1SZVA 4X25A 1CF0A 1F2KA 4ESPA 3UB5P 1ACFA 1PNEA 4QWOA 1PFLA 5EM1A 4X1MA 1FIKA 3T12B 1PRQA 1Y4OA 3CPTA 1A0KA 1FILA 3DAVA 1CJFA 1VETB 2JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBD P;  3MSH A;  1CQA A;  3LEQ A;  5EV0 A;  2V8F A;  3T1Q B;  2PRF A;  3KYE A;  1SKO B;  1SKO A;  5FEG A;  1G5U A;  1J3W A;  5FEF A;  2PAV P;  4FTX A;  4FUW A;  2BTF P;  2HZ5 A;  5FDS A;  1VEU A;  1YPR A;  3MS6 A;  2V8C A;  2ZL1 A;  2ZL1 B;  4X1L A;  3U4L P;  1Z09 A;  5EM0 A;  3T1X A;  2ACG A;  3D9Y A;  2E8J A;  3T1S A;  2JKF A;  2VK3 A;  1K0K A;  3LGO A;  1VET A;  5EVE A;  3CPT B;  3T1R A;  3NUL A;  4D60 A;  1AWI A;  2B95 A;  3NEC A;  3L9K A;  3L7H A;  1VEU B;  1HLU P;  1D1J A;  3CHW P;  1SZV A;  4X25 A;  1CF0 A;  1F2K A;  4ESP A;  3UB5 P;  1ACF A;  1PNE A;  4QWO A;  1PFL A;  5EM1 A;  4X1M A;  1FIK A;  3T12 B;  1PRQ A;  1Y4O A;  3CPT A;  1A0K A;  1FIL A;  3DAV A;  1CJF A;  1VET B;  2JKG A; 
#chains in the Genus database with same CATH topology
 3HLC A;  3QP8 A;  5FQK A;  1KDW A;  2PU2 A;  1HD8 A;  1JVJ A;  2W3F A;  4IVK A;  2Z2M B;  4HH3 A;  4OP8 A;  5FI6 A;  1WYB A;  4G3V A;  1VEU B;  2X71 A;  3I7J A;  3G4P A;  2WAF A;  4GOG A;  3W2Z A;  5G4Z A;  2KX6 A;  1CI9 A;  3KO6 A;  3MF0 A;  2W3G A;  4PM5 A;  2QKP A;  4E04 A;  3NOP C;  2Y59 A;  4GZB A;  1FSY A;  3ZG9 B;  2W3E A;  4E3O A;  2Y2H A;  3V3R A;  1Z09 A;  4OPY A;  3GRJ A;  3QNB A;  1S0W A;  3P98 A;  4FSF A;  4WF0 A;  2Q9N A;  5KSC A;  3N8S A;  2OWH A;  4QD4 A;  4LPZ A;  4X55 A;  4ETX A;  3T12 B;  4HY8 A;  3DTM A;  5HAR A;  2J3T D;  2ZQ8 A;  5EFW A;  2Z6C A;  2Y8H A;  2O9A A;  4NXF A;  2EA9 A;  3OPP A;  3OBF A;  4P6Z M;  3G2Y A;  3K3C A;  1ESI A;  2EFX A;  1S4R A;  4PM6 A;  1ZC2 A;  1ACF A;  3VOY A;  2QWS A;  3HL9 A;  3OPH A;  2VV6 A;  3LEQ A;  1VB6 A;  4Y0O A;  1XX2 A;  1L0F A;  2EX6 A;  2YKF A;  1BSG A;  4UQI M;  3EGX C;  1I2W A;  1K57 C;  2KDK A;  2J80 A;  2Q9M A;  3FPV A;  3M6B A;  3AGE A;  1YSP A;  2GJ3 A;  3DAV A;  2H10 A;  4OPQ A;  3C2W A;  2HPB A;  3F1O B;  3IX3 A;  4UQI S;  1V9Z A;  1XKZ A;  2PD7 A;  3HJI A;  2PD8 A;  1P9R A;  4MN7 A;  4L9F A;  3QP4 A;  3ZYT A;  4DMZ A;  4QY5 A;  5GLA A;  4X1M A;  3CI6 A;  1NY0 A;  3VOL A;  1S66 L;  1G68 A;  1GSX A;  1K54 A;  3HLE A;  1DP8 A;  3BFC A;  1OT6 A;  4IHQ A;  4GHI B;  5FA7 A;  4AFI A;  5CEB A;  3CG5 A;  3D9Y A;  3T4Q A;  3N8R A;  3A0S A;  5M19 A;  2V1A A;  4LLO B;  2ZLY A;  3JPU A;  2VKS A;  2J9P A;  2P04 A;  1PFL A;  2K7S A;  1FR1 A;  2PYP A;  4IJG A;  1ZHH B;  2ZJ9 A;  5EVI D;  1TS8 A;  3IXD A;  1W63 M;  5EVL A;  3CLO A;  4U3T A;  3S7N A;  5F5Y A;  3IHB A;  4LRX C;  2R78 A;  5DTT A;  4DDS A;  3LCE A;  3LFV A;  4R3J A;  3UDX A;  4ARZ A;  2P9V B;  3PBQ A;  5C5K A;  4MN5 A;  4DE1 A;  4X69 A;  2P7J A;  3HLG A;  3TOI A;  2JE5 A;  2XK1 A;  1E4D A;  2OAP 1;  4GNU A;  4QHC A;  3W4O A;  2VEA A;  3QP6 A;  4B9O A;  2OWJ A;  4KZ7 A;  1UGU A;  2D01 A;  1G6O A;  4WEJ A;  2V0W A;  3TG9 A;  5A91 A;  1WE4 A;  5FI7 A;  2IWD A;  2HP6 A;  3E0Y A;  4GKU A;  3OCN A;  5FQQ A;  4JF5 A;  5CGX A;  3LI9 A;  3GVB A;  3PBN A;  3ZVW A;  2WUQ A;  3Q81 A;  3B47 A;  3S4X A;  3ITA A;  4H6J B;  2HF6 A;  1M40 A;  4MBH A;  3MBZ A;  3MS6 A;  4WUJ A;  1SDE A;  4EUZ A;  1RP5 A;  4ZJ2 A;  1SHV A;  3IWO A;  2EX2 A;  5HAQ A;  1TS0 A;  1NXY A;  2VZW A;  3QHY A;  4ZJ3 A;  4E3I A;  1PW1 A;  2OOL A;  5EM1 A;  4KQO A;  3MSH A;  3JVU A;  4GS9 B;  4EBN A;  3DTI A;  1S6R A;  1K57 A;  2PHY A;  4MBF A;  4UA9 A;  3MFD A;  2BAS A;  3CMZ A;  5A93 A;  1CK3 A;  1W7F A;  4WYY A;  1DJC A;  1LHY A;  1S4S A;  4QWO A;  3D72 A;  2VGL S;  4HP4 A;  3CPT A;  2JBF A;  3G35 A;  5FEF A;  4YIN A;  3SW1 A;  3NDG A;  4OLG A;  5A92 A;  2J3W A;  2HV1 A;  1H3Q A;  1OTA A;  4FH4 A;  3KSG A;  1JNU A;  3ZQ5 A;  5BOH A;  2PDR A;  2FZ0 A;  3NJA A;  4K0X A;  1ES4 A;  5I94 A;  3FZC A;  4MBK A;  2H0T A;  4LRZ E;  2XQZ A;  3WS4 A;  1Y54 A;  2YKH A;  3FC7 A;  4R3B A;  2E8J A;  2L4R A;  2OLV A;  5EOE A;  4GDN A;  2WKE A;  2CC1 A;  2GNX A;  1KDS A;  3BEC A;  4N1H A;  4K08 A;  1NLZ A;  1PRQ A;  3ULF A;  5G18 A;  3T1Q B;  2WYX A;  4LV3 A;  4WBG A;  2C6W B;  4ZDX A;  5AQ9 A;  5I5L A;  3UPO A;  3A3D A;  2C5W B;  1KVM A;  4O01 A;  4ZTK A;  5E2E A;  3CHW P;  2J7V A;  4EUV A;  3MFX A;  1PNE A;  4I39 A;  3MMH A;  1Y4O A;  3ZG8 B;  3VP4 A;  1NZO A;  1ERO A;  4G3K A;  5HWT A;  1MPL A;  3VMA A;  4HHD A;  3QNC A;  4KUK A;  1GSV A;  3DWZ A;  4CJN A;  3IX4 A;  2ZC3 B;  1E25 A;  4CLC A;  2XD1 A;  1I2S A;  2W1R A;  1D7E A;  4PAU A;  2G7U A;  3UB5 P;  3LIA A;  2ZD8 A;  2V1B A;  1WA9 A;  2ZOH A;  4U0X A;  4S2L A;  4F94 A;  5DF7 A;  1VET A;  5CGW A;  1XPB A;  1LI0 A;  1DJA A;  4GS9 A;  1JWZ A;  4JF4 A;  3W4Q A;  1W5D A;  4RA7 A;  4P6B A;  5FI2 A;  1FCO A;  3NC8 A;  3WS2 A;  3VOZ A;  3C7U A;  3TRC A;  2VV8 A;  1K54 C;  5EVI A;  2DCF A;  5HSQ A;  1MWT A;  1Q2Q A;  1Y28 A;  3BY9 A;  4E3M A;  4EER A;  3Q7V B;  2I72 A;  4JF6 A;  3LI8 A;  1IYO A;  1T19 A;  1LSW A;  3OC2 A;  3ZNY A;  4I3A A;  4Y17 A;  2Y4A A;  3UME A;  4S2M A;  4GW9 A;  3VP1 A;  1N9O A;  3IH8 A;  4HEF A;  3ZVT A;  4HBU A;  1TF1 A;  4E3K A;  4NXG A;  3IBJ A;  5HL6 A;  4Z9Q A;  1FQG A;  4QU3 A;  4JGO A;  5FL3 A;  2HDU A;  4EBP A;  4UHU A;  3CIT A;  3OPL A;  5EEC A;  2ZMV A;  1XJ6 A;  3IWQ A;  5TR7 A;  1H5X A;  4Y0U A;  4HOI A;  3HJK A;  1K56 A;  3BM6 A;  1K0K A;  1TEM A;  3VFH A;  3NCK A;  1ODV A;  3B3X A;  4ID4 A;  1W79 A;  5AVE A;  3E4Q A;  4HH2 A;  2VJW A;  1CJF A;  2WGW B;  5AQA A;  2HJ9 C;  3LY3 A;  5DFX A;  1GHP A;  1GA9 A;  2BTF P;  1ZTU A;  2P9V A;  2XF3 A;  5F69 A;  2V0U A;  1KE0 A;  3BY8 A;  4KUO A;  1SKF A;  2UWX A;  5L2F A;  3KSF A;  2P74 A;  3C4O A;  5FSR A;  2OLU A;  2WZZ A;  1ES5 A;  4Y13 A;  1VET B;  2IWB A;  3NEC A;  4S2I A;  1SKO A;  1O7E A;  4EEU A;  2I9V A;  1DY6 A;  5L10 A;  1MY8 A;  1YPR A;  3FG8 A;  5FDH A;  2ACG A;  3BRM A;  4KZ4 A;  4GLQ A;  2V2F F;  4FH2 A;  2JKT M;  3KYZ A;  3WS0 A;  4XT2 A;  4F3L A;  3CWF A;  3DTK A;  2FH5 A;  3PBR A;  4LV2 A;  1ZG4 A;  1LL5 A;  1IKI A;  3GDI A;  3WRT A;  4Q0I A;  1IEL A;  3P01 A;  4ARZ B;  3GMW A;  3O3V A;  3VSK A;  1YLJ A;  2Y2O A;  3E2L A;  4U0T A;  1VHM A;  3EQU A;  4ETZ A;  4UA7 A;  3V50 A;  1BLC A;  4HP9 A;  4OOL A;  4N92 A;  2HDS A;  1GA0 A;  3CAX A;  4XUZ A;  3H9W A;  3VFF A;  3ZFZ A;  1MWU A;  4OH0 A;  1OPX A;  4CLC C;  3FV7 A;  4BQM A;  3HLB A;  1HTZ A;  3PAE A;  3BYD A;  3GEC A;  3Q1F A;  1HLU P;  1RGZ A;  4HJ6 A;  2RL3 A;  3ISG A;  1FIK A;  4DXB A;  1H0M A;  1JWP A;  4WZ5 A;  5CX7 A;  1N9L A;  4O8G A;  4MLL A;  3MQO A;  1NWZ A;  1ESU A;  1MBL A;  3C8C A;  1P9W A;  4NEE D;  4EV4 A;  1BZA A;  2VV7 A;  3T50 A;  3K2N A;  5CED A;  4EEP A;  1D1J A;  1F98 A;  2LB5 A;  4KG2 A;  3NOT C;  4OOY A;  2EWW A;  4EES A;  3BLS A;  2G2U A;  5FEG A;  3OLO A;  3SH8 A;  5IU1 A;  2PT7 A;  4S2N A;  3BEB A;  1S1Z A;  3T1X A;  3D3O A;  2Y2P A;  3IXG A;  5K5B A;  3VE4 A;  5HZH A;  2XFT A;  3WS5 A;  2XGN A;  2OSU A;  3ITB A;  1F2K A;  4I3I A;  4OOM A;  5GLD A;  4NET A;  1E3U D;  4EBL A;  4Q0H A;  2A24 B;  1L0E A;  1BLS A;  3FPW A;  2O99 A;  3LR3 A;  5HWV A;  3EEA A;  2V9A A;  1XJ2 A;  1XFQ A;  4PM7 A;  1OME A;  3PBT A;  1BT5 A;  4N1X A;  2XLN A;  4DRT A;  5TGF A;  2Y2G A;  1LL8 A;  2ZQC A;  4KZB A;  4NXE A;  1BYW A;  1YLZ A;  2HGV A;  2GDN A;  2ZMF A;  3O87 A;  4P0M A;  2J3T C;  1XA7 A;  3AGF A;  2RCX A;  3GTC A;  3Q07 A;  4A5R A;  3G2Z A;  3PHY A;  5EV0 A;  1BTL A;  1FOF A;  5DJT A;  3S7P A;  5HWW A;  4Y7P A;  4JXW A;  2JN7 A;  3UO9 A;  3WS1 A;  3V39 A;  1LT0 A;  1GCE A;  3RJU A;  1XFN A;  3UPP A;  3NOU C;  2ZM8 A;  5F82 A;  4Y0T A;  1S67 L;  2H0Y A;  1IOU A;  4Y15 A;  3LEZ A;  4KZA A;  1BUE A;  3P7N A;  4EQ1 A;  5HDD A;  1ONH A;  4LRY C;  4BL3 A;  2Y91 A;  2W0N A;  2M7V A;  5KIZ A;  3LIC A;  1KE4 A;  3U4L P;  3RFB A;  1KVL A;  5AQ7 A;  3WRZ A;  2O9C A;  1EWZ A;  4GN2 A;  5HW3 A;  4BLM A;  3UPN A;  1YAX A;  5J4E A;  3HVF A;  4R38 A;  2W27 A;  4XUX A;  4PM8 A;  2QPN A;  3DTE A;  5F1F A;  1SCW A;  2XDM A;  4X53 A;  1JWV A;  4IUH A;  3V3S A;  2ZQD A;  2B95 A;  1LI9 A;  4LFU A;  3UDF A;  1T1A A;  4DE0 A;  2WKQ A;  1ZG6 A;  4OQG A;  2A49 A;  4Z1W A;  5GLC A;  1X0O A;  3H82 A;  3KYE A;  1SDN A;  1FCN A;  3MQ0 A;  3OPR A;  2G2W A;  2KOI A;  2OAQ 1;  3T1S A;  2IWC A;  3PR6 A;  4QJG A;  2B5R A;  3AGD A;  3N4I A;  4S2P A;  5E2F A;  1W8Q A;  4JGQ A;  3LR0 A;  4C75 A;  1XGJ A;  2QHK A;  3S1Y A;  1AXB A;  4K0W A;  1O07 A;  2H28 A;  4G3W A;  5EVI B;  3PAG A;  1K6R A;  4LEN A;  2WGV A;  4OPR A;  1H8M A;  4R4S A;  3HUN A;  2QJ5 A;  3SH9 A;  1XA1 A;  4EU0 A;  2Y2K A;  2PU4 A;  4OPZ A;  1DJB A;  2EXA A;  3BFD A;  3SS4 A;  2X02 A;  2AVX A;  3UE3 A;  2XSS A;  4KZ6 A;  3A0R A;  3G6O A;  5GHZ A;  3VP0 A;  4I5S A;  5IHV A;  3G30 A;  2WZX A;  4P87 A;  4YFM A;  4KQQ A;  3UE0 A;  3UY6 A;  2J9O A;  2WGW A;  3FKW A;  3MXS A;  2W1T B;  2PRF A;  1YSQ A;  3FWL A;  4B93 A;  4HES A;  4LGW A;  4S2O A;  4Q8I A;  3UDI A;  4DDY A;  2ZQ7 A;  4BEN A;  3O86 A;  4BMW A;  1KOU A;  3PTE A;  1ZKJ A;  2QMI A;  1FR6 A;  1NRJ A;  3BJN A;  3EGD C;  4JXV A;  5HAI A;  3PXP A;  1W63 Q;  3MZF A;  2PR5 A;  4FUW A;  3IF6 B;  3IH9 A;  3CUE A;  5HPF A;  4KEN B;  3TSG A;  2DNS A;  3IT9 A;  3SZT A;  2Y2M A;  2B18 A;  5L07 A;  4DE3 A;  4PPR A;  3HBR A;  3BW6 A;  3BQA A;  3DW0 A;  3ZG5 A;  4Y2F A;  1VEU A;  3IXB A;  3O5Y A;  1YT4 A;  3N7W A;  5F83 A;  4L9E A;  1GSW A;  3TE8 A;  3Q7Z A;  1XJ3 A;  1K55 C;  2MJ6 A;  3M6H A;  2ZC4 B;  4DF6 A;  2JKR M;  1T18 A;  1A0K A;  4BBT A;  3LY4 A;  2VX8 A;  4HJ3 A;  4MN6 A;  5DTS A;  1PZO A;  4H8R A;  3T4J A;  1NYM A;  3WWX A;  3CZD A;  3ZHH A;  2ZOI A;  5TBM B;  1YMS A;  3EEH A;  3F1P B;  2CMN A;  5DF9 A;  3HUM A;  3UB7 A;  5GL9 A;  5TFQ A;  1K38 A;  2JKR I;  1DP9 A;  3PYP A;  1STZ A;  4GJ4 A;  5FDS A;  2ZC6 B;  4IBX A;  2A3U A;  1MWR A;  4HI4 A;  5MC7 A;  3F1O A;  2JHE A;  5CTM A;  4L9G A;  3V5M A;  1DRM A;  5CGS A;  3OOV A;  4R70 A;  4GDB A;  1PI5 A;  4NKP A;  3SH7 A;  2HP5 A;  2HDR A;  3IWI A;  3IS2 B;  4LV1 A;  1T1B A;  1VQQ A;  4DN0 A;  5IT5 A;  1ALQ A;  3HLD A;  4CQH A;  2XD5 A;  3ZDJ A;  3EWK A;  5EVE A;  3R4K A;  1JTD A;  3L9K A;  3OCL A;  5A8B A;  4M4X A;  3IQA A;  1ES3 A;  2W3D A;  3IBR A;  1K4E A;  2W3H A;  4IBR A;  2KLI A;  3IXH A;  2XA7 M;  4MNR A;  3A3E A;  3RH8 B;  3N8L A;  3NBL A;  1L0G A;  3HLF A;  1CI8 A;  1N9B A;  3BLM A;  3FYZ A;  5F1G A;  1L2S A;  5CXW A;  4R0Q A;  3RXX A;  4GHI A;  1K25 A;  2L1M A;  1GHM A;  3LUQ A;  1G6A A;  1CQA A;  1MC0 A;  2A24 A;  2XRN A;  4OQI A;  2FFF B;  4N9K A;  2XRO A;  3LGO A;  1ERQ A;  3LIB A;  4RX2 A;  1F9I A;  4GD6 A;  1KE3 A;  1Q2P A;  2WAD A;  5FQJ A;  1PIO A;  4C3Q A;  4CPK A;  3GQZ A;  3G32 A;  3Q82 A;  1YLW A;  4S2J A;  1K6S A;  3IX8 A;  4HIA A;  5U47 A;  5HPI A;  2X01 A;  3BFF A;  4DJ3 A;  1P97 A;  1UWP X;  5DKL A;  1NLY A;  3M2K A;  5M1A A;  1OTI A;  1LLB A;  5AVF A;  4E6X A;  1YM1 A;  4FD8 A;  4X56 A;  2PYR A;  1N4O A;  3A3F A;  3S22 A;  5L09 A;  3LIF A;  5E2G A;  1MKI A;  2XFS A;  2EXB A;  3BFG A;  2NUT C;  4S2K A;  3M2J A;  2UV0 E;  4L0L A;  1U60 A;  2EFU A;  2Y2J A;  4HJ4 A;  1MXO A;  1NJ4 A;  3NY4 A;  3Q7V A;  5HX9 A;  5D3O A;  5J8X A;  2PBY A;  4KZ3 A;  4P6Z S;  4PKY G;  3RXW A;  5KSH A;  3P09 A;  4WZ5 C;  1ONG A;  3R7W B;  4EQI A;  2IA2 A;  4IUK A;  2K2N A;  2Y2Q A;  3C30 A;  4OP5 A;  3E4P A;  4E3L A;  4B4Z A;  1PWC A;  3U2A A;  3LIE A;  2HJE A;  5DJU A;  3C38 A;  3UB9 A;  4WL9 A;  3KX0 X;  4HNB A;  4KQR A;  3UE6 A;  3SOI A;  3HRE A;  2ZQA A;  1BUL A;  4KG6 A;  5CRF A;  4OKP A;  5FAT A;  3UN7 A;  4O7D A;  2ZM2 A;  1YLT A;  5DF8 A;  3GSG A;  1QMF A;  2VLG A;  1EI5 A;  4CLC E;  3UB6 A;  5HDS A;  3ZGA B;  1T1C A;  3NHQ A;  4E3J A;  1RGY A;  5IS1 A;  1YLP A;  5CEC A;  5TJJ A;  5FQ9 A;  2XH9 A;  3T4K A;  1DP6 A;  2P08 A;  3H82 B;  2VA0 A;  4CLC B;  3E2K A;  4FTX A;  4JKT A;  4II7 A;  2PR6 A;  1JTG A;  4JBF A;  3CPT B;  4KZ8 A;  4QPR A;  3CUE C;  1KGF A;  1XXM A;  3SS3 A;  4DE2 A;  3F1N A;  1SKO B;  1TS7 A;  2NUP C;  1IYS A;  1LL9 A;  1MWS A;  1NYY A;  1RCJ A;  2DMW A;  4PKY A;  4EXO A;  2VK3 A;  3LID A;  1YKD A;  3H7W B;  2INW A;  4IVI A;  4ZBE A;  2VGL M;  4WM9 A;  3JVV A;  3MQQ A;  3B42 A;  1E3U A;  3EQV A;  5CHJ A;  4YWZ A;  2V1Z A;  4MMN A;  3VV4 A;  4JXG A;  4RX3 A;  4C6Y A;  4K91 A;  4O0P A;  1AWI A;  3ICY A;  3BQ8 A;  4XXR A;  1XP4 A;  5EE8 A;  4UA6 A;  4JPM A;  2Q0O A;  3S7O A;  4GD8 A;  3FKV A;  4OON A;  2W1T A;  1IYQ A;  4HQA A;  3DWK A;  4Y5F A;  2WKI A;  1IKG A;  4NG2 A;  2ZL1 A;  2OV5 A;  3IF6 C;  2WGI A;  2JKT I;  4B4X A;  1WYC A;  1SZV A;  3JYI A;  3NIA A;  4R6L A;  1HZO A;  1ES2 A;  2FFY A;  4H6J A;  2Z6D A;  5A90 A;  4R3A A;  3HLW A;  5DKK A;  3IF6 A;  3GV9 A;  4MEZ A;  4MCW A;  3QP1 A;  4R4R A;  1YLY A;  2B02 A;  4BD1 A;  4WN5 A;  4WEL A;  1G28 A;  1QME A;  4FCF A;  2JC7 A;  5L8M A;  3MXR A;  5GHY A;  4YNR A;  2GZA A;  4FOF A;  4RVA A;  1FIL A;  3UB8 A;  2DRW A;  4QY6 A;  1D06 A;  2EX9 A;  2Y55 A;  4E3N A;  2K31 A;  3IS2 A;  4BWI A;  5CTN A;  1XGI A;  4Y3I A;  2XA7 S;  4R1G A;  1I5Q A;  4BBV A;  5E43 A;  1MKM A;  5EVI C;  4PM9 A;  3T4O A;  1OTB A;  4ZJ1 A;  1BLH A;  4WEK A;  3LR5 A;  3A3I A;  5GHX A;  1W8Y A;  4KQD A;  4X6T A;  1PWD A;  3IHA A;  2PAV P;  3MR0 A;  2WK0 A;  2ZL1 B;  5JYP A;  1V9Y A;  1IEM A;  3LR4 A;  1OT9 A;  4NXB A;  4WMC D;  2H5S A;  3C4P A;  4DXC A;  2M1C A;  5EPH A;  3A3J A;  4N9L A;  3C7V A;  1FSW A;  3VP2 A;  2ZC7 A;  1OJG A;  2O0Y A;  4UAA A;  3T4L A;  1G5U A;  1L3L A;  1YQS A;  4B88 A;  2BLS A;  1J9M A;  5M18 A;  2WKR A;  2L0W A;  2ZMA A;  3KYQ A;  4IED A;  4EW7 A;  3ZG0 A;  3SS5 A;  3O88 A;  3V67 A;  3C5A A;  3KSH A;  1PYY A;  2ZBB A;  5DTK A;  4YOF A;  1CEF A;  4E6W A;  2QZ6 A;  2ZC5 B;  5HAP A;  2O9B A;  1CEG A;  5CHU A;  1Z6F A;  4OVD A;  4EET B;  4ZAM A;  1OTE A;  3MKF A;  4BL2 A;  2R9X A;  3RTY A;  2VGK A;  3DBA A;  3G34 A;  1IFQ A;  5G4Y A;  1KGE A;  3W8K A;  5E2H A;  5AQB A;  3VSL A;  4HBT A;  4RYE A;  4KZ5 A;  5JYO A;  2HZ5 A;  4R23 A;  4CLC D;  5KMW A;  4LCL A;  4M3K A;  1L0D A;  4JLF A;  3PBS A;  1ERM A;  4GCZ A;  3IF5 A;  1MZU A;  3R7W A;  4BJP A;  3T4S A;  5HD5 A;  2JKG A;  2QJ7 A;  2V8C A;  3UNW A;  5LBR A;  4D60 A;  3CJM A;  4PHT A;  3W4P A;  3A0V A;  4DJ2 A;  3TW8 A;  2JCH A;  2GX5 A;  5HL1 A;  3PBO A;  3NUL A;  5CER A;  1EW0 A;  3D4F A;  3GR2 A;  2Y79 A;  2XR0 A;  5AJG A;  1C3B A;  4MDZ A;  4RQ9 A;  1OJ5 A;  5HD3 A;  3B33 A;  4OQH A;  4KZ9 A;  5HFO A;  1S1Y A;  3MZE A;  3ZNT A;  4KG5 A;  4PMA A;  3HCY A;  5FQI A;  1TS6 A;  4ZRR A;  1KGG A;  3VE3 A;  4ME4 A;  2E8I A;  1FCM A;  2D02 A;  5DVA A;  2V20 A;  4LV0 A;  4X25 A;  2M7U A;  4WLA A;  4D2O A;  4UEY A;  2EWV A;  3S7Q A;  3BWL A;  1H8Y A;  1J3W A;  5HDC A;  4X1L A;  5EM0 A;  4LCM A;  3MJQ A;  1H8Z A;  4BBU A;  1PW8 A;  5EUA A;  5CHM A;  3E4O A;  5DFY A;  2XEP A;  4QB8 A;  2V8F A;  2VGJ A;  2Y2N A;  3NI9 A;  2R9W A;  3TJZ C;  4I38 A;  4I3J A;  2LB9 A;  5FAO A;  1VM1 A;  3BFE A;  3HUO A;  2WAE A;  1LSV A;  3T1R A;  4JXS A;  2QYB A;  3G31 A;  5F68 A;  3EOI A;  1CF0 A;  1K4F A;  4ESP A;  3NDE A;  4EWF A;  5J7E A;  3UMD A;  1TD5 A;  5FAP A;  1PI4 A;  3QP2 A;  4OLD A;  2ZQ9 A;  2ZM0 A;  4JGR A;  1F5M A;  3UE1 A;  1OTD A;  3F1P A;  3L7H A;  1TDL A;  3VP3 A;  3MXQ A;  4WMC A;  4NK3 A;  4P85 A;  1XJ4 A;  4JGP A;  2WKP A;  3F1N B;  3T4T A;  3KSI A;  4DKI A;  1TDG A;  2Y2I A;  5FQM A;  2Z2L B;  5FAS A;  1PZP A;  1GHI A;  1UWN X;  5FAQ A;  3H7W A;  1BLP A;  2A2L A;  1LSX A;  4XT2 B;  4F3L B;  1HVB A;  3OZH A;  4X68 A;  4OQ0 A;  1NRF A;  2HDQ A;  5EOO A;  1K56 D;  3ZCZ A;  1TVF A;  2J8Y A;  5J3W A;  5F6A A;  1PWG A;  3MZD A;  5TBM A;  4S2N C;  1M6K A;  2EX8 A;  3LO7 A;  2HP9 A;  4Q0J A;  1K55 A;  1IYP A;  2WKH A;  3N6I A;  4WZ4 A;  2PBD P;  3LYX A;  4GB7 A;  5KZH A;  1YMX A;  1N9N A;  2JKF A;  3ZG7 B;  2Y2L A;  3E98 A;  3K3D A;  2BG1 A;  1NZU A;  5GLB A;  3MKE A;  3QP5 A;  4BD0 A;  1P0Z A; 
#chains in the Genus database with same CATH homology
 2PBD P;  3MSH A;  1CQA A;  3LEQ A;  5EV0 A;  2V8F A;  3T1Q B;  2PRF A;  3KYE A;  1SKO B;  1SKO A;  5FEG A;  1G5U A;  1J3W A;  5FEF A;  2PAV P;  4FTX A;  4FUW A;  2BTF P;  2HZ5 A;  5FDS A;  1VEU A;  1YPR A;  3MS6 A;  2V8C A;  2ZL1 A;  2ZL1 B;  4X1L A;  3U4L P;  1Z09 A;  5EM0 A;  3T1X A;  2ACG A;  3D9Y A;  2E8J A;  3T1S A;  2JKF A;  2VK3 A;  1K0K A;  3LGO A;  1VET A;  5EVE A;  3CPT B;  3T1R A;  3NUL A;  4D60 A;  1AWI A;  2B95 A;  3NEC A;  3L9K A;  3L7H A;  1VEU B;  1HLU P;  1D1J A;  3CHW P;  1SZV A;  4X25 A;  1CF0 A;  1F2K A;  4ESP A;  3UB5 P;  1ACF A;  1PNE A;  4QWO A;  1PFL A;  5EM1 A;  4X1M A;  1FIK A;  3T12 B;  1PRQ A;  1Y4O A;  3CPT A;  1A0K A;  1FIL A;  3DAV A;  1CJF A;  1VET B;  2JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...