3LA0A

Crystal structure of uree from helicobacter pylori (metal of unknown identity bound)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
148
structure length
148
Chain Sequence
b'MIIERLVGNLRDLNPLDFSVDHVDLEWFETRKKIARFKTRQGKDIAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRHAALYYGESQFEFKTPFEKPTLALLEKLGVQNRVLSSKLDSKERLTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urease accessory protein ureE
publication title Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal binding protein
total genus 38
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02814 UreE_N UreE urease accessory protein, N-terminal domain
A PF05194 UreE_C UreE urease accessory protein, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.260.20 Mainly Beta Sandwich HSP40/DNAj peptide-binding domain Urease metallochaperone UreE, N-terminal domain 3la0A01
3.30.70.790 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits UreE, C-terminal domain 3la0A02
3NXZA 4J80A 1GMWA 3LA0A 3TJ8A 3NY0A 3I38A 3TJAA 3TJ9A 1GMWD 3LZ8A 1XAOA 1GMVA 1GMUA 2QLDA 1EB0A 1EARA 3L9ZA 2B26A 1NLTA 2HFVA 3AGXA 3AGZA 3AGYA 4L3KA 2Q2GA 1C3GA
chains in the Genus database with same CATH superfamily
1WACA 4GVLA 5T41A 4J9OA 4OL8A 3EYZA 3TUZC 3CULA 2VODA 4M63A 2QMUB 5FIIA 1IBMF 2B5JB 4DQIA 5AJ3F 3QJPA 2BJ8A 3NCRA 4I6AA 1JIHA 3DLEA 1FX4A 4WIIA 1QAJA 1ZPWX 1NJWA 1RLDA 2ZFHA 4NLQA 2DJWA 2MKYA 3NS5A 3TAPA 1SCJB 4OYWA 4R8UB 3CCWA 2B6AA 4FYYB 3HZEA 3MWBA 5HLFB 3PEHA 1WJ9A 1T9YA 5A8WB 4O3RA 4WFYA 3TI0A 3D3BJ 5KFNA 5KG2A 2GJFA 4GVBB 4P2SA 2VU5A 1HW9A 3HO1A 1DURA 1PJ7A 1HHTP 2FZKB 4C6AA 3D1HA 3AJ2A 4B3MJ 2BXJA 2ZH1A 3S6EA 3W63A 2YNIB 1S12A 4MK7A 3T1HJ 2V4JB 5C42A 1FRHA 5HJYA 3P49B 1JLCA 3NOGA 5HBMB 5KFUA 1TL1A 3BN7A 3EMTA 2VV5A 1EKSA 2QN6B 3VGUA 3Q8YA 4OLPA 2CJXB 4KO0A 2PA8D 3QAUA 2KZZA 2BKPA 3CD7A 4O4GB 3GZ7A 4NLUA 3M6VA 2MZRA 1KP6A 2YKQA 1GXLA 4B02A 2C2NA 3I87A 4KTQA 4EUVA 4XIUA 3D1QA 1RT6B 4NRTA 4LF9J 4FPIA 5FD1A 1SL2A 2IIHA 2GA7A 1QVGR 2H5JB 3QO9A 3F44A 1PO6A 2NPFA 3NMAA 1SH2A 4DSKA 2CJBA 2VA3A 4CO5A 1J5EF 4MKYA 3RZAA 2KVIA 3FCHA 4I69A 2JSXA 4JB8B 2K7JA 2HZCA 2N7YA 1GFWB 3PW7A 4WZQA 3UCGA 3MR6A 1VC6A 4X4UA 1LW0A 3VALA 2UUWA 3N6NA 2Z4PA 4NZ6A 2KHCA 3TJAA 4DV6F 5HQLA 4EI2A 2WAQD 2ERRA 4ZVRB 2GQCA 1NDPA 3R5GA 4UOHA 3L7PA 4DL7A 1S9EA 2O66A 2J9CA 3JSRA 3G9CA 1VQ5S 3BKUA 3DYAA 3V81B 3W62A 4YR3A 1HFEL 3RAMA 4NCBA 2E5JA 1CC7A 3GIKA 2MZ1A 2LKZA 2KT3A 1F60B 2O01C 4P71A 4I6WA 3EJMA 3IWXA 1RADB 2DHHA 2H9ZA 1PAEX 2XNQA 3BGLA 1M5VC 4DV3J 3EGWB 4UOGA 4CH0S 4RW4B 4N5SA 1UVJA 5F8GA 1N52B 2IRXA 1FXRA 3MFIA 1UKUA 1S79A 4DXLA 1E6VA 1CS4B 3OT9A 4CP5A 2JDJA 1S1TA 1NU4A 1FK9A 1N33J 3AOAA 2M8HA 2MZTA 3NBPB 3CCLS 1MU2A 4K0KF 3C6TA 4U67Q 1VISA 3V5RA 2VBWA 1YJ7A 2GS8A 3JS9A 3OSPA 4UOFA 5K14B 2IRYA 2HRTA 2W8LA 1R6YA 4GMKA 4AXIA 2MY8A 1U6FA 2ALYB 2GIFA 3J7Z5 1RTJB 1NHUA 3HHDA 4UZCA 1N5VA 4K5RA 4CLZA 4ED6A 3VTIA 2KH9A 2DNGA 4LSNB 2QA2A 4B3SJ 4ED2A 3ITHA 1Q53A 2ODXA 2DXDA 1F1BB 3CEDA 5BR8F 4YY3F 2X51A 4DG1A 1IKXB 4DV1F 2HHQA 5DZ6A 4EK2A 1IKWB 4J9LA 3TANA 4NPOA 4J9RA 2ZJRQ 3PVXA 1M5PC 2DGUA 4ERDA 4OHVA 4EBDA 4PPDA 5D4OA 3QNWB 1V3SA 1N56A 3MEGA 2A2DA 2AYEA 4DV2F 3R2CJ 1H3DA 1B0PA 2GIQA 2HBQB 2DRAA 5B0FA 3CD6S 1WF0A 4IOCQ 3PW2A 3MAHA 1IKVA 4O4RA 4RO0A 1S0VA 4NASA 4UUWA 1VK3A 4LR9A 4PAAA 1DQ8A 2HGLA 2YNFB 1JB0C 3WX4A 2DD8S 2HFVA 2PE8A 1PYOB 5CH7B 1BQNA 1V9OA 4DFPA 3WC2A 1VBXA 3OR2A 3JSYA 2C2OB 3JAMY 3AXKA 2ALZA 3WDOA 5JVHQ 5LMUF 3DGPA 1RAHB 2W4CA 1KLNA 2X1FA 1HBNB 2NYIA 4RW9B 2DGQA 2DNNA 3PO5A 1J27A 4GKKJ 1KVIA 1H2TZ 1WG5A 1RAJA 5KT2A 3SEOA 3MUVP 1DQ9A 1WHWA 3M8PA 1IM4A 4LFBJ 3CSKA 1U2RA 5B0BA 4FBTA 2FGOA 8AT1B 1Y9OA 3A3PB 2W9CB 2KJWA 3FSXA 4NEYA 2J76E 1QSYA 5KG0A 2RT3A 3IA0A 4LT6A 3DFEA 1SQGA 3QFHA 2OSQA 1APSA 2CJQA 2ZE2B 2CQ4A 1XMBA 3ZZPA 3KUHA 4EU0A 4RUAA 4RW6B 4ED1A 4OZ5A 2EC2A 2JC0A 4ENOA 2R4FA 2OPRB 4K50A 2ZOMA 4WE1A 5IOLA 3VAFA 2FVQA 2AV5A 3TWZA 3SSQA 4IR1A 3M32A 4NLOA 2Z0GA 1BHNA 2J7KA 1FO1A 2Z58B 2R7RA 3RBZA 2OMOA 4WZMA 1YG0A 2YBVA 4USIA 2WB4A 3VGVA 3ZTRA 4JI5J 3QGIA 3GFYA 1OO0B 1M5KC 3H98A 4LF6J 2QG9B 5LXYA 4USHA 1FVSA 4CM0A 3LGNA 2IAJB 2ZJQQ 4DR5F 1YJ9S 1JLAA 2J9DE 3OTDA 4ZCLA 1UJ4A 1GNKA 1YBTA 2ZH9A 3QBCA 1I94F 2BA9A 3OW2R 2UXBF 4DBQA 3JYTB 3D0HE 3ULHA 3V6DA 2ZVSA 4RW7B 1X60A 3BKTA 2QFIA 3H2UB 4ZP8A 1RTIA 2GVDA 1PJ6A 1QUPA 2BJ1A 3EICA 3CCMS 1NEEA 2RILA 4U9RA 3GR1A 4OI3A 5IQ6A 2RRBA 2XYPB 2V8PA 5CYJA 1TP7A 2XWXA 5KOXA 2DGOA 3S7RA 1X4DA 1YBUA 2F5GA 2GGPA 1X5PA 3ZO7A 2LEPA 1IQTA 2N7CA 3VZHA 1WG1A 5I3UA 3M9OB 2HQCA 4V19J 1C0UA 3CCRS 5D4LA 1HARA 1HHSA 3OTCA 1U45A 4UY8T 2DK2A 1DTTA 2GQ2A 4A8WA 1JLBA 4XO0A 2GO9A 5D6GA 1XR6A 4X4TA 1X4AA 3AODA 2YNHB 3LWMA 2YKOA 2VA2A 2G13A 3MI7X 4WCEQ 1HD0A 4DX5A 1U25A 3BDEA 1TKZA 3KG1A 3NS6A 2HQ3A 2J5AA 2C3MA 5CZVA 2CVEA 2H54B 1KC8T 3CXCR 1UWBB 3H25A 1EIYB 5CYMA 3EVOA 5EDWA 4LJMA 5ETPA 2NZ4A 2CJKA 2QYGA 4NCAA 1TKXB 3EXYA 1HPZB 3BEGB 5HANA 2P6SA 1S1VB 2FJAB 5HN0A 2HHVA 1OQ6A 1D1UA 2Y0SD 3T6JA 4JYAJ 3Q2SC 1KN6A 1REVB 3OHBA 1A9NB 4B9MA 3LALA 4A4JA 3DLKA 4UF4A 1EP4A 4FYWB 3C2PA 2UVRA 3VR1A 1HBUB 4KSEB 1ZA2B 1JKHA 2PMWA 1FJEB 2CG4A 4DV7F 1ZOTA 3C6EC 2APOA 1UWAA 3ET6B 2AHOB 1Y10A 3M2UB 3SCJE 3AY0A 3RRKA 5D3GB 4KH0B 3MOZA 4EO6A 1NHVA 3BO3A 1RTHB 3PW5A 4TLRA 3UN3A 4ZLNA 4ETZA 4LRBA 2HRUA 1HR0F 3TAMB 2UUAJ 2U1AA 2NXCA 4DSJA 2IY5B 4ED5A 1P8GA 2HWIA 3LUYA 3HVTA 4KHMA 3BQ0A 5IFMA 2EPIA 3I0RA 4X64F 3AJDA 4Y2CA 3U1LA 1RT5B 3C8YA 3SQGA 1N36J 4X4OA 2B4OA 1C2PA 1VQPS 5C25A 4HKQA 3PYGA 2YH0A 4OYXA 1IBLJ 4OJGA 3MR5A 2LA6A 4KBIA 2HNDA 3OL7A 2DISA 3QRRA 5GMDA 1X0PA 2W2QP 3J80U 1CVJA 4ETXA 2HG4A 3OR1A 2B3TB 4JI0J 1HNWF 1RT3A 1LWFA 4RX6A 2JLGA 3ZZ0A 2RNEA 3T19A 1JJ4A 1IWGA 2JEFA 5KFDA 2BJ7A 2WBMA 2ZH6A 4F2SA 3WX8A 2NLWA 4YB5A 3FCVA 3M2VA 3JAMU 3POTB 2IBKA 4O3SA 3GFHA 2AJQA 2OPPB 3HFKA 4B9SA 2KRBA 3RW7A 4X62F 2MHEA 5HVGA 1ZH5A 1U09A 3MPYA 3D6HB 4LF5F 3JTPA 5L9NA 4UZBA 1M5OC 1S9FA 4WFNQ 1MMDA 1MLAA 2FC9A 3RR7A 3CJKA 1RAFB 2HWTA 3H2LA 4W90B 2HNZA 3EPIA 4YUDA 1JXLA 1JLEB 3AHPA 1VDHA 5B0AA 1N54B 4OZ0A 1D8ZA 3E51A 4OHWA 4NLDA 1HBOA 2CZVC 2MJUA 1KHVA 4WKYA 5LMNF 3BYPA 3W60A 4FNIA 1R8HA 2DR5A 1HQEA 2QYCA 2SXLA 3MMAA 1Q5YA 4I2QB 1KFSA 1OSCA 1F9EB 2VZ9A 5E3AA 4C2MA 3WHIA 3UPFA 5GAHI 4LVNP 1JLQA 4C8MA 5U47A 4F4AA 2KKHA 4X4SA 1CEZA 1AW0A 3KK2B 2HQGA 4IO1A 4IOBA 4XTTA 3OUYB 1C1CB 2DO0A 4PPZA 2VHGA 3KK1A 1IBMJ 5AJ3J 4NZ0A 1QE1B 4ZP6A 4CO3A 4GRSA 3KKFA 2VQEF 1QUVA 2RVJA 2W1BA 4URSA 3H40A 4PCQA 3DMJA 3DLEB 4ZPDA 2E5IA 4CNYA 4HLBA 2NQPA 2GAHC 2XMJA 3QT6A 4YP3A 2ZH8A 2HVEA 1H98A 4I7FA 3THTA 1WHYA 2B6AB 3OTBA 3CJ2A 3H4BA 1L3SA 5CYQA 3DRSA 1IBKF 4NLYA 1MMNA 1YVFA 2Y1JA 2HW3A 4DQQA 4LRAA 2VJUA 2LQ5A 4B3RF 2HIYA 1R43A 3EGZA 2PI5A 1HNVA 4YB7A 2AEJA 2J7WA 2KG0A 3DXBA 2GZOA 3SZ2A 2G1DA 5C2CA 2HQIA 3OJUA 4N8OA 2R2TA 4QYZJ 2MLZA 3QGPA 5C42B 1O5JA 3MPVA 3OL8A 3MTKA 1JLCB 4KGXB 4CLWA 3FEYB 1V3RA 2MPUA 5JMNA 5KFWA 2C2MB 1U48A 2XB2D 2Q2GA 2JVMA 4EFAC 4OZ3A 4KO0B 3MR2A 4LBIA 5HI7A 2CQHA 1GTEA 3ETMA 1KHWA 3UQSA 5L46A 2R7OA 2ATCB 1S7HA 5HMYA 2CAJA 3CCZA 2QT7A 4DN0A 5J1EA 4JV0A 4E2FB 2DPJA 2ZBCA 1GMUA 2B9YA 3L9ZA 3U27A 1X4CA 4B3TF 3TVKA 4N76A 2Z57B 1RQ0A 2B7CB 2CXEA 5AXMA 5BYQA 3OPKA 3QO9B 1CG2A 2GJ2A 2OH2A 1J5EJ 1SC6A 4CH1A 1LV5A 4YHHF 1T9TA 3JQJA 5I3QA 1RU2A 3CW2C 4U7UD 5DM7Q 2X7IA 3HMJG 3F73A 4KV8A 3RG6A 1VC5A 3LOUA 1EHWA 3DU6A 3QQCD 3LP2A 4NI2B 4FDFA 4DV6J 1NDLA 2J0QD 4A8KA 3I5CA 1VQ8S 1VBKA 1OQ3A 2EI5A 3GIRA 3NXZA 1X8DA 3C16A 2P9GA 2F4VF 1W2IA 4DZ6A 2AP6A 1R8BA 1S9EB 2CQ2A 1YTYA 2EG1A 3DYAB 2HHTA 4AL5A 5DQGA 1FCAA 1UVNA 1Q5VA 5E2QA 4Z2XA 2H4WB 1RWWB 5AXLA 1R7IA 2XYGB 4PWDB 4ECXA 5EGYA 2DNOA 4BS2A 4TVAB 2XCPA 5IV3A 1TUGB 4CLTA 4ZPBA 1IUJA 1IQZA 3UD3P 5KT4A 4OJ1A 3NLCA 1Y0HA 4FBUA 2UUCF 4EO8A 2UU9J 4PG4A 2IM2A 4X65F 3TO8A 2MQOA 4X66F 3GB0A 1D3WA 2X3GA 4KH1B 2XMAA 4JI8F 4TXSA 1E6VB 4AQYF 3KLIB 1S1TB 4K0KJ 3ELHA 4IG3B 3I9V9 1ICEB 2ZOGA 1MU2B 1WKKA 4K8RA 1FI4A 3C6TB 3T41A 4DS5A 3KDOA 1SQEA 3B8HA 1S1WA 2DXEA 3M9NB 9ATCB 1HNIB 1VOMA 4IFVA 5J2QA 3G82B 3FSIA 5E7OB 2YY3A 3KDNA 4MFBA 5DM6Q 5KG1A 3DOLB 2ILZA 5KFFA 2HHWA 4CLLA 4PQUB 1ZM4A 1WDDA 4EBCA 3UNYA 4JI1F 3PIPQ 5DETA 5IT4A 3C66A 5BR8J 2E9TA 2JL9A 2BE7D 2MQLA 4L76A 4WTOB 2MYFA 4YY3J 4QYZK 1SKSA 2C2EA 3WBZA 4DV1J 4USWA 2JJ4D 4RL1A 4C8ZA 4O3OA 3NNHA 2BW2A 2AIRB 4DFKA 5B7WA 2B4UA 2Z2ZA 2L48A 3CDEA 4QYRA 2OPSA 1C4AA 2FVPA 3FQKA 1TZ0A 2ROGA 4LRFA 2LA4A 3FUYA 4DV2J 2VPWB 2AD9A 5MLCV 1UW9A 3DLGA 1NCLA 1Q95G 3MEGB 1R0BG 2K3IA 2W4PA 4LSLA 4P2XA 1C1BB 3M2RA 5KFMA 3CJ4A 1RTDA 5KFAA 1M0SA 3AD7C 5KFRA 2FJDB 1KWMA 4FPRA 1PGZA 3OHAA 1ELOA 1RAOA 5B09A 3M8WA 3OTOF 1TQLA 2L08A 1D0EA 1T03B 3UFCX 3MEKA 1RAAB 3L7UA 5AE2A 5M2RA 1WEYA 2GX8A 4OYMA 4ECSA 1OS5A 2VOOA 2XO6A 2YWHA 4WPAA 4RWWA 4XAKA 3PHEA 1SI9A 3FRYA 3P96A 1HL6A 3GV8B 2CQ1A 3PYEA 5J2MB 3PHTA 1HWJA 1FRXA 2R42A 4QIFA 1NO8A 1XWLA 2FLLA 2LFVA 4F4YA 2DRBA 3QAEA 1NJXA 1VQYA 1SJ3P 2MZQA 4CM2A 1RBOB 4DX7A 1S6QA 1VQ9S 2CFXA 3KK3B 4ECUA 4LF8F 1VFJA 5D0EA 1IXKA 3MM9B 2RB7A 3KJFB 2WSCC 5DLGA 1T9VA 2B8PA 1RHJB 2DNLA 1P9QC 4KGKA 2BABA 1NK9A 3SIPB 2DH8A 3KJVA 3I5AA 5LM7E 1S9GB 1QSSA 2ZUGA 2FHJD 5A6WA 3NCQA 1YX2A 3IM9A 2YWKA 3GJQB 3M32B 1U1MA 5L1LA 4EWTA 2JFKA 5SUHA 4F67A 1WTFA 3CCES 1TKTA 3V2UC 1NDCA 2VJVA 3I0SB 3G96A 3G6YA 4P75A 2LXFA 4DUZF 2H5IB 4W92B 3BDPA 3T1AA 1XQIA 3GIJA 4ZHRA 2F7VA 2G0IA 4ID5A 3DDKA 2VUGA 4ZCKA 3HJFA 3ZXWA 4DFJA 1KQSR 4DR6F 4U96A 2V34A 2FLNA 4H4MA 3R2DJ 1KTQA 2KFYA 2UUTA 4TU9A 2YPZA 3M8ZA 3W1YC 1JLAB 1KQGB 3GSIA 2IDEA 2BQRA 1LOUA 4KR0B 1I94J 2XI3A 2PT0A 2HMIB 4ID8A 5L39A 2UXBJ 4DR7F 4TY8A 4G1PA 2XY5A 5F3ZA 1NSKL 3KLHB 4WP8A 4HHUA 2GVDB 5KFBA 5KG6A 4K59A 3N9UC 4L6V3 1B7YB 3KLFA 4ZK7M 4QWAA 2V0NA 1MSWD 3P4UB 1HA1A 2V4RA 2GGPB 3BKFA 3A8IA 3MD3A 2YTCA 3A12A 2CQCA 5F8NA 3D6FB 4P9SA 4ELVA 5BYSA 1EB0A 1QJHA 1Y5IB 3SDEA 5I3UB 3H5XA 2UV8G 1OYEA 2VPXB 3TEHB 1WD6A 4FS1A 2R8IA 3B82A 2AEMA 1JLFA 1JLBB 4DCJB 4TY9A 4RNNA 3ZZZA 1Y5LB 4TNOA 1S6OA 4DSEA 4IFYA 5D4NA 2DHAA 2W2PP 2XS2A 4HVZA 1IJFB 3BREA 4ECZA 3S1TA 1FVQA 2P9CA 3BSOA 1WC3A 3PO4A 2ZH4A 1S0NA 1HIYA 4Q0BB 3SCIE 2HYIB 5JVGQ 4PWUA 3IR6B 1NUEA 2YKAA 3IFEA 4K4TA 5CYMB 2JX2A 4ELTA 3UO0A 1L3UA 2VFUA 4M5DA 1G6BA 1PKUA 2HHXA 1CJVB 1S48A 3TJ8A 5HAOA 1HMVA 2NPIA 4OI0A 5F0UA 3FMWA 2XQCA 1GH8A 4LUBA 2B7BB 1T9XA 4ED3A 2NREA 1SBRA 1R27B 2QLXA 1X4HA 4BBYA 2KT2A 4CO1A 3AD8C 1FEEA 1G7CB 3ZTPA 1C4CA 3DLKB 3PRVA 1EP4B 5KFVA 2XG8A 3WQPA 2YVSA 5FDLA 3C14B 4OI2A 4QBUA 1JKHB 4DV7J 2MMYA 3G4SS 3IS9A 5DS7A 3THVA 1WHVA 2ZHOA 1SC4B 3FZBA 1JNZB 2XHWA 4C0OC 4NXMF 3MF5A 3VAIA 1ZA1B 4ZJQA 3SFUA 1H73A 3GWCA 4DL5A 1HR0J 2HGMA 3J81Y 3R7BB 3HSZA 2EK6A 5EWFA 1JX4A 2C2KB 3VHQA 2BE9B 4YN3B 3S8SA 1P6TA 3T5HA 4FVCA 2XGPA 2G4BA 2MGZA 3IM8A 4X64J 1NSAA 3I0RB 1UA1A 4Q45A 1XMQJ 1O51A 1SJRA 2QLBB 2ZKTA 2R7TA 4LQ3A 1R8PA 2GFFA 2MQMA 3SQGB 3HT0A 4NX9A 4M5LA 2JVRA 5HJXA 2B4PA 1N34F 2AWZA 4G1IA 5DG7A 4ZJLA 3CWJA 3HM9A 4ECQA 2QFJA 2HNDB 1JLGA 4X4RA 4ATNA 4DN9A 5T14A 1H72C 4K4WA 3MPWA 2MKHA 2NYHA 4M5IA 2EFQA 3OR1B 3BV8A 3ZZYA 1HI8A 4F4KA 2HRYA 4DV0F 1HNWJ 3DHWC 4USUA 2VONA 2E7XA 1RT3B 4U95A 1SJQA 2WHOA 1LW2A 1K9MT 3MM7A 1RYRA 4M1KA 1YI2S 2Z8QA 2IFXA 1Q8LA 4ZVPB 3FK4A 4LFAF 1V5IB 3VVUA 4X62J 3NWGA 3HCXA 4LF5J 3PYDA 3WIVA 1N6QB 4DR2J 2F8HA 3V4IA 1TVRA 2OUGA 4J9SA 1F9FA 3JTNA 1WG4A 4IQMA 5FJ4A 3OVSA 4RU2A 2CKWA 2CZ9A 1SH3A 5LMNJ 3CDBA 1U0SA 2W01A 4LVOP 2N4CA 1GAOA 1T3OA 1FRJA 3N79A 3JSMA 2YX1A 3VAMA 2J6UA 4G65A 2MKSA 2E5HA 1PBUA 5B0GA 3MMAB 2XZWA 3D5MA 5DGBA 3W5ZA 3CGIA 2DYAA 4XDCA 1UTAA 3VWSA 1YRXA 3PACA 1U49A 1SKRA 2RDJA 2IDLA 4OYAA 4WFAQ 2AEFA 2CADA 5F0WA 1SC1B 4A46A 2VQEJ 2OTJS 3T9NA 2QLWA 2G2OA 3BO4A 3PY8A 1FDNA 2IA0A 5T7LA 2YKNA 1TFYA 3CCQS 3W3SA 3DHXA 4I7FB 3BJYA 5F8MA 4OZNA 4UQGA 1S1XA 3F41A 1IBKJ 4MJKA 1KNZA 3QRQA 1VRTA 3BGFA 5CYQB 1VHIA 3ILOA 4BCAA 3QFWA 4J9MA 4DV4F 1ZETA 4B3RJ 3RB0A 2JWNA 3AGZA 2VC0A 3UCUP 1FJGF 2AJFE 2ZM6F 1UP1A 1HNVB 2W7AA 2YX7A 2HK2A 3OFFA 4DU7A 3HHNB 2JOQA 4HHJA 2XBPA 3BM7A 2EFOA 4ZVEA 1X5TA 4KGMA 2XEXA 1AA1B 4M5MA 5E5NA 4DLEA 2ZC4A 4F3MA 2KTQA 3C19A 3EWGA 3R6LB 2NZCA 2KHDA 4C0HA 4NYZA 1NZ8A 1MROB 4RBTA 5L9XA 1RHUB 3OVBA 4HTJA 2V2ZA 5J1EB 4NZ7A 1RT7A 2MY7A 2J9EA 3Q22A 3CJ5A 3HZGA 4DV5F 1WWHA 3BPSP 4CTAA 4NA3A 3OSNA 3QJLA 1U0HB 3I32A 4USMA 2Q6BA 4LBPA 1RLCL 4YHHJ 4KC5A 2L41A 3PM9A 4GC7A 2MHNA 4LR8A 3MEDA 3R7NB 2V2KA 1Y00A 4OIXA 5GAGU 4DPUA 3O44A 4U8VA 3PX4A 4KV8B 4PXCA 5CZXA 3KTQA 1RE1B 3LP2B 1EARA 3NGDA 3TQ1A 4WKRA 1UETA 5E33A 4LF4J 4YB1P 1D9FA 3CDWA 5CQGA 1WSVA 4ICLA 4X4PA 1FE4A 2NR0A 4WIQA 2ZVIA 3C16B 2A6MA 3W9HA 1Y4ZB 4YFUA 3BSNA 3ENAA 1FTRA 4O44A 1U1LA 1EETA 1OWXA 3CCTA 1FD8A 1YRUA 2YH1A 1Q7YT 4K4VA 2O67A 3OFGA 3MXHP 5ETTA 2HZVA 3PKYA 2LQBA 1HLWA 4JV2A 1AB8A 5DO2A 3GJTB 2BW7A 2WRMA 1RBAA 3ZTOA 2VQFF 2B9EA 4WFZA 1PIEA 4ILMA 4CIOA 2QMWA 2UUCJ 1K8AT 1S1UA 4OZ2A 4OX7A 1NK4A 3MMBB 1RKJA 2DITA 4X66J 2QE5A 2W7OA 3CTRA 3M7VA 4JI8J 1UCNA 2GHVC 2HFSA 4AQYJ 2B8QA 2DY9A 4JUZA 4C8NA 1WTBA 5CXTA 1RGVA 3IBCB 4O3PA 2A10A 1X7VA 1DLOA 4PWWA 1NK8A 4YR0A 3G71S 3DM2A 2HHPA 1HWIA 5D0GA 1X4FA 3NEKA 4IFVB 2FJWA 3IRXA 3J81U 5J2QB 1Q86T 5KFPA 4K4YA 4H4OA 5DDPC 3AA8A 2ABYA 1VQOS 2BBEA 2BOAA 5KFIA 4HT7A 3VQSA 3LW5C 4EYIB 5ETOA 2YWEA 3NGSA 2PEBA 3GIMA 3D3CJ 3BR9A 1RWPB 2OJ3A 2CJ9A 1VCTA 2VICA 1K44A 5GVQA 3KLGA 3DI6A 1KTVA 3VAHA 1YDLA 1YQHA 3W64A 1F5AA 1X9SA 3FKBA 5L8RC 2A6OA 3KMQA 1Q0NA 5E3PA 2OPSB 4OI6A 4CI0B 1VLOA 3LZ8A 3CCJS 4Q2LA 2BM0A 5IM0A 4ES2A 3H5YA 3EGNA 1Q7LB 1L3TA 4M5JA 2DNQA 3DLGB 3FVYA 4LSLB 3R5CA 1IN0A 4ZVSB 2CPZA 3ENVA 3M2RB 4ZITA 2PC6A 2HHUA 1RTDB 4RR5A 4JI6F 1KOHA 1LWXA 2FVSA 3MUMP 1FEHA 3OTOJ 4C0BA 3ADAC 1JQGA 2QL9B 3FSYA 1FFGB 3GFZA 2M3DA 1U7LA 4QWCA 1JJ2R 2Q79A 1HKAA 4ZPCA 4A8YA 5IT9U 3PYFA 1CULA 4ZPAA 4ZVQB 4DCPB 1KDNA 2BX6A 1VIOA 1NK6A 1XR7A 3UN2A 3LP0A 3MCOA 3P45B 1WC1A 3KFWX 5KFJA 4GKJF 1P1LA 4V19X 2HVZA 3N5FA 3HF5A 1JWWA 3ZC4A 2RS2A 2B51A 2H51B 4IDKB 3DLBA 4Q8FA 4CYUA 3LF0A 1NPRA 4LF8J 2ZZMA 3AT1B 5I3PA 1VQ6S 4ZKAA 1LWCA 3CCUS 3ILIA 1VQ7S 4WXWA 4ZLLA 4G6VB 4HACB 2L9NA 5H1SV 2R8HA 3UCZP 1JXEA 3DKDA 2LYVA 4JI4F 4I4BA 5ETQA 3C5XC 4W4MA 3MTJA 3HLUA 1PBAA 4LF7F 2HFOA 4RNFA 1WDTA 2FHJA 1X0FA 1OPZA 1N5YA 2BZ2A 4ED4A 1TKTB 3DXSX 3NGTA 2J8SA 4FN5A 3UE2A 4MK8A 4ZHRB 1X9MA 4DR6J 1S57A 1TL3A 2Q43A 4MKBA 5KG4A 2JH3A 2J6SA 2I9SA 1IKYA 2KU7A 3FFIA 2RKIA 3DOMA 1GMWD 4K4ZA 4DR7J 2IC3A 3PCOB 4IG0A 4ER8A 4A8OA 3CE8A 4PXDA 1X9WA 2HGNA 1GT8A 1FDDA 2OD4A 3O1LA 4HEA9 2FD2A 2HLUA 1TAQA 2KFNA 1NKEA 5M2UA 4ZCMA 1Z2ZA 2P8IA 2DNMA 3W9IA 4AYBD 5DDRC 3W2VA 3UDCA 1ZTWA 3TW0A 4M8LA 1B7FA 2KRRA 2NUUG 1VR6A 1H2UX 2MLYA 4Z7YA 4KFBA 1HYSA 4KE5A 2OD6A 5C5JA 4KGZB 4YMEA 4DUYF 3GU0A 4R5PA 3KUEA 1F2GA 1BMQB 3SMZA 1NMEB 5JUMA 4DF8A 1JLFB 3EM1A 3EGVA 2BVZA 4CRJA 1UJ6A 3R97A 4QPTA 2IHR1 2BRLA 4IFYB 1AZSA 2V4QA 1S77D 4ED7A 4E98A 4C4WA 1K0TA 4DL2A 1NB2A 2GIRA 1NLTA 1URNA 5KT7A 4BHQA 2QO3A 3NNAA 2AGOA 1S0OA 1VC0A 1TMMA 4AD6A 3VAGA 3QT5A 3K8VA 2BJ9A 2FHMA 3QLHB 2HFNA 3ISND 2E44A 4M5DB 2XNRA 2VC1A 5FLXY 1HNXF 3TA1A 1ZZFA 3FEXB 2BACA 2C3OA 1HMVB 4ZMMA 1RXOB 1TK8A 2OMLA 2HWHA 4J9NA 4C8YA 3RBDA 2N3OA 1TK0A 3HSDA 4I2PA 4R8UA 4CLPA 3BPDA 2VBZA 1PILA 1DTQA 3GQCA 3W5XA 4GVBA 1WOPA 2CPFA 1U1KA 1N4LA 2K2PA 1VJWA 4OYBA 2KYXA 2R7UA 2YQ3A 2DHXA 4RUCA 1RZMA 3G2XA 1KVKA 1M1HA 2YNIA 2WSFC 1VQMS 4LIWA 1R3NA 2QLJB 1GK8A 5HATA 2G1HA 4N8NA 2OFGX 4RW8B 3IR5B 2CUYA 2MGZB 4RU9A 4DX6A 1RJJA 4OX8A 3K8WA 3TZYA 1BE4A 4ES3A 3KYLA 1UVKA 4OZLA 4ZN1A 4OZJA 2EKYA 1MW7A 2BM1A 5H9EJ 1N34J 2B56A 4B9TA 5DQIA 3FMBA 3BGRB 3T9ZA 2VASA 1IWAA 2W24A 2XY7A 5CABA 1TTHB 2NCKL 2V8VA 2V9KA 1YJTA 4R25A 1OJ4A 2WVBA 4R0EA 2XC9A 2HK3A 3OBIA 3QZ8A 4DV0J 4K2XA 2VG5B 2RF2A 2CPHA 2FVCA 4FKXA 2EWHA 3N6MA 1KLMA 4H4KA 1QVFR 2M8DB 5F9NA 5IV4A 1YWXA 1QTNB 3Q86A 1LW2B 3MM7B 4CQ1A 3NG8A 2V68A 2JHEA 3LAKA 2EK1A 4LFAJ 1NKCA 2OAUA 3MM5A 4NLPA 4F02A 2V67A 1FRLA 3M6UA 5LJ5Y 4ES1A 3BSCA 1BGXT 3PFEA 2I5JA 1B3TA 5D4PA 1LK7A 2FC8A 3Q8RB 5HMXA 1F3FA 4HH0A 4DR4J 1U8SA 1CQMA 3V4IB 1E6YB 1WF2A 2AQ4A 3RJMB 1T94A 1TVRB 3DRYA 4ECWA 4IRKA 3OD2A 3MUTP 1T0TV 1JMTA 5EN1A 1R6VA 3Q2TC 4ANEA 2QA4S 2E1PA 4DV3F 3JSMB 2H48B 1GQEA 3N28A 2ACMA 1QTMA 2E5GA 2XZTB 1CS4A 1IBCB 4HI2A 3NBPA 2Z30B 4V1Ak 4LFCF 5HVHA 4TQSA 1GXUA 2P6TA 1RWVB 1DAXA 4J9KA 1VBZA 1RT4A 1RTJA 3OQ2A 2YX4A 3HXMA 3NAIA 3H0PA 4OJHA 4LF1A 1FKOA 2HFZA 1XR5A 2XULA 2GC8A 4ZOSA 2CPDA 3J80Y 5D0RA 2K1RA 4LQ9A 1XNRF 4IH7A 1HQ2A 1M1GA 1C0TA 1SV5A 3NY0A 3VZIA 1S1XB 2HZAA 1IKWA 2VFRA 2IM0A 5MAOA 3IAS9 4DSLA 4DV4J 5HQMA 2YQ1A 2KJVA 4CLFA 4A8SA 2WSEC 2R8KA 2BMBA 1FJGJ 3U1MA 3QIDA 2IMOA 3TQEA 2W8KA 3RB4A 4ANCA 4O0NA 4CT8A 3TZWA 1ZM3A 5D78A 4DR3F 4F3OA 1W26A 2MQ8A 3M30B 1VQNS 2YXLA 2QJ3A 2RJZA 1NJZA 4FP9A 5H9EK 1SJ4P 2D1CA 3MCSA 2PMHA 3FBEA 1KRPA 3H5UA 1ZPVA 2FQQB 5J2NA 3RB6A 4ZN3A 1U1OA 4X84A 5KFHA 1X31C 2CG8A 2ZDOA 2E66A 1EJ7L 4K7QA 2I0XA 2BRKA 3BGOP 1NPKA 3HD1A 1YIJS 1LWEA 4YB6A 4NE9C 2IVFB 3AOBA 2NXNA 2XZDB 1HBNA 4BC7A 3MECB 5HROA 4DV5J 3M9MB 1B4SA 3GG0A 1SL0A 5LSRA 4CTAB 5LSOA 2F40A 1UVLA 4M5GA 5B0CA 2CNOB 4L3KA 4F4ZA 5IXUA 4I0WA 1TR0A 2FTRA 3ZZRA 1HW8A 1UEUA 2E7WA 3VVTA 4KRWA 2K7KA 3AGYA 2V94A 1OY6A 3A8KA 2C1EB 1WC0A 4ICLB 3DNCA 4X4QA 4OX9F 2ZE2A 2PFFB 4N47A 1U47A 2HVHA 4DR1J 4OHXA 4RW6A 1RHMB 4NMXA 1U2CA 3CB4A 1X4GA 2ZWOA 2OPRA 4O44B 5FLXU 4FYDA 1JJHA 1U6BA 1YJRA 4ZVTB 3HD2A 3MM6A 2R9LA 3DLHA 1S0MA 2OPQA 2LCWA 3PJWA 2A1BA 2VQFJ 3NRBA 2CPJA 3DU5A 3B4DA 2YKMA 3T5LA 1H7WA 2UUBF 3R1HA 3ICLA 1S1UB 4JI5F 1V6HA 1FFSB 4PXEA 2C28A 2ASLA 4JI2F 2ROPA 1F5BA 4DU8A 2IAJA 2XS7A 4C11A 3W9JA 2CJAA 1PJ5A 4DPWA 3MMJA 3Q8VA 3W8GA 3CMQA 4DL0C 3H5SA 1TMJA 5HMZA 1DLOB 1EQMA 2DPIA 3DM2B 2KYZA 1BWVA 3K2YA 5F41A 2IPOB 3JYTA 3IRXB 1WNEA 2VL1A 2ZH7A 4OLOA 1SC3B 4H4OB 3RW6A 1QAXA 3RRGA 3LGHA 4G3IA 3T5KA 1F3VA 2VFTA 1P9YA 3OXGA 4UW2A 2DBBA 3R3TA 4EGLA 3A4TA 5C24A 3NP5A 3KLVA 1TL5A 3KLGB 1BUXA 2A3JA 4ZJOA 4QIVA 4EZ6A 3R1LA 3AB4B 3TUIC 1FF2A 1YJUA 3LGMA 4BWMA 2BKNA 1FE0A 3M8SA 3PFOA 2X3DA 4PG5A 5IM0B 1PAUB 2V5HG 6AT1B 1R8CA 3QMQA 5I4MA 2IVMA 1VLYA 3IGNA 5HL7Q 3TUPA 1GX6A 3PDNA 4JI6J 1KD1T 1SIWB 5ETSA 4WWSA 4DI6A 3O5TB 2HS0A 3CJRA 3Q8SB 4NA2A 1VS3A 3WC0A 2A0FB 4C9DA 2H1YA 5BJRA 1W2BR 2PGCA 3PIOQ 1P1TA 3B54A 1RWNB 2M5YA 4YDDB 2D7SA 1VI7A 3MR7A 2WVFA 3H20A 1UWBA 2FJXA 4DSFA 1VQKS 4KQZA 2HPUA 3EZ5A 3HFZB 3N6LA 1KQFB 1D8YA 4CLSA 4KY3A 2GHWA 4Y34A 4GKJJ 4LR7A 1Z4UA 4IR9A 1S1VA 4EYHB 2R7VA 2CQDA 2VFSA 3PZPA 3BH7B 4LRCA 3QT7A 5D77A 1UL3A 2XSFA 3MFHA 5E3CA 4JYAF 4CYUB 2AJ4A 2DVIA 2Y8YA 1B70B 3UD5A 1CJKA 4MIAA 4N41A 1LWCB 3UDVA 1HNZF 3D2WA 2BOPA 2WOMA 4FXVA 3CCSS 1RTHA 1Q8BA 3HHKA 4LF7J 1TL7A 4H4KC 4CH7A 1MNEA 5DG9A 1PYSB 3OXLA 4PG6A 2XO7A 5GMKa 4M5NA 2DNZA 4AUKA 1N5YB 4KPCA 1RA7A 1SH0A 2X1GA 2G2ZA 3JTOA 3J7ZT 4F8RA 4ED0A 4NOHA 4Z37A 4KJIA 4C48A 4QR1A 2VIHA 2G2YA 3TAQA 1N36F 2VB6A 4HL9A 1TL3B 1FWLA 3MM8B 3ISZA 3SV4A 1KSPA 5KFOA 1D9AA 4USVA 1X5SA 2PFDA 2RKIB 3DOMB 3PNIA 2RE1A 1RU1A 3KNGA 2MLXA 2IC3B 2RH3A 4IG0B 4QR0A 2G0JA 1GMWA 5KFCA 2M70A 1S72S 4NLTA 1S76D 2LQ8A 3M1VA 4J9QA 1M90T 2MQQA 2MTLA 1KFDA 3W2VB 5D15A 4HTIA 3ENQA 3B4MA 1UVMA 2OPPA 4CO0A 4NLSA 1WUUA 3E01A 1HYSB 4USJC 2DEIA 1RHQB 4DUYJ 2WVCA 3O6QA 3BQ2A 1TK5A 1RSCA 1DJ0A 3RR8A 3ZZOA 2W9BA 3FZ2A 3CJTA 4DQRA 3VF0B 4Q8EA 3GV7B 3IP0A 1TU0B 2M2BA 2ASDA 4DHVA 1IM6A 4K4SA 1V3ZA 1FNXH 2N82B 1HHQA 2KO1A 3W2WA 4HDGA 2ACYA 2XM3A 1RWXB 2CQGA 2Z2LA 2CPEA 2F9DA 4IRCA 3FGVA 1IJEB 4UT4A 5F9LA 2NSBA 1WKJA 4B9VA 2RHSB 4C3LA 3CPWR 1NRKA 1MWQA 1OPIA 1C1CA 1FKAF 4NLXA 3BZQA 4PG8A 1HNXJ 1UZDA 1NXIA 4NA1A 4DMZA 3G6XA 3NS7B 3D6TB 2RQCA 2LU2A 1QE1A 3UVJA 1RHKB 2CVIA 3I96A 3PXGa 2YWFA 3LP1A 4TKTA 2P2CB 4P10A 2F8MA 5EHHA 3HP6A 1IVZA 1KKHA 5HVFA 4I2PB 2B26A 1TL1B 3UW1A 1DTQB 3MPDA 1NH8A 1DY3A 3GIIA 1DFDA 3QWUA 4USKA 5I42A 3RBXA 4UY85 1CPZA 3FQLA 1FFWB 5F8IA 1U1QA 2ZBQA 2PN6A 7FDRA 3PRDA 4Y2KA 2W2NP 2I1RA 3OFHA 3EUNA 2NXUA 4CWBA 2HQDA 3D68A 3K5PA 3CMAS 2C2RA 3LQVA 4M5KA 1NK0A 3ZTQA 5KTQA 4DZDA 3IMQJ 1QLNA 3UDLA 1I5OB 2QLFB 1RP5A 2MKJA 1FXLA 5LSLA 4Q43A 2J9DA 2DIVA 1WKLA 2YWGA 1EAYC 3C15A 2QC3A 1VYAA 2HQFA 2EG2A 2GMJA 3QPIA 3EPGA 3GMGA 5HK4A 1RWOB 2ZITA 5KFZA 2DTJA 3SFGA 3FBFA 1R0CB 1UW4A 2MKCA 1LW0B 4PRFA 3MPUB 1CJUA 2UVUA 2RU9A 4WK3A 3HULA 2XTJP 3KWMA 1N88A 2YQ0A 2ZEJA 5JXSA 2OP5A 3DRRA 2IYIA 4LRDA 2EEYA 5BYRA 1REGX 1HBMA 2HNYA 5IS2A 3O2IA 1PCAA 4KHPF 1Q78A 4NRUA 2UV8A 2CZ4A 3BB5A 4QWEA 3MEEA 5KOWA 2RF2B 5B0DA 5A2QY 4F0HA 2D41A 3M05A 4NI2A 4I67A 3D7SB 1YKWA 2KG1A 3UR3C 4BC9A 1KLMB 5DLFA 1X5OA 3KG0A 3X1LB 2O3DA 4O3NA 4ZVUB 1OMSA 1AUSL 3KOAA 4OX6A 4F0KA 3MM5B 3R8YA 2Y1LB 3W8PA 2HFUA 1KEKA 2CQ0A 1N5QA 2I5JB 2KL8A 3MMCA 1FK9B 1RYSA 4PWDA 3TYTA 2DY1A 1HWLA 4P72A 2V6AA 3D9BA 2D9OA 2J8AA 2RMLA 2UVWA 4RUHA 1N48A 3PX6A 5H9FJ 1SJFA 1I1GA 3MAAA 3DLLQ 3ILJA 3AFGA 3CJ8A 2UU9F 2J0WA 2U2FA 3HHLD 3EVMA 2M0GB 3KLIA 4LFCJ 3DN9A 2Q6CA 4IG3A 5J1NA 3G6VA 2GAGC 3ITHB 3SSSA 2IJNA 4ZPVR 4PZVA 1R31A 2Y3YA 4DG1B 1FX2A 2OFHX 2AX0A 1RT4B 1HNIA 1RAGB 3G82A 3KHGA 1LXJA 1FKPA 2CNNB 3I56S 2VBYA 1FKOB 2B4VA 3DOLA 1NH7A 4PQUA 5E3QA 1MWYA 1XN9A 2CRLA 4F7VA 4OHYA 2KZMA 2D69A 3H4DA 5EWEA 4J9UE 2R8JA 1XNRJ 3UN5A 5CAAA 2K1RB 1R89A 4S0MA 1C0TB 4E0DA 1YK9A 1SV5B 1IKVB 1P27B 2C42A 3DCAA 3NL0A 2N3LA 4QOTA 3HVWA 4QIEA 4MYTA 3TP2A 1UFLA 4TU7A 1BQNB 2M52A 1UEVA 1Q8KA 2LXUA 4GO7X 1FESA 3ENWA 3OR2B 1C1BA 4DR3J 2JLFA 1VRUA 4PYDA 5LMUJ 3L95X 4OV6A 4MMOA 5GAEI 2FGCA 3DGPB 3M4XA 2J7UA 4A8QA 2Z2MA 3CJ3A 3IG1A 4WK1A 4GO5X 4Y3CA 4NLGA 2W9AA 1T03A 2ZZNA 2ZD1A 5IC4B 5J2NB 2XGQA 2R8GA 3SSRA 3M8PB 1RISA 1VK8A 3M8QA 1H6KX 5KFKA 4FF1A 1LWEB 1R8AA 5E3RA 4OQJA 3HVRA 1RACB 2KXNB 1UA0A 5J2MA 3K58A 5HROB 4Y2IA 1J5OA 2HHHF 2HEKA 3H59A 4I56A 2ASYA 2I2YA 4E8UA 5ETMA 4CT9A 1JJCB 2HSEB 4QIWD 2FHKA 3P3DA 1NK5A 1LKZA 2EW9A 5EX3A 4WE1B 1KS2A 3KK3A 2W4DA 2RAQA 2OHDA 2PEHA 1JNRB 3I55S 4A8FA 1H74A 4QZVB 1RI7A 4B9LA 2EFNA 2QX0A 3MM9A 3CUNA 4EMDA 2LDYA 1MN7A 4RLEA 4OX9J 1YGYA 1MG7A 1FDAA 3F0NA 3RB3A 3K59A 2O1PA 4MTPA 1BXNA 2GVZA 5DGAA 2IMWP 1YHQS 5H9FK 1S9GA 2X1BA 4DR5J 2XYHB 1FHTA 5ADZA 3EZUA 3NCPA 4O23A 2N4DA 3AH6A 2JZ8A 3QGGA 2BR0A 2MZSA 3MM6B 3OV7A 5A8RA 1RDRA 5CD4A 1DARA 2MJNA 2RQKA 3OL6A 2OPQB 1LK5A 2H5EA 2UXCF 3WZ0A 3GFXA 7FD1A 3I0SA 4AFFA 4WFXA 5DQHA 2UUBJ 4X4NA 1ZM9A 2VFVA 2YKMB 3GYXB 2DGTA 2WVDA 3SCKE 3PKMA 4JI2J 3V6DB 2QTWA 4DQSA 2UXDF 1S7IA 2E7VA 1SKWA 1RTIB 4DL4A 3K5LA 3OLBA 4C11B 4IKAA 1S6PA 2QLDA 1IR1A 1ZAVA 4ZP9A 4G1QA 4TYAA 5LT5A 3GLJA 1AUDA 3HVAA 2HMIA 1YITS 3HKWA 1FRKA 4CLUA 2BQUA 1ACMB 3A8EA 2ZNZA 4C3MA 4C8KA 1C0UB 2QA1A 2ZH3A 4P7VA 1V5VA 4QW9A 3UR0A 2DB1A 3KLHA 2ZBRA 3RGIA 3RAQA 3UD4P 3PV8A 4ELUA 2ZNYA 1DTTB 3NAHA 1WI6A 4H54A 2XCAA 2R3VA 4WTYA 2KM8C 3R5BA 2OI2A 3SYZA 5C24B 3Q0AA 3VGSA 4ZLJA 4OI1A 3QIPA 3ISNC 4HR2A 4N7TA 2DCLA 3NKYA 2WVEA 4YQWA 4URQU 2MDAA 1K0VA 4RWXA 1FJ7A 2R7XA 1TKZB 5KFTA 4HT5A 1FERA 1JXVA 4CLKA 1XMOF 3C3LA 2FYXA 2ILYA 2EXUA 2K06A 3ZNJ1 5K8OA 4Z7CA 2F1FA 1G4CA 2EFGA 5A2QU 1BC6A 2DR8A 4B9NA 1T95A 3KHRA 3RYLA 2JEGA 2W2OP 4Q0BA 1VRQC 1AYEA 2GV1A 5GADI 5KT3A 5J2PA 5AE1A 4QW8A 3IWNC 1U4BA 3TX8A 3SV3A 1WI8A 1B0TA 1T7PA 4C7QA 3IWLA 4F0MA 2AYGA 3K5NA 4DFMA 2DCUB 3EDRB 1CJVA 4QU6A 1KOOA 3AXMA 4WF9Q 1LFWA 2M9KA 1WOOA 5LJ3Y 1CLFA 1WC5A 4KT0C 2ZJPQ 2XMMA 1U24A 2F4FA 2PA3A 4DCOB 3GV5B 3RUBL 2LECA 3ILLA 5K5MA 2AT1B 2XLKA 1CJKB 1KVJA 2CDRB 3C14A 4KKOA 3QGHA 3HVTB 3CVKA 2IJRA 2W25A 2D3ZA 3GYNA 2QIFA 1HNZJ 4OHZA 1B64A 2XY6A 2V2QA 1N32F 3LAMA 1RUSA 4FYXB 2I6WA 5IT0A 2WOMB 3HHEA 2B0GA 1TELA 4O0IA 3HKZD 2DRDA 2IYGA 1UAWA 2VG6A 1TL7B 1A7GE 3KNAA 5C25B 3G8SA 1DQAA 1S6UA 3BO2A 4NYPA 1F6TA 2E5LF 2CPIA 2DNYA 4IH6A 1MN9A 2Q1LA 4B9UA 3CCVS 2A18A 2CWKA 3GYGA 2YWWA 3GONA 4JI7F 3GJRB 3N5BA 2AX1A 3IXQA 3QRPA 2DH7A 4ZCIA 3GR0A 4NEZA 4JI3F 3KMSA 1G1XA 1XMQF 3MD1A 2RUSA 3IBWA 2WONA 2RQ4A 1LWFB 1NDKA 5IZHA 1C3GA 3JB9k 1OIAA 2FLPA 4OYPA 1NBEB 5IT9Y 3S01A 3M2VB 3R5AA 1S99A 3K7RA 3EZOA 1D09B 1HI0P 3TVYA 2QA4G 1T05A 2JZ5A 3VAKA 4ALZA 2FZCB 8ATCB 1U1PA 3QATA 4EZ9A 2V8HA 4RPFA 4OMFG 1TV6A 2LQJA 1BWEA 5GAHU 3M1VB 3CJKB 2HNZB 3OFEA 2MSSA 3CO9A 1GTHA 3LPYA 2LMIA 4CZCA 2XI2A 4QWDA 4NYOA 5KFSA 1HBOB 1RAEB 5KAKA 1NB7A 2POKA 2D9PA 1T9WA 3E01B 3AD9C 2DKOB 3GTYX 1N6QA 2BANA 1HQEB 3K57A 4B3OA 5B0EA 4DR2F 2W9BB 3KHLA 3N4WA 3PR5B 2QRRA 1JLQB 2W2MP 1VMBA 2AJ2A 2B43A 4C8LA 2EVZA 3D67A 1GXTA 2KT5A 4IH5A 3TX0A 2FY8A 4AT1B 3LTOA 4UUXA 2HBZB 4Y28C 4J90A 3SI8A 3KK1B 4NCGA 2P9EA 3W2WB 4CO4A 5THWA 4IOAQ 2OEJA 3D28A 2WW4A 2XMTA 5CHCB 3PR4A 1SL1A 4ZLPA 3M6XA 3DMJB 4I6YA 3TEGA 2XHCA 4ECYA 4JP8A 4NXNF 1NJYA 4MYUA 3JXOA 3HK2A 2ZKUA 4OZ1A 5AXKA 1WHXA 1NAQA 4WYLA 4FF4A 1YJWS 1CQNA 3ZZUA 3SQOP 3D0IE 4WU2A 1Q82T 2KM8B 2BDPA 5DDQC 1VIXA 3DRSB 4WU3A 3A8JA 3Q23A 3TRGA 5A6PA 4ZS6A 3I9ZA 3HPOA 1FWKA 1TFWA 3UVJB 2A2CA 2HLTA 3OLAA 3T5JA 1Q81T 3G8TA 2MKIA 3FNNA 3NWRA 3GPAA 2ZWPA 3IN5A 3MZIA 1WEXA 1XTZA 3LP1B 4ZVHA 3D4JA 4NLWA 1RCXB 1CJTA 4YOEA 1HQUA 5K8PA 5GMEA 4ZVFA 2E9RX 1ZBTA 1BY9A 2G0CA 2OGUA 2VPYB 2IM1A 3NGRA 1DZ5A 1NNDA 3IBFB 3CT9A 5I42B 3DC2A 3QSYB 3Q24A 4K2JA 5LL6d 4OYOA 2ATLA 1SQFA 4OV1A 4IRDA 5G0RA 2GNKA 4DPTA 4B3TJ 2F3JA 2CA9A 5EX0A 3TUJC 3TA0A 1FWPA 5A0YA 2HBYB 1M1KT 2VBXA 1T02A 2M7SA 3C15B 4MIWA 2HS3A 2BJ3A 3FDSA 2XMWA 2C22A 1NK7A 4AXJA 3K5OA 4QR2A 3TARA 1RT2A 3EX7B 1FTCA 4NWBA 2R7WA 1VGYA 1UZHA 3W66A 4FF2A 3LA0A 1MROA 3D1OA 1PC5A 1VQSA 5ETKA 2F63A 1RHRB 2ZZTA 4JV1A 2FB0A 4JBCA 1ITPA 1CJUB 2CQIA 3US5A 3BBFA 4MKAA 2RQMA 5BXIA 4R0JA 2PDAA 4HH1A 2LXIA 3QZ7A 2ZUAA 1R0AA 2OSRA 3QT8A 1U0HA 4C8OA 3DRRB 2F4VJ 4KHPJ 3SBMA 1HBMB 2HNYB 1TUWA 2K8GA 5AXNA 4PR6A 3CIMA 1S5ZA 1SXLA 3TZZA 2KXHA 3K89A 3MEEB 4QCLA 4NMLA 4L75A 1N8RT 2PO4A 4ILLA 2DNPA 2H65B 5KG3A 3U7JA 2I38A 3R7SB 4IQXA 5CCMA 4LF4F 4DQPA 3TA2A 2C3YA 3N0VA 4DDFA 3HJVA 4F2RA 3BN4A 5HQ8A 2ADBA 2ZC3A 1F9HA 4X65J 1XC9A 4KGVB 5GAGI 4ZIVA 4DL3A 3NOCA 1YRTA 3MMCB 3MURP 4I1TA 1VQ4S 3OJSA 4Q44A 2E9ZA 2R7QA 3W61A 3BR8A 4P74A 1PC4A 1N5TA 1S1WB 2OO4A 2OELA 3MMBA 4MAKA 5G4DA 4XPEA 4MFBB 2AGPA 1GMVA 3MAAB 3SXLA 2E1AA 5SZTA 3TR5A 2COLA 1UPPA 4JI1J 2RRNA 5ETNA 1Y11A 5ETLA 3A1YG 3I4HX 5KFGA 4JV5F 3HHLA 3Q83A 1LQ9A 2Y0BB 1ZM2A 3BQ1A 3DOKA 1L5UA 2HVDA 4QJVA 1LEOA 3J7AN 4J37A 2KI2A 2RUGA 3P8BB 4PYAA 2UP1A 1FKPB 1RKIA 3N01A 4ZP7A 4IO9Q 3GCXP 1YJNS 2FJEB 2L9WA 2DIUA 2BE2A 2AF6A 4L3NA 3BBCA 1RK8A 4PQAA 3U02A 4CO2A 1T11A 1WORA 3G86A 3CJ0A 1F2HA 8RUCA 2ZH5A 5GAEU 3D54A 1RABB 3GSDA 1AFJA 1OY9A 2HKEA 4ZDNA 3CC2S 2B9XA 2QSWA 4Q7AA 1A6LA 3H8YA 1NZAA 3D66A 2PMZD 2CNLB 4FYVB 1S4FA 1DHMA 3T1YF 3QJJA 1VQLS 2JRRA 4P2MA 1VRUB 4ZIWA 1I3OB 1Q4RA 3A3OB 3AQPA 4RNOA 2J0SD 3I38A 4B17A 5KT6A 3RU0A 2CQBA 4DPXA 5DRKA 4Y00A 3G6ES 3IG1B 3H7HB 4FXDA 1XNQF 2XWYA 3BBBA 2ZD1B 2ZDPA 4U7CA 4DWIA 1AROP 1S6QB 5M2PA 2VG7A 3M8QB 2F65A 3GP9A 1JK9B 3H2VE 3DRPA 2YPYA 2HVIA 1AFIA 3KG4A 1BQMA 1SIZA 1NHKL 3CDUA 5HP1A 5AE3A 3PJ9A 3CD0A 5D8HB 3MOJB 2HHHJ 1UFKA 1J5OB 2C2ZB 2R2UA 2DGXA 4NLVA 1FRMA 2ROEA 6FD1A 1WEZA 2JEJA 2ZBPA 2EFPA 4UTGA 2AJ1A 4ZVOB 4RKUC 4UQTA 4IDKA 2V9WA 3KJVB 3IO1A 3HDSA 2NUHA 2OEMA 4FNHA 3LH2S 2M88A 2V69A 4M5HA 2AZ1A 2FDNA 3IGVA 1ZZNA 1BQXA 3E3XA 4FXWA 1Q8IA 1F0XA 3KXDA 3PG9A 4M94A 3J7YI 2BJDA 3C46A 4K4XA 1S4EA 2P5VA 4DUZJ 4HACA 1XK8A 2NXEA 4PUOA 2UZAA 2QEXS 2L9DA 5HSPA 2GVZB 4ID5B 3QYYA 2HIQA 2BEFA 2J6TA 3EE3A 4F04B 3AJ1A 4D3HA 4WXOA 5A76A 1H7XA 4F25A 4H4MB 1D9DA 1EZZB 2BKOA 2FLOA 3D0GE 2Y9HA 3T6BA 5KFQA 3C6UA 2E29A 5A8RB 2GMHA 2GJIA 2UXCJ 3KLEA 2DO4A 2FZGB 1QAYA 5F8HA 3Q8PB 4J91A 1H38A 1W7WA 2YNGA 4TY8B 2RRAA 4X4VA 2FIUA 4PXBA 1NJIT 2VKRA 2UXDJ 1RA6A 2VOPA 1U6ZA 3VV2B 2DR9A 1UVIA 1RT1A 4J5OA 3GILA 1S6PB 1O0PA 1FNOA 1L3KA 4RNHA 1B0VA 3KLFB 4G1QB 4QWBA 1FXDA 3JQMA 4CDIA 3GJSB 5IWAF 1XEZA 2BJEA 4P52A 4PABA 1N0VC 1QDUB 4F36A 4OI4A 1SUQA 1WC6A 2Y1IA 3PTWA 2XSJA 1T3NA 1UMJA 3SDEB 4TLQA 5L38A 3DGVA 4Q2MA 3L4BC 3OL9A 4LREA 3HX9A 4LF2A 5B08A 4A8MP 3L09A 1U2FA 1TKDA 1T8EA 4MH8A 3V6KA 3TZXA 4USTA 4KIAA 1SB6A 1TAUA 1CC8A 7AT1B 3QIPB 1SKUB 2RDIA 1AXQA 2V2VA 2AYBA 3MGJA 2LEAA 1UJ5A 1Y7PA 2B9WA 2HHSA 1GX5A 1Z1ZA 1U02A 1XMOJ 1H0HB 5GADU 4XK8C 2C2DA 2LDIA 4YDXA 1H2VZ 3TOQA 2QV6A 5A8KA 4QPXA 1XBWA 1SPBP 3AOCA 2E1CA 4IUFA 3IRWP 4Q5VA 4L74A 3CNQP 1MWZA 2B5JA 3GE9A 1KONA 4WP3A 2MEWA 1Q79A 3LO3A 4M95A 3ZTSA 4ZPWR 2JEIA 2J0XA 3KHHA 2WK4A 3FC9A 5J2PB 1U8WA 4I68A 5HLFA 4KAIA 4ECVA 5A8WA 4KYZA 3QLHA 4ED8A 3UDEA 5CD4H 1UPMB 3BF4A 5FDLB 3IS9B 2FPHX 2XLJA 3V6HA 2CYYA 2WB1D 3IC1A 3RRHA 2Q66A 3OVAA 1MMLA 1NM2A 4NXMJ 3GG1A 3I82A 1LFPA 3I5BA 4OYZA 4B3MF 3ZNUA 2V4JA 3T3FA 1GEHA 4LMZA 2PD1A 1VJQA 2GO8A 3T1HF 4XDDA 5HBMA 1HWKA 2IVYA 4TYBA 1N5SA 2E1RA 4KKOB 1TUVA 2JLEA 4PG7A 1Y3JA 4FF3A 2W7PA 3K17A 3EXCX 2DR6A 1QAIA 4O4GA 1WF1A 2JC1A 3NGKA 1N32J 4DLGA 3PJXA 3F56A 3MDFA 3PEJA 2ZBIA 3HT3A 2LEBA 2D3O1 1ULRA 3KJNB 5DJBA 1OY8A 4DOZA 2VG6B 1IR0A 5IC6B 1RT6A 2E5LJ 3RTVA 4WBFA 2ASJA 3P5BP 3KUGA 1A0OB 4FS2A 4LF9F 2VDIA 4RW8A 4JI7J 1HI1A 3MR3A 4RBUA 2KFZA 1JLGB 2DNHA 2KVQE 2XMUA 4JI3J 5E41A 2GHPA 2AU0A 1ZYQA 2PIIA 2LQ9A 1U26A 2WONB 1XERA 2KXFA 3ONQA 2O5DA 4RNMA 2CIMA 2VF3A 1QSLA 2FVRA 3BGRA 3W5YA 1NLKL 1K1QA 1CBKA 1EKRA 4YR2A 4CNZA 3DDNA 2VD3A 2DNKA 5K9FA 1S49A 3V81A 4ILRA 3I6PA 4C3KA 3O8WA 2VG5A 1T05B 4JOUA 3TVZA 2V63A 1ZTTA 3FBCA 3BYRA 3HHLC 4P6QA 5L1JA 1TV6B 3W65A 5F3TA 2KB2A 3UWTA 2DHSA 4MT1A 2PSZA 2RIJA 3MHYA 4Y65A 4HDHA 1OYDA 2OTLS 3NGUA 2OLWA 1G2EA 2GW8A 2EKNA 4RW4A 3HI9A 2V8GA 1NSPA 1L3VA 1ZAWA 2NSCA 1O6XA 1XAOA 2AMCB 2BANB 4B3OB 3AB2B 1E6YA 1N33F 1WSRA 4F50A 4DR4F 5K14A 4J80A 2IJFA 3BGUA 3SCLE 4FZVA 2IA6A 1QM9A 2MQNA 2AGQA 2AYMA 4J9VA 4LSNA 5IQQA 4NCGB 4Y6IA 2CQ3A 1EQ0A 2OKQA 1RBLA 3PX0A 2HBRB 3CO0P 4K4UA 1YLXA 4NXNJ 4B3SF 4U6PA 1ZAXA 1SJ1A 5T7LB 2DEJA 2YKNB 5CCLA 1RTZA 2YKPA 1CSJA 1BLUA 3VCDA 1IKXA 4P7TA 4LBHA 4QIGA 5AT1B 3E8OA 3QWPA 4TU8A 2OEKA 5CA5A 1B99A 2JNJA 2EC0A 3KJQB 2QZ8A 1VRTB 2NS1B 2D3OR 1VHFA 2DHGA 3A3NB 3K0JA 4Y2AA 3HSJA 2ZM6J 3CDAA 1X4BA 5L1IA 2E1MC 2Q3PA 2VPZB 2XLIA 5LXRA 3U1NA 1CJTB 3PRBA 1HQUB 2R2RA 5KG5A 1WOSA 3G87A 2GQQA 2YNFA 1ROFA 2VH7A 4HHHA 3I31A 5KG7A 2WW8A 2IRUA 5KFYA 4F26A 1UEKA 2BV3A 2DGSA 4DEZA 1K73T 1Q1KA 1RAIB 3CC7S 2KN4A 5C7PA 4EBEA 4I64A 5DZ7A 5G0RB 2FUG9 2AJ0A 4MIBA 3RAXA 4J9PA 5EWGA 3M30A 4QU7A 3PW0A 3AGXA 1KR4A 1RT7B 4TQRA 2ADCA 4RW9A 3IR7B 3QSIA 9RUBA 5A0YB 2M4MA 4TN2A 5L1KA 4GKKF 1FDBA 2X1AA 4HYKA 1YZ6A 1M5HA 4DS4A 5HO4A 4OFZA 2WBRA 1KQKA 4OJ3A 3MEDB 3L7OA 4LFBF 1RT2B 3Q8UA 1PYTA 2W9CA 4LSZB 2C3UA 3TNVA 1FT8A 4F4WA 5ETVA 1KBRA 1S10A 4CCHA 4C97A 4L72B 3MECA 4BWJA 4WFBQ 5KFLA 4N56A 3B78A 4ECTA 2RDDA 4PEOA 5KT5A 4ANDA 4MKVA 3E2EA 1R0AB 5C2GA 2C3PA 3J81j 1SVDA 4NLRA 5K8MA 4RZRA 3MAQA 2AZ3A 2GMLA 2WTFA 3CJQA 2QL7B 1EETB 3ZFVA 1TL4A 1FA0A 4DL6A 3J7A1 2EFVA 1FJCA 1M5SA 3HFVA 2JVOA 1S97A 3A13A 4EEYA 2F9JA 1Z2LA 4ZPTR 3DLJA 2L3MA 5KFEA 2LVWA 3UNGC 4DR1F 3FRZA 3VAJA 4LF6F 3AA9A 1WC4A 2HS4A 2ZOFA 1ZS6A 2Y1RI 4X2BA 1YBAA 2FHOB 2Z56B 4K5SA 3H90A 3K5MA 3WIUA 3W7BA 4ZA1A 2PI4A 4RBVA 2BUNA 2F8EX 3EDQB 2DNRA 3AQOA 5ETRA 1OSDA 1IR2A 2V8DA 3R5JB 3I4PA 4W98A 4RW7A 3EVWA 5EUHA 4URGA 1PG5B 1N0UA 1W25A 3FCWA 4BDPA 4C98A 1U1NA 4DUTA 5K20B 4JV5J 3CC4S 2IBOA 3HHLB 2RD5C 2H4YB 1YSJA 4KPYA 3RBEA 3DI6B 3DOKB 2WZ1A 4KB7A 5K8NA 1LNQA 5F8LA 2DT9A 1YZ7A 1AT1B 3LWLA 2MB0B 2VKZG 2R7SA 1WELA 3BH6B 4XPCA 5JJBA 2CQPA 1F5CA 3CJSA 4RUBA 2BE2B 2NXJA 3VQTA 4WYWA 5RUBA 3MCNA 4ITSA 2YNHA 4ECRA 1I51B 2BYCA 2DGWA 3LANA 2G9OA 4DF4A 4AL6A 2RS8A 3V4MA 1QY7A 3BS9A 3T1YJ 1RCOB 4BLGA 1CULB 4PKDB 3B6BA 1PSDA 2CJYB 2KDOA 2RSQA 4F4XA 3JQKA 3R27A 5LOQA 4KHRA 1Q16B 2HURA 2XMVA 3L3CA 1TKXA 4LIRA 3LP0B 1YJVA 1HPZA 3M8YA 3R9LA 2CWXA 2I8EA 1RWUA 2FJVA 4NL5A 1XNQJ 2R2SA 2DH9A 2ZHAA 4DJBA 2RU3A 1REVA 3AKOB 2QL5B 3OTEA 2LU1A 4UOCA 2VG7B 4HI1A 1RWKB 3VGTA 2GCFA 1HBUA 3DRPB 4A48A 1BQMB 5HMWA 3IAM9 5HP1B 4Y2MA 2WCXA 2QGFB 3G8QA 4YS2A 3FJ2A 5DG8A 3J7YU 1HWUA 4A47A 4B08A 3ET6A 1RWMB 2OIHA 4L73A 1NKBA 4OYIA 4F3QA 3M2UA 2CPXA 3D6MB 3M6WA 4FKYA 2H3EB 2IM3A 5D3GA 4JI4J 3Q8QB 1U1RA 2QSFA 1X4EA 4J7CA 5DDOC 2EBEA 1G3OA 2VDHA 3TAMA 2AKWB 2HAIA 2MQPA 4N77A 2UUAF 2MZJA 1QD1A 2QMXA 3TJ9A 5E0OA 2CNKB 1S59A 3PW4A 2HAFA 2D3UA 3V6JA 1BD6A 3R6GB 4RJVA 1RT5A 2V50A 4FVMA 4PUOB 3FEZA 4O3QA 3THPA 4IYQA 1RB0A 2MKKA 5ITHA 3GCWP 1XIQA 3CF5Q 2FY1A 1Y5NB 5J1PA 1IKYB 1I6JA 1FNMA 3ETOA 1IBLF 4DX8H 1T9UA 3LPEA 3FFIB 3C6UB 1O8BA 2RHQB 3KLEB 1URRA 3DDIA 1DBDA 4P73A 4QQBA 5F8JA 6FDRA 4ZVGA 4P2FA 4A8XA 3HSGA 2DXFA 2YNGB 1Y3KA 1K1SA 3M8RA 2CDQA 2EBGA 4DPOA 4WP9A 2FJBB 3P6YC 3R5DA 4JI0F 3DRXA 1NPPA 1RT1B 3MM8A 4Y0FA 1FRIA 1HD1A 3ZZTA 2LP4A 3POTA 3JSBA 3H42A 3OXFA 4AL7A 1K47A 2XS5A 1XJWB 3CMES 4GC6A 2AW0A 1J2VA 5IWAJ 2ZH2A 2MSTA 4MK9A 4KFBB 3AAWB 2LLZA 4U8YA 1SUQB 2XSJB 4U7UK 2Z2YB 4R5PB 3CD5A 3FBBA 3O3LA 3UI3A 2DGVA 4WJBA 2D74B 3Q89A 5KFXA 3P5TL 1JLEA 1VBYA 2K3KA 2Y8WA 5D0HA 4DPYA 3X3UA 2MXYA 4DSIA 1UFWA 1DRZA 1AZSB 4CLYA 1EX8A 1FD2A 1LXNA 4I2QA 1NSQA 4D3GA 3MCMA 2CPYA 3BSAA 3NMRA 2UVVA 4YEAA 4AE5A 2JRSA 2XMKA 2ZHBA 3KK2A 2DR7A 2BQ3A 2JFDA 3NNCA 3CIZA 5A8KB 3OUYA
chains in the Genus database with same CATH topology
3NXZA 4J80A 1GMWA 3LA0A 3TJ8A 3NY0A 3I38A 3TJAA 3TJ9A 1GMWD 3LZ8A 1XAOA 1GMVA 1GMUA 2QLDA 1EB0A 1EARA 3L9ZA 2B26A 1NLTA 2HFVA 3AGXA 3AGZA 3AGYA 4L3KA 2Q2GA 1C3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXZ A;  4J80 A;  1GMW A;  3LA0 A;  3TJ8 A;  3NY0 A;  3I38 A;  3TJA A;  3TJ9 A;  1GMW D;  3LZ8 A;  1XAO A;  1GMV A;  1GMU A;  2QLD A;  1EB0 A;  1EAR A;  3L9Z A;  2B26 A;  1NLT A;  2HFV A;  3AGX A;  3AGZ A;  3AGY A;  4L3K A;  2Q2G A;  1C3G A; 
#chains in the Genus database with same CATH topology
 1WAC A;  4GVL A;  5T41 A;  4J9O A;  4OL8 A;  3EYZ A;  3TUZ C;  3CUL A;  2VOD A;  4M63 A;  2QMU B;  5FII A;  1IBM F;  2B5J B;  4DQI A;  5AJ3 F;  3QJP A;  2BJ8 A;  3NCR A;  4I6A A;  1JIH A;  3DLE A;  1FX4 A;  4WII A;  1QAJ A;  1ZPW X;  1NJW A;  1RLD A;  2ZFH A;  4NLQ A;  2DJW A;  2MKY A;  3NS5 A;  3TAP A;  1SCJ B;  4OYW A;  4R8U B;  3CCW A;  2B6A A;  4FYY B;  3HZE A;  3MWB A;  5HLF B;  3PEH A;  1WJ9 A;  1T9Y A;  5A8W B;  4O3R A;  4WFY A;  3TI0 A;  3D3B J;  5KFN A;  5KG2 A;  2GJF A;  4GVB B;  4P2S A;  2VU5 A;  1HW9 A;  3HO1 A;  1DUR A;  1PJ7 A;  1HHT P;  2FZK B;  4C6A A;  3D1H A;  3AJ2 A;  4B3M J;  2BXJ A;  2ZH1 A;  3S6E A;  3W63 A;  2YNI B;  1S12 A;  4MK7 A;  3T1H J;  2V4J B;  5C42 A;  1FRH A;  5HJY A;  3P49 B;  1JLC A;  3NOG A;  5HBM B;  5KFU A;  1TL1 A;  3BN7 A;  3EMT A;  2VV5 A;  1EKS A;  2QN6 B;  3VGU A;  3Q8Y A;  4OLP A;  2CJX B;  4KO0 A;  2PA8 D;  3QAU A;  2KZZ A;  2BKP A;  3CD7 A;  4O4G B;  3GZ7 A;  4NLU A;  3M6V A;  2MZR A;  1KP6 A;  2YKQ A;  1GXL A;  4B02 A;  2C2N A;  3I87 A;  4KTQ A;  4EUV A;  4XIU A;  3D1Q A;  1RT6 B;  4NRT A;  4LF9 J;  4FPI A;  5FD1 A;  1SL2 A;  2IIH A;  2GA7 A;  1QVG R;  2H5J B;  3QO9 A;  3F44 A;  1PO6 A;  2NPF A;  3NMA A;  1SH2 A;  4DSK A;  2CJB A;  2VA3 A;  4CO5 A;  1J5E F;  4MKY A;  3RZA A;  2KVI A;  3FCH A;  4I69 A;  2JSX A;  4JB8 B;  2K7J A;  2HZC A;  2N7Y A;  1GFW B;  3PW7 A;  4WZQ A;  3UCG A;  3MR6 A;  1VC6 A;  4X4U A;  1LW0 A;  3VAL A;  2UUW A;  3N6N A;  2Z4P A;  4NZ6 A;  2KHC A;  3TJA A;  4DV6 F;  5HQL A;  4EI2 A;  2WAQ D;  2ERR A;  4ZVR B;  2GQC A;  1NDP A;  3R5G A;  4UOH A;  3L7P A;  4DL7 A;  1S9E A;  2O66 A;  2J9C A;  3JSR A;  3G9C A;  1VQ5 S;  3BKU A;  3DYA A;  3V81 B;  3W62 A;  4YR3 A;  1HFE L;  3RAM A;  4NCB A;  2E5J A;  1CC7 A;  3GIK A;  2MZ1 A;  2LKZ A;  2KT3 A;  1F60 B;  2O01 C;  4P71 A;  4I6W A;  3EJM A;  3IWX A;  1RAD B;  2DHH A;  2H9Z A;  1PAE X;  2XNQ A;  3BGL A;  1M5V C;  4DV3 J;  3EGW B;  4UOG A;  4CH0 S;  4RW4 B;  4N5S A;  1UVJ A;  5F8G A;  1N52 B;  2IRX A;  1FXR A;  3MFI A;  1UKU A;  1S79 A;  4DXL A;  1E6V A;  1CS4 B;  3OT9 A;  4CP5 A;  2JDJ A;  1S1T A;  1NU4 A;  1FK9 A;  1N33 J;  3AOA A;  2M8H A;  2MZT A;  3NBP B;  3CCL S;  1MU2 A;  4K0K F;  3C6T A;  4U67 Q;  1VIS A;  3V5R A;  2VBW A;  1YJ7 A;  2GS8 A;  3JS9 A;  3OSP A;  4UOF A;  5K14 B;  2IRY A;  2HRT A;  2W8L A;  1R6Y A;  4GMK A;  4AXI A;  2MY8 A;  1U6F A;  2ALY B;  2GIF A;  3J7Z 5;  1RTJ B;  1NHU A;  3HHD A;  4UZC A;  1N5V A;  4K5R A;  4CLZ A;  4ED6 A;  3VTI A;  2KH9 A;  2DNG A;  4LSN B;  2QA2 A;  4B3S J;  4ED2 A;  3ITH A;  1Q53 A;  2ODX A;  2DXD A;  1F1B B;  3CED A;  5BR8 F;  4YY3 F;  2X51 A;  4DG1 A;  1IKX B;  4DV1 F;  2HHQ A;  5DZ6 A;  4EK2 A;  1IKW B;  4J9L A;  3TAN A;  4NPO A;  4J9R A;  2ZJR Q;  3PVX A;  1M5P C;  2DGU A;  4ERD A;  4OHV A;  4EBD A;  4PPD A;  5D4O A;  3QNW B;  1V3S A;  1N56 A;  3MEG A;  2A2D A;  2AYE A;  4DV2 F;  3R2C J;  1H3D A;  1B0P A;  2GIQ A;  2HBQ B;  2DRA A;  5B0F A;  3CD6 S;  1WF0 A;  4IOC Q;  3PW2 A;  3MAH A;  1IKV A;  4O4R A;  4RO0 A;  1S0V A;  4NAS A;  4UUW A;  1VK3 A;  4LR9 A;  4PAA A;  1DQ8 A;  2HGL A;  2YNF B;  1JB0 C;  3WX4 A;  2DD8 S;  2HFV A;  2PE8 A;  1PYO B;  5CH7 B;  1BQN A;  1V9O A;  4DFP A;  3WC2 A;  1VBX A;  3OR2 A;  3JSY A;  2C2O B;  3JAM Y;  3AXK A;  2ALZ A;  3WDO A;  5JVH Q;  5LMU F;  3DGP A;  1RAH B;  2W4C A;  1KLN A;  2X1F A;  1HBN B;  2NYI A;  4RW9 B;  2DGQ A;  2DNN A;  3PO5 A;  1J27 A;  4GKK J;  1KVI A;  1H2T Z;  1WG5 A;  1RAJ A;  5KT2 A;  3SEO A;  3MUV P;  1DQ9 A;  1WHW A;  3M8P A;  1IM4 A;  4LFB J;  3CSK A;  1U2R A;  5B0B A;  4FBT A;  2FGO A;  8AT1 B;  1Y9O A;  3A3P B;  2W9C B;  2KJW A;  3FSX A;  4NEY A;  2J76 E;  1QSY A;  5KG0 A;  2RT3 A;  3IA0 A;  4LT6 A;  3DFE A;  1SQG A;  3QFH A;  2OSQ A;  1APS A;  2CJQ A;  2ZE2 B;  2CQ4 A;  1XMB A;  3ZZP A;  3KUH A;  4EU0 A;  4RUA A;  4RW6 B;  4ED1 A;  4OZ5 A;  2EC2 A;  2JC0 A;  4ENO A;  2R4F A;  2OPR B;  4K50 A;  2ZOM A;  4WE1 A;  5IOL A;  3VAF A;  2FVQ A;  2AV5 A;  3TWZ A;  3SSQ A;  4IR1 A;  3M32 A;  4NLO A;  2Z0G A;  1BHN A;  2J7K A;  1FO1 A;  2Z58 B;  2R7R A;  3RBZ A;  2OMO A;  4WZM A;  1YG0 A;  2YBV A;  4USI A;  2WB4 A;  3VGV A;  3ZTR A;  4JI5 J;  3QGI A;  3GFY A;  1OO0 B;  1M5K C;  3H98 A;  4LF6 J;  2QG9 B;  5LXY A;  4USH A;  1FVS A;  4CM0 A;  3LGN A;  2IAJ B;  2ZJQ Q;  4DR5 F;  1YJ9 S;  1JLA A;  2J9D E;  3OTD A;  4ZCL A;  1UJ4 A;  1GNK A;  1YBT A;  2ZH9 A;  3QBC A;  1I94 F;  2BA9 A;  3OW2 R;  2UXB F;  4DBQ A;  3JYT B;  3D0H E;  3ULH A;  3V6D A;  2ZVS A;  4RW7 B;  1X60 A;  3BKT A;  2QFI A;  3H2U B;  4ZP8 A;  1RTI A;  2GVD A;  1PJ6 A;  1QUP A;  2BJ1 A;  3EIC A;  3CCM S;  1NEE A;  2RIL A;  4U9R A;  3GR1 A;  4OI3 A;  5IQ6 A;  2RRB A;  2XYP B;  2V8P A;  5CYJ A;  1TP7 A;  2XWX A;  5KOX A;  2DGO A;  3S7R A;  1X4D A;  1YBU A;  2F5G A;  2GGP A;  1X5P A;  3ZO7 A;  2LEP A;  1IQT A;  2N7C A;  3VZH A;  1WG1 A;  5I3U A;  3M9O B;  2HQC A;  4V19 J;  1C0U A;  3CCR S;  5D4L A;  1HAR A;  1HHS A;  3OTC A;  1U45 A;  4UY8 T;  2DK2 A;  1DTT A;  2GQ2 A;  4A8W A;  1JLB A;  4XO0 A;  2GO9 A;  5D6G A;  1XR6 A;  4X4T A;  1X4A A;  3AOD A;  2YNH B;  3LWM A;  2YKO A;  2VA2 A;  2G13 A;  3MI7 X;  4WCE Q;  1HD0 A;  4DX5 A;  1U25 A;  3BDE A;  1TKZ A;  3KG1 A;  3NS6 A;  2HQ3 A;  2J5A A;  2C3M A;  5CZV A;  2CVE A;  2H54 B;  1KC8 T;  3CXC R;  1UWB B;  3H25 A;  1EIY B;  5CYM A;  3EVO A;  5EDW A;  4LJM A;  5ETP A;  2NZ4 A;  2CJK A;  2QYG A;  4NCA A;  1TKX B;  3EXY A;  1HPZ B;  3BEG B;  5HAN A;  2P6S A;  1S1V B;  2FJA B;  5HN0 A;  2HHV A;  1OQ6 A;  1D1U A;  2Y0S D;  3T6J A;  4JYA J;  3Q2S C;  1KN6 A;  1REV B;  3OHB A;  1A9N B;  4B9M A;  3LAL A;  4A4J A;  3DLK A;  4UF4 A;  1EP4 A;  4FYW B;  3C2P A;  2UVR A;  3VR1 A;  1HBU B;  4KSE B;  1ZA2 B;  1JKH A;  2PMW A;  1FJE B;  2CG4 A;  4DV7 F;  1ZOT A;  3C6E C;  2APO A;  1UWA A;  3ET6 B;  2AHO B;  1Y10 A;  3M2U B;  3SCJ E;  3AY0 A;  3RRK A;  5D3G B;  4KH0 B;  3MOZ A;  4EO6 A;  1NHV A;  3BO3 A;  1RTH B;  3PW5 A;  4TLR A;  3UN3 A;  4ZLN A;  4ETZ A;  4LRB A;  2HRU A;  1HR0 F;  3TAM B;  2UUA J;  2U1A A;  2NXC A;  4DSJ A;  2IY5 B;  4ED5 A;  1P8G A;  2HWI A;  3LUY A;  3HVT A;  4KHM A;  3BQ0 A;  5IFM A;  2EPI A;  3I0R A;  4X64 F;  3AJD A;  4Y2C A;  3U1L A;  1RT5 B;  3C8Y A;  3SQG A;  1N36 J;  4X4O A;  2B4O A;  1C2P A;  1VQP S;  5C25 A;  4HKQ A;  3PYG A;  2YH0 A;  4OYX A;  1IBL J;  4OJG A;  3MR5 A;  2LA6 A;  4KBI A;  2HND A;  3OL7 A;  2DIS A;  3QRR A;  5GMD A;  1X0P A;  2W2Q P;  3J80 U;  1CVJ A;  4ETX A;  2HG4 A;  3OR1 A;  2B3T B;  4JI0 J;  1HNW F;  1RT3 A;  1LWF A;  4RX6 A;  2JLG A;  3ZZ0 A;  2RNE A;  3T19 A;  1JJ4 A;  1IWG A;  2JEF A;  5KFD A;  2BJ7 A;  2WBM A;  2ZH6 A;  4F2S A;  3WX8 A;  2NLW A;  4YB5 A;  3FCV A;  3M2V A;  3JAM U;  3POT B;  2IBK A;  4O3S A;  3GFH A;  2AJQ A;  2OPP B;  3HFK A;  4B9S A;  2KRB A;  3RW7 A;  4X62 F;  2MHE A;  5HVG A;  1ZH5 A;  1U09 A;  3MPY A;  3D6H B;  4LF5 F;  3JTP A;  5L9N A;  4UZB A;  1M5O C;  1S9F A;  4WFN Q;  1MMD A;  1MLA A;  2FC9 A;  3RR7 A;  3CJK A;  1RAF B;  2HWT A;  3H2L A;  4W90 B;  2HNZ A;  3EPI A;  4YUD A;  1JXL A;  1JLE B;  3AHP A;  1VDH A;  5B0A A;  1N54 B;  4OZ0 A;  1D8Z A;  3E51 A;  4OHW A;  4NLD A;  1HBO A;  2CZV C;  2MJU A;  1KHV A;  4WKY A;  5LMN F;  3BYP A;  3W60 A;  4FNI A;  1R8H A;  2DR5 A;  1HQE A;  2QYC A;  2SXL A;  3MMA A;  1Q5Y A;  4I2Q B;  1KFS A;  1OSC A;  1F9E B;  2VZ9 A;  5E3A A;  4C2M A;  3WHI A;  3UPF A;  5GAH I;  4LVN P;  1JLQ A;  4C8M A;  5U47 A;  4F4A A;  2KKH A;  4X4S A;  1CEZ A;  1AW0 A;  3KK2 B;  2HQG A;  4IO1 A;  4IOB A;  4XTT A;  3OUY B;  1C1C B;  2DO0 A;  4PPZ A;  2VHG A;  3KK1 A;  1IBM J;  5AJ3 J;  4NZ0 A;  1QE1 B;  4ZP6 A;  4CO3 A;  4GRS A;  3KKF A;  2VQE F;  1QUV A;  2RVJ A;  2W1B A;  4URS A;  3H40 A;  4PCQ A;  3DMJ A;  3DLE B;  4ZPD A;  2E5I A;  4CNY A;  4HLB A;  2NQP A;  2GAH C;  2XMJ A;  3QT6 A;  4YP3 A;  2ZH8 A;  2HVE A;  1H98 A;  4I7F A;  3THT A;  1WHY A;  2B6A B;  3OTB A;  3CJ2 A;  3H4B A;  1L3S A;  5CYQ A;  3DRS A;  1IBK F;  4NLY A;  1MMN A;  1YVF A;  2Y1J A;  2HW3 A;  4DQQ A;  4LRA A;  2VJU A;  2LQ5 A;  4B3R F;  2HIY A;  1R43 A;  3EGZ A;  2PI5 A;  1HNV A;  4YB7 A;  2AEJ A;  2J7W A;  2KG0 A;  3DXB A;  2GZO A;  3SZ2 A;  2G1D A;  5C2C A;  2HQI A;  3OJU A;  4N8O A;  2R2T A;  4QYZ J;  2MLZ A;  3QGP A;  5C42 B;  1O5J A;  3MPV A;  3OL8 A;  3MTK A;  1JLC B;  4KGX B;  4CLW A;  3FEY B;  1V3R A;  2MPU A;  5JMN A;  5KFW A;  2C2M B;  1U48 A;  2XB2 D;  2Q2G A;  2JVM A;  4EFA C;  4OZ3 A;  4KO0 B;  3MR2 A;  4LBI A;  5HI7 A;  2CQH A;  1GTE A;  3ETM A;  1KHW A;  3UQS A;  5L46 A;  2R7O A;  2ATC B;  1S7H A;  5HMY A;  2CAJ A;  3CCZ A;  2QT7 A;  4DN0 A;  5J1E A;  4JV0 A;  4E2F B;  2DPJ A;  2ZBC A;  1GMU A;  2B9Y A;  3L9Z A;  3U27 A;  1X4C A;  4B3T F;  3TVK A;  4N76 A;  2Z57 B;  1RQ0 A;  2B7C B;  2CXE A;  5AXM A;  5BYQ A;  3OPK A;  3QO9 B;  1CG2 A;  2GJ2 A;  2OH2 A;  1J5E J;  1SC6 A;  4CH1 A;  1LV5 A;  4YHH F;  1T9T A;  3JQJ A;  5I3Q A;  1RU2 A;  3CW2 C;  4U7U D;  5DM7 Q;  2X7I A;  3HMJ G;  3F73 A;  4KV8 A;  3RG6 A;  1VC5 A;  3LOU A;  1EHW A;  3DU6 A;  3QQC D;  3LP2 A;  4NI2 B;  4FDF A;  4DV6 J;  1NDL A;  2J0Q D;  4A8K A;  3I5C A;  1VQ8 S;  1VBK A;  1OQ3 A;  2EI5 A;  3GIR A;  3NXZ A;  1X8D A;  3C16 A;  2P9G A;  2F4V F;  1W2I A;  4DZ6 A;  2AP6 A;  1R8B A;  1S9E B;  2CQ2 A;  1YTY A;  2EG1 A;  3DYA B;  2HHT A;  4AL5 A;  5DQG A;  1FCA A;  1UVN A;  1Q5V A;  5E2Q A;  4Z2X A;  2H4W B;  1RWW B;  5AXL A;  1R7I A;  2XYG B;  4PWD B;  4ECX A;  5EGY A;  2DNO A;  4BS2 A;  4TVA B;  2XCP A;  5IV3 A;  1TUG B;  4CLT A;  4ZPB A;  1IUJ A;  1IQZ A;  3UD3 P;  5KT4 A;  4OJ1 A;  3NLC A;  1Y0H A;  4FBU A;  2UUC F;  4EO8 A;  2UU9 J;  4PG4 A;  2IM2 A;  4X65 F;  3TO8 A;  2MQO A;  4X66 F;  3GB0 A;  1D3W A;  2X3G A;  4KH1 B;  2XMA A;  4JI8 F;  4TXS A;  1E6V B;  4AQY F;  3KLI B;  1S1T B;  4K0K J;  3ELH A;  4IG3 B;  3I9V 9;  1ICE B;  2ZOG A;  1MU2 B;  1WKK A;  4K8R A;  1FI4 A;  3C6T B;  3T41 A;  4DS5 A;  3KDO A;  1SQE A;  3B8H A;  1S1W A;  2DXE A;  3M9N B;  9ATC B;  1HNI B;  1VOM A;  4IFV A;  5J2Q A;  3G82 B;  3FSI A;  5E7O B;  2YY3 A;  3KDN A;  4MFB A;  5DM6 Q;  5KG1 A;  3DOL B;  2ILZ A;  5KFF A;  2HHW A;  4CLL A;  4PQU B;  1ZM4 A;  1WDD A;  4EBC A;  3UNY A;  4JI1 F;  3PIP Q;  5DET A;  5IT4 A;  3C66 A;  5BR8 J;  2E9T A;  2JL9 A;  2BE7 D;  2MQL A;  4L76 A;  4WTO B;  2MYF A;  4YY3 J;  4QYZ K;  1SKS A;  2C2E A;  3WBZ A;  4DV1 J;  4USW A;  2JJ4 D;  4RL1 A;  4C8Z A;  4O3O A;  3NNH A;  2BW2 A;  2AIR B;  4DFK A;  5B7W A;  2B4U A;  2Z2Z A;  2L48 A;  3CDE A;  4QYR A;  2OPS A;  1C4A A;  2FVP A;  3FQK A;  1TZ0 A;  2ROG A;  4LRF A;  2LA4 A;  3FUY A;  4DV2 J;  2VPW B;  2AD9 A;  5MLC V;  1UW9 A;  3DLG A;  1NCL A;  1Q95 G;  3MEG B;  1R0B G;  2K3I A;  2W4P A;  4LSL A;  4P2X A;  1C1B B;  3M2R A;  5KFM A;  3CJ4 A;  1RTD A;  5KFA A;  1M0S A;  3AD7 C;  5KFR A;  2FJD B;  1KWM A;  4FPR A;  1PGZ A;  3OHA A;  1ELO A;  1RAO A;  5B09 A;  3M8W A;  3OTO F;  1TQL A;  2L08 A;  1D0E A;  1T03 B;  3UFC X;  3MEK A;  1RAA B;  3L7U A;  5AE2 A;  5M2R A;  1WEY A;  2GX8 A;  4OYM A;  4ECS A;  1OS5 A;  2VOO A;  2XO6 A;  2YWH A;  4WPA A;  4RWW A;  4XAK A;  3PHE A;  1SI9 A;  3FRY A;  3P96 A;  1HL6 A;  3GV8 B;  2CQ1 A;  3PYE A;  5J2M B;  3PHT A;  1HWJ A;  1FRX A;  2R42 A;  4QIF A;  1NO8 A;  1XWL A;  2FLL A;  2LFV A;  4F4Y A;  2DRB A;  3QAE A;  1NJX A;  1VQY A;  1SJ3 P;  2MZQ A;  4CM2 A;  1RBO B;  4DX7 A;  1S6Q A;  1VQ9 S;  2CFX A;  3KK3 B;  4ECU A;  4LF8 F;  1VFJ A;  5D0E A;  1IXK A;  3MM9 B;  2RB7 A;  3KJF B;  2WSC C;  5DLG A;  1T9V A;  2B8P A;  1RHJ B;  2DNL A;  1P9Q C;  4KGK A;  2BAB A;  1NK9 A;  3SIP B;  2DH8 A;  3KJV A;  3I5A A;  5LM7 E;  1S9G B;  1QSS A;  2ZUG A;  2FHJ D;  5A6W A;  3NCQ A;  1YX2 A;  3IM9 A;  2YWK A;  3GJQ B;  3M32 B;  1U1M A;  5L1L A;  4EWT A;  2JFK A;  5SUH A;  4F67 A;  1WTF A;  3CCE S;  1TKT A;  3V2U C;  1NDC A;  2VJV A;  3I0S B;  3G96 A;  3G6Y A;  4P75 A;  2LXF A;  4DUZ F;  2H5I B;  4W92 B;  3BDP A;  3T1A A;  1XQI A;  3GIJ A;  4ZHR A;  2F7V A;  2G0I A;  4ID5 A;  3DDK A;  2VUG A;  4ZCK A;  3HJF A;  3ZXW A;  4DFJ A;  1KQS R;  4DR6 F;  4U96 A;  2V34 A;  2FLN A;  4H4M A;  3R2D J;  1KTQ A;  2KFY A;  2UUT A;  4TU9 A;  2YPZ A;  3M8Z A;  3W1Y C;  1JLA B;  1KQG B;  3GSI A;  2IDE A;  2BQR A;  1LOU A;  4KR0 B;  1I94 J;  2XI3 A;  2PT0 A;  2HMI B;  4ID8 A;  5L39 A;  2UXB J;  4DR7 F;  4TY8 A;  4G1P A;  2XY5 A;  5F3Z A;  1NSK L;  3KLH B;  4WP8 A;  4HHU A;  2GVD B;  5KFB A;  5KG6 A;  4K59 A;  3N9U C;  4L6V 3;  1B7Y B;  3KLF A;  4ZK7 M;  4QWA A;  2V0N A;  1MSW D;  3P4U B;  1HA1 A;  2V4R A;  2GGP B;  3BKF A;  3A8I A;  3MD3 A;  2YTC A;  3A12 A;  2CQC A;  5F8N A;  3D6F B;  4P9S A;  4ELV A;  5BYS A;  1EB0 A;  1QJH A;  1Y5I B;  3SDE A;  5I3U B;  3H5X A;  2UV8 G;  1OYE A;  2VPX B;  3TEH B;  1WD6 A;  4FS1 A;  2R8I A;  3B82 A;  2AEM A;  1JLF A;  1JLB B;  4DCJ B;  4TY9 A;  4RNN A;  3ZZZ A;  1Y5L B;  4TNO A;  1S6O A;  4DSE A;  4IFY A;  5D4N A;  2DHA A;  2W2P P;  2XS2 A;  4HVZ A;  1IJF B;  3BRE A;  4ECZ A;  3S1T A;  1FVQ A;  2P9C A;  3BSO A;  1WC3 A;  3PO4 A;  2ZH4 A;  1S0N A;  1HIY A;  4Q0B B;  3SCI E;  2HYI B;  5JVG Q;  4PWU A;  3IR6 B;  1NUE A;  2YKA A;  3IFE A;  4K4T A;  5CYM B;  2JX2 A;  4ELT A;  3UO0 A;  1L3U A;  2VFU A;  4M5D A;  1G6B A;  1PKU A;  2HHX A;  1CJV B;  1S48 A;  3TJ8 A;  5HAO A;  1HMV A;  2NPI A;  4OI0 A;  5F0U A;  3FMW A;  2XQC A;  1GH8 A;  4LUB A;  2B7B B;  1T9X A;  4ED3 A;  2NRE A;  1SBR A;  1R27 B;  2QLX A;  1X4H A;  4BBY A;  2KT2 A;  4CO1 A;  3AD8 C;  1FEE A;  1G7C B;  3ZTP A;  1C4C A;  3DLK B;  3PRV A;  1EP4 B;  5KFV A;  2XG8 A;  3WQP A;  2YVS A;  5FDL A;  3C14 B;  4OI2 A;  4QBU A;  1JKH B;  4DV7 J;  2MMY A;  3G4S S;  3IS9 A;  5DS7 A;  3THV A;  1WHV A;  2ZHO A;  1SC4 B;  3FZB A;  1JNZ B;  2XHW A;  4C0O C;  4NXM F;  3MF5 A;  3VAI A;  1ZA1 B;  4ZJQ A;  3SFU A;  1H73 A;  3GWC A;  4DL5 A;  1HR0 J;  2HGM A;  3J81 Y;  3R7B B;  3HSZ A;  2EK6 A;  5EWF A;  1JX4 A;  2C2K B;  3VHQ A;  2BE9 B;  4YN3 B;  3S8S A;  1P6T A;  3T5H A;  4FVC A;  2XGP A;  2G4B A;  2MGZ A;  3IM8 A;  4X64 J;  1NSA A;  3I0R B;  1UA1 A;  4Q45 A;  1XMQ J;  1O51 A;  1SJR A;  2QLB B;  2ZKT A;  2R7T A;  4LQ3 A;  1R8P A;  2GFF A;  2MQM A;  3SQG B;  3HT0 A;  4NX9 A;  4M5L A;  2JVR A;  5HJX A;  2B4P A;  1N34 F;  2AWZ A;  4G1I A;  5DG7 A;  4ZJL A;  3CWJ A;  3HM9 A;  4ECQ A;  2QFJ A;  2HND B;  1JLG A;  4X4R A;  4ATN A;  4DN9 A;  5T14 A;  1H72 C;  4K4W A;  3MPW A;  2MKH A;  2NYH A;  4M5I A;  2EFQ A;  3OR1 B;  3BV8 A;  3ZZY A;  1HI8 A;  4F4K A;  2HRY A;  4DV0 F;  1HNW J;  3DHW C;  4USU A;  2VON A;  2E7X A;  1RT3 B;  4U95 A;  1SJQ A;  2WHO A;  1LW2 A;  1K9M T;  3MM7 A;  1RYR A;  4M1K A;  1YI2 S;  2Z8Q A;  2IFX A;  1Q8L A;  4ZVP B;  3FK4 A;  4LFA F;  1V5I B;  3VVU A;  4X62 J;  3NWG A;  3HCX A;  4LF5 J;  3PYD A;  3WIV A;  1N6Q B;  4DR2 J;  2F8H A;  3V4I A;  1TVR A;  2OUG A;  4J9S A;  1F9F A;  3JTN A;  1WG4 A;  4IQM A;  5FJ4 A;  3OVS A;  4RU2 A;  2CKW A;  2CZ9 A;  1SH3 A;  5LMN J;  3CDB A;  1U0S A;  2W01 A;  4LVO P;  2N4C A;  1GAO A;  1T3O A;  1FRJ A;  3N79 A;  3JSM A;  2YX1 A;  3VAM A;  2J6U A;  4G65 A;  2MKS A;  2E5H A;  1PBU A;  5B0G A;  3MMA B;  2XZW A;  3D5M A;  5DGB A;  3W5Z A;  3CGI A;  2DYA A;  4XDC A;  1UTA A;  3VWS A;  1YRX A;  3PAC A;  1U49 A;  1SKR A;  2RDJ A;  2IDL A;  4OYA A;  4WFA Q;  2AEF A;  2CAD A;  5F0W A;  1SC1 B;  4A46 A;  2VQE J;  2OTJ S;  3T9N A;  2QLW A;  2G2O A;  3BO4 A;  3PY8 A;  1FDN A;  2IA0 A;  5T7L A;  2YKN A;  1TFY A;  3CCQ S;  3W3S A;  3DHX A;  4I7F B;  3BJY A;  5F8M A;  4OZN A;  4UQG A;  1S1X A;  3F41 A;  1IBK J;  4MJK A;  1KNZ A;  3QRQ A;  1VRT A;  3BGF A;  5CYQ B;  1VHI A;  3ILO A;  4BCA A;  3QFW A;  4J9M A;  4DV4 F;  1ZET A;  4B3R J;  3RB0 A;  2JWN A;  3AGZ A;  2VC0 A;  3UCU P;  1FJG F;  2AJF E;  2ZM6 F;  1UP1 A;  1HNV B;  2W7A A;  2YX7 A;  2HK2 A;  3OFF A;  4DU7 A;  3HHN B;  2JOQ A;  4HHJ A;  2XBP A;  3BM7 A;  2EFO A;  4ZVE A;  1X5T A;  4KGM A;  2XEX A;  1AA1 B;  4M5M A;  5E5N A;  4DLE A;  2ZC4 A;  4F3M A;  2KTQ A;  3C19 A;  3EWG A;  3R6L B;  2NZC A;  2KHD A;  4C0H A;  4NYZ A;  1NZ8 A;  1MRO B;  4RBT A;  5L9X A;  1RHU B;  3OVB A;  4HTJ A;  2V2Z A;  5J1E B;  4NZ7 A;  1RT7 A;  2MY7 A;  2J9E A;  3Q22 A;  3CJ5 A;  3HZG A;  4DV5 F;  1WWH A;  3BPS P;  4CTA A;  4NA3 A;  3OSN A;  3QJL A;  1U0H B;  3I32 A;  4USM A;  2Q6B A;  4LBP A;  1RLC L;  4YHH J;  4KC5 A;  2L41 A;  3PM9 A;  4GC7 A;  2MHN A;  4LR8 A;  3MED A;  3R7N B;  2V2K A;  1Y00 A;  4OIX A;  5GAG U;  4DPU A;  3O44 A;  4U8V A;  3PX4 A;  4KV8 B;  4PXC A;  5CZX A;  3KTQ A;  1RE1 B;  3LP2 B;  1EAR A;  3NGD A;  3TQ1 A;  4WKR A;  1UET A;  5E33 A;  4LF4 J;  4YB1 P;  1D9F A;  3CDW A;  5CQG A;  1WSV A;  4ICL A;  4X4P A;  1FE4 A;  2NR0 A;  4WIQ A;  2ZVI A;  3C16 B;  2A6M A;  3W9H A;  1Y4Z B;  4YFU A;  3BSN A;  3ENA A;  1FTR A;  4O44 A;  1U1L A;  1EET A;  1OWX A;  3CCT A;  1FD8 A;  1YRU A;  2YH1 A;  1Q7Y T;  4K4V A;  2O67 A;  3OFG A;  3MXH P;  5ETT A;  2HZV A;  3PKY A;  2LQB A;  1HLW A;  4JV2 A;  1AB8 A;  5DO2 A;  3GJT B;  2BW7 A;  2WRM A;  1RBA A;  3ZTO A;  2VQF F;  2B9E A;  4WFZ A;  1PIE A;  4ILM A;  4CIO A;  2QMW A;  2UUC J;  1K8A T;  1S1U A;  4OZ2 A;  4OX7 A;  1NK4 A;  3MMB B;  1RKJ A;  2DIT A;  4X66 J;  2QE5 A;  2W7O A;  3CTR A;  3M7V A;  4JI8 J;  1UCN A;  2GHV C;  2HFS A;  4AQY J;  2B8Q A;  2DY9 A;  4JUZ A;  4C8N A;  1WTB A;  5CXT A;  1RGV A;  3IBC B;  4O3P A;  2A10 A;  1X7V A;  1DLO A;  4PWW A;  1NK8 A;  4YR0 A;  3G71 S;  3DM2 A;  2HHP A;  1HWI A;  5D0G A;  1X4F A;  3NEK A;  4IFV B;  2FJW A;  3IRX A;  3J81 U;  5J2Q B;  1Q86 T;  5KFP A;  4K4Y A;  4H4O A;  5DDP C;  3AA8 A;  2ABY A;  1VQO S;  2BBE A;  2BOA A;  5KFI A;  4HT7 A;  3VQS A;  3LW5 C;  4EYI B;  5ETO A;  2YWE A;  3NGS A;  2PEB A;  3GIM A;  3D3C J;  3BR9 A;  1RWP B;  2OJ3 A;  2CJ9 A;  1VCT A;  2VIC A;  1K44 A;  5GVQ A;  3KLG A;  3DI6 A;  1KTV A;  3VAH A;  1YDL A;  1YQH A;  3W64 A;  1F5A A;  1X9S A;  3FKB A;  5L8R C;  2A6O A;  3KMQ A;  1Q0N A;  5E3P A;  2OPS B;  4OI6 A;  4CI0 B;  1VLO A;  3LZ8 A;  3CCJ S;  4Q2L A;  2BM0 A;  5IM0 A;  4ES2 A;  3H5Y A;  3EGN A;  1Q7L B;  1L3T A;  4M5J A;  2DNQ A;  3DLG B;  3FVY A;  4LSL B;  3R5C A;  1IN0 A;  4ZVS B;  2CPZ A;  3ENV A;  3M2R B;  4ZIT A;  2PC6 A;  2HHU A;  1RTD B;  4RR5 A;  4JI6 F;  1KOH A;  1LWX A;  2FVS A;  3MUM P;  1FEH A;  3OTO J;  4C0B A;  3ADA C;  1JQG A;  2QL9 B;  3FSY A;  1FFG B;  3GFZ A;  2M3D A;  1U7L A;  4QWC A;  1JJ2 R;  2Q79 A;  1HKA A;  4ZPC A;  4A8Y A;  5IT9 U;  3PYF A;  1CUL A;  4ZPA A;  4ZVQ B;  4DCP B;  1KDN A;  2BX6 A;  1VIO A;  1NK6 A;  1XR7 A;  3UN2 A;  3LP0 A;  3MCO A;  3P45 B;  1WC1 A;  3KFW X;  5KFJ A;  4GKJ F;  1P1L A;  4V19 X;  2HVZ A;  3N5F A;  3HF5 A;  1JWW A;  3ZC4 A;  2RS2 A;  2B51 A;  2H51 B;  4IDK B;  3DLB A;  4Q8F A;  4CYU A;  3LF0 A;  1NPR A;  4LF8 J;  2ZZM A;  3AT1 B;  5I3P A;  1VQ6 S;  4ZKA A;  1LWC A;  3CCU S;  3ILI A;  1VQ7 S;  4WXW A;  4ZLL A;  4G6V B;  4HAC B;  2L9N A;  5H1S V;  2R8H A;  3UCZ P;  1JXE A;  3DKD A;  2LYV A;  4JI4 F;  4I4B A;  5ETQ A;  3C5X C;  4W4M A;  3MTJ A;  3HLU A;  1PBA A;  4LF7 F;  2HFO A;  4RNF A;  1WDT A;  2FHJ A;  1X0F A;  1OPZ A;  1N5Y A;  2BZ2 A;  4ED4 A;  1TKT B;  3DXS X;  3NGT A;  2J8S A;  4FN5 A;  3UE2 A;  4MK8 A;  4ZHR B;  1X9M A;  4DR6 J;  1S57 A;  1TL3 A;  2Q43 A;  4MKB A;  5KG4 A;  2JH3 A;  2J6S A;  2I9S A;  1IKY A;  2KU7 A;  3FFI A;  2RKI A;  3DOM A;  1GMW D;  4K4Z A;  4DR7 J;  2IC3 A;  3PCO B;  4IG0 A;  4ER8 A;  4A8O A;  3CE8 A;  4PXD A;  1X9W A;  2HGN A;  1GT8 A;  1FDD A;  2OD4 A;  3O1L A;  4HEA 9;  2FD2 A;  2HLU A;  1TAQ A;  2KFN A;  1NKE A;  5M2U A;  4ZCM A;  1Z2Z A;  2P8I A;  2DNM A;  3W9I A;  4AYB D;  5DDR C;  3W2V A;  3UDC A;  1ZTW A;  3TW0 A;  4M8L A;  1B7F A;  2KRR A;  2NUU G;  1VR6 A;  1H2U X;  2MLY A;  4Z7Y A;  4KFB A;  1HYS A;  4KE5 A;  2OD6 A;  5C5J A;  4KGZ B;  4YME A;  4DUY F;  3GU0 A;  4R5P A;  3KUE A;  1F2G A;  1BMQ B;  3SMZ A;  1NME B;  5JUM A;  4DF8 A;  1JLF B;  3EM1 A;  3EGV A;  2BVZ A;  4CRJ A;  1UJ6 A;  3R97 A;  4QPT A;  2IHR 1;  2BRL A;  4IFY B;  1AZS A;  2V4Q A;  1S77 D;  4ED7 A;  4E98 A;  4C4W A;  1K0T A;  4DL2 A;  1NB2 A;  2GIR A;  1NLT A;  1URN A;  5KT7 A;  4BHQ A;  2QO3 A;  3NNA A;  2AGO A;  1S0O A;  1VC0 A;  1TMM A;  4AD6 A;  3VAG A;  3QT5 A;  3K8V A;  2BJ9 A;  2FHM A;  3QLH B;  2HFN A;  3ISN D;  2E44 A;  4M5D B;  2XNR A;  2VC1 A;  5FLX Y;  1HNX F;  3TA1 A;  1ZZF A;  3FEX B;  2BAC A;  2C3O A;  1HMV B;  4ZMM A;  1RXO B;  1TK8 A;  2OML A;  2HWH A;  4J9N A;  4C8Y A;  3RBD A;  2N3O A;  1TK0 A;  3HSD A;  4I2P A;  4R8U A;  4CLP A;  3BPD A;  2VBZ A;  1PIL A;  1DTQ A;  3GQC A;  3W5X A;  4GVB A;  1WOP A;  2CPF A;  1U1K A;  1N4L A;  2K2P A;  1VJW A;  4OYB A;  2KYX A;  2R7U A;  2YQ3 A;  2DHX A;  4RUC A;  1RZM A;  3G2X A;  1KVK A;  1M1H A;  2YNI A;  2WSF C;  1VQM S;  4LIW A;  1R3N A;  2QLJ B;  1GK8 A;  5HAT A;  2G1H A;  4N8N A;  2OFG X;  4RW8 B;  3IR5 B;  2CUY A;  2MGZ B;  4RU9 A;  4DX6 A;  1RJJ A;  4OX8 A;  3K8W A;  3TZY A;  1BE4 A;  4ES3 A;  3KYL A;  1UVK A;  4OZL A;  4ZN1 A;  4OZJ A;  2EKY A;  1MW7 A;  2BM1 A;  5H9E J;  1N34 J;  2B56 A;  4B9T A;  5DQI A;  3FMB A;  3BGR B;  3T9Z A;  2VAS A;  1IWA A;  2W24 A;  2XY7 A;  5CAB A;  1TTH B;  2NCK L;  2V8V A;  2V9K A;  1YJT A;  4R25 A;  1OJ4 A;  2WVB A;  4R0E A;  2XC9 A;  2HK3 A;  3OBI A;  3QZ8 A;  4DV0 J;  4K2X A;  2VG5 B;  2RF2 A;  2CPH A;  2FVC A;  4FKX A;  2EWH A;  3N6M A;  1KLM A;  4H4K A;  1QVF R;  2M8D B;  5F9N A;  5IV4 A;  1YWX A;  1QTN B;  3Q86 A;  1LW2 B;  3MM7 B;  4CQ1 A;  3NG8 A;  2V68 A;  2JHE A;  3LAK A;  2EK1 A;  4LFA J;  1NKC A;  2OAU A;  3MM5 A;  4NLP A;  4F02 A;  2V67 A;  1FRL A;  3M6U A;  5LJ5 Y;  4ES1 A;  3BSC A;  1BGX T;  3PFE A;  2I5J A;  1B3T A;  5D4P A;  1LK7 A;  2FC8 A;  3Q8R B;  5HMX A;  1F3F A;  4HH0 A;  4DR4 J;  1U8S A;  1CQM A;  3V4I B;  1E6Y B;  1WF2 A;  2AQ4 A;  3RJM B;  1T94 A;  1TVR B;  3DRY A;  4ECW A;  4IRK A;  3OD2 A;  3MUT P;  1T0T V;  1JMT A;  5EN1 A;  1R6V A;  3Q2T C;  4ANE A;  2QA4 S;  2E1P A;  4DV3 F;  3JSM B;  2H48 B;  1GQE A;  3N28 A;  2ACM A;  1QTM A;  2E5G A;  2XZT B;  1CS4 A;  1IBC B;  4HI2 A;  3NBP A;  2Z30 B;  4V1A k;  4LFC F;  5HVH A;  4TQS A;  1GXU A;  2P6T A;  1RWV B;  1DAX A;  4J9K A;  1VBZ A;  1RT4 A;  1RTJ A;  3OQ2 A;  2YX4 A;  3HXM A;  3NAI A;  3H0P A;  4OJH A;  4LF1 A;  1FKO A;  2HFZ A;  1XR5 A;  2XUL A;  2GC8 A;  4ZOS A;  2CPD A;  3J80 Y;  5D0R A;  2K1R A;  4LQ9 A;  1XNR F;  4IH7 A;  1HQ2 A;  1M1G A;  1C0T A;  1SV5 A;  3NY0 A;  3VZI A;  1S1X B;  2HZA A;  1IKW A;  2VFR A;  2IM0 A;  5MAO A;  3IAS 9;  4DSL A;  4DV4 J;  5HQM A;  2YQ1 A;  2KJV A;  4CLF A;  4A8S A;  2WSE C;  2R8K A;  2BMB A;  1FJG J;  3U1M A;  3QID A;  2IMO A;  3TQE A;  2W8K A;  3RB4 A;  4ANC A;  4O0N A;  4CT8 A;  3TZW A;  1ZM3 A;  5D78 A;  4DR3 F;  4F3O A;  1W26 A;  2MQ8 A;  3M30 B;  1VQN S;  2YXL A;  2QJ3 A;  2RJZ A;  1NJZ A;  4FP9 A;  5H9E K;  1SJ4 P;  2D1C A;  3MCS A;  2PMH A;  3FBE A;  1KRP A;  3H5U A;  1ZPV A;  2FQQ B;  5J2N A;  3RB6 A;  4ZN3 A;  1U1O A;  4X84 A;  5KFH A;  1X31 C;  2CG8 A;  2ZDO A;  2E66 A;  1EJ7 L;  4K7Q A;  2I0X A;  2BRK A;  3BGO P;  1NPK A;  3HD1 A;  1YIJ S;  1LWE A;  4YB6 A;  4NE9 C;  2IVF B;  3AOB A;  2NXN A;  2XZD B;  1HBN A;  4BC7 A;  3MEC B;  5HRO A;  4DV5 J;  3M9M B;  1B4S A;  3GG0 A;  1SL0 A;  5LSR A;  4CTA B;  5LSO A;  2F40 A;  1UVL A;  4M5G A;  5B0C A;  2CNO B;  4L3K A;  4F4Z A;  5IXU A;  4I0W A;  1TR0 A;  2FTR A;  3ZZR A;  1HW8 A;  1UEU A;  2E7W A;  3VVT A;  4KRW A;  2K7K A;  3AGY A;  2V94 A;  1OY6 A;  3A8K A;  2C1E B;  1WC0 A;  4ICL B;  3DNC A;  4X4Q A;  4OX9 F;  2ZE2 A;  2PFF B;  4N47 A;  1U47 A;  2HVH A;  4DR1 J;  4OHX A;  4RW6 A;  1RHM B;  4NMX A;  1U2C A;  3CB4 A;  1X4G A;  2ZWO A;  2OPR A;  4O44 B;  5FLX U;  4FYD A;  1JJH A;  1U6B A;  1YJR A;  4ZVT B;  3HD2 A;  3MM6 A;  2R9L A;  3DLH A;  1S0M A;  2OPQ A;  2LCW A;  3PJW A;  2A1B A;  2VQF J;  3NRB A;  2CPJ A;  3DU5 A;  3B4D A;  2YKM A;  3T5L A;  1H7W A;  2UUB F;  3R1H A;  3ICL A;  1S1U B;  4JI5 F;  1V6H A;  1FFS B;  4PXE A;  2C28 A;  2ASL A;  4JI2 F;  2ROP A;  1F5B A;  4DU8 A;  2IAJ A;  2XS7 A;  4C11 A;  3W9J A;  2CJA A;  1PJ5 A;  4DPW A;  3MMJ A;  3Q8V A;  3W8G A;  3CMQ A;  4DL0 C;  3H5S A;  1TMJ A;  5HMZ A;  1DLO B;  1EQM A;  2DPI A;  3DM2 B;  2KYZ A;  1BWV A;  3K2Y A;  5F41 A;  2IPO B;  3JYT A;  3IRX B;  1WNE A;  2VL1 A;  2ZH7 A;  4OLO A;  1SC3 B;  4H4O B;  3RW6 A;  1QAX A;  3RRG A;  3LGH A;  4G3I A;  3T5K A;  1F3V A;  2VFT A;  1P9Y A;  3OXG A;  4UW2 A;  2DBB A;  3R3T A;  4EGL A;  3A4T A;  5C24 A;  3NP5 A;  3KLV A;  1TL5 A;  3KLG B;  1BUX A;  2A3J A;  4ZJO A;  4QIV A;  4EZ6 A;  3R1L A;  3AB4 B;  3TUI C;  1FF2 A;  1YJU A;  3LGM A;  4BWM A;  2BKN A;  1FE0 A;  3M8S A;  3PFO A;  2X3D A;  4PG5 A;  5IM0 B;  1PAU B;  2V5H G;  6AT1 B;  1R8C A;  3QMQ A;  5I4M A;  2IVM A;  1VLY A;  3IGN A;  5HL7 Q;  3TUP A;  1GX6 A;  3PDN A;  4JI6 J;  1KD1 T;  1SIW B;  5ETS A;  4WWS A;  4DI6 A;  3O5T B;  2HS0 A;  3CJR A;  3Q8S B;  4NA2 A;  1VS3 A;  3WC0 A;  2A0F B;  4C9D A;  2H1Y A;  5BJR A;  1W2B R;  2PGC A;  3PIO Q;  1P1T A;  3B54 A;  1RWN B;  2M5Y A;  4YDD B;  2D7S A;  1VI7 A;  3MR7 A;  2WVF A;  3H20 A;  1UWB A;  2FJX A;  4DSF A;  1VQK S;  4KQZ A;  2HPU A;  3EZ5 A;  3HFZ B;  3N6L A;  1KQF B;  1D8Y A;  4CLS A;  4KY3 A;  2GHW A;  4Y34 A;  4GKJ J;  4LR7 A;  1Z4U A;  4IR9 A;  1S1V A;  4EYH B;  2R7V A;  2CQD A;  2VFS A;  3PZP A;  3BH7 B;  4LRC A;  3QT7 A;  5D77 A;  1UL3 A;  2XSF A;  3MFH A;  5E3C A;  4JYA F;  4CYU B;  2AJ4 A;  2DVI A;  2Y8Y A;  1B70 B;  3UD5 A;  1CJK A;  4MIA A;  4N41 A;  1LWC B;  3UDV A;  1HNZ F;  3D2W A;  2BOP A;  2WOM A;  4FXV A;  3CCS S;  1RTH A;  1Q8B A;  3HHK A;  4LF7 J;  1TL7 A;  4H4K C;  4CH7 A;  1MNE A;  5DG9 A;  1PYS B;  3OXL A;  4PG6 A;  2XO7 A;  5GMK a;  4M5N A;  2DNZ A;  4AUK A;  1N5Y B;  4KPC A;  1RA7 A;  1SH0 A;  2X1G A;  2G2Z A;  3JTO A;  3J7Z T;  4F8R A;  4ED0 A;  4NOH A;  4Z37 A;  4KJI A;  4C48 A;  4QR1 A;  2VIH A;  2G2Y A;  3TAQ A;  1N36 F;  2VB6 A;  4HL9 A;  1TL3 B;  1FWL A;  3MM8 B;  3ISZ A;  3SV4 A;  1KSP A;  5KFO A;  1D9A A;  4USV A;  1X5S A;  2PFD A;  2RKI B;  3DOM B;  3PNI A;  2RE1 A;  1RU1 A;  3KNG A;  2MLX A;  2IC3 B;  2RH3 A;  4IG0 B;  4QR0 A;  2G0J A;  1GMW A;  5KFC A;  2M70 A;  1S72 S;  4NLT A;  1S76 D;  2LQ8 A;  3M1V A;  4J9Q A;  1M90 T;  2MQQ A;  2MTL A;  1KFD A;  3W2V B;  5D15 A;  4HTI A;  3ENQ A;  3B4M A;  1UVM A;  2OPP A;  4CO0 A;  4NLS A;  1WUU A;  3E01 A;  1HYS B;  4USJ C;  2DEI A;  1RHQ B;  4DUY J;  2WVC A;  3O6Q A;  3BQ2 A;  1TK5 A;  1RSC A;  1DJ0 A;  3RR8 A;  3ZZO A;  2W9B A;  3FZ2 A;  3CJT A;  4DQR A;  3VF0 B;  4Q8E A;  3GV7 B;  3IP0 A;  1TU0 B;  2M2B A;  2ASD A;  4DHV A;  1IM6 A;  4K4S A;  1V3Z A;  1FNX H;  2N82 B;  1HHQ A;  2KO1 A;  3W2W A;  4HDG A;  2ACY A;  2XM3 A;  1RWX B;  2CQG A;  2Z2L A;  2CPE A;  2F9D A;  4IRC A;  3FGV A;  1IJE B;  4UT4 A;  5F9L A;  2NSB A;  1WKJ A;  4B9V A;  2RHS B;  4C3L A;  3CPW R;  1NRK A;  1MWQ A;  1OPI A;  1C1C A;  1FKA F;  4NLX A;  3BZQ A;  4PG8 A;  1HNX J;  1UZD A;  1NXI A;  4NA1 A;  4DMZ A;  3G6X A;  3NS7 B;  3D6T B;  2RQC A;  2LU2 A;  1QE1 A;  3UVJ A;  1RHK B;  2CVI A;  3I96 A;  3PXG a;  2YWF A;  3LP1 A;  4TKT A;  2P2C B;  4P10 A;  2F8M A;  5EHH A;  3HP6 A;  1IVZ A;  1KKH A;  5HVF A;  4I2P B;  2B26 A;  1TL1 B;  3UW1 A;  1DTQ B;  3MPD A;  1NH8 A;  1DY3 A;  3GII A;  1DFD A;  3QWU A;  4USK A;  5I42 A;  3RBX A;  4UY8 5;  1CPZ A;  3FQL A;  1FFW B;  5F8I A;  1U1Q A;  2ZBQ A;  2PN6 A;  7FDR A;  3PRD A;  4Y2K A;  2W2N P;  2I1R A;  3OFH A;  3EUN A;  2NXU A;  4CWB A;  2HQD A;  3D68 A;  3K5P A;  3CMA S;  2C2R A;  3LQV A;  4M5K A;  1NK0 A;  3ZTQ A;  5KTQ A;  4DZD A;  3IMQ J;  1QLN A;  3UDL A;  1I5O B;  2QLF B;  1RP5 A;  2MKJ A;  1FXL A;  5LSL A;  4Q43 A;  2J9D A;  2DIV A;  1WKL A;  2YWG A;  1EAY C;  3C15 A;  2QC3 A;  1VYA A;  2HQF A;  2EG2 A;  2GMJ A;  3QPI A;  3EPG A;  3GMG A;  5HK4 A;  1RWO B;  2ZIT A;  5KFZ A;  2DTJ A;  3SFG A;  3FBF A;  1R0C B;  1UW4 A;  2MKC A;  1LW0 B;  4PRF A;  3MPU B;  1CJU A;  2UVU A;  2RU9 A;  4WK3 A;  3HUL A;  2XTJ P;  3KWM A;  1N88 A;  2YQ0 A;  2ZEJ A;  5JXS A;  2OP5 A;  3DRR A;  2IYI A;  4LRD A;  2EEY A;  5BYR A;  1REG X;  1HBM A;  2HNY A;  5IS2 A;  3O2I A;  1PCA A;  4KHP F;  1Q78 A;  4NRU A;  2UV8 A;  2CZ4 A;  3BB5 A;  4QWE A;  3MEE A;  5KOW A;  2RF2 B;  5B0D A;  5A2Q Y;  4F0H A;  2D41 A;  3M05 A;  4NI2 A;  4I67 A;  3D7S B;  1YKW A;  2KG1 A;  3UR3 C;  4BC9 A;  1KLM B;  5DLF A;  1X5O A;  3KG0 A;  3X1L B;  2O3D A;  4O3N A;  4ZVU B;  1OMS A;  1AUS L;  3KOA A;  4OX6 A;  4F0K A;  3MM5 B;  3R8Y A;  2Y1L B;  3W8P A;  2HFU A;  1KEK A;  2CQ0 A;  1N5Q A;  2I5J B;  2KL8 A;  3MMC A;  1FK9 B;  1RYS A;  4PWD A;  3TYT A;  2DY1 A;  1HWL A;  4P72 A;  2V6A A;  3D9B A;  2D9O A;  2J8A A;  2RML A;  2UVW A;  4RUH A;  1N48 A;  3PX6 A;  5H9F J;  1SJF A;  1I1G A;  3MAA A;  3DLL Q;  3ILJ A;  3AFG A;  3CJ8 A;  2UU9 F;  2J0W A;  2U2F A;  3HHL D;  3EVM A;  2M0G B;  3KLI A;  4LFC J;  3DN9 A;  2Q6C A;  4IG3 A;  5J1N A;  3G6V A;  2GAG C;  3ITH B;  3SSS A;  2IJN A;  4ZPV R;  4PZV A;  1R31 A;  2Y3Y A;  4DG1 B;  1FX2 A;  2OFH X;  2AX0 A;  1RT4 B;  1HNI A;  1RAG B;  3G82 A;  3KHG A;  1LXJ A;  1FKP A;  2CNN B;  3I56 S;  2VBY A;  1FKO B;  2B4V A;  3DOL A;  1NH7 A;  4PQU A;  5E3Q A;  1MWY A;  1XN9 A;  2CRL A;  4F7V A;  4OHY A;  2KZM A;  2D69 A;  3H4D A;  5EWE A;  4J9U E;  2R8J A;  1XNR J;  3UN5 A;  5CAA A;  2K1R B;  1R89 A;  4S0M A;  1C0T B;  4E0D A;  1YK9 A;  1SV5 B;  1IKV B;  1P27 B;  2C42 A;  3DCA A;  3NL0 A;  2N3L A;  4QOT A;  3HVW A;  4QIE A;  4MYT A;  3TP2 A;  1UFL A;  4TU7 A;  1BQN B;  2M52 A;  1UEV A;  1Q8K A;  2LXU A;  4GO7 X;  1FES A;  3ENW A;  3OR2 B;  1C1B A;  4DR3 J;  2JLF A;  1VRU A;  4PYD A;  5LMU J;  3L95 X;  4OV6 A;  4MMO A;  5GAE I;  2FGC A;  3DGP B;  3M4X A;  2J7U A;  4A8Q A;  2Z2M A;  3CJ3 A;  3IG1 A;  4WK1 A;  4GO5 X;  4Y3C A;  4NLG A;  2W9A A;  1T03 A;  2ZZN A;  2ZD1 A;  5IC4 B;  5J2N B;  2XGQ A;  2R8G A;  3SSR A;  3M8P B;  1RIS A;  1VK8 A;  3M8Q A;  1H6K X;  5KFK A;  4FF1 A;  1LWE B;  1R8A A;  5E3R A;  4OQJ A;  3HVR A;  1RAC B;  2KXN B;  1UA0 A;  5J2M A;  3K58 A;  5HRO B;  4Y2I A;  1J5O A;  2HHH F;  2HEK A;  3H59 A;  4I56 A;  2ASY A;  2I2Y A;  4E8U A;  5ETM A;  4CT9 A;  1JJC B;  2HSE B;  4QIW D;  2FHK A;  3P3D A;  1NK5 A;  1LKZ A;  2EW9 A;  5EX3 A;  4WE1 B;  1KS2 A;  3KK3 A;  2W4D A;  2RAQ A;  2OHD A;  2PEH A;  1JNR B;  3I55 S;  4A8F A;  1H74 A;  4QZV B;  1RI7 A;  4B9L A;  2EFN A;  2QX0 A;  3MM9 A;  3CUN A;  4EMD A;  2LDY A;  1MN7 A;  4RLE A;  4OX9 J;  1YGY A;  1MG7 A;  1FDA A;  3F0N A;  3RB3 A;  3K59 A;  2O1P A;  4MTP A;  1BXN A;  2GVZ A;  5DGA A;  2IMW P;  1YHQ S;  5H9F K;  1S9G A;  2X1B A;  4DR5 J;  2XYH B;  1FHT A;  5ADZ A;  3EZU A;  3NCP A;  4O23 A;  2N4D A;  3AH6 A;  2JZ8 A;  3QGG A;  2BR0 A;  2MZS A;  3MM6 B;  3OV7 A;  5A8R A;  1RDR A;  5CD4 A;  1DAR A;  2MJN A;  2RQK A;  3OL6 A;  2OPQ B;  1LK5 A;  2H5E A;  2UXC F;  3WZ0 A;  3GFX A;  7FD1 A;  3I0S A;  4AFF A;  4WFX A;  5DQH A;  2UUB J;  4X4N A;  1ZM9 A;  2VFV A;  2YKM B;  3GYX B;  2DGT A;  2WVD A;  3SCK E;  3PKM A;  4JI2 J;  3V6D B;  2QTW A;  4DQS A;  2UXD F;  1S7I A;  2E7V A;  1SKW A;  1RTI B;  4DL4 A;  3K5L A;  3OLB A;  4C11 B;  4IKA A;  1S6P A;  2QLD A;  1IR1 A;  1ZAV A;  4ZP9 A;  4G1Q A;  4TYA A;  5LT5 A;  3GLJ A;  1AUD A;  3HVA A;  2HMI A;  1YIT S;  3HKW A;  1FRK A;  4CLU A;  2BQU A;  1ACM B;  3A8E A;  2ZNZ A;  4C3M A;  4C8K A;  1C0U B;  2QA1 A;  2ZH3 A;  4P7V A;  1V5V A;  4QW9 A;  3UR0 A;  2DB1 A;  3KLH A;  2ZBR A;  3RGI A;  3RAQ A;  3UD4 P;  3PV8 A;  4ELU A;  2ZNY A;  1DTT B;  3NAH A;  1WI6 A;  4H54 A;  2XCA A;  2R3V A;  4WTY A;  2KM8 C;  3R5B A;  2OI2 A;  3SYZ A;  5C24 B;  3Q0A A;  3VGS A;  4ZLJ A;  4OI1 A;  3QIP A;  3ISN C;  4HR2 A;  4N7T A;  2DCL A;  3NKY A;  2WVE A;  4YQW A;  4URQ U;  2MDA A;  1K0V A;  4RWX A;  1FJ7 A;  2R7X A;  1TKZ B;  5KFT A;  4HT5 A;  1FER A;  1JXV A;  4CLK A;  1XMO F;  3C3L A;  2FYX A;  2ILY A;  2EXU A;  2K06 A;  3ZNJ 1;  5K8O A;  4Z7C A;  2F1F A;  1G4C A;  2EFG A;  5A2Q U;  1BC6 A;  2DR8 A;  4B9N A;  1T95 A;  3KHR A;  3RYL A;  2JEG A;  2W2O P;  4Q0B A;  1VRQ C;  1AYE A;  2GV1 A;  5GAD I;  5KT3 A;  5J2P A;  5AE1 A;  4QW8 A;  3IWN C;  1U4B A;  3TX8 A;  3SV3 A;  1WI8 A;  1B0T A;  1T7P A;  4C7Q A;  3IWL A;  4F0M A;  2AYG A;  3K5N A;  4DFM A;  2DCU B;  3EDR B;  1CJV A;  4QU6 A;  1KOO A;  3AXM A;  4WF9 Q;  1LFW A;  2M9K A;  1WOO A;  5LJ3 Y;  1CLF A;  1WC5 A;  4KT0 C;  2ZJP Q;  2XMM A;  1U24 A;  2F4F A;  2PA3 A;  4DCO B;  3GV5 B;  3RUB L;  2LEC A;  3ILL A;  5K5M A;  2AT1 B;  2XLK A;  1CJK B;  1KVJ A;  2CDR B;  3C14 A;  4KKO A;  3QGH A;  3HVT B;  3CVK A;  2IJR A;  2W25 A;  2D3Z A;  3GYN A;  2QIF A;  1HNZ J;  4OHZ A;  1B64 A;  2XY6 A;  2V2Q A;  1N32 F;  3LAM A;  1RUS A;  4FYX B;  2I6W A;  5IT0 A;  2WOM B;  3HHE A;  2B0G A;  1TEL A;  4O0I A;  3HKZ D;  2DRD A;  2IYG A;  1UAW A;  2VG6 A;  1TL7 B;  1A7G E;  3KNA A;  5C25 B;  3G8S A;  1DQA A;  1S6U A;  3BO2 A;  4NYP A;  1F6T A;  2E5L F;  2CPI A;  2DNY A;  4IH6 A;  1MN9 A;  2Q1L A;  4B9U A;  3CCV S;  2A18 A;  2CWK A;  3GYG A;  2YWW A;  3GON A;  4JI7 F;  3GJR B;  3N5B A;  2AX1 A;  3IXQ A;  3QRP A;  2DH7 A;  4ZCI A;  3GR0 A;  4NEZ A;  4JI3 F;  3KMS A;  1G1X A;  1XMQ F;  3MD1 A;  2RUS A;  3IBW A;  2WON A;  2RQ4 A;  1LWF B;  1NDK A;  5IZH A;  1C3G A;  3JB9 k;  1OIA A;  2FLP A;  4OYP A;  1NBE B;  5IT9 Y;  3S01 A;  3M2V B;  3R5A A;  1S99 A;  3K7R A;  3EZO A;  1D09 B;  1HI0 P;  3TVY A;  2QA4 G;  1T05 A;  2JZ5 A;  3VAK A;  4ALZ A;  2FZC B;  8ATC B;  1U1P A;  3QAT A;  4EZ9 A;  2V8H A;  4RPF A;  4OMF G;  1TV6 A;  2LQJ A;  1BWE A;  5GAH U;  3M1V B;  3CJK B;  2HNZ B;  3OFE A;  2MSS A;  3CO9 A;  1GTH A;  3LPY A;  2LMI A;  4CZC A;  2XI2 A;  4QWD A;  4NYO A;  5KFS A;  1HBO B;  1RAE B;  5KAK A;  1NB7 A;  2POK A;  2D9P A;  1T9W A;  3E01 B;  3AD9 C;  2DKO B;  3GTY X;  1N6Q A;  2BAN A;  1HQE B;  3K57 A;  4B3O A;  5B0E A;  4DR2 F;  2W9B B;  3KHL A;  3N4W A;  3PR5 B;  2QRR A;  1JLQ B;  2W2M P;  1VMB A;  2AJ2 A;  2B43 A;  4C8L A;  2EVZ A;  3D67 A;  1GXT A;  2KT5 A;  4IH5 A;  3TX0 A;  2FY8 A;  4AT1 B;  3LTO A;  4UUX A;  2HBZ B;  4Y28 C;  4J90 A;  3SI8 A;  3KK1 B;  4NCG A;  2P9E A;  3W2W B;  4CO4 A;  5THW A;  4IOA Q;  2OEJ A;  3D28 A;  2WW4 A;  2XMT A;  5CHC B;  3PR4 A;  1SL1 A;  4ZLP A;  3M6X A;  3DMJ B;  4I6Y A;  3TEG A;  2XHC A;  4ECY A;  4JP8 A;  4NXN F;  1NJY A;  4MYU A;  3JXO A;  3HK2 A;  2ZKU A;  4OZ1 A;  5AXK A;  1WHX A;  1NAQ A;  4WYL A;  4FF4 A;  1YJW S;  1CQN A;  3ZZU A;  3SQO P;  3D0I E;  4WU2 A;  1Q82 T;  2KM8 B;  2BDP A;  5DDQ C;  1VIX A;  3DRS B;  4WU3 A;  3A8J A;  3Q23 A;  3TRG A;  5A6P A;  4ZS6 A;  3I9Z A;  3HPO A;  1FWK A;  1TFW A;  3UVJ B;  2A2C A;  2HLT A;  3OLA A;  3T5J A;  1Q81 T;  3G8T A;  2MKI A;  3FNN A;  3NWR A;  3GPA A;  2ZWP A;  3IN5 A;  3MZI A;  1WEX A;  1XTZ A;  3LP1 B;  4ZVH A;  3D4J A;  4NLW A;  1RCX B;  1CJT A;  4YOE A;  1HQU A;  5K8P A;  5GME A;  4ZVF A;  2E9R X;  1ZBT A;  1BY9 A;  2G0C A;  2OGU A;  2VPY B;  2IM1 A;  3NGR A;  1DZ5 A;  1NND A;  3IBF B;  3CT9 A;  5I42 B;  3DC2 A;  3QSY B;  3Q24 A;  4K2J A;  5LL6 d;  4OYO A;  2ATL A;  1SQF A;  4OV1 A;  4IRD A;  5G0R A;  2GNK A;  4DPT A;  4B3T J;  2F3J A;  2CA9 A;  5EX0 A;  3TUJ C;  3TA0 A;  1FWP A;  5A0Y A;  2HBY B;  1M1K T;  2VBX A;  1T02 A;  2M7S A;  3C15 B;  4MIW A;  2HS3 A;  2BJ3 A;  3FDS A;  2XMW A;  2C22 A;  1NK7 A;  4AXJ A;  3K5O A;  4QR2 A;  3TAR A;  1RT2 A;  3EX7 B;  1FTC A;  4NWB A;  2R7W A;  1VGY A;  1UZH A;  3W66 A;  4FF2 A;  3LA0 A;  1MRO A;  3D1O A;  1PC5 A;  1VQS A;  5ETK A;  2F63 A;  1RHR B;  2ZZT A;  4JV1 A;  2FB0 A;  4JBC A;  1ITP A;  1CJU B;  2CQI A;  3US5 A;  3BBF A;  4MKA A;  2RQM A;  5BXI A;  4R0J A;  2PDA A;  4HH1 A;  2LXI A;  3QZ7 A;  2ZUA A;  1R0A A;  2OSR A;  3QT8 A;  1U0H A;  4C8O A;  3DRR B;  2F4V J;  4KHP J;  3SBM A;  1HBM B;  2HNY B;  1TUW A;  2K8G A;  5AXN A;  4PR6 A;  3CIM A;  1S5Z A;  1SXL A;  3TZZ A;  2KXH A;  3K89 A;  3MEE B;  4QCL A;  4NML A;  4L75 A;  1N8R T;  2PO4 A;  4ILL A;  2DNP A;  2H65 B;  5KG3 A;  3U7J A;  2I38 A;  3R7S B;  4IQX A;  5CCM A;  4LF4 F;  4DQP A;  3TA2 A;  2C3Y A;  3N0V A;  4DDF A;  3HJV A;  4F2R A;  3BN4 A;  5HQ8 A;  2ADB A;  2ZC3 A;  1F9H A;  4X65 J;  1XC9 A;  4KGV B;  5GAG I;  4ZIV A;  4DL3 A;  3NOC A;  1YRT A;  3MMC B;  3MUR P;  4I1T A;  1VQ4 S;  3OJS A;  4Q44 A;  2E9Z A;  2R7Q A;  3W61 A;  3BR8 A;  4P74 A;  1PC4 A;  1N5T A;  1S1W B;  2OO4 A;  2OEL A;  3MMB A;  4MAK A;  5G4D A;  4XPE A;  4MFB B;  2AGP A;  1GMV A;  3MAA B;  3SXL A;  2E1A A;  5SZT A;  3TR5 A;  2COL A;  1UPP A;  4JI1 J;  2RRN A;  5ETN A;  1Y11 A;  5ETL A;  3A1Y G;  3I4H X;  5KFG A;  4JV5 F;  3HHL A;  3Q83 A;  1LQ9 A;  2Y0B B;  1ZM2 A;  3BQ1 A;  3DOK A;  1L5U A;  2HVD A;  4QJV A;  1LEO A;  3J7A N;  4J37 A;  2KI2 A;  2RUG A;  3P8B B;  4PYA A;  2UP1 A;  1FKP B;  1RKI A;  3N01 A;  4ZP7 A;  4IO9 Q;  3GCX P;  1YJN S;  2FJE B;  2L9W A;  2DIU A;  2BE2 A;  2AF6 A;  4L3N A;  3BBC A;  1RK8 A;  4PQA A;  3U02 A;  4CO2 A;  1T11 A;  1WOR A;  3G86 A;  3CJ0 A;  1F2H A;  8RUC A;  2ZH5 A;  5GAE U;  3D54 A;  1RAB B;  3GSD A;  1AFJ A;  1OY9 A;  2HKE A;  4ZDN A;  3CC2 S;  2B9X A;  2QSW A;  4Q7A A;  1A6L A;  3H8Y A;  1NZA A;  3D66 A;  2PMZ D;  2CNL B;  4FYV B;  1S4F A;  1DHM A;  3T1Y F;  3QJJ A;  1VQL S;  2JRR A;  4P2M A;  1VRU B;  4ZIW A;  1I3O B;  1Q4R A;  3A3O B;  3AQP A;  4RNO A;  2J0S D;  3I38 A;  4B17 A;  5KT6 A;  3RU0 A;  2CQB A;  4DPX A;  5DRK A;  4Y00 A;  3G6E S;  3IG1 B;  3H7H B;  4FXD A;  1XNQ F;  2XWY A;  3BBB A;  2ZD1 B;  2ZDP A;  4U7C A;  4DWI A;  1ARO P;  1S6Q B;  5M2P A;  2VG7 A;  3M8Q B;  2F65 A;  3GP9 A;  1JK9 B;  3H2V E;  3DRP A;  2YPY A;  2HVI A;  1AFI A;  3KG4 A;  1BQM A;  1SIZ A;  1NHK L;  3CDU A;  5HP1 A;  5AE3 A;  3PJ9 A;  3CD0 A;  5D8H B;  3MOJ B;  2HHH J;  1UFK A;  1J5O B;  2C2Z B;  2R2U A;  2DGX A;  4NLV A;  1FRM A;  2ROE A;  6FD1 A;  1WEZ A;  2JEJ A;  2ZBP A;  2EFP A;  4UTG A;  2AJ1 A;  4ZVO B;  4RKU C;  4UQT A;  4IDK A;  2V9W A;  3KJV B;  3IO1 A;  3HDS A;  2NUH A;  2OEM A;  4FNH A;  3LH2 S;  2M88 A;  2V69 A;  4M5H A;  2AZ1 A;  2FDN A;  3IGV A;  1ZZN A;  1BQX A;  3E3X A;  4FXW A;  1Q8I A;  1F0X A;  3KXD A;  3PG9 A;  4M94 A;  3J7Y I;  2BJD A;  3C46 A;  4K4X A;  1S4E A;  2P5V A;  4DUZ J;  4HAC A;  1XK8 A;  2NXE A;  4PUO A;  2UZA A;  2QEX S;  2L9D A;  5HSP A;  2GVZ B;  4ID5 B;  3QYY A;  2HIQ A;  2BEF A;  2J6T A;  3EE3 A;  4F04 B;  3AJ1 A;  4D3H A;  4WXO A;  5A76 A;  1H7X A;  4F25 A;  4H4M B;  1D9D A;  1EZZ B;  2BKO A;  2FLO A;  3D0G E;  2Y9H A;  3T6B A;  5KFQ A;  3C6U A;  2E29 A;  5A8R B;  2GMH A;  2GJI A;  2UXC J;  3KLE A;  2DO4 A;  2FZG B;  1QAY A;  5F8H A;  3Q8P B;  4J91 A;  1H38 A;  1W7W A;  2YNG A;  4TY8 B;  2RRA A;  4X4V A;  2FIU A;  4PXB A;  1NJI T;  2VKR A;  2UXD J;  1RA6 A;  2VOP A;  1U6Z A;  3VV2 B;  2DR9 A;  1UVI A;  1RT1 A;  4J5O A;  3GIL A;  1S6P B;  1O0P A;  1FNO A;  1L3K A;  4RNH A;  1B0V A;  3KLF B;  4G1Q B;  4QWB A;  1FXD A;  3JQM A;  4CDI A;  3GJS B;  5IWA F;  1XEZ A;  2BJE A;  4P52 A;  4PAB A;  1N0V C;  1QDU B;  4F36 A;  4OI4 A;  1SUQ A;  1WC6 A;  2Y1I A;  3PTW A;  2XSJ A;  1T3N A;  1UMJ A;  3SDE B;  4TLQ A;  5L38 A;  3DGV A;  4Q2M A;  3L4B C;  3OL9 A;  4LRE A;  3HX9 A;  4LF2 A;  5B08 A;  4A8M P;  3L09 A;  1U2F A;  1TKD A;  1T8E A;  4MH8 A;  3V6K A;  3TZX A;  4UST A;  4KIA A;  1SB6 A;  1TAU A;  1CC8 A;  7AT1 B;  3QIP B;  1SKU B;  2RDI A;  1AXQ A;  2V2V A;  2AYB A;  3MGJ A;  2LEA A;  1UJ5 A;  1Y7P A;  2B9W A;  2HHS A;  1GX5 A;  1Z1Z A;  1U02 A;  1XMO J;  1H0H B;  5GAD U;  4XK8 C;  2C2D A;  2LDI A;  4YDX A;  1H2V Z;  3TOQ A;  2QV6 A;  5A8K A;  4QPX A;  1XBW A;  1SPB P;  3AOC A;  2E1C A;  4IUF A;  3IRW P;  4Q5V A;  4L74 A;  3CNQ P;  1MWZ A;  2B5J A;  3GE9 A;  1KON A;  4WP3 A;  2MEW A;  1Q79 A;  3LO3 A;  4M95 A;  3ZTS A;  4ZPW R;  2JEI A;  2J0X A;  3KHH A;  2WK4 A;  3FC9 A;  5J2P B;  1U8W A;  4I68 A;  5HLF A;  4KAI A;  4ECV A;  5A8W A;  4KYZ A;  3QLH A;  4ED8 A;  3UDE A;  5CD4 H;  1UPM B;  3BF4 A;  5FDL B;  3IS9 B;  2FPH X;  2XLJ A;  3V6H A;  2CYY A;  2WB1 D;  3IC1 A;  3RRH A;  2Q66 A;  3OVA A;  1MML A;  1NM2 A;  4NXM J;  3GG1 A;  3I82 A;  1LFP A;  3I5B A;  4OYZ A;  4B3M F;  3ZNU A;  2V4J A;  3T3F A;  1GEH A;  4LMZ A;  2PD1 A;  1VJQ A;  2GO8 A;  3T1H F;  4XDD A;  5HBM A;  1HWK A;  2IVY A;  4TYB A;  1N5S A;  2E1R A;  4KKO B;  1TUV A;  2JLE A;  4PG7 A;  1Y3J A;  4FF3 A;  2W7P A;  3K17 A;  3EXC X;  2DR6 A;  1QAI A;  4O4G A;  1WF1 A;  2JC1 A;  3NGK A;  1N32 J;  4DLG A;  3PJX A;  3F56 A;  3MDF A;  3PEJ A;  2ZBI A;  3HT3 A;  2LEB A;  2D3O 1;  1ULR A;  3KJN B;  5DJB A;  1OY8 A;  4DOZ A;  2VG6 B;  1IR0 A;  5IC6 B;  1RT6 A;  2E5L J;  3RTV A;  4WBF A;  2ASJ A;  3P5B P;  3KUG A;  1A0O B;  4FS2 A;  4LF9 F;  2VDI A;  4RW8 A;  4JI7 J;  1HI1 A;  3MR3 A;  4RBU A;  2KFZ A;  1JLG B;  2DNH A;  2KVQ E;  2XMU A;  4JI3 J;  5E41 A;  2GHP A;  2AU0 A;  1ZYQ A;  2PII A;  2LQ9 A;  1U26 A;  2WON B;  1XER A;  2KXF A;  3ONQ A;  2O5D A;  4RNM A;  2CIM A;  2VF3 A;  1QSL A;  2FVR A;  3BGR A;  3W5Y A;  1NLK L;  1K1Q A;  1CBK A;  1EKR A;  4YR2 A;  4CNZ A;  3DDN A;  2VD3 A;  2DNK A;  5K9F A;  1S49 A;  3V81 A;  4ILR A;  3I6P A;  4C3K A;  3O8W A;  2VG5 A;  1T05 B;  4JOU A;  3TVZ A;  2V63 A;  1ZTT A;  3FBC A;  3BYR A;  3HHL C;  4P6Q A;  5L1J A;  1TV6 B;  3W65 A;  5F3T A;  2KB2 A;  3UWT A;  2DHS A;  4MT1 A;  2PSZ A;  2RIJ A;  3MHY A;  4Y65 A;  4HDH A;  1OYD A;  2OTL S;  3NGU A;  2OLW A;  1G2E A;  2GW8 A;  2EKN A;  4RW4 A;  3HI9 A;  2V8G A;  1NSP A;  1L3V A;  1ZAW A;  2NSC A;  1O6X A;  1XAO A;  2AMC B;  2BAN B;  4B3O B;  3AB2 B;  1E6Y A;  1N33 F;  1WSR A;  4F50 A;  4DR4 F;  5K14 A;  4J80 A;  2IJF A;  3BGU A;  3SCL E;  4FZV A;  2IA6 A;  1QM9 A;  2MQN A;  2AGQ A;  2AYM A;  4J9V A;  4LSN A;  5IQQ A;  4NCG B;  4Y6I A;  2CQ3 A;  1EQ0 A;  2OKQ A;  1RBL A;  3PX0 A;  2HBR B;  3CO0 P;  4K4U A;  1YLX A;  4NXN J;  4B3S F;  4U6P A;  1ZAX A;  1SJ1 A;  5T7L B;  2DEJ A;  2YKN B;  5CCL A;  1RTZ A;  2YKP A;  1CSJ A;  1BLU A;  3VCD A;  1IKX A;  4P7T A;  4LBH A;  4QIG A;  5AT1 B;  3E8O A;  3QWP A;  4TU8 A;  2OEK A;  5CA5 A;  1B99 A;  2JNJ A;  2EC0 A;  3KJQ B;  2QZ8 A;  1VRT B;  2NS1 B;  2D3O R;  1VHF A;  2DHG A;  3A3N B;  3K0J A;  4Y2A A;  3HSJ A;  2ZM6 J;  3CDA A;  1X4B A;  5L1I A;  2E1M C;  2Q3P A;  2VPZ B;  2XLI A;  5LXR A;  3U1N A;  1CJT B;  3PRB A;  1HQU B;  2R2R A;  5KG5 A;  1WOS A;  3G87 A;  2GQQ A;  2YNF A;  1ROF A;  2VH7 A;  4HHH A;  3I31 A;  5KG7 A;  2WW8 A;  2IRU A;  5KFY A;  4F26 A;  1UEK A;  2BV3 A;  2DGS A;  4DEZ A;  1K73 T;  1Q1K A;  1RAI B;  3CC7 S;  2KN4 A;  5C7P A;  4EBE A;  4I64 A;  5DZ7 A;  5G0R B;  2FUG 9;  2AJ0 A;  4MIB A;  3RAX A;  4J9P A;  5EWG A;  3M30 A;  4QU7 A;  3PW0 A;  3AGX A;  1KR4 A;  1RT7 B;  4TQR A;  2ADC A;  4RW9 A;  3IR7 B;  3QSI A;  9RUB A;  5A0Y B;  2M4M A;  4TN2 A;  5L1K A;  4GKK F;  1FDB A;  2X1A A;  4HYK A;  1YZ6 A;  1M5H A;  4DS4 A;  5HO4 A;  4OFZ A;  2WBR A;  1KQK A;  4OJ3 A;  3MED B;  3L7O A;  4LFB F;  1RT2 B;  3Q8U A;  1PYT A;  2W9C A;  4LSZ B;  2C3U A;  3TNV A;  1FT8 A;  4F4W A;  5ETV A;  1KBR A;  1S10 A;  4CCH A;  4C97 A;  4L72 B;  3MEC A;  4BWJ A;  4WFB Q;  5KFL A;  4N56 A;  3B78 A;  4ECT A;  2RDD A;  4PEO A;  5KT5 A;  4AND A;  4MKV A;  3E2E A;  1R0A B;  5C2G A;  2C3P A;  3J81 j;  1SVD A;  4NLR A;  5K8M A;  4RZR A;  3MAQ A;  2AZ3 A;  2GML A;  2WTF A;  3CJQ A;  2QL7 B;  1EET B;  3ZFV A;  1TL4 A;  1FA0 A;  4DL6 A;  3J7A 1;  2EFV A;  1FJC A;  1M5S A;  3HFV A;  2JVO A;  1S97 A;  3A13 A;  4EEY A;  2F9J A;  1Z2L A;  4ZPT R;  3DLJ A;  2L3M A;  5KFE A;  2LVW A;  3UNG C;  4DR1 F;  3FRZ A;  3VAJ A;  4LF6 F;  3AA9 A;  1WC4 A;  2HS4 A;  2ZOF A;  1ZS6 A;  2Y1R I;  4X2B A;  1YBA A;  2FHO B;  2Z56 B;  4K5S A;  3H90 A;  3K5M A;  3WIU A;  3W7B A;  4ZA1 A;  2PI4 A;  4RBV A;  2BUN A;  2F8E X;  3EDQ B;  2DNR A;  3AQO A;  5ETR A;  1OSD A;  1IR2 A;  2V8D A;  3R5J B;  3I4P A;  4W98 A;  4RW7 A;  3EVW A;  5EUH A;  4URG A;  1PG5 B;  1N0U A;  1W25 A;  3FCW A;  4BDP A;  4C98 A;  1U1N A;  4DUT A;  5K20 B;  4JV5 J;  3CC4 S;  2IBO A;  3HHL B;  2RD5 C;  2H4Y B;  1YSJ A;  4KPY A;  3RBE A;  3DI6 B;  3DOK B;  2WZ1 A;  4KB7 A;  5K8N A;  1LNQ A;  5F8L A;  2DT9 A;  1YZ7 A;  1AT1 B;  3LWL A;  2MB0 B;  2VKZ G;  2R7S A;  1WEL A;  3BH6 B;  4XPC A;  5JJB A;  2CQP A;  1F5C A;  3CJS A;  4RUB A;  2BE2 B;  2NXJ A;  3VQT A;  4WYW A;  5RUB A;  3MCN A;  4ITS A;  2YNH A;  4ECR A;  1I51 B;  2BYC A;  2DGW A;  3LAN A;  2G9O A;  4DF4 A;  4AL6 A;  2RS8 A;  3V4M A;  1QY7 A;  3BS9 A;  3T1Y J;  1RCO B;  4BLG A;  1CUL B;  4PKD B;  3B6B A;  1PSD A;  2CJY B;  2KDO A;  2RSQ A;  4F4X A;  3JQK A;  3R27 A;  5LOQ A;  4KHR A;  1Q16 B;  2HUR A;  2XMV A;  3L3C A;  1TKX A;  4LIR A;  3LP0 B;  1YJV A;  1HPZ A;  3M8Y A;  3R9L A;  2CWX A;  2I8E A;  1RWU A;  2FJV A;  4NL5 A;  1XNQ J;  2R2S A;  2DH9 A;  2ZHA A;  4DJB A;  2RU3 A;  1REV A;  3AKO B;  2QL5 B;  3OTE A;  2LU1 A;  4UOC A;  2VG7 B;  4HI1 A;  1RWK B;  3VGT A;  2GCF A;  1HBU A;  3DRP B;  4A48 A;  1BQM B;  5HMW A;  3IAM 9;  5HP1 B;  4Y2M A;  2WCX A;  2QGF B;  3G8Q A;  4YS2 A;  3FJ2 A;  5DG8 A;  3J7Y U;  1HWU A;  4A47 A;  4B08 A;  3ET6 A;  1RWM B;  2OIH A;  4L73 A;  1NKB A;  4OYI A;  4F3Q A;  3M2U A;  2CPX A;  3D6M B;  3M6W A;  4FKY A;  2H3E B;  2IM3 A;  5D3G A;  4JI4 J;  3Q8Q B;  1U1R A;  2QSF A;  1X4E A;  4J7C A;  5DDO C;  2EBE A;  1G3O A;  2VDH A;  3TAM A;  2AKW B;  2HAI A;  2MQP A;  4N77 A;  2UUA F;  2MZJ A;  1QD1 A;  2QMX A;  3TJ9 A;  5E0O A;  2CNK B;  1S59 A;  3PW4 A;  2HAF A;  2D3U A;  3V6J A;  1BD6 A;  3R6G B;  4RJV A;  1RT5 A;  2V50 A;  4FVM A;  4PUO B;  3FEZ A;  4O3Q A;  3THP A;  4IYQ A;  1RB0 A;  2MKK A;  5ITH A;  3GCW P;  1XIQ A;  3CF5 Q;  2FY1 A;  1Y5N B;  5J1P A;  1IKY B;  1I6J A;  1FNM A;  3ETO A;  1IBL F;  4DX8 H;  1T9U A;  3LPE A;  3FFI B;  3C6U B;  1O8B A;  2RHQ B;  3KLE B;  1URR A;  3DDI A;  1DBD A;  4P73 A;  4QQB A;  5F8J A;  6FDR A;  4ZVG A;  4P2F A;  4A8X A;  3HSG A;  2DXF A;  2YNG B;  1Y3K A;  1K1S A;  3M8R A;  2CDQ A;  2EBG A;  4DPO A;  4WP9 A;  2FJB B;  3P6Y C;  3R5D A;  4JI0 F;  3DRX A;  1NPP A;  1RT1 B;  3MM8 A;  4Y0F A;  1FRI A;  1HD1 A;  3ZZT A;  2LP4 A;  3POT A;  3JSB A;  3H42 A;  3OXF A;  4AL7 A;  1K47 A;  2XS5 A;  1XJW B;  3CME S;  4GC6 A;  2AW0 A;  1J2V A;  5IWA J;  2ZH2 A;  2MST A;  4MK9 A;  4KFB B;  3AAW B;  2LLZ A;  4U8Y A;  1SUQ B;  2XSJ B;  4U7U K;  2Z2Y B;  4R5P B;  3CD5 A;  3FBB A;  3O3L A;  3UI3 A;  2DGV A;  4WJB A;  2D74 B;  3Q89 A;  5KFX A;  3P5T L;  1JLE A;  1VBY A;  2K3K A;  2Y8W A;  5D0H A;  4DPY A;  3X3U A;  2MXY A;  4DSI A;  1UFW A;  1DRZ A;  1AZS B;  4CLY A;  1EX8 A;  1FD2 A;  1LXN A;  4I2Q A;  1NSQ A;  4D3G A;  3MCM A;  2CPY A;  3BSA A;  3NMR A;  2UVV A;  4YEA A;  4AE5 A;  2JRS A;  2XMK A;  2ZHB A;  3KK2 A;  2DR7 A;  2BQ3 A;  2JFD A;  3NNC A;  3CIZ A;  5A8K B;  3OUY A; 
#chains in the Genus database with same CATH homology
 3NXZ A;  4J80 A;  1GMW A;  3LA0 A;  3TJ8 A;  3NY0 A;  3I38 A;  3TJA A;  3TJ9 A;  1GMW D;  3LZ8 A;  1XAO A;  1GMV A;  1GMU A;  2QLD A;  1EB0 A;  1EAR A;  3L9Z A;  2B26 A;  1NLT A;  2HFV A;  3AGX A;  3AGZ A;  3AGY A;  4L3K A;  2Q2G A;  1C3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...