3LA1A

High resolution crystal structure of cypet mutant a167i
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
236
structure length
235
Chain Sequence
MVSKGEELFGGIVPILVELEGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSVMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNITDGSVQLADHYQQNTPIGDGPVILPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Crystal Structure of CyPet
rcsb
source organism Aequorea victoria
molecule tags Fluorescent protein
total genus 70
structure length 235
sequence length 236
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3la1A00
3PJ5A 3P8UA 2ARLA 2YE1A 3BXAA 3CFAA 1RMOA 4DXOA 3WLDA 3M22A 4R6DA 4W7AA 3EK8A 3ZULA 1EMGA 5H88A 4IK5A 1EMMA 4KF5A 3SRYA 4LJDC 3CFHA 3DQDA 1RMMA 3SVEA 2QU1A 5HZOA 3DQOA 1MYWA 3ST2A 2QLGA 2G3OA 3GEXA 3AI4A 5J2OA 2EMDA 5HZSA 3DQ1A 4TZAA 2Z6ZA 1QYQA 2VVHA 4DXIA 5HGEA 4Q9XA 4R6BA 4JC2A 2DDDA 4JGEA 2HPWA 3DQ2A 2A48A 2DUEA 2EMNA 3U8PA 3ZTFA 4IK8A 2WIQA 3DQ3A 5DY6A 3NT3A 1HCJA 3DPXA 3TMTA 4P1QA 3OSQA 4LJBA 3CBEA 2IOVA 3DQMA 5AQBB 2QLEA 4Q9WA 1MOVA 4KAGA 1Q4CA 4W74A 2HGYA 2WHTA 1YFPA 4XOVA 2GX0A 4GF6B 3S05A 2G6XA 3SVDA 3GB3A 2WISA 4W73A 5HBDA 2H5QA 1XAEA 4W6AA 1JC0A 2H9WA 2A50B 4DXQA 3VK1A 2OKYA 2ICRA 3LVCA 2DUIA 3SVRA 4Q7RA 5EB6A 2H5PA 3DQIA 4Q7UA 4AR7A 2OJKA 3CD9A 1XMZA 2GW3A 3RWAA 4U2VA 3SSHA 4OHSA 2WHUA 4UTSA 4W6FA 2B3PA 2ZMWA 1QYOA 2Q57A 4W6BA 2QLIA 2VVJA 1BFPA 4L12A 4ZB1A 2AWJA 2ZO7A 1RM9A 2HQZA 2HQKA 4J8AA 5DPHA 1ZUXA 3DQLA 3PIBA 2DUHA 4ORNA 3LA1A 3SV5A 2DDCA 4H47A 4W6DA 1YHHA 3U0MA 2IB5A 2Z6YA 5DPGA 3DQNA 4HQ8A 5FHVA 4EDOA 5DTLA 1KYPA 3E5TA 3EK4A 4DXMA 2AWLA 4W7CA 3SVCA 4ZF5A 4LQUA 3ST4A 4IK9A 1KP5A 1GGXA 2ZO6A 4XGYA 4DKNA 4EDSA 3K1KA 1JBYA 2VZXA 4W6CA 1EMKA 4KW9A 4W76A 3EVVA 1KYRA 4L1IA 4H3NA 5DQMA 1Q4DA 3U8AA 4JFGA 4DXPA 3M24A 4HVFA 1H6RA 3ADFA 4W7DA 4W6UA 2OTBA 2Y0GA 5EJUA 1RRXA 2HFCA 1CV7A 4HQ9A 4AS8A 1EMCA 3LF4B 4ZBLA 2HGDA 2QRFA 3U0LA 3WCKA 4W72A 2G6EA 4I2YA 3SG2A 2G6YA 4HE4A 3TMRA 2YFPA 2VADA 4RTCA 5DRFA 4ZINA 4NWSA 4B30A 1YHGA 3CFFA 3DPWA 3NEDA 1F09A 3MGFA 4IZNA 2H6VA 5H89A 4ZIOA 2POXA 3AKOA 4IK1A 4H48A 3KCSA 5KTGA 4W6GA 4N3DA 3NF0A 2HRSA 2OKWA 4KW8A 5BTTB 2C9IA 3A8SA 2DUFA 4LJDA 4P76A 5EXCI 4W7XA 3EVRA 4LQTA 1EMFA 5FVGA 4RYWA 1S6ZA 1JBZA 1OXDA 4W6HA 1C4FA 2V4EB 2PXSA 3RWTA 5DU0A 4B30B 3SVNA 4JEOA 5EHUA 3SG6A 4W7RA 1W7UA 4H3MA 4EULA 2Z1OA 4PPKA 1QXTA 5DQBA 2A47A 1ZGOA 3SSPA 3P28A 1YJFA 3PJBA 4JF9A 3SVBA 1Q73A 3O78A 4KEXA 3CGLA 4KF5C 3SS0A 1HUYA 3LVDA 1XSSA 3H1OA 1XQMA 3E5WA 3EVUA 3GL4A 3WLCA 3GJ1A 4B5YA 2VVIA 4W6PA 3SSLA 1EMLA 2QZ0A 4IK4A 3BX9A 3PJ7A 2DUGA 2BTJA 3IR8A 4OJ0A 2O2BA 4W69A 2GW4B 1YJ2A 1QY3A 1RMPA 3DQ7A 4JRBA 1QYFA 1YZWA 4OGSA 3SSTA 5LTRA 3CD1A 3W1CA 1EMEA 3V3DA 3I19A 4W6KA 4PFEA 4EMQA 2EMOA 3DQ8A 3GJ2A 4Z4MA 4LW5A 4BDUA 2C9JA 3EK7A 2PXWA 2YE0A 1F0BA 2A54B 2WHSA 4W6JA 2O24A 4Z4KA 4KGEA 1YHIA 4W7FA 4W6NA 5HW9A 1Q4BA 2B3QA 4W7EA 3DQHA 3EVPA 3U0KA 1KYSA 4GOBA 2Q6PA 3ED8A 4J88A 4Q7TA 2QLHA 5LTQA 2FWQA 3DQ9A 2O29A 3VICA 1UISA 4RYSA 4W6SA 2H5OA 5BT0A 2DD9A 2H8QA 2DD7A 4W6RA 5HZUA 2AHAA 5BTTA 5DPIA 5F9GA 3DQFA 2Z6XA 3AI5A 2G16B 3SG7A 2QT2A 3LVAA 2FL1A 2V4EA 1W7TA 4J89A 5EXUA 2VAEA 4OQWA 1OXEA 3ST0A 4W6OA 5EBJA 4GESB 1Q4EA 4DKMA 4ZF3A 3DQJA 2OTEA 3BXBA 3LF3A 3NT9A 1JC1A 3CB9A 2AWMA 4DXNA 4LJCA 3SSVA 3KCTA 3DQAA 3G9AA 3H1RA 2A53B 1H4UA 1W7SA 3LSAA 3W1DA 2GX2A 5FVIA 4ZF4A 2A52B 4W77A 3SG3A 3SG4A 2QLGB 3ST3A 4L13A 4XVPA 4W6MA 1OXFA 2JADA 3DQUA 2AH8A 4TZGA 3VHTA 2WURA 3O77A 1XA9A 3DQ4A 1Z1QA 2G3DB 3NEZA 4KW4A 5EB7A 5BQLA 5LTPA 5H87A 5DTXA 5DRGA 5EXBA 3DQKA 4EN1A 4OY4A 3ZUJA 3EKJA 4XOWA 1Z1PA 3DPZA 1GL4A 3OGOA 3BXCA 4HQCA 4ZFSA 2IE2A 2IB6A 5LK4A 3SVUA 1MOUA 4H3LA 2YDZA 3E5VA 2HCGA 1EMAA 1EMBA 3LS3A 5HZTA 2A46A 2H5RA 2WSOA 1G7KA 2A56B 3OSRA 3SSKA 4IK3A 1GFLA 3SVOA 2FZUA 2G2SB 2OGRA 3SG5A 4ANJA 3SSYA 1ZGQA 3VHTB 3DQ5A 1ZGPA 4W6IA 5DTYA 3SVSA 3ZUFA 3UG0A 3UFZA 2WSNA 4KPIA 3DQEA 4W6TA 4KGFA 4W75A 3DQCA 4KA9A 2G5ZB 5FVFA 2ZMUA 3U8CA 2P4MA 2V4EC 5DTZA 3U0NA 2HJOA 3EKHA 4KF4A 4XL5A 3DQ6A 4PPJA 5DPJA 2RH7A 2AWKA 5T3IA 4PPLA 1B9CA 3IP2A 1Q4AA 4W6LA
chains in the Genus database with same CATH superfamily
3PJ5A 3P8UA 2ARLA 2YE1A 3BXAA 3CFAA 1RMOA 4DXOA 3WLDA 3M22A 4R6DA 4W7AA 3EK8A 3ZULA 1EMGA 5H88A 4IK5A 1EMMA 4KF5A 3SRYA 4LJDC 3CFHA 3DQDA 1RMMA 3SVEA 2QU1A 5HZOA 3DQOA 1MYWA 3ST2A 2QLGA 2G3OA 3GEXA 3AI4A 5J2OA 2EMDA 5HZSA 3DQ1A 4TZAA 2Z6ZA 1QYQA 2VVHA 4DXIA 5HGEA 4Q9XA 4R6BA 4JC2A 2DDDA 4JGEA 2HPWA 3DQ2A 2A48A 2DUEA 2EMNA 3U8PA 3ZTFA 4IK8A 2WIQA 3DQ3A 5DY6A 3NT3A 1HCJA 3DPXA 3TMTA 4P1QA 3OSQA 4LJBA 3CBEA 2IOVA 3DQMA 5AQBB 2QLEA 4Q9WA 1MOVA 4KAGA 1Q4CA 4W74A 2HGYA 2WHTA 1YFPA 4XOVA 2GX0A 4GF6B 3S05A 2G6XA 3SVDA 3GB3A 2WISA 4W73A 5HBDA 2H5QA 1XAEA 4W6AA 1JC0A 2H9WA 2A50B 4DXQA 3VK1A 2OKYA 2ICRA 3LVCA 2DUIA 3SVRA 4Q7RA 5EB6A 2H5PA 3DQIA 4Q7UA 4AR7A 2OJKA 3CD9A 1XMZA 2GW3A 3RWAA 4U2VA 3SSHA 4OHSA 2WHUA 4UTSA 4W6FA 2B3PA 2ZMWA 1QYOA 2Q57A 4W6BA 2QLIA 2VVJA 1BFPA 4L12A 4ZB1A 2AWJA 2ZO7A 1RM9A 2HQZA 2HQKA 4J8AA 5DPHA 1ZUXA 3DQLA 3PIBA 2DUHA 4ORNA 3LA1A 3SV5A 2DDCA 4H47A 4W6DA 1YHHA 3U0MA 2IB5A 2Z6YA 5DPGA 3DQNA 4HQ8A 5FHVA 4EDOA 5DTLA 1KYPA 3E5TA 3EK4A 4DXMA 2AWLA 4W7CA 3SVCA 4ZF5A 4LQUA 3ST4A 4IK9A 1KP5A 1GGXA 2ZO6A 4XGYA 4DKNA 4EDSA 3K1KA 1JBYA 2VZXA 4W6CA 1EMKA 4KW9A 4W76A 3EVVA 1KYRA 4L1IA 4H3NA 5DQMA 1Q4DA 3U8AA 4JFGA 4DXPA 3M24A 4HVFA 1H6RA 3ADFA 4W7DA 4W6UA 2OTBA 2Y0GA 5EJUA 1RRXA 2HFCA 1CV7A 4HQ9A 4AS8A 1EMCA 3LF4B 4ZBLA 2HGDA 2QRFA 3U0LA 3WCKA 4W72A 2G6EA 4I2YA 3SG2A 2G6YA 4HE4A 3TMRA 2YFPA 2VADA 4RTCA 5DRFA 4ZINA 4NWSA 4B30A 1YHGA 3CFFA 3DPWA 3NEDA 1F09A 3MGFA 4IZNA 2H6VA 5H89A 4ZIOA 2POXA 3AKOA 4IK1A 4H48A 3KCSA 5KTGA 4W6GA 4N3DA 3NF0A 2HRSA 2OKWA 4KW8A 5BTTB 2C9IA 3A8SA 2DUFA 4LJDA 4P76A 5EXCI 4W7XA 3EVRA 4LQTA 1EMFA 5FVGA 4RYWA 1S6ZA 1JBZA 1OXDA 4W6HA 1C4FA 2V4EB 2PXSA 3RWTA 5DU0A 4B30B 3SVNA 4JEOA 5EHUA 3SG6A 4W7RA 1W7UA 4H3MA 4EULA 2Z1OA 4PPKA 1QXTA 5DQBA 2A47A 1ZGOA 3SSPA 3P28A 1YJFA 3PJBA 4JF9A 3SVBA 1Q73A 3O78A 4KEXA 3CGLA 4KF5C 3SS0A 1HUYA 3LVDA 1XSSA 3H1OA 1XQMA 3E5WA 3EVUA 3GL4A 3WLCA 3GJ1A 4B5YA 2VVIA 4W6PA 3SSLA 1EMLA 2QZ0A 4IK4A 3BX9A 3PJ7A 2DUGA 2BTJA 3IR8A 4OJ0A 2O2BA 4W69A 2GW4B 1YJ2A 1QY3A 1RMPA 3DQ7A 4JRBA 1QYFA 1YZWA 4OGSA 3SSTA 5LTRA 3CD1A 3W1CA 1EMEA 3V3DA 3I19A 4W6KA 4PFEA 4EMQA 2EMOA 3DQ8A 3GJ2A 4Z4MA 4LW5A 4BDUA 2C9JA 3EK7A 2PXWA 2YE0A 1F0BA 2A54B 2WHSA 4W6JA 2O24A 4Z4KA 4KGEA 1YHIA 4W7FA 4W6NA 5HW9A 1Q4BA 2B3QA 4W7EA 3DQHA 3EVPA 3U0KA 1KYSA 4GOBA 2Q6PA 3ED8A 4J88A 4Q7TA 2QLHA 5LTQA 2FWQA 3DQ9A 2O29A 3VICA 1UISA 4RYSA 4W6SA 2H5OA 5BT0A 2DD9A 2H8QA 2DD7A 4W6RA 5HZUA 2AHAA 5BTTA 5DPIA 5F9GA 3DQFA 2Z6XA 3AI5A 2G16B 3SG7A 2QT2A 3LVAA 2FL1A 2V4EA 1W7TA 4J89A 5EXUA 2VAEA 4OQWA 1OXEA 3ST0A 4W6OA 5EBJA 4GESB 1Q4EA 4DKMA 4ZF3A 3DQJA 2OTEA 3BXBA 3LF3A 3NT9A 1JC1A 3CB9A 2AWMA 4DXNA 4LJCA 3SSVA 3KCTA 3DQAA 3G9AA 3H1RA 2A53B 1H4UA 1W7SA 3LSAA 3W1DA 2GX2A 5FVIA 4ZF4A 2A52B 4W77A 3SG3A 3SG4A 2QLGB 3ST3A 4L13A 4XVPA 4W6MA 1OXFA 2JADA 3DQUA 2AH8A 4TZGA 3VHTA 2WURA 3O77A 1XA9A 3DQ4A 1Z1QA 2G3DB 3NEZA 4KW4A 5EB7A 5BQLA 5LTPA 5H87A 5DTXA 5DRGA 5EXBA 3DQKA 4EN1A 4OY4A 3ZUJA 3EKJA 4XOWA 1Z1PA 3DPZA 1GL4A 3OGOA 3BXCA 4HQCA 4ZFSA 2IE2A 2IB6A 5LK4A 3SVUA 1MOUA 4H3LA 2YDZA 3E5VA 2HCGA 1EMAA 1EMBA 3LS3A 5HZTA 2A46A 2H5RA 2WSOA 1G7KA 2A56B 3OSRA 3SSKA 4IK3A 1GFLA 3SVOA 2FZUA 2G2SB 2OGRA 3SG5A 4ANJA 3SSYA 1ZGQA 3VHTB 3DQ5A 1ZGPA 4W6IA 5DTYA 3SVSA 3ZUFA 3UG0A 3UFZA 2WSNA 4KPIA 3DQEA 4W6TA 4KGFA 4W75A 3DQCA 4KA9A 2G5ZB 5FVFA 2ZMUA 3U8CA 2P4MA 2V4EC 5DTZA 3U0NA 2HJOA 3EKHA 4KF4A 4XL5A 3DQ6A 4PPJA 5DPJA 2RH7A 2AWKA 5T3IA 4PPLA 1B9CA 3IP2A 1Q4AA 4W6LA
chains in the Genus database with same CATH topology
3PJ5A 3P8UA 2ARLA 2YE1A 3BXAA 3CFAA 1RMOA 4DXOA 3WLDA 3M22A 4R6DA 4W7AA 3EK8A 3ZULA 1EMGA 5H88A 4IK5A 1EMMA 4KF5A 3SRYA 4LJDC 3CFHA 3DQDA 1RMMA 3SVEA 2QU1A 5HZOA 3DQOA 1MYWA 3ST2A 2QLGA 2G3OA 3GEXA 3AI4A 5J2OA 2EMDA 5HZSA 3DQ1A 4TZAA 2Z6ZA 1QYQA 2VVHA 4DXIA 5HGEA 4Q9XA 4R6BA 4JC2A 2DDDA 4JGEA 2HPWA 3DQ2A 2A48A 2DUEA 2EMNA 3U8PA 3ZTFA 4IK8A 2WIQA 3DQ3A 5DY6A 3NT3A 1HCJA 3DPXA 3TMTA 4P1QA 3OSQA 4LJBA 3CBEA 2IOVA 3DQMA 5AQBB 2QLEA 4Q9WA 1MOVA 4KAGA 1Q4CA 4W74A 2HGYA 2WHTA 1YFPA 4XOVA 2GX0A 4GF6B 3S05A 2G6XA 3SVDA 3GB3A 2WISA 4W73A 5HBDA 2H5QA 1XAEA 4W6AA 1JC0A 2H9WA 2A50B 4DXQA 3VK1A 2OKYA 2ICRA 3LVCA 2DUIA 3SVRA 4Q7RA 5EB6A 2H5PA 3DQIA 4Q7UA 4AR7A 2OJKA 3CD9A 1XMZA 2GW3A 3RWAA 4U2VA 3SSHA 4OHSA 2WHUA 4UTSA 4W6FA 2B3PA 2ZMWA 1QYOA 2Q57A 4W6BA 2QLIA 2VVJA 1BFPA 4L12A 4ZB1A 2AWJA 2ZO7A 1RM9A 2HQZA 2HQKA 4J8AA 5DPHA 1ZUXA 3DQLA 3PIBA 2DUHA 4ORNA 3LA1A 3SV5A 2DDCA 4H47A 4W6DA 1YHHA 3U0MA 2IB5A 2Z6YA 5DPGA 3DQNA 4HQ8A 5FHVA 4EDOA 5DTLA 1KYPA 3E5TA 3EK4A 4DXMA 2AWLA 4W7CA 3SVCA 4ZF5A 4LQUA 3ST4A 4IK9A 1KP5A 1GGXA 2ZO6A 4XGYA 4DKNA 4EDSA 3K1KA 1JBYA 2VZXA 4W6CA 1EMKA 4KW9A 4W76A 3EVVA 1KYRA 4L1IA 4H3NA 5DQMA 1Q4DA 3U8AA 4JFGA 4DXPA 3M24A 4HVFA 1H6RA 3ADFA 4W7DA 4W6UA 2OTBA 2Y0GA 5EJUA 1RRXA 2HFCA 1CV7A 4HQ9A 4AS8A 1EMCA 3LF4B 4ZBLA 2HGDA 2QRFA 3U0LA 3WCKA 4W72A 2G6EA 4I2YA 3SG2A 2G6YA 4HE4A 3TMRA 2YFPA 2VADA 4RTCA 5DRFA 4ZINA 4NWSA 4B30A 1YHGA 3CFFA 3DPWA 3NEDA 1F09A 3MGFA 4IZNA 2H6VA 5H89A 4ZIOA 2POXA 3AKOA 4IK1A 4H48A 3KCSA 5KTGA 4W6GA 4N3DA 3NF0A 2HRSA 2OKWA 4KW8A 5BTTB 2C9IA 3A8SA 2DUFA 4LJDA 4P76A 5EXCI 4W7XA 3EVRA 4LQTA 1EMFA 5FVGA 4RYWA 1S6ZA 1JBZA 1OXDA 4W6HA 1C4FA 2V4EB 2PXSA 3RWTA 5DU0A 4B30B 3SVNA 4JEOA 5EHUA 3SG6A 4W7RA 1W7UA 4H3MA 4EULA 2Z1OA 4PPKA 1QXTA 5DQBA 2A47A 1ZGOA 3SSPA 3P28A 1YJFA 3PJBA 4JF9A 3SVBA 1Q73A 3O78A 4KEXA 3CGLA 4KF5C 3SS0A 1HUYA 3LVDA 1XSSA 3H1OA 1XQMA 3E5WA 3EVUA 3GL4A 3WLCA 3GJ1A 4B5YA 2VVIA 4W6PA 3SSLA 1EMLA 2QZ0A 4IK4A 3BX9A 3PJ7A 2DUGA 2BTJA 3IR8A 4OJ0A 2O2BA 4W69A 2GW4B 1YJ2A 1QY3A 1RMPA 3DQ7A 4JRBA 1QYFA 1YZWA 4OGSA 3SSTA 5LTRA 3CD1A 3W1CA 1EMEA 3V3DA 3I19A 4W6KA 4PFEA 4EMQA 2EMOA 3DQ8A 3GJ2A 4Z4MA 4LW5A 4BDUA 2C9JA 3EK7A 2PXWA 2YE0A 1F0BA 2A54B 2WHSA 4W6JA 2O24A 4Z4KA 4KGEA 1YHIA 4W7FA 4W6NA 5HW9A 1Q4BA 2B3QA 4W7EA 3DQHA 3EVPA 3U0KA 1KYSA 4GOBA 2Q6PA 3ED8A 4J88A 4Q7TA 2QLHA 5LTQA 2FWQA 3DQ9A 2O29A 3VICA 1UISA 4RYSA 4W6SA 2H5OA 5BT0A 2DD9A 2H8QA 2DD7A 4W6RA 5HZUA 2AHAA 5BTTA 5DPIA 5F9GA 3DQFA 2Z6XA 3AI5A 2G16B 3SG7A 2QT2A 3LVAA 2FL1A 2V4EA 1W7TA 4J89A 5EXUA 2VAEA 4OQWA 1OXEA 3ST0A 4W6OA 5EBJA 4GESB 1Q4EA 4DKMA 4ZF3A 3DQJA 2OTEA 3BXBA 3LF3A 3NT9A 1JC1A 3CB9A 2AWMA 4DXNA 4LJCA 3SSVA 3KCTA 3DQAA 3G9AA 3H1RA 2A53B 1H4UA 1W7SA 3LSAA 3W1DA 2GX2A 5FVIA 4ZF4A 2A52B 4W77A 3SG3A 3SG4A 2QLGB 3ST3A 4L13A 4XVPA 4W6MA 1OXFA 2JADA 3DQUA 2AH8A 4TZGA 3VHTA 2WURA 3O77A 1XA9A 3DQ4A 1Z1QA 2G3DB 3NEZA 4KW4A 5EB7A 5BQLA 5LTPA 5H87A 5DTXA 5DRGA 5EXBA 3DQKA 4EN1A 4OY4A 3ZUJA 3EKJA 4XOWA 1Z1PA 3DPZA 1GL4A 3OGOA 3BXCA 4HQCA 4ZFSA 2IE2A 2IB6A 5LK4A 3SVUA 1MOUA 4H3LA 2YDZA 3E5VA 2HCGA 1EMAA 1EMBA 3LS3A 5HZTA 2A46A 2H5RA 2WSOA 1G7KA 2A56B 3OSRA 3SSKA 4IK3A 1GFLA 3SVOA 2FZUA 2G2SB 2OGRA 3SG5A 4ANJA 3SSYA 1ZGQA 3VHTB 3DQ5A 1ZGPA 4W6IA 5DTYA 3SVSA 3ZUFA 3UG0A 3UFZA 2WSNA 4KPIA 3DQEA 4W6TA 4KGFA 4W75A 3DQCA 4KA9A 2G5ZB 5FVFA 2ZMUA 3U8CA 2P4MA 2V4EC 5DTZA 3U0NA 2HJOA 3EKHA 4KF4A 4XL5A 3DQ6A 4PPJA 5DPJA 2RH7A 2AWKA 5T3IA 4PPLA 1B9CA 3IP2A 1Q4AA 4W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJ5 A;  3P8U A;  2ARL A;  2YE1 A;  3BXA A;  3CFA A;  1RMO A;  4DXO A;  3WLD A;  3M22 A;  4R6D A;  4W7A A;  3EK8 A;  3ZUL A;  1EMG A;  5H88 A;  4IK5 A;  1EMM A;  4KF5 A;  3SRY A;  4LJD C;  3CFH A;  3DQD A;  1RMM A;  3SVE A;  2QU1 A;  5HZO A;  3DQO A;  1MYW A;  3ST2 A;  2QLG A;  2G3O A;  3GEX A;  3AI4 A;  5J2O A;  2EMD A;  5HZS A;  3DQ1 A;  4TZA A;  2Z6Z A;  1QYQ A;  2VVH A;  4DXI A;  5HGE A;  4Q9X A;  4R6B A;  4JC2 A;  2DDD A;  4JGE A;  2HPW A;  3DQ2 A;  2A48 A;  2DUE A;  2EMN A;  3U8P A;  3ZTF A;  4IK8 A;  2WIQ A;  3DQ3 A;  5DY6 A;  3NT3 A;  1HCJ A;  3DPX A;  3TMT A;  4P1Q A;  3OSQ A;  4LJB A;  3CBE A;  2IOV A;  3DQM A;  5AQB B;  2QLE A;  4Q9W A;  1MOV A;  4KAG A;  1Q4C A;  4W74 A;  2HGY A;  2WHT A;  1YFP A;  4XOV A;  2GX0 A;  4GF6 B;  3S05 A;  2G6X A;  3SVD A;  3GB3 A;  2WIS A;  4W73 A;  5HBD A;  2H5Q A;  1XAE A;  4W6A A;  1JC0 A;  2H9W A;  2A50 B;  4DXQ A;  3VK1 A;  2OKY A;  2ICR A;  3LVC A;  2DUI A;  3SVR A;  4Q7R A;  5EB6 A;  2H5P A;  3DQI A;  4Q7U A;  4AR7 A;  2OJK A;  3CD9 A;  1XMZ A;  2GW3 A;  3RWA A;  4U2V A;  3SSH A;  4OHS A;  2WHU A;  4UTS A;  4W6F A;  2B3P A;  2ZMW A;  1QYO A;  2Q57 A;  4W6B A;  2QLI A;  2VVJ A;  1BFP A;  4L12 A;  4ZB1 A;  2AWJ A;  2ZO7 A;  1RM9 A;  2HQZ A;  2HQK A;  4J8A A;  5DPH A;  1ZUX A;  3DQL A;  3PIB A;  2DUH A;  4ORN A;  3LA1 A;  3SV5 A;  2DDC A;  4H47 A;  4W6D A;  1YHH A;  3U0M A;  2IB5 A;  2Z6Y A;  5DPG A;  3DQN A;  4HQ8 A;  5FHV A;  4EDO A;  5DTL A;  1KYP A;  3E5T A;  3EK4 A;  4DXM A;  2AWL A;  4W7C A;  3SVC A;  4ZF5 A;  4LQU A;  3ST4 A;  4IK9 A;  1KP5 A;  1GGX A;  2ZO6 A;  4XGY A;  4DKN A;  4EDS A;  3K1K A;  1JBY A;  2VZX A;  4W6C A;  1EMK A;  4KW9 A;  4W76 A;  3EVV A;  1KYR A;  4L1I A;  4H3N A;  5DQM A;  1Q4D A;  3U8A A;  4JFG A;  4DXP A;  3M24 A;  4HVF A;  1H6R A;  3ADF A;  4W7D A;  4W6U A;  2OTB A;  2Y0G A;  5EJU A;  1RRX A;  2HFC A;  1CV7 A;  4HQ9 A;  4AS8 A;  1EMC A;  3LF4 B;  4ZBL A;  2HGD A;  2QRF A;  3U0L A;  3WCK A;  4W72 A;  2G6E A;  4I2Y A;  3SG2 A;  2G6Y A;  4HE4 A;  3TMR A;  2YFP A;  2VAD A;  4RTC A;  5DRF A;  4ZIN A;  4NWS A;  4B30 A;  1YHG A;  3CFF A;  3DPW A;  3NED A;  1F09 A;  3MGF A;  4IZN A;  2H6V A;  5H89 A;  4ZIO A;  2POX A;  3AKO A;  4IK1 A;  4H48 A;  3KCS A;  5KTG A;  4W6G A;  4N3D A;  3NF0 A;  2HRS A;  2OKW A;  4KW8 A;  5BTT B;  2C9I A;  3A8S A;  2DUF A;  4LJD A;  4P76 A;  5EXC I;  4W7X A;  3EVR A;  4LQT A;  1EMF A;  5FVG A;  4RYW A;  1S6Z A;  1JBZ A;  1OXD A;  4W6H A;  1C4F A;  2V4E B;  2PXS A;  3RWT A;  5DU0 A;  4B30 B;  3SVN A;  4JEO A;  5EHU A;  3SG6 A;  4W7R A;  1W7U A;  4H3M A;  4EUL A;  2Z1O A;  4PPK A;  1QXT A;  5DQB A;  2A47 A;  1ZGO A;  3SSP A;  3P28 A;  1YJF A;  3PJB A;  4JF9 A;  3SVB A;  1Q73 A;  3O78 A;  4KEX A;  3CGL A;  4KF5 C;  3SS0 A;  1HUY A;  3LVD A;  1XSS A;  3H1O A;  1XQM A;  3E5W A;  3EVU A;  3GL4 A;  3WLC A;  3GJ1 A;  4B5Y A;  2VVI A;  4W6P A;  3SSL A;  1EML A;  2QZ0 A;  4IK4 A;  3BX9 A;  3PJ7 A;  2DUG A;  2BTJ A;  3IR8 A;  4OJ0 A;  2O2B A;  4W69 A;  2GW4 B;  1YJ2 A;  1QY3 A;  1RMP A;  3DQ7 A;  4JRB A;  1QYF A;  1YZW A;  4OGS A;  3SST A;  5LTR A;  3CD1 A;  3W1C A;  1EME A;  3V3D A;  3I19 A;  4W6K A;  4PFE A;  4EMQ A;  2EMO A;  3DQ8 A;  3GJ2 A;  4Z4M A;  4LW5 A;  4BDU A;  2C9J A;  3EK7 A;  2PXW A;  2YE0 A;  1F0B A;  2A54 B;  2WHS A;  4W6J A;  2O24 A;  4Z4K A;  4KGE A;  1YHI A;  4W7F A;  4W6N A;  5HW9 A;  1Q4B A;  2B3Q A;  4W7E A;  3DQH A;  3EVP A;  3U0K A;  1KYS A;  4GOB A;  2Q6P A;  3ED8 A;  4J88 A;  4Q7T A;  2QLH A;  5LTQ A;  2FWQ A;  3DQ9 A;  2O29 A;  3VIC A;  1UIS A;  4RYS A;  4W6S A;  2H5O A;  5BT0 A;  2DD9 A;  2H8Q A;  2DD7 A;  4W6R A;  5HZU A;  2AHA A;  5BTT A;  5DPI A;  5F9G A;  3DQF A;  2Z6X A;  3AI5 A;  2G16 B;  3SG7 A;  2QT2 A;  3LVA A;  2FL1 A;  2V4E A;  1W7T A;  4J89 A;  5EXU A;  2VAE A;  4OQW A;  1OXE A;  3ST0 A;  4W6O A;  5EBJ A;  4GES B;  1Q4E A;  4DKM A;  4ZF3 A;  3DQJ A;  2OTE A;  3BXB A;  3LF3 A;  3NT9 A;  1JC1 A;  3CB9 A;  2AWM A;  4DXN A;  4LJC A;  3SSV A;  3KCT A;  3DQA A;  3G9A A;  3H1R A;  2A53 B;  1H4U A;  1W7S A;  3LSA A;  3W1D A;  2GX2 A;  5FVI A;  4ZF4 A;  2A52 B;  4W77 A;  3SG3 A;  3SG4 A;  2QLG B;  3ST3 A;  4L13 A;  4XVP A;  4W6M A;  1OXF A;  2JAD A;  3DQU A;  2AH8 A;  4TZG A;  3VHT A;  2WUR A;  3O77 A;  1XA9 A;  3DQ4 A;  1Z1Q A;  2G3D B;  3NEZ A;  4KW4 A;  5EB7 A;  5BQL A;  5LTP A;  5H87 A;  5DTX A;  5DRG A;  5EXB A;  3DQK A;  4EN1 A;  4OY4 A;  3ZUJ A;  3EKJ A;  4XOW A;  1Z1P A;  3DPZ A;  1GL4 A;  3OGO A;  3BXC A;  4HQC A;  4ZFS A;  2IE2 A;  2IB6 A;  5LK4 A;  3SVU A;  1MOU A;  4H3L A;  2YDZ A;  3E5V A;  2HCG A;  1EMA A;  1EMB A;  3LS3 A;  5HZT A;  2A46 A;  2H5R A;  2WSO A;  1G7K A;  2A56 B;  3OSR A;  3SSK A;  4IK3 A;  1GFL A;  3SVO A;  2FZU A;  2G2S B;  2OGR A;  3SG5 A;  4ANJ A;  3SSY A;  1ZGQ A;  3VHT B;  3DQ5 A;  1ZGP A;  4W6I A;  5DTY A;  3SVS A;  3ZUF A;  3UG0 A;  3UFZ A;  2WSN A;  4KPI A;  3DQE A;  4W6T A;  4KGF A;  4W75 A;  3DQC A;  4KA9 A;  2G5Z B;  5FVF A;  2ZMU A;  3U8C A;  2P4M A;  2V4E C;  5DTZ A;  3U0N A;  2HJO A;  3EKH A;  4KF4 A;  4XL5 A;  3DQ6 A;  4PPJ A;  5DPJ A;  2RH7 A;  2AWK A;  5T3I A;  4PPL A;  1B9C A;  3IP2 A;  1Q4A A;  4W6L A; 
#chains in the Genus database with same CATH topology
 3PJ5 A;  3P8U A;  2ARL A;  2YE1 A;  3BXA A;  3CFA A;  1RMO A;  4DXO A;  3WLD A;  3M22 A;  4R6D A;  4W7A A;  3EK8 A;  3ZUL A;  1EMG A;  5H88 A;  4IK5 A;  1EMM A;  4KF5 A;  3SRY A;  4LJD C;  3CFH A;  3DQD A;  1RMM A;  3SVE A;  2QU1 A;  5HZO A;  3DQO A;  1MYW A;  3ST2 A;  2QLG A;  2G3O A;  3GEX A;  3AI4 A;  5J2O A;  2EMD A;  5HZS A;  3DQ1 A;  4TZA A;  2Z6Z A;  1QYQ A;  2VVH A;  4DXI A;  5HGE A;  4Q9X A;  4R6B A;  4JC2 A;  2DDD A;  4JGE A;  2HPW A;  3DQ2 A;  2A48 A;  2DUE A;  2EMN A;  3U8P A;  3ZTF A;  4IK8 A;  2WIQ A;  3DQ3 A;  5DY6 A;  3NT3 A;  1HCJ A;  3DPX A;  3TMT A;  4P1Q A;  3OSQ A;  4LJB A;  3CBE A;  2IOV A;  3DQM A;  5AQB B;  2QLE A;  4Q9W A;  1MOV A;  4KAG A;  1Q4C A;  4W74 A;  2HGY A;  2WHT A;  1YFP A;  4XOV A;  2GX0 A;  4GF6 B;  3S05 A;  2G6X A;  3SVD A;  3GB3 A;  2WIS A;  4W73 A;  5HBD A;  2H5Q A;  1XAE A;  4W6A A;  1JC0 A;  2H9W A;  2A50 B;  4DXQ A;  3VK1 A;  2OKY A;  2ICR A;  3LVC A;  2DUI A;  3SVR A;  4Q7R A;  5EB6 A;  2H5P A;  3DQI A;  4Q7U A;  4AR7 A;  2OJK A;  3CD9 A;  1XMZ A;  2GW3 A;  3RWA A;  4U2V A;  3SSH A;  4OHS A;  2WHU A;  4UTS A;  4W6F A;  2B3P A;  2ZMW A;  1QYO A;  2Q57 A;  4W6B A;  2QLI A;  2VVJ A;  1BFP A;  4L12 A;  4ZB1 A;  2AWJ A;  2ZO7 A;  1RM9 A;  2HQZ A;  2HQK A;  4J8A A;  5DPH A;  1ZUX A;  3DQL A;  3PIB A;  2DUH A;  4ORN A;  3LA1 A;  3SV5 A;  2DDC A;  4H47 A;  4W6D A;  1YHH A;  3U0M A;  2IB5 A;  2Z6Y A;  5DPG A;  3DQN A;  4HQ8 A;  5FHV A;  4EDO A;  5DTL A;  1KYP A;  3E5T A;  3EK4 A;  4DXM A;  2AWL A;  4W7C A;  3SVC A;  4ZF5 A;  4LQU A;  3ST4 A;  4IK9 A;  1KP5 A;  1GGX A;  2ZO6 A;  4XGY A;  4DKN A;  4EDS A;  3K1K A;  1JBY A;  2VZX A;  4W6C A;  1EMK A;  4KW9 A;  4W76 A;  3EVV A;  1KYR A;  4L1I A;  4H3N A;  5DQM A;  1Q4D A;  3U8A A;  4JFG A;  4DXP A;  3M24 A;  4HVF A;  1H6R A;  3ADF A;  4W7D A;  4W6U A;  2OTB A;  2Y0G A;  5EJU A;  1RRX A;  2HFC A;  1CV7 A;  4HQ9 A;  4AS8 A;  1EMC A;  3LF4 B;  4ZBL A;  2HGD A;  2QRF A;  3U0L A;  3WCK A;  4W72 A;  2G6E A;  4I2Y A;  3SG2 A;  2G6Y A;  4HE4 A;  3TMR A;  2YFP A;  2VAD A;  4RTC A;  5DRF A;  4ZIN A;  4NWS A;  4B30 A;  1YHG A;  3CFF A;  3DPW A;  3NED A;  1F09 A;  3MGF A;  4IZN A;  2H6V A;  5H89 A;  4ZIO A;  2POX A;  3AKO A;  4IK1 A;  4H48 A;  3KCS A;  5KTG A;  4W6G A;  4N3D A;  3NF0 A;  2HRS A;  2OKW A;  4KW8 A;  5BTT B;  2C9I A;  3A8S A;  2DUF A;  4LJD A;  4P76 A;  5EXC I;  4W7X A;  3EVR A;  4LQT A;  1EMF A;  5FVG A;  4RYW A;  1S6Z A;  1JBZ A;  1OXD A;  4W6H A;  1C4F A;  2V4E B;  2PXS A;  3RWT A;  5DU0 A;  4B30 B;  3SVN A;  4JEO A;  5EHU A;  3SG6 A;  4W7R A;  1W7U A;  4H3M A;  4EUL A;  2Z1O A;  4PPK A;  1QXT A;  5DQB A;  2A47 A;  1ZGO A;  3SSP A;  3P28 A;  1YJF A;  3PJB A;  4JF9 A;  3SVB A;  1Q73 A;  3O78 A;  4KEX A;  3CGL A;  4KF5 C;  3SS0 A;  1HUY A;  3LVD A;  1XSS A;  3H1O A;  1XQM A;  3E5W A;  3EVU A;  3GL4 A;  3WLC A;  3GJ1 A;  4B5Y A;  2VVI A;  4W6P A;  3SSL A;  1EML A;  2QZ0 A;  4IK4 A;  3BX9 A;  3PJ7 A;  2DUG A;  2BTJ A;  3IR8 A;  4OJ0 A;  2O2B A;  4W69 A;  2GW4 B;  1YJ2 A;  1QY3 A;  1RMP A;  3DQ7 A;  4JRB A;  1QYF A;  1YZW A;  4OGS A;  3SST A;  5LTR A;  3CD1 A;  3W1C A;  1EME A;  3V3D A;  3I19 A;  4W6K A;  4PFE A;  4EMQ A;  2EMO A;  3DQ8 A;  3GJ2 A;  4Z4M A;  4LW5 A;  4BDU A;  2C9J A;  3EK7 A;  2PXW A;  2YE0 A;  1F0B A;  2A54 B;  2WHS A;  4W6J A;  2O24 A;  4Z4K A;  4KGE A;  1YHI A;  4W7F A;  4W6N A;  5HW9 A;  1Q4B A;  2B3Q A;  4W7E A;  3DQH A;  3EVP A;  3U0K A;  1KYS A;  4GOB A;  2Q6P A;  3ED8 A;  4J88 A;  4Q7T A;  2QLH A;  5LTQ A;  2FWQ A;  3DQ9 A;  2O29 A;  3VIC A;  1UIS A;  4RYS A;  4W6S A;  2H5O A;  5BT0 A;  2DD9 A;  2H8Q A;  2DD7 A;  4W6R A;  5HZU A;  2AHA A;  5BTT A;  5DPI A;  5F9G A;  3DQF A;  2Z6X A;  3AI5 A;  2G16 B;  3SG7 A;  2QT2 A;  3LVA A;  2FL1 A;  2V4E A;  1W7T A;  4J89 A;  5EXU A;  2VAE A;  4OQW A;  1OXE A;  3ST0 A;  4W6O A;  5EBJ A;  4GES B;  1Q4E A;  4DKM A;  4ZF3 A;  3DQJ A;  2OTE A;  3BXB A;  3LF3 A;  3NT9 A;  1JC1 A;  3CB9 A;  2AWM A;  4DXN A;  4LJC A;  3SSV A;  3KCT A;  3DQA A;  3G9A A;  3H1R A;  2A53 B;  1H4U A;  1W7S A;  3LSA A;  3W1D A;  2GX2 A;  5FVI A;  4ZF4 A;  2A52 B;  4W77 A;  3SG3 A;  3SG4 A;  2QLG B;  3ST3 A;  4L13 A;  4XVP A;  4W6M A;  1OXF A;  2JAD A;  3DQU A;  2AH8 A;  4TZG A;  3VHT A;  2WUR A;  3O77 A;  1XA9 A;  3DQ4 A;  1Z1Q A;  2G3D B;  3NEZ A;  4KW4 A;  5EB7 A;  5BQL A;  5LTP A;  5H87 A;  5DTX A;  5DRG A;  5EXB A;  3DQK A;  4EN1 A;  4OY4 A;  3ZUJ A;  3EKJ A;  4XOW A;  1Z1P A;  3DPZ A;  1GL4 A;  3OGO A;  3BXC A;  4HQC A;  4ZFS A;  2IE2 A;  2IB6 A;  5LK4 A;  3SVU A;  1MOU A;  4H3L A;  2YDZ A;  3E5V A;  2HCG A;  1EMA A;  1EMB A;  3LS3 A;  5HZT A;  2A46 A;  2H5R A;  2WSO A;  1G7K A;  2A56 B;  3OSR A;  3SSK A;  4IK3 A;  1GFL A;  3SVO A;  2FZU A;  2G2S B;  2OGR A;  3SG5 A;  4ANJ A;  3SSY A;  1ZGQ A;  3VHT B;  3DQ5 A;  1ZGP A;  4W6I A;  5DTY A;  3SVS A;  3ZUF A;  3UG0 A;  3UFZ A;  2WSN A;  4KPI A;  3DQE A;  4W6T A;  4KGF A;  4W75 A;  3DQC A;  4KA9 A;  2G5Z B;  5FVF A;  2ZMU A;  3U8C A;  2P4M A;  2V4E C;  5DTZ A;  3U0N A;  2HJO A;  3EKH A;  4KF4 A;  4XL5 A;  3DQ6 A;  4PPJ A;  5DPJ A;  2RH7 A;  2AWK A;  5T3I A;  4PPL A;  1B9C A;  3IP2 A;  1Q4A A;  4W6L A; 
#chains in the Genus database with same CATH homology
 3PJ5 A;  3P8U A;  2ARL A;  2YE1 A;  3BXA A;  3CFA A;  1RMO A;  4DXO A;  3WLD A;  3M22 A;  4R6D A;  4W7A A;  3EK8 A;  3ZUL A;  1EMG A;  5H88 A;  4IK5 A;  1EMM A;  4KF5 A;  3SRY A;  4LJD C;  3CFH A;  3DQD A;  1RMM A;  3SVE A;  2QU1 A;  5HZO A;  3DQO A;  1MYW A;  3ST2 A;  2QLG A;  2G3O A;  3GEX A;  3AI4 A;  5J2O A;  2EMD A;  5HZS A;  3DQ1 A;  4TZA A;  2Z6Z A;  1QYQ A;  2VVH A;  4DXI A;  5HGE A;  4Q9X A;  4R6B A;  4JC2 A;  2DDD A;  4JGE A;  2HPW A;  3DQ2 A;  2A48 A;  2DUE A;  2EMN A;  3U8P A;  3ZTF A;  4IK8 A;  2WIQ A;  3DQ3 A;  5DY6 A;  3NT3 A;  1HCJ A;  3DPX A;  3TMT A;  4P1Q A;  3OSQ A;  4LJB A;  3CBE A;  2IOV A;  3DQM A;  5AQB B;  2QLE A;  4Q9W A;  1MOV A;  4KAG A;  1Q4C A;  4W74 A;  2HGY A;  2WHT A;  1YFP A;  4XOV A;  2GX0 A;  4GF6 B;  3S05 A;  2G6X A;  3SVD A;  3GB3 A;  2WIS A;  4W73 A;  5HBD A;  2H5Q A;  1XAE A;  4W6A A;  1JC0 A;  2H9W A;  2A50 B;  4DXQ A;  3VK1 A;  2OKY A;  2ICR A;  3LVC A;  2DUI A;  3SVR A;  4Q7R A;  5EB6 A;  2H5P A;  3DQI A;  4Q7U A;  4AR7 A;  2OJK A;  3CD9 A;  1XMZ A;  2GW3 A;  3RWA A;  4U2V A;  3SSH A;  4OHS A;  2WHU A;  4UTS A;  4W6F A;  2B3P A;  2ZMW A;  1QYO A;  2Q57 A;  4W6B A;  2QLI A;  2VVJ A;  1BFP A;  4L12 A;  4ZB1 A;  2AWJ A;  2ZO7 A;  1RM9 A;  2HQZ A;  2HQK A;  4J8A A;  5DPH A;  1ZUX A;  3DQL A;  3PIB A;  2DUH A;  4ORN A;  3LA1 A;  3SV5 A;  2DDC A;  4H47 A;  4W6D A;  1YHH A;  3U0M A;  2IB5 A;  2Z6Y A;  5DPG A;  3DQN A;  4HQ8 A;  5FHV A;  4EDO A;  5DTL A;  1KYP A;  3E5T A;  3EK4 A;  4DXM A;  2AWL A;  4W7C A;  3SVC A;  4ZF5 A;  4LQU A;  3ST4 A;  4IK9 A;  1KP5 A;  1GGX A;  2ZO6 A;  4XGY A;  4DKN A;  4EDS A;  3K1K A;  1JBY A;  2VZX A;  4W6C A;  1EMK A;  4KW9 A;  4W76 A;  3EVV A;  1KYR A;  4L1I A;  4H3N A;  5DQM A;  1Q4D A;  3U8A A;  4JFG A;  4DXP A;  3M24 A;  4HVF A;  1H6R A;  3ADF A;  4W7D A;  4W6U A;  2OTB A;  2Y0G A;  5EJU A;  1RRX A;  2HFC A;  1CV7 A;  4HQ9 A;  4AS8 A;  1EMC A;  3LF4 B;  4ZBL A;  2HGD A;  2QRF A;  3U0L A;  3WCK A;  4W72 A;  2G6E A;  4I2Y A;  3SG2 A;  2G6Y A;  4HE4 A;  3TMR A;  2YFP A;  2VAD A;  4RTC A;  5DRF A;  4ZIN A;  4NWS A;  4B30 A;  1YHG A;  3CFF A;  3DPW A;  3NED A;  1F09 A;  3MGF A;  4IZN A;  2H6V A;  5H89 A;  4ZIO A;  2POX A;  3AKO A;  4IK1 A;  4H48 A;  3KCS A;  5KTG A;  4W6G A;  4N3D A;  3NF0 A;  2HRS A;  2OKW A;  4KW8 A;  5BTT B;  2C9I A;  3A8S A;  2DUF A;  4LJD A;  4P76 A;  5EXC I;  4W7X A;  3EVR A;  4LQT A;  1EMF A;  5FVG A;  4RYW A;  1S6Z A;  1JBZ A;  1OXD A;  4W6H A;  1C4F A;  2V4E B;  2PXS A;  3RWT A;  5DU0 A;  4B30 B;  3SVN A;  4JEO A;  5EHU A;  3SG6 A;  4W7R A;  1W7U A;  4H3M A;  4EUL A;  2Z1O A;  4PPK A;  1QXT A;  5DQB A;  2A47 A;  1ZGO A;  3SSP A;  3P28 A;  1YJF A;  3PJB A;  4JF9 A;  3SVB A;  1Q73 A;  3O78 A;  4KEX A;  3CGL A;  4KF5 C;  3SS0 A;  1HUY A;  3LVD A;  1XSS A;  3H1O A;  1XQM A;  3E5W A;  3EVU A;  3GL4 A;  3WLC A;  3GJ1 A;  4B5Y A;  2VVI A;  4W6P A;  3SSL A;  1EML A;  2QZ0 A;  4IK4 A;  3BX9 A;  3PJ7 A;  2DUG A;  2BTJ A;  3IR8 A;  4OJ0 A;  2O2B A;  4W69 A;  2GW4 B;  1YJ2 A;  1QY3 A;  1RMP A;  3DQ7 A;  4JRB A;  1QYF A;  1YZW A;  4OGS A;  3SST A;  5LTR A;  3CD1 A;  3W1C A;  1EME A;  3V3D A;  3I19 A;  4W6K A;  4PFE A;  4EMQ A;  2EMO A;  3DQ8 A;  3GJ2 A;  4Z4M A;  4LW5 A;  4BDU A;  2C9J A;  3EK7 A;  2PXW A;  2YE0 A;  1F0B A;  2A54 B;  2WHS A;  4W6J A;  2O24 A;  4Z4K A;  4KGE A;  1YHI A;  4W7F A;  4W6N A;  5HW9 A;  1Q4B A;  2B3Q A;  4W7E A;  3DQH A;  3EVP A;  3U0K A;  1KYS A;  4GOB A;  2Q6P A;  3ED8 A;  4J88 A;  4Q7T A;  2QLH A;  5LTQ A;  2FWQ A;  3DQ9 A;  2O29 A;  3VIC A;  1UIS A;  4RYS A;  4W6S A;  2H5O A;  5BT0 A;  2DD9 A;  2H8Q A;  2DD7 A;  4W6R A;  5HZU A;  2AHA A;  5BTT A;  5DPI A;  5F9G A;  3DQF A;  2Z6X A;  3AI5 A;  2G16 B;  3SG7 A;  2QT2 A;  3LVA A;  2FL1 A;  2V4E A;  1W7T A;  4J89 A;  5EXU A;  2VAE A;  4OQW A;  1OXE A;  3ST0 A;  4W6O A;  5EBJ A;  4GES B;  1Q4E A;  4DKM A;  4ZF3 A;  3DQJ A;  2OTE A;  3BXB A;  3LF3 A;  3NT9 A;  1JC1 A;  3CB9 A;  2AWM A;  4DXN A;  4LJC A;  3SSV A;  3KCT A;  3DQA A;  3G9A A;  3H1R A;  2A53 B;  1H4U A;  1W7S A;  3LSA A;  3W1D A;  2GX2 A;  5FVI A;  4ZF4 A;  2A52 B;  4W77 A;  3SG3 A;  3SG4 A;  2QLG B;  3ST3 A;  4L13 A;  4XVP A;  4W6M A;  1OXF A;  2JAD A;  3DQU A;  2AH8 A;  4TZG A;  3VHT A;  2WUR A;  3O77 A;  1XA9 A;  3DQ4 A;  1Z1Q A;  2G3D B;  3NEZ A;  4KW4 A;  5EB7 A;  5BQL A;  5LTP A;  5H87 A;  5DTX A;  5DRG A;  5EXB A;  3DQK A;  4EN1 A;  4OY4 A;  3ZUJ A;  3EKJ A;  4XOW A;  1Z1P A;  3DPZ A;  1GL4 A;  3OGO A;  3BXC A;  4HQC A;  4ZFS A;  2IE2 A;  2IB6 A;  5LK4 A;  3SVU A;  1MOU A;  4H3L A;  2YDZ A;  3E5V A;  2HCG A;  1EMA A;  1EMB A;  3LS3 A;  5HZT A;  2A46 A;  2H5R A;  2WSO A;  1G7K A;  2A56 B;  3OSR A;  3SSK A;  4IK3 A;  1GFL A;  3SVO A;  2FZU A;  2G2S B;  2OGR A;  3SG5 A;  4ANJ A;  3SSY A;  1ZGQ A;  3VHT B;  3DQ5 A;  1ZGP A;  4W6I A;  5DTY A;  3SVS A;  3ZUF A;  3UG0 A;  3UFZ A;  2WSN A;  4KPI A;  3DQE A;  4W6T A;  4KGF A;  4W75 A;  3DQC A;  4KA9 A;  2G5Z B;  5FVF A;  2ZMU A;  3U8C A;  2P4M A;  2V4E C;  5DTZ A;  3U0N A;  2HJO A;  3EKH A;  4KF4 A;  4XL5 A;  3DQ6 A;  4PPJ A;  5DPJ A;  2RH7 A;  2AWK A;  5T3I A;  4PPL A;  1B9C A;  3IP2 A;  1Q4A A;  4W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...