3L9UA

Crystal structure of salmonella enterica serovar typhimurium dsbl
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
199
structure length
199
Chain Sequence
ASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSDKVADLVTFTPFHLETKGEYGKQASEVFAVLIAKDKAAGISLFDAKSQFKKAKFAWYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQADFEAALKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLIYTKNIKSIDSMAELVRELATKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide isomerase
publication title Structural and functional characterization of three DsbA paralogues from Salmonella enterica serovar typhimurium
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 73
structure length 199
sequence length 199
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3l9uA00
1FG4A 6GSYA 5DQYA 1UC7A 5J41A 3QR6A 4LA1A 1K0DA 5LCZA 5HFKA 2I81A 4RI7A 1ZGNA 2HRFA 4KNDA 3EU3A 2FHEA 2NDOA 4F0CA 5D9TA 4V2MA 1EOHA 2LQOA 1UN2A 4WXTA 3Q74A 4MJBA 1YDKA 6GSXA 4O92A 4I97A 3ZIVA 4XHMA 2YNXA 3GH6A 1V57A 13GSA 2C0DA 4MK3A 2X8HA 1F9MA 3RPNA 2L4CA 4FYUA 2M46A 2H76A 1QK8A 3KTLA 2WGRA 3QDNA 3J7Yk 2DIYA 2WS2A 1LBKA 3V1WA 3UBLA 3EVIA 4IQAA 4HJMA 3NIVA 2VD1A 2GVPA 3F9UA 3UARA 1PL1A 2DJ0A 3ED3A 4BVYA 3EC3A 1EV9A 5D9XA 3MWHA 1X0RA 4Z7XA 3TJBA 1JZDA 1XIYA 4PUFC 3GSSA 3VWUA 1GSSA 1GSDA 1GLPA 3ZITA 4EO3A 1YEXA 2FGXA 1SYXA 3L0HA 1GP1A 4OCEA 2B1LA 2I3YA 8GSSA 3GX0A 4ZXGA 5D73A 4MH2A 2F9SA 1AUCA 1ZYEA 4ECJA 1G7EA 4F82A 1EZKA 4XS4A 5G30A 2ON7A 3D22A 3NOFA 1M9AA 3CTFA 2A2SA 1FW1A 5FWGA 2HT9A 4ZB8A 2K9FA 1NSWA 4XRAA 3UAPA 1K3LA 1TRUA 1OC3A 2B5XA 1R7HA 3RHBA 2PGTA 3FRCA 4DVCA 2HYXA 2EIQA 2HI7A 1EWXA 1I5GA 1TKDB 4BWSA 10GSA 2JADA 3CTGA 2ALBA 1YF0A 2IN3A 4KE3A 1WOUA 2MMOA 3ISOA 5GZZB 1WJKA 1XXUA 4NPBA 4OO5A 4MCUA 1T7PB 4ECIA 5IO2A 4TR3A 1BQ7A 3DVXA 2RM5A 2IMKA 3M0FA 4OWYA 3GL5A 1F6MC 3ME7A 3TJJA 1SL2B 5C00A 4L5LA 2B7JA 4ULXA 22GSA 1MD3A 3ZYWA 5AIVA 1X9WB 2J23A 3I43A 5ECSA 1K0CA 3BD2A 5G31A 2L5LA 1THOA 4MZCA 2H8LA 3TDGA 5DCGA 4YAVA 3TKQA 3F6DA 1YF1A 1ZL9A 4KX4A 5IMVA 1MD4A 1SYRA 4WR4A 2L6DA 4MA9A 1TW9A 1ERVA 2WDUA 1MDIA 3WGXA 3IHQA 2KOKA 5JCGA 2CZ2A 3HHVA 5ECRB 1AQWA 2LNTA 2Z9SA 4I2TA 2C3NA 3Q19A 4DSQA 1PA3A 3MNGA 3O3TA 4JR4A 1JZWA 1RK4A 2MMNA 1PRXA 3GYKA 2V2GA 2L57A 3TRXA 1G6WA 1TP9A 2N5FA 3KMOA 2YWIA 1PSQA 2VD0A 2GS3A 5ECMB 4JBBA 3ZVJA 1M2AA 1SD9A 3IBHA 1AXDA 2IPAA 4K8MA 2HSHA 4PQHA 5F0GA 4TR4A 4XIHA 2F8AA 3APQA 2WFCA 3DWVA 4IW9A 4GSSA 2WB9A 2LRNA 5KN2A 4K7IA 1YQ1A 5J4UA 5CO3A 4EXJA 4TR1B 3GKNA 5F05A 4MJCA 2VLTA 5KN3A 2C0EA 4WF4A 2H6XA 5CRDA 2O7KA 1Z6MA 3EE2A 4V2NA 4ZL8A 3KXOA 3C1RA 1NM3A 1BG5A 5CREA 2MBSA 2L4QA 1KTEA 1ZYQB 3TJFA 2HZFA 3FY7A 2PMTA 2DJ2A 2XPDA 1THXA 2VUPA 5IIZA 1WE0A 4WR5A 5JCWA 4CW9A 5A5KA 2DIZA 5F06A 3L9SA 3RDWA 1T00A 4WKWA 1U87A 4EDZA 2GLRA 5ENUA 2DMMA 3EWLA 2K8VA 1G7OA 5GAND 2DJKA 1RW1A 2C3QA 6GSTA 3GL3A 3UL3A 4AJ8A 4GXZA 1JFUA 1ERWA 2YV7A 3FHKA 4OFTA 3OR5A 1OE8A 1XW9A 1DE2A 1W4VA 4JEDA 4IJ3A 1A2JA 5H5SA 3L9VA 4NMUA 1XVQA 3VWWA 3C73A 5DQSA 2ZCTA 4K9ZA 3RAZA 5DDLA 5E4WA 3A2WA 3QFAC 4HZ4A 1AIUA 5IO0A 3GRXA 1M99A 1S3AA 4GSNA 1YJ6A 2IFQA 3QFBC 5A4VA 1K3OA 2AV4A 3KIJA 1E2YA 5HR3A 2YV9A 3ZREA 2QKEA 2GSRA 2AJQB 1TI3A 1U6TA 5ELAA 3O6TA 5B8BA 3IE3A 3GHAA 4ACSA 2JSYA 4HU9A 1SJZA 2DSAA 3TRPA 3ERGA 4TR1A 1XWGA 1A8LA 2H70A 1A0RP 3A2XA 4EDYA 4RQXA 3EMXA 3BOAA 2I4AA 2JZSA 2E0QA 5HR2A 1U3AA 1ERTA 4F9ZA 1XZOA 5DALB 3UJ1A 4IVFA 3GMFA 3DKSA 1FVJA 3VURA 2VLUA 2TIRA 3F6FA 1EOGA 1GNWA 5IMFA 4HI7A 6GSSA 4N0VA 3MDKA 3EINA 2EIOA 1XBSA 1GL8A 2FUG2 4G10A 4MF5A 3VFIA 1SL0B 4N10A 4OD7A 2EC4A 3SWLA 1GTUA 4MH3A 3D4TA 2CZ3A 3DIEA 2L59A 4IGJA 4YAPA 4J57E 3ERFA 2OACA 2WZ9A 1AC1A 4CHSA 1KBNA 3A5WA 3M9JA 4FH8A 1TK0B 2CX4A 2AB6A 3ERWA 1EP7A 4IQ1A 2QC7A 4PURA 3J7Yb 3PR8A 5A4UA 1DUGA 2PBJA 3NZNA 2YCDA 2G0FA 1EEMA 2MMZA 5IOWA 2FWGA 5CAXA 3TJKA 2IMDA 2NBSA 4N0ZA 4KCEA 4F03A 5LNKe 2H71A 4IJIA 1B9YC 4PQIA 1RQMA 5ECQB 2LJAA 2MZCA 3D0ZA 2VCTA 5D8IA 3M3MA 4ISDA 2B7KA 4BVXA 1XPVA 1TXXA 3QMXA 1O73A 3EURA 1JHBA 4CDOA 2H19A 2E2MA 4WBJA 3FZ4A 2G2QA 2FNOA 4RI6A 1XVWA 2VAFA 1HYUA 3W6GA 1PGTA 1GLQA 4V1Ag 4OO4A 4KAEA 3GNJA 1Q98A 1PL2A 4HQZA 2XPEA 4MLYA 2JZRA 1BAYA 3HXSA 3TUEA 3KMNA 2VLVA 2X99A 2O8VB 4PXOA 2F3MA 2XBIA 4KSMA 5DALA 2GTUA 4AGSA 4QQ7A 4IKHA 2M72A 3TGZA 1ON4A 2YANA 5CP1A 1PN9A 3CMIA 2VL3A 4PUAA 5B7CA 2J9HA 3RBTA 2PPTA 2LUSA 19GSA 1I9DA 1N8JA 2OBKA 3IAM2 5IMAA 5D9WA 3GSTA 1GUMA 2FCHA 1VF1A 3LJRA 3EMPA 2F51A 2H1GA 5ECPB 2H0IA 3L4NA 1R26A 3VK9A 2GZPA 1WMJA 2DJJA 4K1FA 2DLXA 2A2RA 1B8XA 2PUKC 5L71A 3O76A 2PVQA 1Z7RA 2GQKA 4HQSA 3DD3A 2X8GA 2GT5A 2LJRA 1T8EB 2RIIA 5EL8A 1XFLA 1NHYA 3KTBA 3D5JA 4XRDA 2VCZA 5ECKB 2C4JA 2C8UA 2VCWA 2VCVA 4GLTA 1ABAA 2GDRA 1OE7A 3HKRA 4JZQA 4GSTA 3P90A 4ZB6A 3H4KA 2FA8A 2IWTA 5G2ZA 4NXIA 4E8HA 4MDCA 4K7OA 5D96A 2AAWA 2AYTA 1M7TA 3ZMKA 1N2AA 4G2EA 4N30A 3CRUA 1H75A 2LNSA 2LQQA 2LSTA 3FR3A 4OFMA 3CBUA 1DBYA 1U3IA 2V6OA 1NHOA 2VL9A 2REMA 4FIWA 1V98A 3I69A 3QPMA 2GQLA 2TRXA 2H1DA 1T3BA 3KH9A 1SU9A 4I8BA 5CRHA 6GSVA 3F4TA 1HD2A 2CT6A 5ECNB 3IXRA 3GX8A 1FB0A 3ZVJD 5H5QA 3U6VA 1TK8B 1VF3A 4ML6A 3M8NA 2HFDA 3GN3A 2K18A 4KB3A 4HUAA 5B8AA 1MDKA 4XS1A 2IL3A 2FD3A 5DAKB 2TRCP 5ECLB 2PERA 4TXVA 4MPGA 1OKTA 3GH9A 4ZBAA 1BYEA 2DBCA 3BCKA 5AISA 2BJXA 1E6BA 3KM6A 1GULA 1O7UA 4KSOA 1HQOA 1O8WA 2HLSA 3KZQA 1A2LA 2KP2A 1SK2A 5ECIB 2AHEA 3GKXA 1GTIA 4POBA 2N5BA 1BEDA 3G7YA 3L9UA 5G5FA 3FK8A 4AF2A 5DJMA 1SJIA 3RPPA 4MZBA 1PX6A 2QSIA 5IPHA 3ME8A 1A2MA 6GSUA 1M9BA 2V1MA 3FZAA 4KUNA 4I2UA 3DEXA 2VO4A 1SKWB 1VF2A 2X8CA 3TKSC 2WJUA 2LTKA 2R37A 4ZILA 4TRXA 3LG6A 2JSZA 3VPQA 3TJGA 3KGKA 4J56E 1WRYA 3TKSA 1AAZA 1OVNA 1R4WA 1DE1A 1B4PA 1XCCA 3ZL5A 3HZ4A 3PINA 4AJ6A 3QAWA 4NAXA 1USBA 3LQ7A 5EY6A 3KD0A 3WT1A 2C0FA 4N11A 1XWCA 2A4VA 1GUKA 4K0GA 4Q5FA 4TKYA 5CRWA 3LYPA 4GCIA 3C7MA 4IBPA 1V40A 4TOPA 3C1SA 4H86A 2KLXA 2FWEA 5KN0A 3AY8A 1AQXA 3M9KA 4LMVA 5JWQB 4XCSA 4GWRA 1Z5YE 2ES7A 4D73B 5GAPD 2JZTA 1B4QA 1FAAA 4IS0A 1TK5B 11GSA 1EGOA 3ZMLA 5G1LA 17GSA 4K0NA 5GSTA 3CYNA 1PQNA 2YZHA 1JLVA 1SJ6A 4O7HA 1TJDA 1TDIA 1EEJA 3WYWA 5IOXA 4HJ2A 1A8YA 1PKZA 5IQYA 3QD9A 5JWRB 1ILOA 2B6MA 5DAKA 4NHWA 1GTBA 3HJMA 2OBIA 3P2AA 1BJXA 1FOVA 2V6KA 3F4RA 1GSUA 3IA1A 5GSSA 5F07A 1W89A 2L6CA 2H73A 2P31A 4X0XA 3RHCA 3ZFLA 3LXTA 3GURA 3HVXA 1ZOFA 2KP1A 5HR1A 5ELGA 2GZYA 5A4WA 1FVKA 3LFLA 1MEKA 2V32A 4F2IA 1ZZYA 4E8EA 1GRXA 3APSA 2PWJA 3TKSE 3E9JB 2OA7A 4HU7A 1KEBA 2FWFA 2E2GA 3FR9A 1Y6EA 3HY2A 1XW6A 1B9XC 1MTCA 1F2EA 4ZIJA 3WGDA 3ZLPA 3P8WA 3QCPA 2O85A 4POKA 4TVEA 3QAGA 2R2JA 2OE1A 5E59A 1QQ2A 5FHIA 4BPYA 2B5EA 2B3SA 5DJLA 3F4SA 4EE0A 1XOBA 1OC8A 1YEPA 1K0MA 1TRWA 2P5QA 1VRSD 2H66A 3HVSA 4MF7A 1V58A 2VL2A 1K0NA 2LS5A 3GFKA 2C0GA 2YP6A 1PMTA 2M80A 1UVZA 4D73A 3VWXA 4IN0A 2OJLA 1M2BA 2ZUPA 2DJ1A 2H0HA 3H93A 3TCOA 1TRSA 2CQ9A 1UA5A 3DRNA 1EP8A 1G0TA 3GV1A 4IELA 18GSA 1X5CA 3D4MA 2O87A 4BA7A 4LLRA 3IAS2 5HQPA 3WGEA 1XWAA 1GWCA 2CVKA 3R2QA 4QL7A 3FR6A 1O6JA 1URMA 3S9FA 1CQHA 1HNCA 4ZBDA 14GSA 3KP9A 2C3TA 3A3TA 3MSZA 2VM2A 3BBYA 1Z3EA 3VLNA 3IC4A 3ZFBA 2BTOT 12GSA 3HJPA 3U5RE 3LEFA 3Q6OA 1YKCA 3TB2A 2C80A 5J5NA 3KEBA 2OKAA 4JU5A 3SBCA 5DCHA 3VI7A 3F63A 3F3RA 3GTUB 5KEJA 1BX9A 4PX1A 4PNFA 4Q5RA 3TOUA 4L8EA 5EPFA 3UOMA 2I1UA 5ECOB 1JZOA 1QXHA 4KA0A 4ILFA 1GSYA 3BJ5A 2LKUA 3F3QA 2H30A 3ZIJA 4EVMA 2NPBA 2H6ZA 2OADA 2LRTA 4ID0A 3CXGA 4YQMA 3IK9A 2DC5A 3TKPA 1G6YA 4X1UA 1OYJA 1Z6NA 2CV4A 3G7IA 1A24A 4G19A 4L0WA 3HDCA 3LSZA 4TN8A 5CRGA 4ZL7A 2RUEA 2P0GA 1Z7PA 4LMWA 2GSQA 1ST9A 2GSSA 4GRFA 4KGIA 1FO5A 5D9VA 1OC9B 3GUSA 2LEGA 1A0FA 1H4OA 3GKKA 1O81A 2YZUA 3KH7A 5EVOA 5LD0A 4KH7A 1SKRB 4Q5NA 4YQVA 1VGLA 4OFNA 5C04A 4IP1A 4FO5A 1K0AA 2GT6A 3VPTA 5IM9A 1PX7A 4OMVA 2JACA 4FYBA 4HZ2A 2NTOA 4POMA 4ECBA 4JRRA 2WRTA 3W8SA 1B48A 2NVLA 3HA9A 5COHA 3FEUA 2O89A 5J9BA 2ON5A 3KCMA 1WPIA 1IYIA 2MMAA 4FYCA 4DSSB 5IMZA 1VF4A 5AN1A 2H6YA 3KJYA 4PNGA 1GSQA 1TOFA 3FW2A 1Z9HA 3K8NA 4DSRA 1XW5A 4HS1A 4RQRA 3H1NA 1TI1A 4TXOB 1V9WA 3HYPA 1QMVA 1LU4A 3GTUA 5G1KA 2PVOC 4WEYA 4X43A 1XWBA 1XWKA 3MAKA 2HRNA 2IJYA 3DYRA 3HCZA 1GUHA 4NV2A 1PD21 4MJEA 3GIXA 4MPFA 1FB6A 2GZZA 3UEMA 5ECHB 1TU7A 1GNEA 2CA8A 1KNGA 2XHFA 5ABRA 3LGCA 3DMLA 4IHUA 5IMDA 1Y25A 4KW6A 2JU5A 1GH2A 5HR0A 4HOJA 2CAIA 1ML6A 1TU8A 3IPZA 4I6XA 3LXZA 4KDXA 5INYA 2LJKA 1OC9A 2VM1A 3D6IA 4AJ7A 3HJOA 4BWQA 2YN1A 5ID2B 2OE0A 1J08A 3UIWA 4XTSA 2GQMA 3QOUA 4GQCA 4J2FA 5AGYA 3APOA 4V2LA 3IK7A 2C1YA 2K6VA 4EUYA 2V41A 3C71A 2HXKA 2VIMA 2RM6A 2VOCA 4POLA 1JLWA 3US3A 2HE3A 1M0UA 4BL7A 2JL4A 5IPGA 5FT3A 2XC2A 3N9JA 2HNLA 2R4VA 3TKRA 16GSA 3FZ5A 3UVTA 4KCAA 2I9HA 3H79A 4MF6A 4DSSA 2CX3A 1K0OA 3N5OA 4GQFA 2P5RA 3PH9A 2AUVA 3DVWA 4O5RA 5B6NA 3FZ9A 3GA4A 1HNAA 2WCIA 3CSJA 4EF0A 3VWVA 1YKAA 1K3YA 2RUFA 2VCQA 4ZB9A 4L5OA 1QGVA 2D2ZA 2CAQA 1SK1A 4TXOA 2B1KA 2H1BA 2IFQB 3JCML 4IP6A 4GF0A 2HZEB 2PU9C 5D93A 2RLIA 1T1VA 4LL1B 4PGTA 3H8QA 7GSSA 1NW2A 3PGTA 1MDJA 1JZRA 1GTAA 1Q4JA 3ZTLA 4QL9A 1R5AA 2FA4A 4WF5A 4K6XA 3DGQA 2BMXA 1F3BA 3UBKA 5F8BA 3DXBA 5DVBA 1M2DA 4GTUA 2FWHA 4HDEA 2CVBA 3CRTA 2B5YA 4MP4A 2R3XA 4KDYA 5HFIA 3LYKA 1K0BA 1S3DA 3CSIA 3G7JA 2DJ3A 4YH2A 2GGTA 1U88A 2H75A 3IDVA 2YPMA 1FHEA 2EIRA 4K2DA 5J9CA 2E7PA 2MBTA 5J3RA 3LORA 3G9BA 2YOIA 3ZZXA 3L78A 3UMAA 5ID2A 2QGVA 3IV4A 1AQVA 3F0IA 4NWYA 1WWJA 4Q5QA 1X5DA 2R6KA 1ZCPA 3D21A 1WP0A 4KDUA 4HEA2 4EL1A 4NHZA 1HNBA 4ML1A 4XS6A 3WD6A 1SD8A 4JR6A 4LL4B 1QUWA 4MZWA 5AIXA 5CYYA 4ZBBA 1J9BA 2LRCA 2VCXA 4L0UA 1R5PA 1TTZA 3QAVA 5B6MA 5G5EA 4EKZA 4V1Ap 3ZRDA 2H72A 4EC0A 2OE3A 2IMIA 3VI5A 2N5AA 1C72A 3EYTA 2H01A 1X9MB 4MABA 5H5RA 2L5OA 4I5QA 3HZ8A 5KN1A 3I9V2 2IMFA 1ACVA 4F0BA 2HSYA 1F3AA 1S3CA 3E3EA 2FY6A 4TW5A 3CSHA 3Q18A 5CNWA 3TRQA 4MJAA 2HZEA 3M1GA 2GSTA 4DEJA 5DBQA 1YY7A 3GKMA 4PQ1A 3UVHA 3I6AA 1T4YA 3TOTA 1SK0A 2KUCA 2DMLA 1DSBA 1GSFA 2MYGA 2FLSA 2KHPA 2R5GA 4NV5A 2VL2C 4ECCA 1EGRA 3LWAA 1IYHA 4WBRD 3FKFA 1AW9A 2F8FA 5HFGA 1X5EA 3WT2A 2H74A 2IIYA 4RUVA 2XBQA 2IMEA 3BCIA 2YWOA 2H0GA 1O85A 1QFNA 1SL1B 1EV4A 2YWNA 3W8JA 1O8XA 3A2VA 3IR4A 1T4ZA 2PN8A 5JCUA 5JWOB 4TR0A 2CVDA 3IRAA 5IMCA 3FYGA 1ERUA 1XOAA 1J0FA 2LV3A 1SENA 2WULA 2ZNMA 3P7XA 4OCFA 3F8UA 1TRVA 3HD5A 4ZL9A 1PKWA 2X64A 3KP8A 1ZMAA 4K7NA 3E0UA 6GSWA 1F37A 3HVVA 1CQGA 1A23A 4G9HA 2YWMA 2YJHA 9GSSA 4XS4B 4WETA 1LJRA 1WIKA 4P3YB 3C8EA 1SKSB 1OKDA 4MMMA 3EU4A 4JE1A 4YQUA 2K8SA 4O32A 1X9SB 20GSA 1OAZA 1YZXA 2YJ7A 3IOSA 1V2AA 1GSEA 2H1AA
chains in the Genus database with same CATH superfamily
1FG4A 6GSYA 3IC8A 5DQYA 1UC7A 5J41A 3QR6A 4LA1A 1K0DA 5LCZA 5HFKA 2I81A 4RI7A 1ZGNA 2HRFA 4KNDA 3EU3A 2FHEA 2NDOA 4F0CA 5D9TA 4V2MA 1EOHA 2LQOA 1UN2A 4WXTA 3Q74A 4MJBA 1YDKA 6GSXA 4O92A 4I97A 3FMWA 3ZIVA 4XHMA 4YKGA 2YNXA 3GH6A 1PFOA 1V57A 13GSA 2C0DA 4MK3A 2X8HA 1F9MA 3RPNA 2L4CA 4FYUA 2M46A 2H76A 1QK8A 3KTLA 2WGRA 3QDNA 3J7Yk 2DIYA 2WS2A 1LBKA 3V1WA 3UBLA 3EVIA 4IQAA 4HJMA 3NIVA 2VD1A 2GVPA 4Z2RA 3F9UA 3UARA 1PL1A 2DJ0A 3ED3A 4BVYA 3EC3A 1EV9A 5D9XA 3MWHA 1X0RA 4Z7XA 3TJBA 1JZDA 1XIYA 4PUFC 3GSSA 3VWUA 1GSSA 1GSDA 1GLPA 3ZITA 4EO3A 1YEXA 2FGXA 1SYXA 3L0HA 1GP1A 4OCEA 2B1LA 2I3YA 8GSSA 3GX0A 4ZXGA 5D73A 4MH2A 2F9SA 1AUCA 1ZYEA 4ECJA 1G7EA 4F82A 1EZKA 4XS4A 5G30A 2ON7A 3D22A 3NOFA 1M9AA 3CTFA 2A2SA 1FW1A 5FWGA 2HT9A 4ZB8A 2K9FA 2R0PA 1NSWA 4XRAA 3UAPA 1K3LA 1TRUA 1OC3A 2B5XA 1R7HA 3RHBA 2PGTA 3FRCA 4DVCA 2HYXA 2EIQA 3HVNA 2HI7A 1EWXA 1I5GA 1TKDB 4BWSA 10GSA 2JADA 3CTGA 2ALBA 1YF0A 2IN3A 4KE3A 1WOUA 2MMOA 1FOHA 3ISOA 5GZZB 1WJKA 4Z2UA 1XXUA 4NPBA 4OO5A 4MCUA 1T7PB 4ECIA 5IO2A 4TR3A 1BQ7A 3DVXA 2RM5A 2IMKA 3M0FA 4OWYA 3GL5A 1F6MC 3ME7A 3TJJA 1SL2B 5C00A 4L5LA 2B7JA 4ULXA 22GSA 1MD3A 4X4JA 3ZYWA 5AIVA 1X9WB 2J23A 3I43A 5ECSA 1K0CA 3BD2A 5G31A 2L5LA 1THOA 4MZCA 2H8LA 4PTSA 3TDGA 5DCGA 4YAVA 3TKQA 3F6DA 4EIQA 1YF1A 1ZL9A 4KX4A 5IMVA 1MD4A 1SYRA 4WR4A 2L6DA 4MA9A 1TW9A 1ERVA 2WDUA 1MDIA 3WGXA 3IHQA 2KOKA 5JCGA 2CZ2A 3HHVA 5ECRB 1AQWA 2LNTA 2Z9SA 4I2TA 2C3NA 3Q19A 4DSQA 1PA3A 3MNGA 3O3TA 4JR4A 1JZWA 1RK4A 2MMNA 1PRXA 3GYKA 2V2GA 2L57A 3TRXA 1G6WA 1TP9A 2N5FA 3KMOA 2YWIA 1PSQA 2VD0A 2GS3A 5ECMB 4JBBA 3ZVJA 1M2AA 1SD9A 3IBHA 1AXDA 2IPAA 4K8MA 2HSHA 4PQHA 5F0GA 2HSMA 4TR4A 4XIHA 2F8AA 3APQA 2WFCA 3DWVA 4IW9A 4GSSA 2WB9A 2HRAA 2LRNA 4CY6A 5KN2A 4K7IA 1YQ1A 5J4UA 5CO3A 4EXJA 4TR1B 3GKNA 5F05A 4MJCA 2VLTA 5KN3A 2C0EA 4WF4A 2H6XA 5CRDA 2O7KA 1Z6MA 3EE2A 4V2NA 4ZL8A 3KXOA 3C1RA 1NM3A 1BG5A 5CREA 2MBSA 4USSA 2L4QA 1KTEA 1ZYQB 3TJFA 2HZFA 3FY7A 2PMTA 2DJ2A 2XPDA 1THXA 2VUPA 5IIZA 1WE0A 4WR5A 5JCWA 4CW9A 5A5KA 2DIZA 5F06A 3L9SA 3RDWA 1T00A 4WKWA 1U87A 4EDZA 2GLRA 5ENUA 2DMMA 3EWLA 2K8VA 1G7OA 5GAND 2DJKA 1RW1A 2C3QA 6GSTA 3GL3A 3UL3A 4AJ8A 4GXZA 1JFUA 1ERWA 2YV7A 3FHKA 4OFTA 3OR5A 1OE8A 1XW9A 1DE2A 1W4VA 4JEDA 4IJ3A 1A2JA 5H5SA 3L9VA 4NMUA 1XVQA 3VWWA 3C73A 5DQSA 2ZCTA 4K9ZA 3RAZA 5DDLA 5E4WA 3A2WA 3QFAC 4HZ4A 1AIUA 5IO0A 3GRXA 1M99A 1S3AA 4GSNA 2X4AA 1YJ6A 2IFQA 3QFBC 5A4VA 1K3OA 2AV4A 3KIJA 1E2YA 5HR3A 2YV9A 3ZREA 2QKEA 2GSRA 2AJQB 1TI3A 1U6TA 5ELAA 3O6TA 5B8BA 3IE3A 3GHAA 4ACSA 3CQFA 2JSYA 5BRTA 4HU9A 1SJZA 2DSAA 3TRPA 3ERGA 4TR1A 1XWGA 1A8LA 2H70A 1A0RP 3A2XA 4EDYA 4RQXA 3EMXA 3BOAA 2I4AA 2JZSA 2E0QA 5HR2A 1U3AA 1ERTA 4F9ZA 1XZOA 5DALB 3UJ1A 3IHGA 3LW9A 4IVFA 3GMFA 3DKSA 1FVJA 3VURA 2VLUA 2TIRA 3F6FA 1EOGA 1GNWA 5IMFA 4HI7A 6GSSA 4N0VA 3MDKA 3EINA 2EIOA 1XBSA 1GL8A 2FUG2 4G10A 4MF5A 3VFIA 1SL0B 4N10A 4OD7A 2UZ8A 2EC4A 3SWLA 1GTUA 4MH3A 3D4TA 2CZ3A 3DIEA 2L59A 4IGJA 4YAPA 4J57E 3ERFA 2OACA 2WZ9A 1AC1A 4CHSA 1KBNA 3A5WA 3M9JA 4FH8A 1TK0B 2CX4A 2AB6A 3ERWA 1EP7A 4IQ1A 2QC7A 4PURA 3J7Yb 3PR8A 5A4UA 1DUGA 2PBJA 1ZYNA 3NZNA 2YCDA 2G0FA 1EEMA 2MMZA 5IOWA 2FWGA 5CAXA 3TJKA 2IMDA 2NBSA 4N0ZA 4KCEA 4F03A 5LNKe 2H71A 4IJIA 1B9YC 4PQIA 1RQMA 5ECQB 2LJAA 2MZCA 3D0ZA 2VCTA 5D8IA 3M3MA 4ISDA 2B7KA 4BVXA 1XPVA 1TXXA 5KOWA 3QMXA 1O73A 3EURA 1JHBA 4CDOA 2H19A 2E2MA 4WBJA 3FZ4A 2G2QA 2FNOA 4RI6A 1XVWA 2VAFA 1HYUA 3EPTA 3W6GA 1PGTA 1GLQA 4V1Ag 4OO4A 4KAEA 3GNJA 1Q98A 1PL2A 4HQZA 2XPEA 4MLYA 2JZRA 1BAYA 3HXSA 3TUEA 3KMNA 2VLVA 2X99A 2R0GA 2O8VB 4PXOA 2F3MA 2XBIA 4KSMA 5DALA 2GTUA 4AGSA 4QQ7A 4IKHA 2M72A 3TGZA 1ZYPA 1ON4A 2YANA 5CP1A 1M3JA 1PN9A 3CMIA 2VL3A 4PUAA 5B7CA 2J9HA 3RBTA 2PPTA 2LUSA 19GSA 1I9DA 1N8JA 2OBKA 3IAM2 5IMAA 5D9WA 3GSTA 1GUMA 2FCHA 1VF1A 3LJRA 3EMPA 2F51A 2H1GA 5ECPB 2H0IA 3L4NA 1R26A 3VK9A 2GZPA 1WMJA 2DJJA 4K1FA 2DLXA 2A2RA 1B8XA 2PUKC 5L71A 3O76A 2PVQA 1Z7RA 2GQKA 4HQSA 3DD3A 2X8GA 2GT5A 2LJRA 1T8EB 2RIIA 3R3EA 5EL8A 1XFLA 1NHYA 3KTBA 3D5JA 4XRDA 2VCZA 5ECKB 2C4JA 2C8UA 2VCWA 2VCVA 4GLTA 1ABAA 2GDRA 1OE7A 3HKRA 4JZQA 4GSTA 3P90A 4ZB6A 3H4KA 2FA8A 2IWTA 5G2ZA 4NXIA 4E8HA 4MDCA 4K7OA 5D96A 2AAWA 2AYTA 1M7TA 3ZMKA 1N2AA 4G2EA 4N30A 3CRUA 1H75A 2LNSA 2LQQA 2LSTA 3FR3A 4OFMA 3CBUA 1DBYA 1U3IA 2V6OA 1NHOA 2VL9A 2REMA 4FIWA 1V98A 3I69A 3QPMA 2GQLA 2TRXA 2H1DA 1T3BA 3KH9A 1SU9A 4I8BA 5CRHA 6GSVA 3F4TA 1HD2A 2CT6A 5ECNB 3IXRA 3GX8A 1FB0A 3ZVJD 4O5UA 5H5QA 3U6VA 1TK8B 1VF3A 4ML6A 3M8NA 2HFDA 3GN3A 2K18A 4KB3A 4HUAA 5B8AA 1MDKA 4XS1A 2IL3A 2FD3A 5DAKB 2TRCP 5ECLB 2PERA 4TXVA 4MPGA 1OKTA 3GH9A 4ZBAA 1BYEA 2DBCA 3BCKA 5AISA 2BJXA 1E6BA 3KM6A 1GULA 1O7UA 4KSOA 1HQOA 1O8WA 2HLSA 3KZQA 1A2LA 2KP2A 1SK2A 5ECIB 2AHEA 3GKXA 1GTIA 4POBA 2N5BA 1BEDA 3G7YA 3L9UA 5G5FA 3FK8A 4AF2A 5DJMA 1SJIA 3RPPA 4MZBA 1PX6A 1PN0A 2QSIA 5IPHA 3ME8A 3PPUA 1A2MA 6GSUA 1M9BA 2V1MA 3FZAA 4KUNA 4I2UA 3DEXA 2VO4A 1SKWB 1VF2A 2X8CA 3TKSC 2WJUA 2LTKA 2R37A 4ZILA 4TRXA 3LG6A 2JSZA 3VPQA 3TJGA 3KGKA 4J56E 1WRYA 3TKSA 1AAZA 1OVNA 1R4WA 1DE1A 1B4PA 1XCCA 3ZL5A 3HZ4A 3PINA 4AJ6A 3QAWA 4NAXA 1USBA 3LQ7A 5EY6A 3KD0A 3WT1A 2X49A 2C0FA 5BMUA 4N11A 1XWCA 2A4VA 1GUKA 2A4HA 4K0GA 4Q5FA 4TKYA 5CRWA 3LYPA 4A5PA 4GCIA 3C7MA 4IBPA 1V40A 4TOPA 3C1SA 4H86A 2KLXA 2FWEA 5KN0A 3AY8A 1AQXA 3M9KA 4LMVA 5JWQB 4XCSA 4GWRA 1Z5YE 2ES7A 3MIXA 4D73B 5GAPD 2JZTA 1B4QA 1FAAA 4IS0A 1TK5B 11GSA 1EGOA 3ZMLA 5G1LA 17GSA 4K0NA 5GSTA 3CYNA 1PQNA 2YZHA 1JLVA 1SJ6A 4O7HA 1TJDA 1TDIA 1EEJA 3WYWA 2A2PA 5IOXA 4HJ2A 1A8YA 1PKZA 5IQYA 3QD9A 5JWRB 1ILOA 2B6MA 5DAKA 4NHWA 1GTBA 3HJMA 2OBIA 3P2AA 1BJXA 1FOVA 2V6KA 3F4RA 1GSUA 3IA1A 5GSSA 5F07A 1W89A 2L6CA 2H73A 2P31A 4X0XA 3RHCA 3ZFLA 3LXTA 3GURA 3HVXA 1ZOFA 4G0IA 2KP1A 5HR1A 5ELGA 2GZYA 5A4WA 1FVKA 3LFLA 5KOXA 2QA2A 1MEKA 2V32A 4K5SA 4F2IA 1ZZYA 4E8EA 1GRXA 3APSA 2PWJA 3TKSE 3E9JB 2OA7A 4HU7A 4O5QA 1KEBA 2FWFA 2E2GA 3FR9A 1Y6EA 3HY2A 1XW6A 1B9XC 1MTCA 1F2EA 4ZIJA 3WGDA 3ZLPA 3P8WA 3QCPA 2O85A 4POKA 4TVEA 3QAGA 4K2XA 2R2JA 2OE1A 5E59A 1QQ2A 5FHIA 4G0KA 4BPYA 2B5EA 2B3SA 5DJLA 3F4SA 4EE0A 1XOBA 1OC8A 1YEPA 1K0MA 1TRWA 2P5QA 1VRSD 2H66A 3HVSA 4MF7A 1V58A 2VL2A 1K0NA 2LS5A 3GFKA 2C0GA 2YP6A 1PMTA 2M80A 1UVZA 4D73A 3VWXA 4IN0A 2OJLA 1M2BA 2ZUPA 2DJ1A 2H0HA 3H93A 1S3RA 3TCOA 1TRSA 2CQ9A 4ICYA 1UA5A 3DRNA 1EP8A 1G0TA 3GV1A 4IELA 18GSA 1X5CA 3D4MA 2O87A 4BA7A 4LLRA 3IAS2 5HQPA 3WGEA 1XWAA 1GWCA 2CVKA 3R2QA 4QL7A 3FR6A 1O6JA 4BVYB 1URMA 3S9FA 1CQHA 1HNCA 4ZBDA 14GSA 3KP9A 2C3TA 3A3TA 3MSZA 2VM2A 3BBYA 1Z3EA 3VLNA 3IC4A 3ZFBA 2BTOT 12GSA 3HJPA 3U5RE 3LEFA 3Q6OA 1YKCA 3TB2A 2C80A 5J5NA 3KEBA 2OKAA 4JU5A 3SBCA 5DCHA 3VI7A 3F63A 3F3RA 3GTUB 5KEJA 1BX9A 4PX1A 4PNFA 4Q5RA 3TOUA 4L8EA 5EPFA 3UOMA 2I1UA 5ECOB 1JZOA 1QXHA 4KA0A 4ILFA 1GSYA 3BJ5A 2LKUA 3F3QA 2H30A 3ZIJA 4EVMA 2NPBA 2H6ZA 2OADA 2LRTA 4ID0A 3A5IA 3CXGA 4YQMA 3IK9A 2DC5A 3TKPA 1G6YA 4X1UA 1OYJA 1Z6NA 2CV4A 3G7IA 1A24A 4G0LA 4G19A 4L0WA 3HDCA 3LSZA 4TN8A 5CRGA 4ZL7A 2RUEA 2P0GA 1Z7PA 4LMWA 2GSQA 1ST9A 2GSSA 4GRFA 4KGIA 1FO5A 5D9VA 1OC9B 3GUSA 2LEGA 1A0FA 1H4OA 3GKKA 1O81A 2YZUA 3KH7A 5EVOA 5LD0A 4KH7A 4MNNA 1SKRB 4Q5NA 4YQVA 1VGLA 4OFNA 5C04A 4IP1A 4BL7B 4FO5A 1K0AA 2GT6A 3VPTA 5IM9A 1PX7A 4OMVA 2JACA 4FYBA 4HZ2A 2NTOA 4POMA 4ECBA 4JRRA 2WRTA 3W8SA 1B48A 2NVLA 3HA9A 5COHA 3FEUA 2O89A 5J9BA 2ON5A 2DKIA 3KCMA 1WPIA 1IYIA 2MMAA 4FYCA 4DSSB 5IMZA 1VF4A 5AN1A 2H6YA 3KJYA 4PNGA 1GSQA 1TOFA 3FW2A 1Z9HA 3K8NA 4DSRA 1XW5A 4HS1A 4RQRA 3H1NA 1TI1A 4TXOB 1V9WA 3HYPA 1QMVA 1LU4A 3GTUA 5G1KA 2PVOC 4K5RA 4WEYA 4X43A 1XWBA 1XWKA 3MAKA 2HRNA 2IJYA 3DYRA 3HCZA 1GUHA 4NV2A 1PD21 4MJEA 3GIXA 4MPFA 1FB6A 2GZZA 3UEMA 5ECHB 1TU7A 1GNEA 2CA8A 1KNGA 2XHFA 5ABRA 3LGCA 3DMLA 2DKHA 4IHUA 5IMDA 3MYDA 1Y25A 4KW6A 2JU5A 1GH2A 5HR0A 4HOJA 2CAIA 1ML6A 1TU8A 3IPZA 4I6XA 3LXZA 4KDXA 5INYA 2LJKA 1OC9A 2VM1A 3D6IA 4AJ7A 3HJOA 4BWQA 2YN1A 5ID2B 2OE0A 1J08A 3UIWA 4XTSA 2GQMA 3QOUA 4GQCA 4J2FA 5AGYA 3APOA 4V2LA 3IK7A 2C1YA 2K6VA 4EUYA 2V41A 2HRKA 3C71A 2HXKA 2VIMA 2RM6A 2VOCA 4POLA 1JLWA 3US3A 2HE3A 1M0UA 4BL7A 2JL4A 5IPGA 5FT3A 2XC2A 3N9JA 2HNLA 2R4VA 4FQUA 3TKRA 16GSA 3FZ5A 3UVTA 4KCAA 2I9HA 3H79A 4MF6A 4DSSA 2CX3A 1K0OA 3N5OA 4GQFA 2P5RA 3PH9A 2AUVA 3DVWA 4O5RA 5B6NA 3FZ9A 3GA4A 1HNAA 2WCIA 3CSJA 4EF0A 3VWVA 1YKAA 1K3YA 2RUFA 2VCQA 4ZB9A 4L5OA 1QGVA 2D2ZA 2CAQA 1SK1A 4TXOA 2B1KA 2H1BA 2IFQB 3JCML 4IP6A 4GF0A 2HZEB 4EIPA 2PU9C 5D93A 2RLIA 1T1VA 4LL1B 4PGTA 3H8QA 7GSSA 1NW2A 2R0CA 3PGTA 1MDJA 1JZRA 1GTAA 1Q4JA 2QA1A 3ZTLA 4QL9A 1R5AA 2FA4A 4WF5A 4K6XA 3DGQA 2BMXA 1F3BA 3UBKA 5F8BA 3DXBA 5DVBA 1XG8A 1M2DA 4GTUA 2FWHA 4HDEA 2CVBA 3CRTA 2B5YA 4MP4A 2R3XA 4KDYA 5HFIA 3LYKA 1K0BA 1S3DA 3CSIA 3G7JA 2DJ3A 4YH2A 2GGTA 1U88A 2H75A 3IDVA 2YPMA 1FHEA 2EIRA 4K2DA 5J9CA 2E7PA 2MBTA 5J3RA 3LORA 3G9BA 2YOIA 3ZZXA 3L78A 3UMAA 5ID2A 2QGVA 3IV4A 1AQVA 4BIKA 3F0IA 4NWYA 1WWJA 4Q5QA 1X5DA 2R6KA 1ZCPA 3D21A 1WP0A 4KDUA 4HEA2 4EL1A 4NHZA 1HNBA 4ML1A 4XS6A 3WD6A 1SD8A 4JR6A 4HSCX 4LL4B 1QUWA 4MZWA 5AIXA 5CYYA 4ZBBA 1J9BA 2LRCA 2VCXA 4L0UA 1R5PA 1TTZA 3QAVA 5B6MA 5G5EA 4EKZA 4V1Ap 3ZRDA 2H72A 4EC0A 2OE3A 4YKFA 2IMIA 3VI5A 2N5AA 1C72A 3EYTA 2H01A 1X9MB 4MABA 5H5RA 2L5OA 4I5QA 3HZ8A 5KN1A 3I9V2 2IMFA 1ACVA 4F0BA 2HSYA 1F3AA 1S3CA 3E3EA 2FY6A 4TW5A 3CSHA 4BVXB 3Q18A 5CNWA 3TRQA 4MJAA 2HZEA 3M1GA 2GSTA 4DEJA 5DBQA 1YY7A 3GKMA 4PQ1A 3UVHA 3I6AA 4Z2TA 1T4YA 3TOTA 1SK0A 2KUCA 2DMLA 1M3IA 1DSBA 1GSFA 2MYGA 2FLSA 2KHPA 2R5GA 4KF9A 4NV5A 2VL2C 4ECCA 1EGRA 3LWAA 1IYHA 4WBRD 3FKFA 1AW9A 2F8FA 5HFGA 1X5EA 3WT2A 2H74A 2IIYA 4RUVA 2XBQA 2IMEA 3BCIA 2YWOA 2H0GA 1O85A 1QFNA 1SL1B 1EV4A 2YWNA 3W8JA 1O8XA 3A2VA 3IR4A 1T4ZA 2PN8A 5JCUA 5JWOB 4TR0A 2CVDA 3IRAA 5IMCA 3FYGA 1ERUA 1XOAA 1J0FA 2LV3A 1SENA 2WULA 2ZNMA 3P7XA 4OCFA 3F8UA 1TRVA 3HD5A 4ZL9A 1PKWA 2X64A 3KP8A 1ZMAA 4K7NA 3E0UA 6GSWA 1F37A 3HVVA 1CQGA 1A23A 4G9HA 2YWMA 2YJHA 9GSSA 4XS4B 4WETA 1LJRA 1WIKA 4P3YB 3C8EA 1SKSB 1OKDA 4MMMA 3EU4A 4CY8A 4JE1A 4YQUA 2K8SA 4O32A 1X9SB 20GSA 1OAZA 1YZXA 2YJ7A 3IOSA 1V2AA 1GSEA 2H1AA
chains in the Genus database with same CATH topology
1FG4A 6GSYA 3IC8A 5DQYA 1UC7A 5J41A 3QR6A 4LA1A 1K0DA 5LCZA 5HFKA 2I81A 4RI7A 1ZGNA 2HRFA 4KNDA 3EU3A 2FHEA 2NDOA 4F0CA 5D9TA 4V2MA 1EOHA 2LQOA 1UN2A 4WXTA 3Q74A 4MJBA 1YDKA 6GSXA 4O92A 4I97A 3FMWA 3ZIVA 4XHMA 4YKGA 2YNXA 3GH6A 1V57A 13GSA 2C0DA 4MK3A 2X8HA 1F9MA 3RPNA 2L4CA 4FYUA 2M46A 2H76A 1QK8A 3KTLA 2WGRA 3QDNA 3J7Yk 2DIYA 2WS2A 1LBKA 3V1WA 3UBLA 3EVIA 4IQAA 4HJMA 3NIVA 2VD1A 2GVPA 4Z2RA 3F9UA 3UARA 1PL1A 2DJ0A 3ED3A 4BVYA 3EC3A 1EV9A 5D9XA 3MWHA 1X0RA 4Z7XA 3TJBA 1JZDA 1XIYA 4PUFC 3GSSA 3VWUA 1GSSA 1GSDA 1GLPA 3ZITA 4EO3A 1YEXA 2FGXA 1SYXA 3L0HA 1GP1A 4OCEA 2B1LA 2I3YA 8GSSA 3GX0A 4ZXGA 5D73A 4MH2A 2F9SA 1AUCA 1ZYEA 4ECJA 1G7EA 4F82A 1EZKA 4XS4A 5G30A 2ON7A 3D22A 3NOFA 1M9AA 3CTFA 2A2SA 1FW1A 5FWGA 2HT9A 4ZB8A 2K9FA 2R0PA 1NSWA 4XRAA 3UAPA 1K3LA 1TRUA 1OC3A 2B5XA 1R7HA 3RHBA 2PGTA 3FRCA 4DVCA 2HYXA 2EIQA 2HI7A 1EWXA 1I5GA 1TKDB 4BWSA 10GSA 2JADA 3CTGA 2ALBA 1YF0A 2IN3A 4KE3A 1WOUA 2MMOA 1FOHA 3ISOA 5GZZB 1WJKA 4Z2UA 1XXUA 4NPBA 4OO5A 4MCUA 1T7PB 4ECIA 5IO2A 4TR3A 1BQ7A 3DVXA 2RM5A 2IMKA 3M0FA 4OWYA 3GL5A 1F6MC 3ME7A 3TJJA 1SL2B 5C00A 4L5LA 2B7JA 4ULXA 22GSA 1MD3A 4X4JA 3ZYWA 5AIVA 1X9WB 2J23A 3I43A 5ECSA 1K0CA 3BD2A 5G31A 2L5LA 1THOA 4MZCA 2H8LA 4PTSA 3TDGA 5DCGA 4YAVA 3TKQA 3F6DA 4EIQA 1YF1A 1ZL9A 4KX4A 5IMVA 1MD4A 1SYRA 4WR4A 2L6DA 4MA9A 1TW9A 1ERVA 2WDUA 1MDIA 3WGXA 3IHQA 2KOKA 5JCGA 2CZ2A 3HHVA 5ECRB 1AQWA 2LNTA 2Z9SA 4I2TA 2C3NA 3Q19A 4DSQA 1PA3A 3MNGA 3O3TA 4JR4A 1JZWA 1RK4A 2MMNA 1PRXA 3GYKA 2V2GA 2L57A 3TRXA 1G6WA 1TP9A 2N5FA 3KMOA 2YWIA 1PSQA 2VD0A 2GS3A 5ECMB 4JBBA 3ZVJA 1M2AA 1SD9A 3IBHA 1AXDA 2IPAA 4K8MA 2HSHA 4PQHA 5F0GA 2HSMA 4TR4A 4XIHA 2F8AA 3APQA 2WFCA 3DWVA 4IW9A 4GSSA 2WB9A 2HRAA 2LRNA 4CY6A 5KN2A 4K7IA 1YQ1A 5J4UA 5CO3A 4EXJA 4TR1B 3GKNA 5F05A 4MJCA 2VLTA 5KN3A 2C0EA 4WF4A 2H6XA 5CRDA 2O7KA 1Z6MA 3EE2A 4V2NA 4ZL8A 3KXOA 3C1RA 1NM3A 1BG5A 5CREA 2MBSA 4USSA 2L4QA 1KTEA 1ZYQB 3TJFA 2HZFA 3FY7A 2PMTA 2DJ2A 2XPDA 1THXA 2VUPA 5IIZA 1WE0A 4WR5A 5JCWA 4CW9A 5A5KA 2DIZA 5F06A 3L9SA 3RDWA 1T00A 4WKWA 1U87A 4EDZA 2GLRA 5ENUA 2DMMA 3EWLA 2K8VA 1G7OA 5GAND 2DJKA 1RW1A 2C3QA 6GSTA 3GL3A 3UL3A 4AJ8A 4GXZA 1JFUA 1ERWA 2YV7A 3FHKA 4OFTA 3OR5A 1OE8A 1XW9A 1DE2A 1W4VA 4JEDA 4IJ3A 1A2JA 5H5SA 3L9VA 4NMUA 1XVQA 3VWWA 3C73A 5DQSA 2ZCTA 4K9ZA 3RAZA 5DDLA 5E4WA 3A2WA 3QFAC 4HZ4A 1AIUA 5IO0A 3GRXA 1M99A 1S3AA 4GSNA 2X4AA 1YJ6A 2IFQA 3QFBC 5A4VA 1K3OA 2AV4A 3KIJA 1E2YA 5HR3A 2YV9A 3ZREA 2QKEA 2GSRA 2AJQB 1TI3A 1U6TA 5ELAA 3O6TA 5B8BA 3IE3A 3GHAA 4ACSA 2JSYA 5BRTA 4HU9A 1SJZA 2DSAA 3TRPA 3ERGA 4TR1A 1XWGA 1A8LA 2H70A 1A0RP 3A2XA 4EDYA 4RQXA 3EMXA 3BOAA 2I4AA 2JZSA 2E0QA 5HR2A 1U3AA 1ERTA 4F9ZA 1XZOA 5DALB 3UJ1A 3IHGA 3LW9A 4IVFA 3GMFA 3DKSA 1FVJA 3VURA 2VLUA 2TIRA 3F6FA 1EOGA 1GNWA 5IMFA 4HI7A 6GSSA 4N0VA 3MDKA 3EINA 2EIOA 1XBSA 1GL8A 2FUG2 4G10A 4MF5A 3VFIA 1SL0B 4N10A 4OD7A 2UZ8A 2EC4A 3SWLA 1GTUA 4MH3A 3D4TA 2CZ3A 3DIEA 2L59A 4IGJA 4YAPA 4J57E 3ERFA 2OACA 2WZ9A 1AC1A 4CHSA 1KBNA 3A5WA 3M9JA 4FH8A 1TK0B 2CX4A 2AB6A 3ERWA 1EP7A 4IQ1A 2QC7A 4PURA 3J7Yb 3PR8A 5A4UA 1DUGA 2PBJA 1ZYNA 3NZNA 2YCDA 2G0FA 1EEMA 2MMZA 5IOWA 2FWGA 5CAXA 3TJKA 2IMDA 2NBSA 4N0ZA 4KCEA 4F03A 5LNKe 2H71A 4IJIA 1B9YC 4PQIA 1RQMA 5ECQB 2LJAA 2MZCA 3D0ZA 2VCTA 5D8IA 3M3MA 4ISDA 2B7KA 4BVXA 1XPVA 1TXXA 5KOWA 3QMXA 1O73A 3EURA 1JHBA 4CDOA 2H19A 2E2MA 4WBJA 3FZ4A 2G2QA 2FNOA 4RI6A 1XVWA 2VAFA 1HYUA 3EPTA 3W6GA 1PGTA 1GLQA 4V1Ag 4OO4A 4KAEA 3GNJA 1Q98A 1PL2A 4HQZA 2XPEA 4MLYA 2JZRA 1BAYA 3HXSA 3TUEA 3KMNA 2VLVA 2X99A 2R0GA 2O8VB 4PXOA 2F3MA 2XBIA 4KSMA 5DALA 2GTUA 4AGSA 4QQ7A 4IKHA 2M72A 3TGZA 1ZYPA 1ON4A 2YANA 5CP1A 1PN9A 3CMIA 2VL3A 4PUAA 5B7CA 2J9HA 3RBTA 2PPTA 2LUSA 19GSA 1I9DA 1N8JA 2OBKA 3IAM2 5IMAA 5D9WA 3GSTA 1GUMA 2FCHA 1VF1A 3LJRA 3EMPA 2F51A 2H1GA 5ECPB 2H0IA 3L4NA 1R26A 3VK9A 2GZPA 1WMJA 2DJJA 4K1FA 2DLXA 2A2RA 1B8XA 2PUKC 5L71A 3O76A 2PVQA 1Z7RA 2GQKA 4HQSA 3DD3A 2X8GA 2GT5A 2LJRA 1T8EB 2RIIA 3R3EA 5EL8A 1XFLA 1NHYA 3KTBA 3D5JA 4XRDA 2VCZA 5ECKB 2C4JA 2C8UA 2VCWA 2VCVA 4GLTA 1ABAA 2GDRA 1OE7A 3HKRA 4JZQA 4GSTA 3P90A 4ZB6A 3H4KA 2FA8A 2IWTA 5G2ZA 4NXIA 4E8HA 4MDCA 4K7OA 5D96A 2AAWA 2AYTA 1M7TA 3ZMKA 1N2AA 4G2EA 4N30A 3CRUA 1H75A 2LNSA 2LQQA 2LSTA 3FR3A 4OFMA 3CBUA 1DBYA 1U3IA 2V6OA 1NHOA 2VL9A 2REMA 4FIWA 1V98A 3I69A 3QPMA 2GQLA 2TRXA 2H1DA 1T3BA 3KH9A 1SU9A 4I8BA 5CRHA 6GSVA 3F4TA 1HD2A 2CT6A 5ECNB 3IXRA 3GX8A 1FB0A 3ZVJD 4O5UA 5H5QA 3U6VA 1TK8B 1VF3A 4ML6A 3M8NA 2HFDA 3GN3A 2K18A 4KB3A 4HUAA 5B8AA 1MDKA 4XS1A 2IL3A 2FD3A 5DAKB 2TRCP 5ECLB 2PERA 4TXVA 4MPGA 1OKTA 3GH9A 4ZBAA 1BYEA 2DBCA 3BCKA 5AISA 2BJXA 1E6BA 3KM6A 1GULA 1O7UA 4KSOA 1HQOA 1O8WA 2HLSA 3KZQA 1A2LA 2KP2A 1SK2A 5ECIB 2AHEA 3GKXA 1GTIA 4POBA 2N5BA 1BEDA 3G7YA 3L9UA 5G5FA 3FK8A 4AF2A 5DJMA 1SJIA 3RPPA 4MZBA 1PX6A 1PN0A 2QSIA 5IPHA 3ME8A 3PPUA 1A2MA 6GSUA 1M9BA 2V1MA 3FZAA 4KUNA 4I2UA 3DEXA 2VO4A 1SKWB 1VF2A 2X8CA 3TKSC 2WJUA 2LTKA 2R37A 4ZILA 4TRXA 3LG6A 2JSZA 3VPQA 3TJGA 3KGKA 4J56E 1WRYA 3TKSA 1AAZA 1OVNA 1R4WA 1DE1A 1B4PA 1XCCA 3ZL5A 3HZ4A 3PINA 4AJ6A 3QAWA 4NAXA 1USBA 3LQ7A 5EY6A 3KD0A 3WT1A 2X49A 2C0FA 5BMUA 4N11A 1XWCA 2A4VA 1GUKA 2A4HA 4K0GA 4Q5FA 4TKYA 5CRWA 3LYPA 4A5PA 4GCIA 3C7MA 4IBPA 1V40A 4TOPA 3C1SA 4H86A 2KLXA 2FWEA 5KN0A 3AY8A 1AQXA 3M9KA 4LMVA 5JWQB 4XCSA 4GWRA 1Z5YE 2ES7A 3MIXA 4D73B 5GAPD 2JZTA 1B4QA 1FAAA 4IS0A 1TK5B 11GSA 1EGOA 3ZMLA 5G1LA 17GSA 4K0NA 5GSTA 3CYNA 1PQNA 2YZHA 1JLVA 1SJ6A 4O7HA 1TJDA 1TDIA 1EEJA 3WYWA 2A2PA 5IOXA 4HJ2A 1A8YA 1PKZA 5IQYA 3QD9A 5JWRB 1ILOA 2B6MA 5DAKA 4NHWA 1GTBA 3HJMA 2OBIA 3P2AA 1BJXA 1FOVA 2V6KA 3F4RA 1GSUA 3IA1A 5GSSA 5F07A 1W89A 2L6CA 2H73A 2P31A 4X0XA 3RHCA 3ZFLA 3LXTA 3GURA 3HVXA 1ZOFA 4G0IA 2KP1A 5HR1A 5ELGA 2GZYA 5A4WA 1FVKA 3LFLA 5KOXA 2QA2A 1MEKA 2V32A 4K5SA 4F2IA 1ZZYA 4E8EA 1GRXA 3APSA 2PWJA 3TKSE 3E9JB 2OA7A 4HU7A 4O5QA 1KEBA 2FWFA 2E2GA 3FR9A 1Y6EA 3HY2A 1XW6A 1B9XC 1MTCA 1F2EA 4ZIJA 3WGDA 3ZLPA 3P8WA 3QCPA 2O85A 4POKA 4TVEA 3QAGA 4K2XA 2R2JA 2OE1A 5E59A 1QQ2A 5FHIA 4G0KA 4BPYA 2B5EA 2B3SA 5DJLA 3F4SA 4EE0A 1XOBA 1OC8A 1YEPA 1K0MA 1TRWA 2P5QA 1VRSD 2H66A 3HVSA 4MF7A 1V58A 2VL2A 1K0NA 2LS5A 3GFKA 2C0GA 2YP6A 1PMTA 2M80A 1UVZA 4D73A 3VWXA 4IN0A 2OJLA 1M2BA 2ZUPA 2DJ1A 2H0HA 3H93A 3TCOA 1TRSA 2CQ9A 4ICYA 1UA5A 3DRNA 1EP8A 1G0TA 3GV1A 4IELA 18GSA 1X5CA 3D4MA 2O87A 4BA7A 4LLRA 3IAS2 5HQPA 3WGEA 1XWAA 1GWCA 2CVKA 3R2QA 4QL7A 3FR6A 1O6JA 4BVYB 1URMA 3S9FA 1CQHA 1HNCA 4ZBDA 14GSA 3KP9A 2C3TA 3A3TA 3MSZA 2VM2A 3BBYA 1Z3EA 3VLNA 3IC4A 3ZFBA 2BTOT 12GSA 3HJPA 3U5RE 3LEFA 3Q6OA 1YKCA 3TB2A 2C80A 5J5NA 3KEBA 2OKAA 4JU5A 3SBCA 5DCHA 3VI7A 3F63A 3F3RA 3GTUB 5KEJA 1BX9A 4PX1A 4PNFA 4Q5RA 3TOUA 4L8EA 5EPFA 3UOMA 2I1UA 5ECOB 1JZOA 1QXHA 4KA0A 4ILFA 1GSYA 3BJ5A 2LKUA 3F3QA 2H30A 3ZIJA 4EVMA 2NPBA 2H6ZA 2OADA 2LRTA 4ID0A 3A5IA 3CXGA 4YQMA 3IK9A 2DC5A 3TKPA 1G6YA 4X1UA 1OYJA 1Z6NA 2CV4A 3G7IA 1A24A 4G0LA 4G19A 4L0WA 3HDCA 3LSZA 4TN8A 5CRGA 4ZL7A 2RUEA 2P0GA 1Z7PA 4LMWA 2GSQA 1ST9A 2GSSA 4GRFA 4KGIA 1FO5A 5D9VA 1OC9B 3GUSA 2LEGA 1A0FA 1H4OA 3GKKA 1O81A 2YZUA 3KH7A 5EVOA 5LD0A 4KH7A 4MNNA 1SKRB 4Q5NA 4YQVA 1VGLA 4OFNA 5C04A 4IP1A 4BL7B 4FO5A 1K0AA 2GT6A 3VPTA 5IM9A 1PX7A 4OMVA 2JACA 4FYBA 4HZ2A 2NTOA 4POMA 4ECBA 4JRRA 2WRTA 3W8SA 1B48A 2NVLA 3HA9A 5COHA 3FEUA 2O89A 5J9BA 2ON5A 2DKIA 3KCMA 1WPIA 1IYIA 2MMAA 4FYCA 4DSSB 5IMZA 1VF4A 5AN1A 2H6YA 3KJYA 4PNGA 1GSQA 1TOFA 3FW2A 1Z9HA 3K8NA 4DSRA 1XW5A 4HS1A 4RQRA 3H1NA 1TI1A 4TXOB 1V9WA 3HYPA 1QMVA 1LU4A 3GTUA 5G1KA 2PVOC 4K5RA 4WEYA 4X43A 1XWBA 1XWKA 3MAKA 2HRNA 2IJYA 3DYRA 3HCZA 1GUHA 4NV2A 1PD21 4MJEA 3GIXA 4MPFA 1FB6A 2GZZA 3UEMA 5ECHB 1TU7A 1GNEA 2CA8A 1KNGA 2XHFA 5ABRA 3LGCA 3DMLA 2DKHA 4IHUA 5IMDA 3MYDA 1Y25A 4KW6A 2JU5A 1GH2A 5HR0A 4HOJA 2CAIA 1ML6A 1TU8A 3IPZA 4I6XA 3LXZA 4KDXA 5INYA 2LJKA 1OC9A 2VM1A 3D6IA 4AJ7A 3HJOA 4BWQA 2YN1A 5ID2B 2OE0A 1J08A 3UIWA 4XTSA 2GQMA 3QOUA 4GQCA 4J2FA 5AGYA 3APOA 4V2LA 3IK7A 2C1YA 2K6VA 4EUYA 2V41A 2HRKA 3C71A 2HXKA 2VIMA 2RM6A 2VOCA 4POLA 1JLWA 3US3A 2HE3A 1M0UA 4BL7A 2JL4A 5IPGA 5FT3A 2XC2A 3N9JA 2HNLA 2R4VA 4FQUA 3TKRA 16GSA 3FZ5A 3UVTA 4KCAA 2I9HA 3H79A 4MF6A 4DSSA 2CX3A 1K0OA 3N5OA 4GQFA 2P5RA 3PH9A 2AUVA 3DVWA 4O5RA 5B6NA 3FZ9A 3GA4A 1HNAA 2WCIA 3CSJA 4EF0A 3VWVA 1YKAA 1K3YA 2RUFA 2VCQA 4ZB9A 4L5OA 1QGVA 2D2ZA 2CAQA 1SK1A 4TXOA 2B1KA 2H1BA 2IFQB 3JCML 4IP6A 4GF0A 2HZEB 4EIPA 2PU9C 5D93A 2RLIA 1T1VA 4LL1B 4PGTA 3H8QA 7GSSA 1NW2A 2R0CA 3PGTA 1MDJA 1JZRA 1GTAA 1Q4JA 2QA1A 3ZTLA 4QL9A 1R5AA 2FA4A 4WF5A 4K6XA 3DGQA 2BMXA 1F3BA 3UBKA 5F8BA 3DXBA 5DVBA 1M2DA 4GTUA 2FWHA 4HDEA 2CVBA 3CRTA 2B5YA 4MP4A 2R3XA 4KDYA 5HFIA 3LYKA 1K0BA 1S3DA 3CSIA 3G7JA 2DJ3A 4YH2A 2GGTA 1U88A 2H75A 3IDVA 2YPMA 1FHEA 2EIRA 4K2DA 5J9CA 2E7PA 2MBTA 5J3RA 3LORA 3G9BA 2YOIA 3ZZXA 3L78A 3UMAA 5ID2A 2QGVA 3IV4A 1AQVA 3F0IA 4NWYA 1WWJA 4Q5QA 1X5DA 2R6KA 1ZCPA 3D21A 1WP0A 4KDUA 4HEA2 4EL1A 4NHZA 1HNBA 4ML1A 4XS6A 3WD6A 1SD8A 4JR6A 4LL4B 1QUWA 4MZWA 5AIXA 5CYYA 4ZBBA 1J9BA 2LRCA 2VCXA 4L0UA 1R5PA 1TTZA 3QAVA 5B6MA 5G5EA 4EKZA 4V1Ap 3ZRDA 2H72A 4EC0A 2OE3A 4YKFA 2IMIA 3VI5A 2N5AA 1C72A 3EYTA 2H01A 1X9MB 4MABA 5H5RA 2L5OA 4I5QA 3HZ8A 5KN1A 3I9V2 2IMFA 1ACVA 4F0BA 2HSYA 1F3AA 1S3CA 3E3EA 2FY6A 4TW5A 3CSHA 4BVXB 3Q18A 5CNWA 3TRQA 4MJAA 2HZEA 3M1GA 2GSTA 4DEJA 5DBQA 1YY7A 3GKMA 4PQ1A 3UVHA 3I6AA 4Z2TA 1T4YA 3TOTA 1SK0A 2KUCA 2DMLA 1DSBA 1GSFA 2MYGA 2FLSA 2KHPA 2R5GA 4KF9A 4NV5A 2VL2C 4ECCA 1EGRA 3LWAA 1IYHA 4WBRD 3FKFA 1AW9A 2F8FA 5HFGA 1X5EA 3WT2A 2H74A 2IIYA 4RUVA 2XBQA 2IMEA 3BCIA 2YWOA 2H0GA 1O85A 1QFNA 1SL1B 1EV4A 2YWNA 3W8JA 1O8XA 3A2VA 3IR4A 1T4ZA 2PN8A 5JCUA 5JWOB 4TR0A 2CVDA 3IRAA 5IMCA 3FYGA 1ERUA 1XOAA 1J0FA 2LV3A 1SENA 2WULA 2ZNMA 3P7XA 4OCFA 3F8UA 1TRVA 3HD5A 4ZL9A 1PKWA 2X64A 3KP8A 1ZMAA 4K7NA 3E0UA 6GSWA 1F37A 3HVVA 1CQGA 1A23A 4G9HA 2YWMA 2YJHA 9GSSA 4XS4B 4WETA 1LJRA 1WIKA 4P3YB 3C8EA 1SKSB 1OKDA 4MMMA 3EU4A 4CY8A 4JE1A 4YQUA 2K8SA 4O32A 1X9SB 20GSA 1OAZA 1YZXA 2YJ7A 3IOSA 1V2AA 1GSEA 2H1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FG4 A;  6GSY A;  5DQY A;  1UC7 A;  5J41 A;  3QR6 A;  4LA1 A;  1K0D A;  5LCZ A;  5HFK A;  2I81 A;  4RI7 A;  1ZGN A;  2HRF A;  4KND A;  3EU3 A;  2FHE A;  2NDO A;  4F0C A;  5D9T A;  4V2M A;  1EOH A;  2LQO A;  1UN2 A;  4WXT A;  3Q74 A;  4MJB A;  1YDK A;  6GSX A;  4O92 A;  4I97 A;  3ZIV A;  4XHM A;  2YNX A;  3GH6 A;  1V57 A;  13GS A;  2C0D A;  4MK3 A;  2X8H A;  1F9M A;  3RPN A;  2L4C A;  4FYU A;  2M46 A;  2H76 A;  1QK8 A;  3KTL A;  2WGR A;  3QDN A;  3J7Y k;  2DIY A;  2WS2 A;  1LBK A;  3V1W A;  3UBL A;  3EVI A;  4IQA A;  4HJM A;  3NIV A;  2VD1 A;  2GVP A;  3F9U A;  3UAR A;  1PL1 A;  2DJ0 A;  3ED3 A;  4BVY A;  3EC3 A;  1EV9 A;  5D9X A;  3MWH A;  1X0R A;  4Z7X A;  3TJB A;  1JZD A;  1XIY A;  4PUF C;  3GSS A;  3VWU A;  1GSS A;  1GSD A;  1GLP A;  3ZIT A;  4EO3 A;  1YEX A;  2FGX A;  1SYX A;  3L0H A;  1GP1 A;  4OCE A;  2B1L A;  2I3Y A;  8GSS A;  3GX0 A;  4ZXG A;  5D73 A;  4MH2 A;  2F9S A;  1AUC A;  1ZYE A;  4ECJ A;  1G7E A;  4F82 A;  1EZK A;  4XS4 A;  5G30 A;  2ON7 A;  3D22 A;  3NOF A;  1M9A A;  3CTF A;  2A2S A;  1FW1 A;  5FWG A;  2HT9 A;  4ZB8 A;  2K9F A;  1NSW A;  4XRA A;  3UAP A;  1K3L A;  1TRU A;  1OC3 A;  2B5X A;  1R7H A;  3RHB A;  2PGT A;  3FRC A;  4DVC A;  2HYX A;  2EIQ A;  2HI7 A;  1EWX A;  1I5G A;  1TKD B;  4BWS A;  10GS A;  2JAD A;  3CTG A;  2ALB A;  1YF0 A;  2IN3 A;  4KE3 A;  1WOU A;  2MMO A;  3ISO A;  5GZZ B;  1WJK A;  1XXU A;  4NPB A;  4OO5 A;  4MCU A;  1T7P B;  4ECI A;  5IO2 A;  4TR3 A;  1BQ7 A;  3DVX A;  2RM5 A;  2IMK A;  3M0F A;  4OWY A;  3GL5 A;  1F6M C;  3ME7 A;  3TJJ A;  1SL2 B;  5C00 A;  4L5L A;  2B7J A;  4ULX A;  22GS A;  1MD3 A;  3ZYW A;  5AIV A;  1X9W B;  2J23 A;  3I43 A;  5ECS A;  1K0C A;  3BD2 A;  5G31 A;  2L5L A;  1THO A;  4MZC A;  2H8L A;  3TDG A;  5DCG A;  4YAV A;  3TKQ A;  3F6D A;  1YF1 A;  1ZL9 A;  4KX4 A;  5IMV A;  1MD4 A;  1SYR A;  4WR4 A;  2L6D A;  4MA9 A;  1TW9 A;  1ERV A;  2WDU A;  1MDI A;  3WGX A;  3IHQ A;  2KOK A;  5JCG A;  2CZ2 A;  3HHV A;  5ECR B;  1AQW A;  2LNT A;  2Z9S A;  4I2T A;  2C3N A;  3Q19 A;  4DSQ A;  1PA3 A;  3MNG A;  3O3T A;  4JR4 A;  1JZW A;  1RK4 A;  2MMN A;  1PRX A;  3GYK A;  2V2G A;  2L57 A;  3TRX A;  1G6W A;  1TP9 A;  2N5F A;  3KMO A;  2YWI A;  1PSQ A;  2VD0 A;  2GS3 A;  5ECM B;  4JBB A;  3ZVJ A;  1M2A A;  1SD9 A;  3IBH A;  1AXD A;  2IPA A;  4K8M A;  2HSH A;  4PQH A;  5F0G A;  4TR4 A;  4XIH A;  2F8A A;  3APQ A;  2WFC A;  3DWV A;  4IW9 A;  4GSS A;  2WB9 A;  2LRN A;  5KN2 A;  4K7I A;  1YQ1 A;  5J4U A;  5CO3 A;  4EXJ A;  4TR1 B;  3GKN A;  5F05 A;  4MJC A;  2VLT A;  5KN3 A;  2C0E A;  4WF4 A;  2H6X A;  5CRD A;  2O7K A;  1Z6M A;  3EE2 A;  4V2N A;  4ZL8 A;  3KXO A;  3C1R A;  1NM3 A;  1BG5 A;  5CRE A;  2MBS A;  2L4Q A;  1KTE A;  1ZYQ B;  3TJF A;  2HZF A;  3FY7 A;  2PMT A;  2DJ2 A;  2XPD A;  1THX A;  2VUP A;  5IIZ A;  1WE0 A;  4WR5 A;  5JCW A;  4CW9 A;  5A5K A;  2DIZ A;  5F06 A;  3L9S A;  3RDW A;  1T00 A;  4WKW A;  1U87 A;  4EDZ A;  2GLR A;  5ENU A;  2DMM A;  3EWL A;  2K8V A;  1G7O A;  5GAN D;  2DJK A;  1RW1 A;  2C3Q A;  6GST A;  3GL3 A;  3UL3 A;  4AJ8 A;  4GXZ A;  1JFU A;  1ERW A;  2YV7 A;  3FHK A;  4OFT A;  3OR5 A;  1OE8 A;  1XW9 A;  1DE2 A;  1W4V A;  4JED A;  4IJ3 A;  1A2J A;  5H5S A;  3L9V A;  4NMU A;  1XVQ A;  3VWW A;  3C73 A;  5DQS A;  2ZCT A;  4K9Z A;  3RAZ A;  5DDL A;  5E4W A;  3A2W A;  3QFA C;  4HZ4 A;  1AIU A;  5IO0 A;  3GRX A;  1M99 A;  1S3A A;  4GSN A;  1YJ6 A;  2IFQ A;  3QFB C;  5A4V A;  1K3O A;  2AV4 A;  3KIJ A;  1E2Y A;  5HR3 A;  2YV9 A;  3ZRE A;  2QKE A;  2GSR A;  2AJQ B;  1TI3 A;  1U6T A;  5ELA A;  3O6T A;  5B8B A;  3IE3 A;  3GHA A;  4ACS A;  2JSY A;  4HU9 A;  1SJZ A;  2DSA A;  3TRP A;  3ERG A;  4TR1 A;  1XWG A;  1A8L A;  2H70 A;  1A0R P;  3A2X A;  4EDY A;  4RQX A;  3EMX A;  3BOA A;  2I4A A;  2JZS A;  2E0Q A;  5HR2 A;  1U3A A;  1ERT A;  4F9Z A;  1XZO A;  5DAL B;  3UJ1 A;  4IVF A;  3GMF A;  3DKS A;  1FVJ A;  3VUR A;  2VLU A;  2TIR A;  3F6F A;  1EOG A;  1GNW A;  5IMF A;  4HI7 A;  6GSS A;  4N0V A;  3MDK A;  3EIN A;  2EIO A;  1XBS A;  1GL8 A;  2FUG 2;  4G10 A;  4MF5 A;  3VFI A;  1SL0 B;  4N10 A;  4OD7 A;  2EC4 A;  3SWL A;  1GTU A;  4MH3 A;  3D4T A;  2CZ3 A;  3DIE A;  2L59 A;  4IGJ A;  4YAP A;  4J57 E;  3ERF A;  2OAC A;  2WZ9 A;  1AC1 A;  4CHS A;  1KBN A;  3A5W A;  3M9J A;  4FH8 A;  1TK0 B;  2CX4 A;  2AB6 A;  3ERW A;  1EP7 A;  4IQ1 A;  2QC7 A;  4PUR A;  3J7Y b;  3PR8 A;  5A4U A;  1DUG A;  2PBJ A;  3NZN A;  2YCD A;  2G0F A;  1EEM A;  2MMZ A;  5IOW A;  2FWG A;  5CAX A;  3TJK A;  2IMD A;  2NBS A;  4N0Z A;  4KCE A;  4F03 A;  5LNK e;  2H71 A;  4IJI A;  1B9Y C;  4PQI A;  1RQM A;  5ECQ B;  2LJA A;  2MZC A;  3D0Z A;  2VCT A;  5D8I A;  3M3M A;  4ISD A;  2B7K A;  4BVX A;  1XPV A;  1TXX A;  3QMX A;  1O73 A;  3EUR A;  1JHB A;  4CDO A;  2H19 A;  2E2M A;  4WBJ A;  3FZ4 A;  2G2Q A;  2FNO A;  4RI6 A;  1XVW A;  2VAF A;  1HYU A;  3W6G A;  1PGT A;  1GLQ A;  4V1A g;  4OO4 A;  4KAE A;  3GNJ A;  1Q98 A;  1PL2 A;  4HQZ A;  2XPE A;  4MLY A;  2JZR A;  1BAY A;  3HXS A;  3TUE A;  3KMN A;  2VLV A;  2X99 A;  2O8V B;  4PXO A;  2F3M A;  2XBI A;  4KSM A;  5DAL A;  2GTU A;  4AGS A;  4QQ7 A;  4IKH A;  2M72 A;  3TGZ A;  1ON4 A;  2YAN A;  5CP1 A;  1PN9 A;  3CMI A;  2VL3 A;  4PUA A;  5B7C A;  2J9H A;  3RBT A;  2PPT A;  2LUS A;  19GS A;  1I9D A;  1N8J A;  2OBK A;  3IAM 2;  5IMA A;  5D9W A;  3GST A;  1GUM A;  2FCH A;  1VF1 A;  3LJR A;  3EMP A;  2F51 A;  2H1G A;  5ECP B;  2H0I A;  3L4N A;  1R26 A;  3VK9 A;  2GZP A;  1WMJ A;  2DJJ A;  4K1F A;  2DLX A;  2A2R A;  1B8X A;  2PUK C;  5L71 A;  3O76 A;  2PVQ A;  1Z7R A;  2GQK A;  4HQS A;  3DD3 A;  2X8G A;  2GT5 A;  2LJR A;  1T8E B;  2RII A;  5EL8 A;  1XFL A;  1NHY A;  3KTB A;  3D5J A;  4XRD A;  2VCZ A;  5ECK B;  2C4J A;  2C8U A;  2VCW A;  2VCV A;  4GLT A;  1ABA A;  2GDR A;  1OE7 A;  3HKR A;  4JZQ A;  4GST A;  3P90 A;  4ZB6 A;  3H4K A;  2FA8 A;  2IWT A;  5G2Z A;  4NXI A;  4E8H A;  4MDC A;  4K7O A;  5D96 A;  2AAW A;  2AYT A;  1M7T A;  3ZMK A;  1N2A A;  4G2E A;  4N30 A;  3CRU A;  1H75 A;  2LNS A;  2LQQ A;  2LST A;  3FR3 A;  4OFM A;  3CBU A;  1DBY A;  1U3I A;  2V6O A;  1NHO A;  2VL9 A;  2REM A;  4FIW A;  1V98 A;  3I69 A;  3QPM A;  2GQL A;  2TRX A;  2H1D A;  1T3B A;  3KH9 A;  1SU9 A;  4I8B A;  5CRH A;  6GSV A;  3F4T A;  1HD2 A;  2CT6 A;  5ECN B;  3IXR A;  3GX8 A;  1FB0 A;  3ZVJ D;  5H5Q A;  3U6V A;  1TK8 B;  1VF3 A;  4ML6 A;  3M8N A;  2HFD A;  3GN3 A;  2K18 A;  4KB3 A;  4HUA A;  5B8A A;  1MDK A;  4XS1 A;  2IL3 A;  2FD3 A;  5DAK B;  2TRC P;  5ECL B;  2PER A;  4TXV A;  4MPG A;  1OKT A;  3GH9 A;  4ZBA A;  1BYE A;  2DBC A;  3BCK A;  5AIS A;  2BJX A;  1E6B A;  3KM6 A;  1GUL A;  1O7U A;  4KSO A;  1HQO A;  1O8W A;  2HLS A;  3KZQ A;  1A2L A;  2KP2 A;  1SK2 A;  5ECI B;  2AHE A;  3GKX A;  1GTI A;  4POB A;  2N5B A;  1BED A;  3G7Y A;  3L9U A;  5G5F A;  3FK8 A;  4AF2 A;  5DJM A;  1SJI A;  3RPP A;  4MZB A;  1PX6 A;  2QSI A;  5IPH A;  3ME8 A;  1A2M A;  6GSU A;  1M9B A;  2V1M A;  3FZA A;  4KUN A;  4I2U A;  3DEX A;  2VO4 A;  1SKW B;  1VF2 A;  2X8C A;  3TKS C;  2WJU A;  2LTK A;  2R37 A;  4ZIL A;  4TRX A;  3LG6 A;  2JSZ A;  3VPQ A;  3TJG A;  3KGK A;  4J56 E;  1WRY A;  3TKS A;  1AAZ A;  1OVN A;  1R4W A;  1DE1 A;  1B4P A;  1XCC A;  3ZL5 A;  3HZ4 A;  3PIN A;  4AJ6 A;  3QAW A;  4NAX A;  1USB A;  3LQ7 A;  5EY6 A;  3KD0 A;  3WT1 A;  2C0F A;  4N11 A;  1XWC A;  2A4V A;  1GUK A;  4K0G A;  4Q5F A;  4TKY A;  5CRW A;  3LYP A;  4GCI A;  3C7M A;  4IBP A;  1V40 A;  4TOP A;  3C1S A;  4H86 A;  2KLX A;  2FWE A;  5KN0 A;  3AY8 A;  1AQX A;  3M9K A;  4LMV A;  5JWQ B;  4XCS A;  4GWR A;  1Z5Y E;  2ES7 A;  4D73 B;  5GAP D;  2JZT A;  1B4Q A;  1FAA A;  4IS0 A;  1TK5 B;  11GS A;  1EGO A;  3ZML A;  5G1L A;  17GS A;  4K0N A;  5GST A;  3CYN A;  1PQN A;  2YZH A;  1JLV A;  1SJ6 A;  4O7H A;  1TJD A;  1TDI A;  1EEJ A;  3WYW A;  5IOX A;  4HJ2 A;  1A8Y A;  1PKZ A;  5IQY A;  3QD9 A;  5JWR B;  1ILO A;  2B6M A;  5DAK A;  4NHW A;  1GTB A;  3HJM A;  2OBI A;  3P2A A;  1BJX A;  1FOV A;  2V6K A;  3F4R A;  1GSU A;  3IA1 A;  5GSS A;  5F07 A;  1W89 A;  2L6C A;  2H73 A;  2P31 A;  4X0X A;  3RHC A;  3ZFL A;  3LXT A;  3GUR A;  3HVX A;  1ZOF A;  2KP1 A;  5HR1 A;  5ELG A;  2GZY A;  5A4W A;  1FVK A;  3LFL A;  1MEK A;  2V32 A;  4F2I A;  1ZZY A;  4E8E A;  1GRX A;  3APS A;  2PWJ A;  3TKS E;  3E9J B;  2OA7 A;  4HU7 A;  1KEB A;  2FWF A;  2E2G A;  3FR9 A;  1Y6E A;  3HY2 A;  1XW6 A;  1B9X C;  1MTC A;  1F2E A;  4ZIJ A;  3WGD A;  3ZLP A;  3P8W A;  3QCP A;  2O85 A;  4POK A;  4TVE A;  3QAG A;  2R2J A;  2OE1 A;  5E59 A;  1QQ2 A;  5FHI A;  4BPY A;  2B5E A;  2B3S A;  5DJL A;  3F4S A;  4EE0 A;  1XOB A;  1OC8 A;  1YEP A;  1K0M A;  1TRW A;  2P5Q A;  1VRS D;  2H66 A;  3HVS A;  4MF7 A;  1V58 A;  2VL2 A;  1K0N A;  2LS5 A;  3GFK A;  2C0G A;  2YP6 A;  1PMT A;  2M80 A;  1UVZ A;  4D73 A;  3VWX A;  4IN0 A;  2OJL A;  1M2B A;  2ZUP A;  2DJ1 A;  2H0H A;  3H93 A;  3TCO A;  1TRS A;  2CQ9 A;  1UA5 A;  3DRN A;  1EP8 A;  1G0T A;  3GV1 A;  4IEL A;  18GS A;  1X5C A;  3D4M A;  2O87 A;  4BA7 A;  4LLR A;  3IAS 2;  5HQP A;  3WGE A;  1XWA A;  1GWC A;  2CVK A;  3R2Q A;  4QL7 A;  3FR6 A;  1O6J A;  1URM A;  3S9F A;  1CQH A;  1HNC A;  4ZBD A;  14GS A;  3KP9 A;  2C3T A;  3A3T A;  3MSZ A;  2VM2 A;  3BBY A;  1Z3E A;  3VLN A;  3IC4 A;  3ZFB A;  2BTO T;  12GS A;  3HJP A;  3U5R E;  3LEF A;  3Q6O A;  1YKC A;  3TB2 A;  2C80 A;  5J5N A;  3KEB A;  2OKA A;  4JU5 A;  3SBC A;  5DCH A;  3VI7 A;  3F63 A;  3F3R A;  3GTU B;  5KEJ A;  1BX9 A;  4PX1 A;  4PNF A;  4Q5R A;  3TOU A;  4L8E A;  5EPF A;  3UOM A;  2I1U A;  5ECO B;  1JZO A;  1QXH A;  4KA0 A;  4ILF A;  1GSY A;  3BJ5 A;  2LKU A;  3F3Q A;  2H30 A;  3ZIJ A;  4EVM A;  2NPB A;  2H6Z A;  2OAD A;  2LRT A;  4ID0 A;  3CXG A;  4YQM A;  3IK9 A;  2DC5 A;  3TKP A;  1G6Y A;  4X1U A;  1OYJ A;  1Z6N A;  2CV4 A;  3G7I A;  1A24 A;  4G19 A;  4L0W A;  3HDC A;  3LSZ A;  4TN8 A;  5CRG A;  4ZL7 A;  2RUE A;  2P0G A;  1Z7P A;  4LMW A;  2GSQ A;  1ST9 A;  2GSS A;  4GRF A;  4KGI A;  1FO5 A;  5D9V A;  1OC9 B;  3GUS A;  2LEG A;  1A0F A;  1H4O A;  3GKK A;  1O81 A;  2YZU A;  3KH7 A;  5EVO A;  5LD0 A;  4KH7 A;  1SKR B;  4Q5N A;  4YQV A;  1VGL A;  4OFN A;  5C04 A;  4IP1 A;  4FO5 A;  1K0A A;  2GT6 A;  3VPT A;  5IM9 A;  1PX7 A;  4OMV A;  2JAC A;  4FYB A;  4HZ2 A;  2NTO A;  4POM A;  4ECB A;  4JRR A;  2WRT A;  3W8S A;  1B48 A;  2NVL A;  3HA9 A;  5COH A;  3FEU A;  2O89 A;  5J9B A;  2ON5 A;  3KCM A;  1WPI A;  1IYI A;  2MMA A;  4FYC A;  4DSS B;  5IMZ A;  1VF4 A;  5AN1 A;  2H6Y A;  3KJY A;  4PNG A;  1GSQ A;  1TOF A;  3FW2 A;  1Z9H A;  3K8N A;  4DSR A;  1XW5 A;  4HS1 A;  4RQR A;  3H1N A;  1TI1 A;  4TXO B;  1V9W A;  3HYP A;  1QMV A;  1LU4 A;  3GTU A;  5G1K A;  2PVO C;  4WEY A;  4X43 A;  1XWB A;  1XWK A;  3MAK A;  2HRN A;  2IJY A;  3DYR A;  3HCZ A;  1GUH A;  4NV2 A;  1PD2 1;  4MJE A;  3GIX A;  4MPF A;  1FB6 A;  2GZZ A;  3UEM A;  5ECH B;  1TU7 A;  1GNE A;  2CA8 A;  1KNG A;  2XHF A;  5ABR A;  3LGC A;  3DML A;  4IHU A;  5IMD A;  1Y25 A;  4KW6 A;  2JU5 A;  1GH2 A;  5HR0 A;  4HOJ A;  2CAI A;  1ML6 A;  1TU8 A;  3IPZ A;  4I6X A;  3LXZ A;  4KDX A;  5INY A;  2LJK A;  1OC9 A;  2VM1 A;  3D6I A;  4AJ7 A;  3HJO A;  4BWQ A;  2YN1 A;  5ID2 B;  2OE0 A;  1J08 A;  3UIW A;  4XTS A;  2GQM A;  3QOU A;  4GQC A;  4J2F A;  5AGY A;  3APO A;  4V2L A;  3IK7 A;  2C1Y A;  2K6V A;  4EUY A;  2V41 A;  3C71 A;  2HXK A;  2VIM A;  2RM6 A;  2VOC A;  4POL A;  1JLW A;  3US3 A;  2HE3 A;  1M0U A;  4BL7 A;  2JL4 A;  5IPG A;  5FT3 A;  2XC2 A;  3N9J A;  2HNL A;  2R4V A;  3TKR A;  16GS A;  3FZ5 A;  3UVT A;  4KCA A;  2I9H A;  3H79 A;  4MF6 A;  4DSS A;  2CX3 A;  1K0O A;  3N5O A;  4GQF A;  2P5R A;  3PH9 A;  2AUV A;  3DVW A;  4O5R A;  5B6N A;  3FZ9 A;  3GA4 A;  1HNA A;  2WCI A;  3CSJ A;  4EF0 A;  3VWV A;  1YKA A;  1K3Y A;  2RUF A;  2VCQ A;  4ZB9 A;  4L5O A;  1QGV A;  2D2Z A;  2CAQ A;  1SK1 A;  4TXO A;  2B1K A;  2H1B A;  2IFQ B;  3JCM L;  4IP6 A;  4GF0 A;  2HZE B;  2PU9 C;  5D93 A;  2RLI A;  1T1V A;  4LL1 B;  4PGT A;  3H8Q A;  7GSS A;  1NW2 A;  3PGT A;  1MDJ A;  1JZR A;  1GTA A;  1Q4J A;  3ZTL A;  4QL9 A;  1R5A A;  2FA4 A;  4WF5 A;  4K6X A;  3DGQ A;  2BMX A;  1F3B A;  3UBK A;  5F8B A;  3DXB A;  5DVB A;  1M2D A;  4GTU A;  2FWH A;  4HDE A;  2CVB A;  3CRT A;  2B5Y A;  4MP4 A;  2R3X A;  4KDY A;  5HFI A;  3LYK A;  1K0B A;  1S3D A;  3CSI A;  3G7J A;  2DJ3 A;  4YH2 A;  2GGT A;  1U88 A;  2H75 A;  3IDV A;  2YPM A;  1FHE A;  2EIR A;  4K2D A;  5J9C A;  2E7P A;  2MBT A;  5J3R A;  3LOR A;  3G9B A;  2YOI A;  3ZZX A;  3L78 A;  3UMA A;  5ID2 A;  2QGV A;  3IV4 A;  1AQV A;  3F0I A;  4NWY A;  1WWJ A;  4Q5Q A;  1X5D A;  2R6K A;  1ZCP A;  3D21 A;  1WP0 A;  4KDU A;  4HEA 2;  4EL1 A;  4NHZ A;  1HNB A;  4ML1 A;  4XS6 A;  3WD6 A;  1SD8 A;  4JR6 A;  4LL4 B;  1QUW A;  4MZW A;  5AIX A;  5CYY A;  4ZBB A;  1J9B A;  2LRC A;  2VCX A;  4L0U A;  1R5P A;  1TTZ A;  3QAV A;  5B6M A;  5G5E A;  4EKZ A;  4V1A p;  3ZRD A;  2H72 A;  4EC0 A;  2OE3 A;  2IMI A;  3VI5 A;  2N5A A;  1C72 A;  3EYT A;  2H01 A;  1X9M B;  4MAB A;  5H5R A;  2L5O A;  4I5Q A;  3HZ8 A;  5KN1 A;  3I9V 2;  2IMF A;  1ACV A;  4F0B A;  2HSY A;  1F3A A;  1S3C A;  3E3E A;  2FY6 A;  4TW5 A;  3CSH A;  3Q18 A;  5CNW A;  3TRQ A;  4MJA A;  2HZE A;  3M1G A;  2GST A;  4DEJ A;  5DBQ A;  1YY7 A;  3GKM A;  4PQ1 A;  3UVH A;  3I6A A;  1T4Y A;  3TOT A;  1SK0 A;  2KUC A;  2DML A;  1DSB A;  1GSF A;  2MYG A;  2FLS A;  2KHP A;  2R5G A;  4NV5 A;  2VL2 C;  4ECC A;  1EGR A;  3LWA A;  1IYH A;  4WBR D;  3FKF A;  1AW9 A;  2F8F A;  5HFG A;  1X5E A;  3WT2 A;  2H74 A;  2IIY A;  4RUV A;  2XBQ A;  2IME A;  3BCI A;  2YWO A;  2H0G A;  1O85 A;  1QFN A;  1SL1 B;  1EV4 A;  2YWN A;  3W8J A;  1O8X A;  3A2V A;  3IR4 A;  1T4Z A;  2PN8 A;  5JCU A;  5JWO B;  4TR0 A;  2CVD A;  3IRA A;  5IMC A;  3FYG A;  1ERU A;  1XOA A;  1J0F A;  2LV3 A;  1SEN A;  2WUL A;  2ZNM A;  3P7X A;  4OCF A;  3F8U A;  1TRV A;  3HD5 A;  4ZL9 A;  1PKW A;  2X64 A;  3KP8 A;  1ZMA A;  4K7N A;  3E0U A;  6GSW A;  1F37 A;  3HVV A;  1CQG A;  1A23 A;  4G9H A;  2YWM A;  2YJH A;  9GSS A;  4XS4 B;  4WET A;  1LJR A;  1WIK A;  4P3Y B;  3C8E A;  1SKS B;  1OKD A;  4MMM A;  3EU4 A;  4JE1 A;  4YQU A;  2K8S A;  4O32 A;  1X9S B;  20GS A;  1OAZ A;  1YZX A;  2YJ7 A;  3IOS A;  1V2A A;  1GSE A;  2H1A A; 
#chains in the Genus database with same CATH topology
 1FG4 A;  6GSY A;  3IC8 A;  5DQY A;  1UC7 A;  5J41 A;  3QR6 A;  4LA1 A;  1K0D A;  5LCZ A;  5HFK A;  2I81 A;  4RI7 A;  1ZGN A;  2HRF A;  4KND A;  3EU3 A;  2FHE A;  2NDO A;  4F0C A;  5D9T A;  4V2M A;  1EOH A;  2LQO A;  1UN2 A;  4WXT A;  3Q74 A;  4MJB A;  1YDK A;  6GSX A;  4O92 A;  4I97 A;  3FMW A;  3ZIV A;  4XHM A;  4YKG A;  2YNX A;  3GH6 A;  1PFO A;  1V57 A;  13GS A;  2C0D A;  4MK3 A;  2X8H A;  1F9M A;  3RPN A;  2L4C A;  4FYU A;  2M46 A;  2H76 A;  1QK8 A;  3KTL A;  2WGR A;  3QDN A;  3J7Y k;  2DIY A;  2WS2 A;  1LBK A;  3V1W A;  3UBL A;  3EVI A;  4IQA A;  4HJM A;  3NIV A;  2VD1 A;  2GVP A;  4Z2R A;  3F9U A;  3UAR A;  1PL1 A;  2DJ0 A;  3ED3 A;  4BVY A;  3EC3 A;  1EV9 A;  5D9X A;  3MWH A;  1X0R A;  4Z7X A;  3TJB A;  1JZD A;  1XIY A;  4PUF C;  3GSS A;  3VWU A;  1GSS A;  1GSD A;  1GLP A;  3ZIT A;  4EO3 A;  1YEX A;  2FGX A;  1SYX A;  3L0H A;  1GP1 A;  4OCE A;  2B1L A;  2I3Y A;  8GSS A;  3GX0 A;  4ZXG A;  5D73 A;  4MH2 A;  2F9S A;  1AUC A;  1ZYE A;  4ECJ A;  1G7E A;  4F82 A;  1EZK A;  4XS4 A;  5G30 A;  2ON7 A;  3D22 A;  3NOF A;  1M9A A;  3CTF A;  2A2S A;  1FW1 A;  5FWG A;  2HT9 A;  4ZB8 A;  2K9F A;  2R0P A;  1NSW A;  4XRA A;  3UAP A;  1K3L A;  1TRU A;  1OC3 A;  2B5X A;  1R7H A;  3RHB A;  2PGT A;  3FRC A;  4DVC A;  2HYX A;  2EIQ A;  3HVN A;  2HI7 A;  1EWX A;  1I5G A;  1TKD B;  4BWS A;  10GS A;  2JAD A;  3CTG A;  2ALB A;  1YF0 A;  2IN3 A;  4KE3 A;  1WOU A;  2MMO A;  1FOH A;  3ISO A;  5GZZ B;  1WJK A;  4Z2U A;  1XXU A;  4NPB A;  4OO5 A;  4MCU A;  1T7P B;  4ECI A;  5IO2 A;  4TR3 A;  1BQ7 A;  3DVX A;  2RM5 A;  2IMK A;  3M0F A;  4OWY A;  3GL5 A;  1F6M C;  3ME7 A;  3TJJ A;  1SL2 B;  5C00 A;  4L5L A;  2B7J A;  4ULX A;  22GS A;  1MD3 A;  4X4J A;  3ZYW A;  5AIV A;  1X9W B;  2J23 A;  3I43 A;  5ECS A;  1K0C A;  3BD2 A;  5G31 A;  2L5L A;  1THO A;  4MZC A;  2H8L A;  4PTS A;  3TDG A;  5DCG A;  4YAV A;  3TKQ A;  3F6D A;  4EIQ A;  1YF1 A;  1ZL9 A;  4KX4 A;  5IMV A;  1MD4 A;  1SYR A;  4WR4 A;  2L6D A;  4MA9 A;  1TW9 A;  1ERV A;  2WDU A;  1MDI A;  3WGX A;  3IHQ A;  2KOK A;  5JCG A;  2CZ2 A;  3HHV A;  5ECR B;  1AQW A;  2LNT A;  2Z9S A;  4I2T A;  2C3N A;  3Q19 A;  4DSQ A;  1PA3 A;  3MNG A;  3O3T A;  4JR4 A;  1JZW A;  1RK4 A;  2MMN A;  1PRX A;  3GYK A;  2V2G A;  2L57 A;  3TRX A;  1G6W A;  1TP9 A;  2N5F A;  3KMO A;  2YWI A;  1PSQ A;  2VD0 A;  2GS3 A;  5ECM B;  4JBB A;  3ZVJ A;  1M2A A;  1SD9 A;  3IBH A;  1AXD A;  2IPA A;  4K8M A;  2HSH A;  4PQH A;  5F0G A;  2HSM A;  4TR4 A;  4XIH A;  2F8A A;  3APQ A;  2WFC A;  3DWV A;  4IW9 A;  4GSS A;  2WB9 A;  2HRA A;  2LRN A;  4CY6 A;  5KN2 A;  4K7I A;  1YQ1 A;  5J4U A;  5CO3 A;  4EXJ A;  4TR1 B;  3GKN A;  5F05 A;  4MJC A;  2VLT A;  5KN3 A;  2C0E A;  4WF4 A;  2H6X A;  5CRD A;  2O7K A;  1Z6M A;  3EE2 A;  4V2N A;  4ZL8 A;  3KXO A;  3C1R A;  1NM3 A;  1BG5 A;  5CRE A;  2MBS A;  4USS A;  2L4Q A;  1KTE A;  1ZYQ B;  3TJF A;  2HZF A;  3FY7 A;  2PMT A;  2DJ2 A;  2XPD A;  1THX A;  2VUP A;  5IIZ A;  1WE0 A;  4WR5 A;  5JCW A;  4CW9 A;  5A5K A;  2DIZ A;  5F06 A;  3L9S A;  3RDW A;  1T00 A;  4WKW A;  1U87 A;  4EDZ A;  2GLR A;  5ENU A;  2DMM A;  3EWL A;  2K8V A;  1G7O A;  5GAN D;  2DJK A;  1RW1 A;  2C3Q A;  6GST A;  3GL3 A;  3UL3 A;  4AJ8 A;  4GXZ A;  1JFU A;  1ERW A;  2YV7 A;  3FHK A;  4OFT A;  3OR5 A;  1OE8 A;  1XW9 A;  1DE2 A;  1W4V A;  4JED A;  4IJ3 A;  1A2J A;  5H5S A;  3L9V A;  4NMU A;  1XVQ A;  3VWW A;  3C73 A;  5DQS A;  2ZCT A;  4K9Z A;  3RAZ A;  5DDL A;  5E4W A;  3A2W A;  3QFA C;  4HZ4 A;  1AIU A;  5IO0 A;  3GRX A;  1M99 A;  1S3A A;  4GSN A;  2X4A A;  1YJ6 A;  2IFQ A;  3QFB C;  5A4V A;  1K3O A;  2AV4 A;  3KIJ A;  1E2Y A;  5HR3 A;  2YV9 A;  3ZRE A;  2QKE A;  2GSR A;  2AJQ B;  1TI3 A;  1U6T A;  5ELA A;  3O6T A;  5B8B A;  3IE3 A;  3GHA A;  4ACS A;  3CQF A;  2JSY A;  5BRT A;  4HU9 A;  1SJZ A;  2DSA A;  3TRP A;  3ERG A;  4TR1 A;  1XWG A;  1A8L A;  2H70 A;  1A0R P;  3A2X A;  4EDY A;  4RQX A;  3EMX A;  3BOA A;  2I4A A;  2JZS A;  2E0Q A;  5HR2 A;  1U3A A;  1ERT A;  4F9Z A;  1XZO A;  5DAL B;  3UJ1 A;  3IHG A;  3LW9 A;  4IVF A;  3GMF A;  3DKS A;  1FVJ A;  3VUR A;  2VLU A;  2TIR A;  3F6F A;  1EOG A;  1GNW A;  5IMF A;  4HI7 A;  6GSS A;  4N0V A;  3MDK A;  3EIN A;  2EIO A;  1XBS A;  1GL8 A;  2FUG 2;  4G10 A;  4MF5 A;  3VFI A;  1SL0 B;  4N10 A;  4OD7 A;  2UZ8 A;  2EC4 A;  3SWL A;  1GTU A;  4MH3 A;  3D4T A;  2CZ3 A;  3DIE A;  2L59 A;  4IGJ A;  4YAP A;  4J57 E;  3ERF A;  2OAC A;  2WZ9 A;  1AC1 A;  4CHS A;  1KBN A;  3A5W A;  3M9J A;  4FH8 A;  1TK0 B;  2CX4 A;  2AB6 A;  3ERW A;  1EP7 A;  4IQ1 A;  2QC7 A;  4PUR A;  3J7Y b;  3PR8 A;  5A4U A;  1DUG A;  2PBJ A;  1ZYN A;  3NZN A;  2YCD A;  2G0F A;  1EEM A;  2MMZ A;  5IOW A;  2FWG A;  5CAX A;  3TJK A;  2IMD A;  2NBS A;  4N0Z A;  4KCE A;  4F03 A;  5LNK e;  2H71 A;  4IJI A;  1B9Y C;  4PQI A;  1RQM A;  5ECQ B;  2LJA A;  2MZC A;  3D0Z A;  2VCT A;  5D8I A;  3M3M A;  4ISD A;  2B7K A;  4BVX A;  1XPV A;  1TXX A;  5KOW A;  3QMX A;  1O73 A;  3EUR A;  1JHB A;  4CDO A;  2H19 A;  2E2M A;  4WBJ A;  3FZ4 A;  2G2Q A;  2FNO A;  4RI6 A;  1XVW A;  2VAF A;  1HYU A;  3EPT A;  3W6G A;  1PGT A;  1GLQ A;  4V1A g;  4OO4 A;  4KAE A;  3GNJ A;  1Q98 A;  1PL2 A;  4HQZ A;  2XPE A;  4MLY A;  2JZR A;  1BAY A;  3HXS A;  3TUE A;  3KMN A;  2VLV A;  2X99 A;  2R0G A;  2O8V B;  4PXO A;  2F3M A;  2XBI A;  4KSM A;  5DAL A;  2GTU A;  4AGS A;  4QQ7 A;  4IKH A;  2M72 A;  3TGZ A;  1ZYP A;  1ON4 A;  2YAN A;  5CP1 A;  1M3J A;  1PN9 A;  3CMI A;  2VL3 A;  4PUA A;  5B7C A;  2J9H A;  3RBT A;  2PPT A;  2LUS A;  19GS A;  1I9D A;  1N8J A;  2OBK A;  3IAM 2;  5IMA A;  5D9W A;  3GST A;  1GUM A;  2FCH A;  1VF1 A;  3LJR A;  3EMP A;  2F51 A;  2H1G A;  5ECP B;  2H0I A;  3L4N A;  1R26 A;  3VK9 A;  2GZP A;  1WMJ A;  2DJJ A;  4K1F A;  2DLX A;  2A2R A;  1B8X A;  2PUK C;  5L71 A;  3O76 A;  2PVQ A;  1Z7R A;  2GQK A;  4HQS A;  3DD3 A;  2X8G A;  2GT5 A;  2LJR A;  1T8E B;  2RII A;  3R3E A;  5EL8 A;  1XFL A;  1NHY A;  3KTB A;  3D5J A;  4XRD A;  2VCZ A;  5ECK B;  2C4J A;  2C8U A;  2VCW A;  2VCV A;  4GLT A;  1ABA A;  2GDR A;  1OE7 A;  3HKR A;  4JZQ A;  4GST A;  3P90 A;  4ZB6 A;  3H4K A;  2FA8 A;  2IWT A;  5G2Z A;  4NXI A;  4E8H A;  4MDC A;  4K7O A;  5D96 A;  2AAW A;  2AYT A;  1M7T A;  3ZMK A;  1N2A A;  4G2E A;  4N30 A;  3CRU A;  1H75 A;  2LNS A;  2LQQ A;  2LST A;  3FR3 A;  4OFM A;  3CBU A;  1DBY A;  1U3I A;  2V6O A;  1NHO A;  2VL9 A;  2REM A;  4FIW A;  1V98 A;  3I69 A;  3QPM A;  2GQL A;  2TRX A;  2H1D A;  1T3B A;  3KH9 A;  1SU9 A;  4I8B A;  5CRH A;  6GSV A;  3F4T A;  1HD2 A;  2CT6 A;  5ECN B;  3IXR A;  3GX8 A;  1FB0 A;  3ZVJ D;  4O5U A;  5H5Q A;  3U6V A;  1TK8 B;  1VF3 A;  4ML6 A;  3M8N A;  2HFD A;  3GN3 A;  2K18 A;  4KB3 A;  4HUA A;  5B8A A;  1MDK A;  4XS1 A;  2IL3 A;  2FD3 A;  5DAK B;  2TRC P;  5ECL B;  2PER A;  4TXV A;  4MPG A;  1OKT A;  3GH9 A;  4ZBA A;  1BYE A;  2DBC A;  3BCK A;  5AIS A;  2BJX A;  1E6B A;  3KM6 A;  1GUL A;  1O7U A;  4KSO A;  1HQO A;  1O8W A;  2HLS A;  3KZQ A;  1A2L A;  2KP2 A;  1SK2 A;  5ECI B;  2AHE A;  3GKX A;  1GTI A;  4POB A;  2N5B A;  1BED A;  3G7Y A;  3L9U A;  5G5F A;  3FK8 A;  4AF2 A;  5DJM A;  1SJI A;  3RPP A;  4MZB A;  1PX6 A;  1PN0 A;  2QSI A;  5IPH A;  3ME8 A;  3PPU A;  1A2M A;  6GSU A;  1M9B A;  2V1M A;  3FZA A;  4KUN A;  4I2U A;  3DEX A;  2VO4 A;  1SKW B;  1VF2 A;  2X8C A;  3TKS C;  2WJU A;  2LTK A;  2R37 A;  4ZIL A;  4TRX A;  3LG6 A;  2JSZ A;  3VPQ A;  3TJG A;  3KGK A;  4J56 E;  1WRY A;  3TKS A;  1AAZ A;  1OVN A;  1R4W A;  1DE1 A;  1B4P A;  1XCC A;  3ZL5 A;  3HZ4 A;  3PIN A;  4AJ6 A;  3QAW A;  4NAX A;  1USB A;  3LQ7 A;  5EY6 A;  3KD0 A;  3WT1 A;  2X49 A;  2C0F A;  5BMU A;  4N11 A;  1XWC A;  2A4V A;  1GUK A;  2A4H A;  4K0G A;  4Q5F A;  4TKY A;  5CRW A;  3LYP A;  4A5P A;  4GCI A;  3C7M A;  4IBP A;  1V40 A;  4TOP A;  3C1S A;  4H86 A;  2KLX A;  2FWE A;  5KN0 A;  3AY8 A;  1AQX A;  3M9K A;  4LMV A;  5JWQ B;  4XCS A;  4GWR A;  1Z5Y E;  2ES7 A;  3MIX A;  4D73 B;  5GAP D;  2JZT A;  1B4Q A;  1FAA A;  4IS0 A;  1TK5 B;  11GS A;  1EGO A;  3ZML A;  5G1L A;  17GS A;  4K0N A;  5GST A;  3CYN A;  1PQN A;  2YZH A;  1JLV A;  1SJ6 A;  4O7H A;  1TJD A;  1TDI A;  1EEJ A;  3WYW A;  2A2P A;  5IOX A;  4HJ2 A;  1A8Y A;  1PKZ A;  5IQY A;  3QD9 A;  5JWR B;  1ILO A;  2B6M A;  5DAK A;  4NHW A;  1GTB A;  3HJM A;  2OBI A;  3P2A A;  1BJX A;  1FOV A;  2V6K A;  3F4R A;  1GSU A;  3IA1 A;  5GSS A;  5F07 A;  1W89 A;  2L6C A;  2H73 A;  2P31 A;  4X0X A;  3RHC A;  3ZFL A;  3LXT A;  3GUR A;  3HVX A;  1ZOF A;  4G0I A;  2KP1 A;  5HR1 A;  5ELG A;  2GZY A;  5A4W A;  1FVK A;  3LFL A;  5KOX A;  2QA2 A;  1MEK A;  2V32 A;  4K5S A;  4F2I A;  1ZZY A;  4E8E A;  1GRX A;  3APS A;  2PWJ A;  3TKS E;  3E9J B;  2OA7 A;  4HU7 A;  4O5Q A;  1KEB A;  2FWF A;  2E2G A;  3FR9 A;  1Y6E A;  3HY2 A;  1XW6 A;  1B9X C;  1MTC A;  1F2E A;  4ZIJ A;  3WGD A;  3ZLP A;  3P8W A;  3QCP A;  2O85 A;  4POK A;  4TVE A;  3QAG A;  4K2X A;  2R2J A;  2OE1 A;  5E59 A;  1QQ2 A;  5FHI A;  4G0K A;  4BPY A;  2B5E A;  2B3S A;  5DJL A;  3F4S A;  4EE0 A;  1XOB A;  1OC8 A;  1YEP A;  1K0M A;  1TRW A;  2P5Q A;  1VRS D;  2H66 A;  3HVS A;  4MF7 A;  1V58 A;  2VL2 A;  1K0N A;  2LS5 A;  3GFK A;  2C0G A;  2YP6 A;  1PMT A;  2M80 A;  1UVZ A;  4D73 A;  3VWX A;  4IN0 A;  2OJL A;  1M2B A;  2ZUP A;  2DJ1 A;  2H0H A;  3H93 A;  1S3R A;  3TCO A;  1TRS A;  2CQ9 A;  4ICY A;  1UA5 A;  3DRN A;  1EP8 A;  1G0T A;  3GV1 A;  4IEL A;  18GS A;  1X5C A;  3D4M A;  2O87 A;  4BA7 A;  4LLR A;  3IAS 2;  5HQP A;  3WGE A;  1XWA A;  1GWC A;  2CVK A;  3R2Q A;  4QL7 A;  3FR6 A;  1O6J A;  4BVY B;  1URM A;  3S9F A;  1CQH A;  1HNC A;  4ZBD A;  14GS A;  3KP9 A;  2C3T A;  3A3T A;  3MSZ A;  2VM2 A;  3BBY A;  1Z3E A;  3VLN A;  3IC4 A;  3ZFB A;  2BTO T;  12GS A;  3HJP A;  3U5R E;  3LEF A;  3Q6O A;  1YKC A;  3TB2 A;  2C80 A;  5J5N A;  3KEB A;  2OKA A;  4JU5 A;  3SBC A;  5DCH A;  3VI7 A;  3F63 A;  3F3R A;  3GTU B;  5KEJ A;  1BX9 A;  4PX1 A;  4PNF A;  4Q5R A;  3TOU A;  4L8E A;  5EPF A;  3UOM A;  2I1U A;  5ECO B;  1JZO A;  1QXH A;  4KA0 A;  4ILF A;  1GSY A;  3BJ5 A;  2LKU A;  3F3Q A;  2H30 A;  3ZIJ A;  4EVM A;  2NPB A;  2H6Z A;  2OAD A;  2LRT A;  4ID0 A;  3A5I A;  3CXG A;  4YQM A;  3IK9 A;  2DC5 A;  3TKP A;  1G6Y A;  4X1U A;  1OYJ A;  1Z6N A;  2CV4 A;  3G7I A;  1A24 A;  4G0L A;  4G19 A;  4L0W A;  3HDC A;  3LSZ A;  4TN8 A;  5CRG A;  4ZL7 A;  2RUE A;  2P0G A;  1Z7P A;  4LMW A;  2GSQ A;  1ST9 A;  2GSS A;  4GRF A;  4KGI A;  1FO5 A;  5D9V A;  1OC9 B;  3GUS A;  2LEG A;  1A0F A;  1H4O A;  3GKK A;  1O81 A;  2YZU A;  3KH7 A;  5EVO A;  5LD0 A;  4KH7 A;  4MNN A;  1SKR B;  4Q5N A;  4YQV A;  1VGL A;  4OFN A;  5C04 A;  4IP1 A;  4BL7 B;  4FO5 A;  1K0A A;  2GT6 A;  3VPT A;  5IM9 A;  1PX7 A;  4OMV A;  2JAC A;  4FYB A;  4HZ2 A;  2NTO A;  4POM A;  4ECB A;  4JRR A;  2WRT A;  3W8S A;  1B48 A;  2NVL A;  3HA9 A;  5COH A;  3FEU A;  2O89 A;  5J9B A;  2ON5 A;  2DKI A;  3KCM A;  1WPI A;  1IYI A;  2MMA A;  4FYC A;  4DSS B;  5IMZ A;  1VF4 A;  5AN1 A;  2H6Y A;  3KJY A;  4PNG A;  1GSQ A;  1TOF A;  3FW2 A;  1Z9H A;  3K8N A;  4DSR A;  1XW5 A;  4HS1 A;  4RQR A;  3H1N A;  1TI1 A;  4TXO B;  1V9W A;  3HYP A;  1QMV A;  1LU4 A;  3GTU A;  5G1K A;  2PVO C;  4K5R A;  4WEY A;  4X43 A;  1XWB A;  1XWK A;  3MAK A;  2HRN A;  2IJY A;  3DYR A;  3HCZ A;  1GUH A;  4NV2 A;  1PD2 1;  4MJE A;  3GIX A;  4MPF A;  1FB6 A;  2GZZ A;  3UEM A;  5ECH B;  1TU7 A;  1GNE A;  2CA8 A;  1KNG A;  2XHF A;  5ABR A;  3LGC A;  3DML A;  2DKH A;  4IHU A;  5IMD A;  3MYD A;  1Y25 A;  4KW6 A;  2JU5 A;  1GH2 A;  5HR0 A;  4HOJ A;  2CAI A;  1ML6 A;  1TU8 A;  3IPZ A;  4I6X A;  3LXZ A;  4KDX A;  5INY A;  2LJK A;  1OC9 A;  2VM1 A;  3D6I A;  4AJ7 A;  3HJO A;  4BWQ A;  2YN1 A;  5ID2 B;  2OE0 A;  1J08 A;  3UIW A;  4XTS A;  2GQM A;  3QOU A;  4GQC A;  4J2F A;  5AGY A;  3APO A;  4V2L A;  3IK7 A;  2C1Y A;  2K6V A;  4EUY A;  2V41 A;  2HRK A;  3C71 A;  2HXK A;  2VIM A;  2RM6 A;  2VOC A;  4POL A;  1JLW A;  3US3 A;  2HE3 A;  1M0U A;  4BL7 A;  2JL4 A;  5IPG A;  5FT3 A;  2XC2 A;  3N9J A;  2HNL A;  2R4V A;  4FQU A;  3TKR A;  16GS A;  3FZ5 A;  3UVT A;  4KCA A;  2I9H A;  3H79 A;  4MF6 A;  4DSS A;  2CX3 A;  1K0O A;  3N5O A;  4GQF A;  2P5R A;  3PH9 A;  2AUV A;  3DVW A;  4O5R A;  5B6N A;  3FZ9 A;  3GA4 A;  1HNA A;  2WCI A;  3CSJ A;  4EF0 A;  3VWV A;  1YKA A;  1K3Y A;  2RUF A;  2VCQ A;  4ZB9 A;  4L5O A;  1QGV A;  2D2Z A;  2CAQ A;  1SK1 A;  4TXO A;  2B1K A;  2H1B A;  2IFQ B;  3JCM L;  4IP6 A;  4GF0 A;  2HZE B;  4EIP A;  2PU9 C;  5D93 A;  2RLI A;  1T1V A;  4LL1 B;  4PGT A;  3H8Q A;  7GSS A;  1NW2 A;  2R0C A;  3PGT A;  1MDJ A;  1JZR A;  1GTA A;  1Q4J A;  2QA1 A;  3ZTL A;  4QL9 A;  1R5A A;  2FA4 A;  4WF5 A;  4K6X A;  3DGQ A;  2BMX A;  1F3B A;  3UBK A;  5F8B A;  3DXB A;  5DVB A;  1XG8 A;  1M2D A;  4GTU A;  2FWH A;  4HDE A;  2CVB A;  3CRT A;  2B5Y A;  4MP4 A;  2R3X A;  4KDY A;  5HFI A;  3LYK A;  1K0B A;  1S3D A;  3CSI A;  3G7J A;  2DJ3 A;  4YH2 A;  2GGT A;  1U88 A;  2H75 A;  3IDV A;  2YPM A;  1FHE A;  2EIR A;  4K2D A;  5J9C A;  2E7P A;  2MBT A;  5J3R A;  3LOR A;  3G9B A;  2YOI A;  3ZZX A;  3L78 A;  3UMA A;  5ID2 A;  2QGV A;  3IV4 A;  1AQV A;  4BIK A;  3F0I A;  4NWY A;  1WWJ A;  4Q5Q A;  1X5D A;  2R6K A;  1ZCP A;  3D21 A;  1WP0 A;  4KDU A;  4HEA 2;  4EL1 A;  4NHZ A;  1HNB A;  4ML1 A;  4XS6 A;  3WD6 A;  1SD8 A;  4JR6 A;  4HSC X;  4LL4 B;  1QUW A;  4MZW A;  5AIX A;  5CYY A;  4ZBB A;  1J9B A;  2LRC A;  2VCX A;  4L0U A;  1R5P A;  1TTZ A;  3QAV A;  5B6M A;  5G5E A;  4EKZ A;  4V1A p;  3ZRD A;  2H72 A;  4EC0 A;  2OE3 A;  4YKF A;  2IMI A;  3VI5 A;  2N5A A;  1C72 A;  3EYT A;  2H01 A;  1X9M B;  4MAB A;  5H5R A;  2L5O A;  4I5Q A;  3HZ8 A;  5KN1 A;  3I9V 2;  2IMF A;  1ACV A;  4F0B A;  2HSY A;  1F3A A;  1S3C A;  3E3E A;  2FY6 A;  4TW5 A;  3CSH A;  4BVX B;  3Q18 A;  5CNW A;  3TRQ A;  4MJA A;  2HZE A;  3M1G A;  2GST A;  4DEJ A;  5DBQ A;  1YY7 A;  3GKM A;  4PQ1 A;  3UVH A;  3I6A A;  4Z2T A;  1T4Y A;  3TOT A;  1SK0 A;  2KUC A;  2DML A;  1M3I A;  1DSB A;  1GSF A;  2MYG A;  2FLS A;  2KHP A;  2R5G A;  4KF9 A;  4NV5 A;  2VL2 C;  4ECC A;  1EGR A;  3LWA A;  1IYH A;  4WBR D;  3FKF A;  1AW9 A;  2F8F A;  5HFG A;  1X5E A;  3WT2 A;  2H74 A;  2IIY A;  4RUV A;  2XBQ A;  2IME A;  3BCI A;  2YWO A;  2H0G A;  1O85 A;  1QFN A;  1SL1 B;  1EV4 A;  2YWN A;  3W8J A;  1O8X A;  3A2V A;  3IR4 A;  1T4Z A;  2PN8 A;  5JCU A;  5JWO B;  4TR0 A;  2CVD A;  3IRA A;  5IMC A;  3FYG A;  1ERU A;  1XOA A;  1J0F A;  2LV3 A;  1SEN A;  2WUL A;  2ZNM A;  3P7X A;  4OCF A;  3F8U A;  1TRV A;  3HD5 A;  4ZL9 A;  1PKW A;  2X64 A;  3KP8 A;  1ZMA A;  4K7N A;  3E0U A;  6GSW A;  1F37 A;  3HVV A;  1CQG A;  1A23 A;  4G9H A;  2YWM A;  2YJH A;  9GSS A;  4XS4 B;  4WET A;  1LJR A;  1WIK A;  4P3Y B;  3C8E A;  1SKS B;  1OKD A;  4MMM A;  3EU4 A;  4CY8 A;  4JE1 A;  4YQU A;  2K8S A;  4O32 A;  1X9S B;  20GS A;  1OAZ A;  1YZX A;  2YJ7 A;  3IOS A;  1V2A A;  1GSE A;  2H1A A; 
#chains in the Genus database with same CATH homology
 1FG4 A;  6GSY A;  3IC8 A;  5DQY A;  1UC7 A;  5J41 A;  3QR6 A;  4LA1 A;  1K0D A;  5LCZ A;  5HFK A;  2I81 A;  4RI7 A;  1ZGN A;  2HRF A;  4KND A;  3EU3 A;  2FHE A;  2NDO A;  4F0C A;  5D9T A;  4V2M A;  1EOH A;  2LQO A;  1UN2 A;  4WXT A;  3Q74 A;  4MJB A;  1YDK A;  6GSX A;  4O92 A;  4I97 A;  3FMW A;  3ZIV A;  4XHM A;  4YKG A;  2YNX A;  3GH6 A;  1V57 A;  13GS A;  2C0D A;  4MK3 A;  2X8H A;  1F9M A;  3RPN A;  2L4C A;  4FYU A;  2M46 A;  2H76 A;  1QK8 A;  3KTL A;  2WGR A;  3QDN A;  3J7Y k;  2DIY A;  2WS2 A;  1LBK A;  3V1W A;  3UBL A;  3EVI A;  4IQA A;  4HJM A;  3NIV A;  2VD1 A;  2GVP A;  4Z2R A;  3F9U A;  3UAR A;  1PL1 A;  2DJ0 A;  3ED3 A;  4BVY A;  3EC3 A;  1EV9 A;  5D9X A;  3MWH A;  1X0R A;  4Z7X A;  3TJB A;  1JZD A;  1XIY A;  4PUF C;  3GSS A;  3VWU A;  1GSS A;  1GSD A;  1GLP A;  3ZIT A;  4EO3 A;  1YEX A;  2FGX A;  1SYX A;  3L0H A;  1GP1 A;  4OCE A;  2B1L A;  2I3Y A;  8GSS A;  3GX0 A;  4ZXG A;  5D73 A;  4MH2 A;  2F9S A;  1AUC A;  1ZYE A;  4ECJ A;  1G7E A;  4F82 A;  1EZK A;  4XS4 A;  5G30 A;  2ON7 A;  3D22 A;  3NOF A;  1M9A A;  3CTF A;  2A2S A;  1FW1 A;  5FWG A;  2HT9 A;  4ZB8 A;  2K9F A;  2R0P A;  1NSW A;  4XRA A;  3UAP A;  1K3L A;  1TRU A;  1OC3 A;  2B5X A;  1R7H A;  3RHB A;  2PGT A;  3FRC A;  4DVC A;  2HYX A;  2EIQ A;  2HI7 A;  1EWX A;  1I5G A;  1TKD B;  4BWS A;  10GS A;  2JAD A;  3CTG A;  2ALB A;  1YF0 A;  2IN3 A;  4KE3 A;  1WOU A;  2MMO A;  1FOH A;  3ISO A;  5GZZ B;  1WJK A;  4Z2U A;  1XXU A;  4NPB A;  4OO5 A;  4MCU A;  1T7P B;  4ECI A;  5IO2 A;  4TR3 A;  1BQ7 A;  3DVX A;  2RM5 A;  2IMK A;  3M0F A;  4OWY A;  3GL5 A;  1F6M C;  3ME7 A;  3TJJ A;  1SL2 B;  5C00 A;  4L5L A;  2B7J A;  4ULX A;  22GS A;  1MD3 A;  4X4J A;  3ZYW A;  5AIV A;  1X9W B;  2J23 A;  3I43 A;  5ECS A;  1K0C A;  3BD2 A;  5G31 A;  2L5L A;  1THO A;  4MZC A;  2H8L A;  4PTS A;  3TDG A;  5DCG A;  4YAV A;  3TKQ A;  3F6D A;  4EIQ A;  1YF1 A;  1ZL9 A;  4KX4 A;  5IMV A;  1MD4 A;  1SYR A;  4WR4 A;  2L6D A;  4MA9 A;  1TW9 A;  1ERV A;  2WDU A;  1MDI A;  3WGX A;  3IHQ A;  2KOK A;  5JCG A;  2CZ2 A;  3HHV A;  5ECR B;  1AQW A;  2LNT A;  2Z9S A;  4I2T A;  2C3N A;  3Q19 A;  4DSQ A;  1PA3 A;  3MNG A;  3O3T A;  4JR4 A;  1JZW A;  1RK4 A;  2MMN A;  1PRX A;  3GYK A;  2V2G A;  2L57 A;  3TRX A;  1G6W A;  1TP9 A;  2N5F A;  3KMO A;  2YWI A;  1PSQ A;  2VD0 A;  2GS3 A;  5ECM B;  4JBB A;  3ZVJ A;  1M2A A;  1SD9 A;  3IBH A;  1AXD A;  2IPA A;  4K8M A;  2HSH A;  4PQH A;  5F0G A;  2HSM A;  4TR4 A;  4XIH A;  2F8A A;  3APQ A;  2WFC A;  3DWV A;  4IW9 A;  4GSS A;  2WB9 A;  2HRA A;  2LRN A;  4CY6 A;  5KN2 A;  4K7I A;  1YQ1 A;  5J4U A;  5CO3 A;  4EXJ A;  4TR1 B;  3GKN A;  5F05 A;  4MJC A;  2VLT A;  5KN3 A;  2C0E A;  4WF4 A;  2H6X A;  5CRD A;  2O7K A;  1Z6M A;  3EE2 A;  4V2N A;  4ZL8 A;  3KXO A;  3C1R A;  1NM3 A;  1BG5 A;  5CRE A;  2MBS A;  4USS A;  2L4Q A;  1KTE A;  1ZYQ B;  3TJF A;  2HZF A;  3FY7 A;  2PMT A;  2DJ2 A;  2XPD A;  1THX A;  2VUP A;  5IIZ A;  1WE0 A;  4WR5 A;  5JCW A;  4CW9 A;  5A5K A;  2DIZ A;  5F06 A;  3L9S A;  3RDW A;  1T00 A;  4WKW A;  1U87 A;  4EDZ A;  2GLR A;  5ENU A;  2DMM A;  3EWL A;  2K8V A;  1G7O A;  5GAN D;  2DJK A;  1RW1 A;  2C3Q A;  6GST A;  3GL3 A;  3UL3 A;  4AJ8 A;  4GXZ A;  1JFU A;  1ERW A;  2YV7 A;  3FHK A;  4OFT A;  3OR5 A;  1OE8 A;  1XW9 A;  1DE2 A;  1W4V A;  4JED A;  4IJ3 A;  1A2J A;  5H5S A;  3L9V A;  4NMU A;  1XVQ A;  3VWW A;  3C73 A;  5DQS A;  2ZCT A;  4K9Z A;  3RAZ A;  5DDL A;  5E4W A;  3A2W A;  3QFA C;  4HZ4 A;  1AIU A;  5IO0 A;  3GRX A;  1M99 A;  1S3A A;  4GSN A;  2X4A A;  1YJ6 A;  2IFQ A;  3QFB C;  5A4V A;  1K3O A;  2AV4 A;  3KIJ A;  1E2Y A;  5HR3 A;  2YV9 A;  3ZRE A;  2QKE A;  2GSR A;  2AJQ B;  1TI3 A;  1U6T A;  5ELA A;  3O6T A;  5B8B A;  3IE3 A;  3GHA A;  4ACS A;  2JSY A;  5BRT A;  4HU9 A;  1SJZ A;  2DSA A;  3TRP A;  3ERG A;  4TR1 A;  1XWG A;  1A8L A;  2H70 A;  1A0R P;  3A2X A;  4EDY A;  4RQX A;  3EMX A;  3BOA A;  2I4A A;  2JZS A;  2E0Q A;  5HR2 A;  1U3A A;  1ERT A;  4F9Z A;  1XZO A;  5DAL B;  3UJ1 A;  3IHG A;  3LW9 A;  4IVF A;  3GMF A;  3DKS A;  1FVJ A;  3VUR A;  2VLU A;  2TIR A;  3F6F A;  1EOG A;  1GNW A;  5IMF A;  4HI7 A;  6GSS A;  4N0V A;  3MDK A;  3EIN A;  2EIO A;  1XBS A;  1GL8 A;  2FUG 2;  4G10 A;  4MF5 A;  3VFI A;  1SL0 B;  4N10 A;  4OD7 A;  2UZ8 A;  2EC4 A;  3SWL A;  1GTU A;  4MH3 A;  3D4T A;  2CZ3 A;  3DIE A;  2L59 A;  4IGJ A;  4YAP A;  4J57 E;  3ERF A;  2OAC A;  2WZ9 A;  1AC1 A;  4CHS A;  1KBN A;  3A5W A;  3M9J A;  4FH8 A;  1TK0 B;  2CX4 A;  2AB6 A;  3ERW A;  1EP7 A;  4IQ1 A;  2QC7 A;  4PUR A;  3J7Y b;  3PR8 A;  5A4U A;  1DUG A;  2PBJ A;  1ZYN A;  3NZN A;  2YCD A;  2G0F A;  1EEM A;  2MMZ A;  5IOW A;  2FWG A;  5CAX A;  3TJK A;  2IMD A;  2NBS A;  4N0Z A;  4KCE A;  4F03 A;  5LNK e;  2H71 A;  4IJI A;  1B9Y C;  4PQI A;  1RQM A;  5ECQ B;  2LJA A;  2MZC A;  3D0Z A;  2VCT A;  5D8I A;  3M3M A;  4ISD A;  2B7K A;  4BVX A;  1XPV A;  1TXX A;  5KOW A;  3QMX A;  1O73 A;  3EUR A;  1JHB A;  4CDO A;  2H19 A;  2E2M A;  4WBJ A;  3FZ4 A;  2G2Q A;  2FNO A;  4RI6 A;  1XVW A;  2VAF A;  1HYU A;  3EPT A;  3W6G A;  1PGT A;  1GLQ A;  4V1A g;  4OO4 A;  4KAE A;  3GNJ A;  1Q98 A;  1PL2 A;  4HQZ A;  2XPE A;  4MLY A;  2JZR A;  1BAY A;  3HXS A;  3TUE A;  3KMN A;  2VLV A;  2X99 A;  2R0G A;  2O8V B;  4PXO A;  2F3M A;  2XBI A;  4KSM A;  5DAL A;  2GTU A;  4AGS A;  4QQ7 A;  4IKH A;  2M72 A;  3TGZ A;  1ZYP A;  1ON4 A;  2YAN A;  5CP1 A;  1PN9 A;  3CMI A;  2VL3 A;  4PUA A;  5B7C A;  2J9H A;  3RBT A;  2PPT A;  2LUS A;  19GS A;  1I9D A;  1N8J A;  2OBK A;  3IAM 2;  5IMA A;  5D9W A;  3GST A;  1GUM A;  2FCH A;  1VF1 A;  3LJR A;  3EMP A;  2F51 A;  2H1G A;  5ECP B;  2H0I A;  3L4N A;  1R26 A;  3VK9 A;  2GZP A;  1WMJ A;  2DJJ A;  4K1F A;  2DLX A;  2A2R A;  1B8X A;  2PUK C;  5L71 A;  3O76 A;  2PVQ A;  1Z7R A;  2GQK A;  4HQS A;  3DD3 A;  2X8G A;  2GT5 A;  2LJR A;  1T8E B;  2RII A;  3R3E A;  5EL8 A;  1XFL A;  1NHY A;  3KTB A;  3D5J A;  4XRD A;  2VCZ A;  5ECK B;  2C4J A;  2C8U A;  2VCW A;  2VCV A;  4GLT A;  1ABA A;  2GDR A;  1OE7 A;  3HKR A;  4JZQ A;  4GST A;  3P90 A;  4ZB6 A;  3H4K A;  2FA8 A;  2IWT A;  5G2Z A;  4NXI A;  4E8H A;  4MDC A;  4K7O A;  5D96 A;  2AAW A;  2AYT A;  1M7T A;  3ZMK A;  1N2A A;  4G2E A;  4N30 A;  3CRU A;  1H75 A;  2LNS A;  2LQQ A;  2LST A;  3FR3 A;  4OFM A;  3CBU A;  1DBY A;  1U3I A;  2V6O A;  1NHO A;  2VL9 A;  2REM A;  4FIW A;  1V98 A;  3I69 A;  3QPM A;  2GQL A;  2TRX A;  2H1D A;  1T3B A;  3KH9 A;  1SU9 A;  4I8B A;  5CRH A;  6GSV A;  3F4T A;  1HD2 A;  2CT6 A;  5ECN B;  3IXR A;  3GX8 A;  1FB0 A;  3ZVJ D;  4O5U A;  5H5Q A;  3U6V A;  1TK8 B;  1VF3 A;  4ML6 A;  3M8N A;  2HFD A;  3GN3 A;  2K18 A;  4KB3 A;  4HUA A;  5B8A A;  1MDK A;  4XS1 A;  2IL3 A;  2FD3 A;  5DAK B;  2TRC P;  5ECL B;  2PER A;  4TXV A;  4MPG A;  1OKT A;  3GH9 A;  4ZBA A;  1BYE A;  2DBC A;  3BCK A;  5AIS A;  2BJX A;  1E6B A;  3KM6 A;  1GUL A;  1O7U A;  4KSO A;  1HQO A;  1O8W A;  2HLS A;  3KZQ A;  1A2L A;  2KP2 A;  1SK2 A;  5ECI B;  2AHE A;  3GKX A;  1GTI A;  4POB A;  2N5B A;  1BED A;  3G7Y A;  3L9U A;  5G5F A;  3FK8 A;  4AF2 A;  5DJM A;  1SJI A;  3RPP A;  4MZB A;  1PX6 A;  1PN0 A;  2QSI A;  5IPH A;  3ME8 A;  3PPU A;  1A2M A;  6GSU A;  1M9B A;  2V1M A;  3FZA A;  4KUN A;  4I2U A;  3DEX A;  2VO4 A;  1SKW B;  1VF2 A;  2X8C A;  3TKS C;  2WJU A;  2LTK A;  2R37 A;  4ZIL A;  4TRX A;  3LG6 A;  2JSZ A;  3VPQ A;  3TJG A;  3KGK A;  4J56 E;  1WRY A;  3TKS A;  1AAZ A;  1OVN A;  1R4W A;  1DE1 A;  1B4P A;  1XCC A;  3ZL5 A;  3HZ4 A;  3PIN A;  4AJ6 A;  3QAW A;  4NAX A;  1USB A;  3LQ7 A;  5EY6 A;  3KD0 A;  3WT1 A;  2X49 A;  2C0F A;  5BMU A;  4N11 A;  1XWC A;  2A4V A;  1GUK A;  2A4H A;  4K0G A;  4Q5F A;  4TKY A;  5CRW A;  3LYP A;  4A5P A;  4GCI A;  3C7M A;  4IBP A;  1V40 A;  4TOP A;  3C1S A;  4H86 A;  2KLX A;  2FWE A;  5KN0 A;  3AY8 A;  1AQX A;  3M9K A;  4LMV A;  5JWQ B;  4XCS A;  4GWR A;  1Z5Y E;  2ES7 A;  3MIX A;  4D73 B;  5GAP D;  2JZT A;  1B4Q A;  1FAA A;  4IS0 A;  1TK5 B;  11GS A;  1EGO A;  3ZML A;  5G1L A;  17GS A;  4K0N A;  5GST A;  3CYN A;  1PQN A;  2YZH A;  1JLV A;  1SJ6 A;  4O7H A;  1TJD A;  1TDI A;  1EEJ A;  3WYW A;  2A2P A;  5IOX A;  4HJ2 A;  1A8Y A;  1PKZ A;  5IQY A;  3QD9 A;  5JWR B;  1ILO A;  2B6M A;  5DAK A;  4NHW A;  1GTB A;  3HJM A;  2OBI A;  3P2A A;  1BJX A;  1FOV A;  2V6K A;  3F4R A;  1GSU A;  3IA1 A;  5GSS A;  5F07 A;  1W89 A;  2L6C A;  2H73 A;  2P31 A;  4X0X A;  3RHC A;  3ZFL A;  3LXT A;  3GUR A;  3HVX A;  1ZOF A;  4G0I A;  2KP1 A;  5HR1 A;  5ELG A;  2GZY A;  5A4W A;  1FVK A;  3LFL A;  5KOX A;  2QA2 A;  1MEK A;  2V32 A;  4K5S A;  4F2I A;  1ZZY A;  4E8E A;  1GRX A;  3APS A;  2PWJ A;  3TKS E;  3E9J B;  2OA7 A;  4HU7 A;  4O5Q A;  1KEB A;  2FWF A;  2E2G A;  3FR9 A;  1Y6E A;  3HY2 A;  1XW6 A;  1B9X C;  1MTC A;  1F2E A;  4ZIJ A;  3WGD A;  3ZLP A;  3P8W A;  3QCP A;  2O85 A;  4POK A;  4TVE A;  3QAG A;  4K2X A;  2R2J A;  2OE1 A;  5E59 A;  1QQ2 A;  5FHI A;  4G0K A;  4BPY A;  2B5E A;  2B3S A;  5DJL A;  3F4S A;  4EE0 A;  1XOB A;  1OC8 A;  1YEP A;  1K0M A;  1TRW A;  2P5Q A;  1VRS D;  2H66 A;  3HVS A;  4MF7 A;  1V58 A;  2VL2 A;  1K0N A;  2LS5 A;  3GFK A;  2C0G A;  2YP6 A;  1PMT A;  2M80 A;  1UVZ A;  4D73 A;  3VWX A;  4IN0 A;  2OJL A;  1M2B A;  2ZUP A;  2DJ1 A;  2H0H A;  3H93 A;  3TCO A;  1TRS A;  2CQ9 A;  4ICY A;  1UA5 A;  3DRN A;  1EP8 A;  1G0T A;  3GV1 A;  4IEL A;  18GS A;  1X5C A;  3D4M A;  2O87 A;  4BA7 A;  4LLR A;  3IAS 2;  5HQP A;  3WGE A;  1XWA A;  1GWC A;  2CVK A;  3R2Q A;  4QL7 A;  3FR6 A;  1O6J A;  4BVY B;  1URM A;  3S9F A;  1CQH A;  1HNC A;  4ZBD A;  14GS A;  3KP9 A;  2C3T A;  3A3T A;  3MSZ A;  2VM2 A;  3BBY A;  1Z3E A;  3VLN A;  3IC4 A;  3ZFB A;  2BTO T;  12GS A;  3HJP A;  3U5R E;  3LEF A;  3Q6O A;  1YKC A;  3TB2 A;  2C80 A;  5J5N A;  3KEB A;  2OKA A;  4JU5 A;  3SBC A;  5DCH A;  3VI7 A;  3F63 A;  3F3R A;  3GTU B;  5KEJ A;  1BX9 A;  4PX1 A;  4PNF A;  4Q5R A;  3TOU A;  4L8E A;  5EPF A;  3UOM A;  2I1U A;  5ECO B;  1JZO A;  1QXH A;  4KA0 A;  4ILF A;  1GSY A;  3BJ5 A;  2LKU A;  3F3Q A;  2H30 A;  3ZIJ A;  4EVM A;  2NPB A;  2H6Z A;  2OAD A;  2LRT A;  4ID0 A;  3A5I A;  3CXG A;  4YQM A;  3IK9 A;  2DC5 A;  3TKP A;  1G6Y A;  4X1U A;  1OYJ A;  1Z6N A;  2CV4 A;  3G7I A;  1A24 A;  4G0L A;  4G19 A;  4L0W A;  3HDC A;  3LSZ A;  4TN8 A;  5CRG A;  4ZL7 A;  2RUE A;  2P0G A;  1Z7P A;  4LMW A;  2GSQ A;  1ST9 A;  2GSS A;  4GRF A;  4KGI A;  1FO5 A;  5D9V A;  1OC9 B;  3GUS A;  2LEG A;  1A0F A;  1H4O A;  3GKK A;  1O81 A;  2YZU A;  3KH7 A;  5EVO A;  5LD0 A;  4KH7 A;  4MNN A;  1SKR B;  4Q5N A;  4YQV A;  1VGL A;  4OFN A;  5C04 A;  4IP1 A;  4BL7 B;  4FO5 A;  1K0A A;  2GT6 A;  3VPT A;  5IM9 A;  1PX7 A;  4OMV A;  2JAC A;  4FYB A;  4HZ2 A;  2NTO A;  4POM A;  4ECB A;  4JRR A;  2WRT A;  3W8S A;  1B48 A;  2NVL A;  3HA9 A;  5COH A;  3FEU A;  2O89 A;  5J9B A;  2ON5 A;  2DKI A;  3KCM A;  1WPI A;  1IYI A;  2MMA A;  4FYC A;  4DSS B;  5IMZ A;  1VF4 A;  5AN1 A;  2H6Y A;  3KJY A;  4PNG A;  1GSQ A;  1TOF A;  3FW2 A;  1Z9H A;  3K8N A;  4DSR A;  1XW5 A;  4HS1 A;  4RQR A;  3H1N A;  1TI1 A;  4TXO B;  1V9W A;  3HYP A;  1QMV A;  1LU4 A;  3GTU A;  5G1K A;  2PVO C;  4K5R A;  4WEY A;  4X43 A;  1XWB A;  1XWK A;  3MAK A;  2HRN A;  2IJY A;  3DYR A;  3HCZ A;  1GUH A;  4NV2 A;  1PD2 1;  4MJE A;  3GIX A;  4MPF A;  1FB6 A;  2GZZ A;  3UEM A;  5ECH B;  1TU7 A;  1GNE A;  2CA8 A;  1KNG A;  2XHF A;  5ABR A;  3LGC A;  3DML A;  2DKH A;  4IHU A;  5IMD A;  3MYD A;  1Y25 A;  4KW6 A;  2JU5 A;  1GH2 A;  5HR0 A;  4HOJ A;  2CAI A;  1ML6 A;  1TU8 A;  3IPZ A;  4I6X A;  3LXZ A;  4KDX A;  5INY A;  2LJK A;  1OC9 A;  2VM1 A;  3D6I A;  4AJ7 A;  3HJO A;  4BWQ A;  2YN1 A;  5ID2 B;  2OE0 A;  1J08 A;  3UIW A;  4XTS A;  2GQM A;  3QOU A;  4GQC A;  4J2F A;  5AGY A;  3APO A;  4V2L A;  3IK7 A;  2C1Y A;  2K6V A;  4EUY A;  2V41 A;  2HRK A;  3C71 A;  2HXK A;  2VIM A;  2RM6 A;  2VOC A;  4POL A;  1JLW A;  3US3 A;  2HE3 A;  1M0U A;  4BL7 A;  2JL4 A;  5IPG A;  5FT3 A;  2XC2 A;  3N9J A;  2HNL A;  2R4V A;  4FQU A;  3TKR A;  16GS A;  3FZ5 A;  3UVT A;  4KCA A;  2I9H A;  3H79 A;  4MF6 A;  4DSS A;  2CX3 A;  1K0O A;  3N5O A;  4GQF A;  2P5R A;  3PH9 A;  2AUV A;  3DVW A;  4O5R A;  5B6N A;  3FZ9 A;  3GA4 A;  1HNA A;  2WCI A;  3CSJ A;  4EF0 A;  3VWV A;  1YKA A;  1K3Y A;  2RUF A;  2VCQ A;  4ZB9 A;  4L5O A;  1QGV A;  2D2Z A;  2CAQ A;  1SK1 A;  4TXO A;  2B1K A;  2H1B A;  2IFQ B;  3JCM L;  4IP6 A;  4GF0 A;  2HZE B;  4EIP A;  2PU9 C;  5D93 A;  2RLI A;  1T1V A;  4LL1 B;  4PGT A;  3H8Q A;  7GSS A;  1NW2 A;  2R0C A;  3PGT A;  1MDJ A;  1JZR A;  1GTA A;  1Q4J A;  2QA1 A;  3ZTL A;  4QL9 A;  1R5A A;  2FA4 A;  4WF5 A;  4K6X A;  3DGQ A;  2BMX A;  1F3B A;  3UBK A;  5F8B A;  3DXB A;  5DVB A;  1M2D A;  4GTU A;  2FWH A;  4HDE A;  2CVB A;  3CRT A;  2B5Y A;  4MP4 A;  2R3X A;  4KDY A;  5HFI A;  3LYK A;  1K0B A;  1S3D A;  3CSI A;  3G7J A;  2DJ3 A;  4YH2 A;  2GGT A;  1U88 A;  2H75 A;  3IDV A;  2YPM A;  1FHE A;  2EIR A;  4K2D A;  5J9C A;  2E7P A;  2MBT A;  5J3R A;  3LOR A;  3G9B A;  2YOI A;  3ZZX A;  3L78 A;  3UMA A;  5ID2 A;  2QGV A;  3IV4 A;  1AQV A;  3F0I A;  4NWY A;  1WWJ A;  4Q5Q A;  1X5D A;  2R6K A;  1ZCP A;  3D21 A;  1WP0 A;  4KDU A;  4HEA 2;  4EL1 A;  4NHZ A;  1HNB A;  4ML1 A;  4XS6 A;  3WD6 A;  1SD8 A;  4JR6 A;  4LL4 B;  1QUW A;  4MZW A;  5AIX A;  5CYY A;  4ZBB A;  1J9B A;  2LRC A;  2VCX A;  4L0U A;  1R5P A;  1TTZ A;  3QAV A;  5B6M A;  5G5E A;  4EKZ A;  4V1A p;  3ZRD A;  2H72 A;  4EC0 A;  2OE3 A;  4YKF A;  2IMI A;  3VI5 A;  2N5A A;  1C72 A;  3EYT A;  2H01 A;  1X9M B;  4MAB A;  5H5R A;  2L5O A;  4I5Q A;  3HZ8 A;  5KN1 A;  3I9V 2;  2IMF A;  1ACV A;  4F0B A;  2HSY A;  1F3A A;  1S3C A;  3E3E A;  2FY6 A;  4TW5 A;  3CSH A;  4BVX B;  3Q18 A;  5CNW A;  3TRQ A;  4MJA A;  2HZE A;  3M1G A;  2GST A;  4DEJ A;  5DBQ A;  1YY7 A;  3GKM A;  4PQ1 A;  3UVH A;  3I6A A;  4Z2T A;  1T4Y A;  3TOT A;  1SK0 A;  2KUC A;  2DML A;  1DSB A;  1GSF A;  2MYG A;  2FLS A;  2KHP A;  2R5G A;  4KF9 A;  4NV5 A;  2VL2 C;  4ECC A;  1EGR A;  3LWA A;  1IYH A;  4WBR D;  3FKF A;  1AW9 A;  2F8F A;  5HFG A;  1X5E A;  3WT2 A;  2H74 A;  2IIY A;  4RUV A;  2XBQ A;  2IME A;  3BCI A;  2YWO A;  2H0G A;  1O85 A;  1QFN A;  1SL1 B;  1EV4 A;  2YWN A;  3W8J A;  1O8X A;  3A2V A;  3IR4 A;  1T4Z A;  2PN8 A;  5JCU A;  5JWO B;  4TR0 A;  2CVD A;  3IRA A;  5IMC A;  3FYG A;  1ERU A;  1XOA A;  1J0F A;  2LV3 A;  1SEN A;  2WUL A;  2ZNM A;  3P7X A;  4OCF A;  3F8U A;  1TRV A;  3HD5 A;  4ZL9 A;  1PKW A;  2X64 A;  3KP8 A;  1ZMA A;  4K7N A;  3E0U A;  6GSW A;  1F37 A;  3HVV A;  1CQG A;  1A23 A;  4G9H A;  2YWM A;  2YJH A;  9GSS A;  4XS4 B;  4WET A;  1LJR A;  1WIK A;  4P3Y B;  3C8E A;  1SKS B;  1OKD A;  4MMM A;  3EU4 A;  4CY8 A;  4JE1 A;  4YQU A;  2K8S A;  4O32 A;  1X9S B;  20GS A;  1OAZ A;  1YZX A;  2YJ7 A;  3IOS A;  1V2A A;  1GSE A;  2H1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...