3LA3A

Crystal structure of ntca in complex with 2,2-difluoropentanedioic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSRQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 58
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la3A01
1CAUA 3I71A 2Q1ZB 4MEXF 2DPDA 1R1UA 3G73A 4QGMA 2IC1A 4XF1A 3WTZA 4PJYA 3RPQA 4ZU5A 2HQRA 1UIKA 2KXLA 1R5GA 1KQ8A 4XLPF 1W5TA 1YW7A 3HHHA 4I0BA 4WF2A 4G7ZF 5D6FA 1ZLKA 3W6JB 3J80Z 4MH0E 3G7DA 2VBXA 1KYZA 4UHTA 1ZN2A 3H8UA 4IEPA 3I64A 1O7FA 2UWMA 3CTAA 4MNUA 4L5JA 3KGZA 4KIFA 2E9QA 4HA8A 3U1DA 3V7SA 5I0SA 3BY6A 3SHFA 1RZ4A 2ZMEB 2ISZA 2VN2A 4Y15A 1L3LA 2EFOA 3LZZA 2PFBA 3K1PA 5ERIA 3IRRA 1FSHA 2B9UA 4Q29A 4GYGA 2LF7A 1PP7U 2KIUA 1W7PA 3H1MA 4XF4A 1EYBA 4J1XA 2JPCA 3HIFA 4KYWA 2XV4S 2O3FA 4IEXA 3SFZA 3U2RA 2EVXA 1BJAA 3ES1A 3F8NA 5CADA 1Z6TA 3VODA 2OZUA 1IN7A 3LAGA 1KU3A 4OU0A 4KDPA 1J7KA 1JHHA 3NL1A 4L9NA 3QPTA 1DZTA 5FFZA 4KWJA 2JSCA 1FBUA 2P4WA 2EFPA 1J0RA 5E1RA 2UYBA 4JTNA 5C6CA 4XSZF 4RAZA 1LR5A 4XFHA 5BPXA 2D5FA 1XD7A 4NQWA 2XAFA 2PAEA 4RAYA 3KEOA 1A04A 4P55A 1BBYA 2L01A 4UXNA 4XFGA 3IDBB 4AVAA 4CYDA 3E6CC 1GXQA 1P92A 2Q0AA 1LDJA 4KT5C 3EJKA 4I0AA 2FEZA 3P9CA 4JVAA 2LDUA 4OMZA 5A2QZ 5A2QK 4WXCA 3R0AA 2GZWA 3KE2A 1UW8A 1ZZ9A 3KGLA 1PUEE 3S2WA 4IERA 4BAYA 3OGJA 1F4KA 4YNIA 2GC1A 1WRJA 4LLOA 2CQKA 2Z5UA 3C1DA 4BHBA 2R3SA 1YW8A 5BOXA 3F8FA 3CLPA 3SQNA 3RDIA 4EWEA 2PMHA 2W24A 1P2FA 5DDGA 2O8XA 1R1TA 3Q9SA 5FCCA 2FBKA 2AXLA 2XVCA 1ZZ8A 3O14A 5I8SA 3WW2A 1NHAA 1ODDA 1IXRC 4LB5A 5KHGA 2K02A 2W57A 1L3JA 4XEZA 3ZMDA 2DAOA 3E6MA 2EV0A 2D93A 1XE8A 2LNBA 3BWGA 4WZCA 3RJPA 2ZJ2A 2EFNA 5LLQA 1FWZA 3TDUC 2COMA 1QXRA 2BGCA 4U88A 2ZBKA 2G9WA 1J58A 1TNTA 4WBBA 3T8RA 1FYMA 1V3FA 3H3ZA 1G6NA 3HOTA 3SCHA 2XUBA 3HSFA 2MA3A 4IHTA 4TLFA 1HW5A 3QU6A 2IXLA 3PQJA 3GFJA 1H0MA 2QVSB 5D4RA 5FLHA 2Z33A 2VT3A 4L11A 5FQ0B 3HYIA 1Z6RA 3LA3A 1HQCA 4E2QA 1BM9A 3I54A 4Y17A 3T1BA 2QCSB 1LJ9A 3KCCA 4HQMA 5FFXA 2ZO4A 3O6BB 4HDVA 1HBXG 2KJCA 2A6HF 4YFKF 5DV5A 4ENKA 3T5XA 2ETEA 2XHKA 1J2XA 1LDDA 3EDPA 3N4MA 4GO1A 4H0EA 1J75A 3BOQA 4LG0B 3FJSA 1WGPA 4LK1F 2EFQA 3V8LA 4Q4ZF 4IEWA 3LOIA 5FD5A 2XAQA 5BS6A 4FAGA 2Z69A 3MZYA 1Z1DA 1DP7P 2XLGA 1XN7A 3IWZA 2QUFA 1X82A 2QWWA 2VECA 2MH9A 3FXUA 4R79A 3HRSA 1K6OA 1HW1A 5FGMA 5J8FA 3PQKA 5CJ9A 2STTA 4EM1A 2MBFA 2P7CB 1IPJA 3E97A 4HLXA 2EB7A 2HQNA 1T0FA 6PAXA 3HOSA 3VFZA 2ACJA 2OYZA 3ZPLA 2FMLA 1ZX5A 2IPQX 3WGIA 3S7IA 2IXKA 4I3PA 2EV5A 3IKVA 3ZMUA 1HKQA 3DEUA 1TQIA 4LLLA 1IN4A 3QP6A 4JQFA 5HDKA 2Y0OA 1IN8A 3GX4X 2PLYA 3ZMVA 3DPTA 1ZH5A 4UNOA 4KNYA 3WODF 2RDPA 1E2XA 1YS6A 4KWKA 4Q0QA 1FOKA 2RKHA 2E7WA 4EJOA 4HVRA 3F8BA 4M9XA 3I58A 2FNPA 2RVCA 1O4TA 4HVOA 3I59B 1IRGA 1K7AA 1LB2A 1O3TA 4HX8A 1YUDA 3CUQC 4DNCA 4LEJA 3EO6A 2ADUA 1Q1HA 5E17F 3WGGA 2C0ZA 3JTHA 2L54A 1O3SA 4ETSA 2ZFWA 3M8FA 3J81K 3WTVC 4ZYDA 3TNPB 4B09A 2V6CA 2XAJA 1ZRRA 3KMHA 1TBXA 4LTAA 4UVBA 4ZYEA 2P5LC 2B0LA 2PHDA 4RB2C 4OFGA 2FE3A 5CVRA 2H27A 1S3JA 4LUMA 3HRMA 1ZLJA 1XGNA 2XROA 4Q47A 1PMIA 2OD5A 1XB4A 3O2PE 5HDNA 3J80K 1OPCA 1R1VA 4ZU4A 3EETA 3I53A 2QBYA 1CAWB 2A68F 5ICGA 3QAHA 4U7DA 5HS7A 4ZZLA 3GZ6A 2FSWA 4AD9A 4ONUA 5JHUA 1D8JA 5I93A 1MZBA 2HEOA 4AXOA 5AONA 4OIRF 4Q5SF 3TOAA 1J3PA 1WWXA 2RC4A 4KU7A 1XGMA 2EWNA 4A6DA 3RPUA 3HQXA 3I59A 4HZFA 3L00A 1O3QA 4LULA 1UCRA 4BHPA 2M30A 5FB2A 3CUQA 3E5XA 3PFIA 4L9TA 4PIXA 3M70A 1ZHFA 5E1WA 4M9ZA 2DK5A 1B1BA 3M1EA 1BIBA 3H1WA 2GH2A 4META 3U11A 4HMZA 2OU2A 4HDUA 4R8HA 3BROA 4Z82A 1WKMA 3QU3A 3DXJF 1U12A 3ZMTA 1J5YA 4X6RB 3OD0A 2ET1A 1EP0A 4I7HA 3L2HA 1I1SA 3D5LA 4G94A 4EJVA 4GGGA 2HKXA 5HLGA 3BU7A 3IKTA 3OOPA 1DPRA 2BV6A 4O3MA 3T8TA 4HN1A 2J5PA 3GZ5A 1HSJA 1G3TA 2K4BA 3K9TA 1FSEA 2ETHA 4HX4A 1MDMA 3FM5A 2OQRA 3SXYA 1Y0UA 3RIRA 2XGXA 3TNQA 2ZXJA 3RTRA 2L3DA 2DK8A 1F1ZA 5BPIA 1UIJA 4LB6B 4AVBA 1UFMA 1JE8A 1YQAA 2V1DA 4PGGA 5LEJA 2EAAA 2V09A 4G8XA 2HGCA 1NE6A 1J59A 2M8EA 4MV2A 1BOAA 4BYYA 4U7BA 3V8JA 3BALA 4F8AA 5LBQA 4HF0A 3CL1A 2F2EA 4UBGA 4U0YA 1NZCA 1X7NA 4S05A 4RGXA 3BJAA 5D8LB 3ECOA 3OTFA 5TJJA 2O6GE 1WA4A 3F8MA 1PDNC 2PYTA 5IT9K 3EHKA 3KP2A 5ILSA 2KRFA 5LGTA 3FFQA 1KA8A 4G9YA 3C18A 1ZRFA 3HT1A 3FXRA 3CJNA 1TW3A 4F7ZA 2DO7A 1WQ2A 3LWCA 1XSDA 4UUVA 1CAVA 2NNNA 4MGRA 1EY2A 2FOKA 4AIJA 5KHIA 1HSTA 5FLIA 1X8EA 2BBYA 4EGZA 1YO5C 1NE4A 1BIAA 2AS5F 1VP6A 1H1IA 1SD4A 3DN7A 3J81Z 3K69A 4IJAA 5K1YA 2VE8A 1YFXA 3L2CA 2X0LA 3I0TA 4ASNA 1YFWA 5HI0A 4YYOA 1TTYA 2D5HA 2BNMA 2UXXA 3Q5FA 1DGWA 3WU0A 1IN6A 1FC3A 1B9MA 3ELKA 1R36A 2WC2A 2EA2A 1KGSA 5J3UA 1MD0A 1STZA 1TNSA 2UXNA 1P6RA 4G6DA 4A0XA 1K78A 1IXCA 3C3WA 1BI3A 3KZYA 3QACA 3USSA 2VPVA 3D0SA 3GFIA 4LD5A 3L09A 1F5TA 1R23A 2OZ6A 5D6EA 4KMFA 5I8TA 2PAMA 4IEYA 2P5KA 2QENA 3LAJA 3MDPA 4RB3C 4LLGF 2P8TA 4XFAA 2VBWA 3MPBA 2DLLA 5BPDA 2Q4SA 4LA2A 4HW0A 2O61A 1O5UA 2FRHA 5D5XB 1REPC 4FBFA 5DD8A 2X4HA 2HTSA 3NJZA 2WWYA 2FNAA 4DQ2A 3R0JA 2O1QA 4HAMA 1RL3A 2GA1A 2HYGD 2XLAA 3TO6A 5LEKA 2VODA 1B6AA 1YHFA 4IHSA 5JSPA 2PEXA 1R22A 3BZ6A 2PG4A 4IEUA 5D5WB 5J6XA 1B4AA 5LRSA 4PZJA 1ZGJA 3T0YA 2VOOA 4HX7A 4M73A 3DL3A 1H9GA 5KHHA 3ECHA 5DUIA 2K4JA 2CFXA 2VQAA 5DEQA 4MGZE 3ROUA 1Z91A 1LNWA 5I0RA 1ZG3A 2VXZA 5L3CA 2IP2A 2F5FA 4IRIA 5DCMA 2W85A 4LUKA 3JAMZ 1CAXB 2XASA 1MJBA 5BV6A 4QMAA 5J7MA 1T6SA 5FLXZ 3KLOA 2P7VB 1QBJA 1KQ9A 2MNGA 3GBFA 2BNOA 4P9GA 4WCGA 2FA5A 2JPBA 4Q0UA 4IEZA 3MZHA 2OZJA 1T38A 4ORFA 5HOOA 4ZU7A 2BEOA 4HV5A 1ZZCA 2RNJA 3HRUA 2IXCA 1FPQA 4OOIA 2IRFG 2I45A 2OA2A 1R58A 2PJPA 4XRFA 2N7GA 1DDNA 4UVAA 2D45A 2KIMA 1JGSA 4YIIA 1VJ2A 2MHFA 3SZTA 3NEUA 5BMZA 3KLNA 2Y0MA 1VR3A 2NYXA 3I5UA 1TQMA 2VC0A 3QOPA 4L9VA 4IF4A 1FBQA 3UKNA 3IBMA 5K5RA 2PMUA 1LDKB 4NB5A 4BNCA 2DW4A 1ULYA 1AWCA 3VOEA 3JAMK 4HF1A 3SCFA 2EA4A 3ZMSA 3COAC 4RB1A 3FX3A 5FQ0A 5DD4A 3WE2A 3ACLA 2DTRA 3TDZC 2Z9OA 5H6RA 3D0JA 5I8YA 1MKMA 3GUDA 1S29A 2DU9A 4LLNA 3REOA 1XMKA 1XSXA 2GXGA 2CO5A 4GCVA 5FO5A 4A5MA 4HVQA 4G7HF 4A12A 3BPZA 2IJLA 1E17A 1XSVA 2YX7A 3WG9A 4HSJA 1WI9A 1ZZ6A 4A0ZA 3GYDA 2MD5A 1J3RA 4R52A 2WTEA 1DPUA 4YFXF 1RIOH 4P5OA 4EV0A 1QZYA 5HDGA 1FI2A 4CGZA 3TQNA 2L4AA 4ESBA 4BIFA 2EFWA 1IUYA 4KA4A 3HUGA 3Q9VA 2P6SA 3ETQA 3O3KA 1J3QA 4KWLA 4QM9A 2FQPA 1HKSA 3KP7A 3WE3A 3MFKA 4AIKA 3EBRA 1Z7UA 1UHWA 2H0VA 3IC7A 1QY4A 3ZN1A 1SMTA 2MLGA 4LMYA 1KU9A 3GYHX 5CYVA 2PAKA 4M71A 2HJIA 2QYOA 3RYPA 4WXHA 4XFFA 1WSUA 1XDSA 1FXZA 3MWMA 2VONA 5BXXA 1RI7A 1H9TA 3M3IA 2UYAA 1BI0A 2XRNA 4K8FA 4RD7A 1I1GA 2CGPA 2FMYA 2K86A 2XKPA 1TW2A 2L4MA 5AIQA 2HWVA 1O3RA 3GFMA 5T3NA 5L3BA 2XL7A 3WTUC 1BN5A 4NVPA 1MJAA 4L9JA 1S7OA 3FF5A 5LRRA 5BY5A 3K2ZA 3NVCA 5TRDA 4BH9A 1BI1A 3J7AO 2D1VA 2OPKA 1H1MA 2R7FA 2YR2A 4I01A 2QVOA 3FZ3A 4ENJA 4MQ9F 3F22A 1ON1A 2FBIA 5K8SA 1IZ1A 1I6XA 4XLNF 1GQHA 5J8CA 1D3YA 3K1MA 3WW4A 2BYVE 1S8NA 2QDRA 3F6OA 2RQPA 4MTDA 4E70A 2P5VA 2UY9A 2IA0A 3TO7A 1MJ9A 1T2KA 1Q3EA 5K5OA 1SFEA 2VE9A 1RUNA 3KFWX 5KHKA 4MGKE 2DBBA 4FHTA 1IN5A 2OQGA 4I2OA 4FT8A 3IRQA 2PTMA 4Q0PA 1T39A 2PBIA 4FX0A 4KMUX 4E2GA 2NS0A 2ESNA 1KYWA 2QZ8A 4TV7A 2M1BA 4EJTA 1CX4A 4MGYE 5F64A 5ED4A 4I02A 1J9IA 4RB0A 2KJBA 3NW4A 2OAZA 4L2NA 3W6KB 2ELHA 2FQ3A 3BDDA 2CAVA 3UKTA 3TO9A 3GO5A 2F4PA 5JR7B 3H50A 5JAXA 3LWFA 1CF7B 4OINF 3DQVC 2P6TA 1LEAA 1OYYA 3OCPA 3L9FA 5LHGA 1RTVA 2K0GA 3KSCA 5LGUA 5D5VB 2JRTA 4M6YA 3U0ZA 2QQAA 4A6EA 1I27A 3FM3A 3B02A 5AVPA 1OKRA 1V4RA 3WU1B 5ICCA 3N97A 3V7RA 3KP5A 4GYIA 3ZDSA 1K79A 4L0ZB 3ML6A 2Q8KA 4XFIA 3BCWA 2RV8A 2GC0A 1YLLA 1Q43A 1LKNA 5LHIA 4XFCA 3LQQA 4CZZA 2VT2A 4IEQA 1USSA 3FMSA 4XBFA 2D1HA 4O5VA 3SCGA 2H6CA 4HLYA 3VEPA 3C3VA 2OA4A 4M9SA 2QLZA 2O0YA 2WFPA 4D7TA 3DF8A 4I09A 2LKPA 4A5NA 5HS8A 1S7AA 1YWKA 1Q5OA 1ZG1A 3DPLC 1G3SA 4PDKA 4FAHA 4LJZF 4EJUA 5CVJA 4ENMA 2GIVA 2IA1A 3CUOA 4Z07A 5I91A 5JSOA 5F1RA 3ABUA 2O03A 3GWZA 3R60A 5KHJA 2W84A 5E16A 1KU2A 2V9VA 4EJWA 1EV7A 2E1CA 1IRFA 5AIPA 4L18B 4EM0B 2YX4A 5DCMB 2EV6A 2BE5F 1ZAOA 2XIGA 3GF2A 3K1NA 3H3UA 2B8MA 2M45A 4G6QA 4KIGA 1EH8A 5JCTA 1ZRDA 1NXMA 2W25A 1AOYA 4MZUA 5CVVA 1W7PB 3CO2A 1K78B 1VTNC 4H7LA 4P9FA 5E1XA 1Y3TA 4GXOA 2JTVA 3S0MA 4Q0SA 4I98B 4U0WA 2NRAC 5I0UA 1FP2A 2STWA 4OIQF 1UPIA 4IRGA 2IXJA 1ONVA 4PGHA 4PCQA 2G7HA 1NYWA 2CSOA 3QP5A 5CLSA 3TKYA 5LGNA 2XLFA 4HV6A 5CVIA 4WVZA 3IL2A 1LVAA 1C0WA 1FT9A 1W5SA 2FF4A 1OI6A 1P4XA 4QWQA 1RNLA 1XGOA 4IEVA 3KZZA 3BJ6A 3TGNA 3CUQB 1QNTA 1ON2A 3BJOA 4YARA 2Q2EA 3H7JA 4EQQA 4QGLA 3LQRA 3PVBB 1TLHB 4B8XA 5JFRA 2MLKA 4YSFA 2LF8A 1F9NA 1CAUB 3GW2A 1QGPA 1TQ5A 3BP8A 4HN0A 3WTTC 4HLTA 4Q0VA 3ES4A 4MX3A 1FBSA 1U5TC 4RGSA 3V7CA 2GAUA 2K7LA 3BPVA 3H92A 1U5TB 3LA2A 4IEOA 2J5OA 2FXAA 2HZTA 1CAWA 5CU1A 4CDGA 2NAZA 2XL9A 4WK8F 3GVAA 4P9UA 4WWCA 2VBYA 4ENNA 3BB6A 5HVQC 4ZH4F 4OLLA 2YPRA 2DPUA 1SFXA 2DQLA 1XRUA 3FZVA 3KETA 2F5DA 2XKOA 3SXWA 2PQ8A 3RI4A 1UCXA 3ZN0A 1USTA 5KVRA 1QO0D 3CF6E 3LSTA 1GXPA 4YIFA 4LG0A 3E3VA 5D5UB 2QNKA 2NNYA 3LA7A 1UHMA 2RGVA 4LFUA 5D1IA 1YFYA 3KP3A 3E5UA 1XE7A 2E7XA 1FNNA 5JI6A 2KIFA 4IESA 4LGWA 1ZZBA 4MQVA 4Z2YA 2GC2A 4EWAA 3ST7A 4J1WA 1YS7A 3CO6C 2DFIA 1Z9CA 2V1UA 2LSOA 1XGSA 1SEFA 5D4SA 3HSRA 1XMAA 2M5WA 3VB2A 3CLOA 2GC3A 4JTOA 2ET7A 1W7PD 2ZCWA 3E5QA 4CXFA 1B59A 5J48A 1SAXA 3HTUA 2PHLA 1U5TA 4XF0A 1ZARA 5HLHA 1IW7F 4DINB 5ICFA 5HS9A 1O5LA 2PQQA 3MEXA 4X6QB 4XETA 2UZKA 1SQ4A 4AWXB 4AQ6A 3PLQA 5FLXK 4L0YB 1IPKA 4AVPA 2IXIA 2IW5A 4OMYA 1ZVFA 4HSLA 1QXJA 1YG2A 3OV8A 3S7EA 1ZG5A 3U9GA 4CO8A 2CWEA 1YYVA 4D7SA 2HS5A 1BC8C 4KIBA 3EQLF 3RKWA 2HTJA 3K0LA 4YRDA 1GQGA 5E1ZB 2QQ9A 4HYEA 1GHCA 1OD5A 4XF3A 3NQOA 2H94A 3DV8A 3P7NA 3EQEA 2GQQA 5EFUA 3MQ0A 4OIOF 3WTWC 2G7UA 1OR7A 5C8WA 2XAGA 2DT5A 3RYKA 3ERED 1O7LA 2D2WA 2RN7A 3F21A 3GXOA 2ZNZA 3HT2A 4HBNA 1XCBA 2CAUA 3DFGA 3JZVA 4A2UA 4IVNA 1TQPA 4N9HA 1CAVB 4XSXF 4Y13A 4RGUA 2YSRA 4B29A 1FY7A 4GULA 3HTSB 1YW9A 3CJXA 3MAJA 1JUHA 3RZZA 1LQ1A 4UBHA 3JTGA 4EWDA 1YFHA 1FYKA 2K9ZA 1JXSA 4EM2A 2FU4A 2CG4A 3ZQ7A 3SMHA 3GEZA 3EUHA 2Z3YA 5BQTA 2L02A 2ATFA 3DKWA 2DCTA 3AAFA 2CW0F 4PIZA 1IAWA 1RUOA 2MC3A 3WW1A 4EGYA 3FMQA 3IIAA 4EMSA 2GXBA 4ON0A 5EZWA 1PM7A 1PP8F 4CHUA 1S6LA 1ZZ7A 5E8IA 3WTYC 1D8KA 4LK0F 5I0TA 3IDCB 1SFUA 3F3XA 1T98A 2H6BA 4BXUA 3KP4A 1Z05A 2DI3A 3M9AA 4XF9A 4XFBA 3IHUA 2GU9A 4KN7X 4MTEA 3PNAA 3JSOA 1R7JA 4HOBA 3MYXA 3TOBA 4ZYGA 2ZNYA 3JW4A 5IT9Z 4KU8A 4QX5A 2CYYA 1V70A 5E20A 1OMIA 2H09A 3NRVA 1B9NA 3I4PA 1EPZA 4HF2A 2M87A 2PFWA 3B73A 3SZPA 4QLCU 3L7WA 1L0OC 5HLIA 3QPHA 3SHRA 1WLTA 4S04A 2CV6A 3HSEA 3KEQA 1XDUA 2EA7A 1ZGAA 3UKVA 3NSTA 3DP7A 2TDXA 4RS8A 5ILUA 2B5HA 5L3EA 1QQIA 4UVCA 5F6FA 2MH2A 4MHGA 3JSPA 4JV4A 3ZP5A 3U10A 1YLFA 2ZKZA 3G3ZA 4CICA 3OF1A 5FPXA 5D8KB 2A07F 4PIYA 2ZMEA 1FP1D 4EROA 2V1XA 3FHZA 5E18F 2HR3A 4NHJA 5KBFA 2F5EA 4ZZDA 2HFHA 5DUKA 4JBAA 5ILVA 1HW2A 3CO7C 2D40A 4HBLA 5L3GA 3FWEA 2A3SA 1EH6A 5H6QA 2A61A 3VHRA 4UV8A 1DUXC 3FMRA 4UV9A 3GFLA 1OYWA 2GWRA 2IXHA 1UD1A 4YG2F 3RNSA 2HDCA 2VBZA 4EVIA 1QWRA 3ZMZA 2P17A 3P9IA 2HKOA 5ICEA 3EYIA 4N9IA 3WGHA 3P9KA 2IA2A 1FZPB 3E6BA 1OFNA 2E1NA 2JT1A 1SFNA 4N0BA 3FE5A 3LAPA 2Z99A 1G3WA 1FLIA 4M6XA 4BQAA 3H1YA 2UY8A 5FLJA 1OYIA 1ZREA 1P4WA 4YFNF 4QGNA 2ISYA 3F72A 3C7JA 3KP6A 1MDMB 5K5QA 4QXKA 1R00A 4P96A 5FDBA 3H9AA 1U3EM 2A5YB 5JSRA 4WXDA 2VC1A 1P4AA 1U8RA 3V8KA 3LFKA 5E8GA 4HQEA 3FHIB 1MGTA 1D5VA 2Q0OA 2ESHA 3CEWA 3GLXA 1X8MA 1I5ZA 2A69F 1EH7A 4ESFA 5IT3A 1BC7C 1IF1A 2PA7A 3E6DA 3HRTA 3V4GA 1XCVA 2HOEA 4KFCA 1RGSA 5DCFA 1IXSB 2C6YA 1GVJA 4ESJA 5JVTA 4BHCA 1X3UA 1ZNPA 1J1LA 4WX9A 3H7YA 5LHHA 2QQBA 1SD6A 4MUVA 2FBHA 1ZYRF 4E2SA 2Q30A 5BUVA 4KN4X 3ABTA 1LRHA 4KICA 2R7DA 1G3YA 3F6VA 1RC6A 4RGRA 5L3FA 4M72A 4MEYF 1U6GA 2QJVA 3D82A 4K2EA 4M74A 2DQRA 3M7GA 3EYYA 1YIOA 3R61A 5EEGA 3QRFF 4ZYHA 3WTXC 1UB9A 2BNNA 1G4DA 4A0YA 2YU3A 4LA3A 4U0VA 1CGPA 1Y9QA 1JHFA 4L5IA 3IWFA 3NKTA 3WTSC 4AQ2A 1KU7A 5FPZA 2O8QA 2F5CA 3M8EA 3ELNA 1SD5A 1W4MA 4OIPF 5JR3A 4AVCA 2Z2SB 4R1HA 2HYFA 3RKYA 3F23A 3RKXA 2QM3A 2QBYB 5EEHA 1CAXA 5FD6A 1SD7A 5L3DA 4O9GA 4D0PA 4G7OF 2IVMA 2ZKLA 4IRHA 1U78A 3FXQA 3RYRA 1U2WA 2Y48A 1QPMA 1FYLA 1HXDA 2MPFA 2V79A 1CF7A 3ISPA 3R6SA 2EK5A 3ULQB 4O6JA 2VOPA 1O57A 1HKTA 4FX4A 1SMYF 2PN6A 2IT0A 1QZZA 2OBPA 3WW3A 4AIHA 2WV0A 5KK1A 1R5HA 3I7DA 3HHGA 4UXAA 2K27A 1YTYA 1KQ0A 4KUMA 3F8CA 5CVUA 2EJRA 2Y75A 1LEBA 2A6EF 4IPAA 4MGIE 4IETA 1YFUA 2XAHA 1ZRCA 3MCZA 2JZYA 4QM8A 1BI2A 3BPXA 5H20A 1DGRA 4KL1A 2GA2A 4JK1X 4O9EA 3R4KA 4IXAA 1DZRA 5DYMA 2PI0A 3CDHA 4Q48A 1FX7A 2KKOA
chains in the Genus database with same CATH superfamily
2DU1A 3I71A 3JRCA 1Y9GA 2RQQA 2DPDA 2H1KA 2O7OA 5JIUA 3G73A 4QGMA 1OVSA 4XF1A 3WTZA 2LTPA 3P6BA 4UY8I 2SBAA 1KD7A 2ZXWH 1UIKA 2LALA 2LYCA 3MLKA 1MS0A 4JKLA 4CP9B 4XLPF 1RIRA 2P3KA 3IIIA 1ITYA 2JIGA 2GNDA 1K5MB 4I0BA 2QZ2A 2W82A 3O8HA 2LRPA 2QGUA 4PLOA 4CSWA 1YI7A 3TRSB 1ASJ2 1ZLKA 3CD6I 1COV1 1XNDA 1ZN2A 3H8UA 4IEPA 1W1WE 4L5JA 2M8GX 4NN0A 3V7SA 2WZ8A 5I0SA 4XUQA 3KV5A 2OIIA 4RDUA 4Y15A 1ZGWA 4ZYAA 2PFBA 1FSHA 3IRRA 4XURA 3N9QA 3BR1A 1O8PA 2DCZA 1ETYA 1X3ZB 3WR0A 1QHGA 4GMP0 4XHBA 1EYBA 5GKAC 5A1FA 1DYKA 3HIFA 4ZDPA 5FKOA 5LBBA 2WY7Q 1BJAA 3ES1A 4BOWA 2YYOA 5CADA 4CDQC 1Z6TA 2OVUA 2OZUA 3ZQGA 1UXXX 3FLPA 3LAGA 3AP6A 2W1WA 3NL1A 3BR6A 2LFBA 2P4EA 3QPTA 1DZTA 3V65A 1WLCA 5FFZA 3ECQA 3T2QA 3ACGA 4PBOA 4ISRA 1GBGA 3VZLA 4XPVA 2HXIA 4ARYA 2R7SA 2UYBA 1YE9A 1OFSA 4XSZF 5A33A 4RAZA 1LR5A 1WMDA 2R16A 4UW3A 2D5FA 2WNUC 3RWKX 4XL9A 4WVMA 4FOVA 1A04A 1BBYA 4D7NA 4UXNA 5DG2A 4IV3B 2AGSA 3JRAA 4CYDA 4YZ2A 2B42B 2P2KA 2Q0AA 1TMF1 2DA3A 2FEZA 3GZEA 5A2QZ 3ZX7A 3R0AA 1Z78A 2FDJA 5F3GA 4IO9F 2FDGA 4AF9A 5B5EC 1X36A 1ZZ9A 4Q4Y3 3S2WA 3HOUJ 3OGJA 1F4KA 1WRJA 2Z5UA 2ZGPA 2R3SA 4Y7NJ 3ZO0B 4AVSA 2PHRA 2CYFA 3CLPA 3WNOA 3SQNA 2CUEA 2WAAA 4EWEA 1P2FA 5DDGA 4NROA 1RXFA 2Y9ZA 5J37A 3MF9A 5FCCA 1CIYA 1RVF1 3O14A 2ECCA 5JVVA 1BYHA 1JYTA 3HBZA 2Y9YA 5KHGA 1GNHA 3ZMDA 2V5YA 2D93A 4ZONA 2ZSIB 2HWE1 2WFF3 2ZJ2A 3DYOA 2XJSA 5FKKA 1FWZA 5FZEA 2NMNA 5FR3A 4UW5A 5ACA2 3C7HA 2WZR2 2BGCA 1J58A 3T8RA 3VD9A 2DTYA 1FYMA 2AH2A 2ZS6B 5DUXA 2BVMA 4P14A 1IDZA 3VBOA 1HW5A 4B4CA 4IGOA 3SH4A 3ASOH 5FY8A 3LA3A 4PJMA 3ZIXA 1HV0A 3ZR8X 3I54A 4Y17A 2JDHA 4HKOA 3CMAI 3JQXA 2ZO4A 2RR13 4C8DA 3O6BB 2JG8B 1HBXG 3QD6A 4BE0A 5JR2A 5DV5A 3NRUA 3T5XA 4SBVA 4JDNA 3EDPA 2O14A 5C3QA 1QJY3 1J75A 1OOPC 1W0OA 2WBKA 3RRDA 3BG3A 4LG0B 2EIMH 5SV8A 4QPGA 4IEWA 3LOIA 1D1AA 2R7UA 1UQXA 3VHPA 2Z69A 4Q8KA 2V6EA 1UAAA 2ZJRF 3G1OA 4DMIA 1UU6A 1KRIA 2P37A 4XKWA 2LW8A 2QWWA 2VECA 2JXAA 1WUVA 3HRSA 1XPWA 4Y4RA 2I5UA 3LFMA 3BTXA 5CJ9A 2STTA 4EM1A 3KCYA 2P7CB 5KNLA 4DNYA 4HLXA 1OF4A 1T0FA 6PAXA 1EAH1 1MMSA 5D8AC 4BDYA 2ACJA 5HNHA 4Y1YA 4YGBA 3ZMUA 3W9AA 1HKQA 3BQYA 1TQIA 4LLLA 3JBG3 3IH3A 1IN8A 4N90A 2PLYA 5T52A 1HQLA 5FYZA 1C8NA 5B4XA 1YRNA 3N36A 2WS92 4KNYA 4DYQA 1FOKA 2RKHA 2E7WA 4EJOA 4M9XA 1U9OA 2RVCA 2YHJA 1HXS1 5BNPA 4IE0A 5A7NA 1O3TA 4DNCA 3DPRA 2ADUA 3GHMA 5FBJA 5JIAA 1SVLA 5C4JJ 1YOVB 4ETSA 1HLVA 3M8FA 4ZYDA 1ZRIA 3VB9A 3UJQA 2XAJA 3NV3A 4LTAA 4ZYEA 5EPAA 1YQ5A 1XNKA 2PHDA 3LSJA 1XS9A 1JZ4A 2H27A 2OPWA 1S3JA 4DIQA 1ACCA 1AR92 5HXMA 4FE4A 1XGNA 1DQ5A 4Z8BA 1VE0A 2OD5A 1MS8A 5A7WB 1NAEA 1R1VA 4ZU4A 3EETA 3I53A 2YY1A 2QBYA 1W8OA 5HS7A 1OHFA 2FSWA 2VQ0A 1U5YA 3TBDA 1EUTA 3SEPA 2VCMA 2QQOA 2HEOA 5T5LA 1QJX2 5ABJC 3R0RA 1GOHA 1WWXA 2RC4A 1BMV1 3HQXA 1H4GA 2WAEA 5EZGA 2JE9A 4HZFA 2BY1A 1X9PA 3Q8EA 4UF0A 4BHPA 3L2UA 1RXGA 1W8ZA 1ZHFA 5E1WA 5JZGC 1B1BA 2RS53 2ZGLA 2IS4A 4META 4A7ZA 4TWTA 2MEV3 2DFBA 4HMZA 4DQAA 3OYEA 2XG3A 1FMWA 3DXJF 1X58A 1QDOA 1U12A 3ZMTA 1Q8QA 1IO2A 1UZZA 1JI8A 3L2HA 2JENA 3AYAA 1SFKA 1T0FC 3S8PA 3POSA 3TWIA 3JRBA 3VBRC 3BR5A 4G94A 2IS6A 4CPBA 2HKXA 3BU7A 2K40A 1SFYA 3IKTA 3K70D 4A3GJ 2BV6A 2JRMA 2OCCH 1CQTA 5JXJA 3OR1C 1LECA 2GH8A 2ZX4A 1G3TA 4B48A 3AYEA 4HX4A 5CQGA 3OS1A 4JX0A 2E2JJ 3RIRA 1JOBA 3HXLA 2RS11 1MBJA 3QQAA 1GUIA 2DK8A 1PGL2 4M3CE 4EZHA 1UFMA 1JE8A 1J84A 4YZ1A 2D98A 4CCCA 5LEJA 1AL22 2A05A 2Y64A 4BYYA 3F0CA 5CQEA 2RR12 5D21A 2JA8J 3A0HC 4BJ5C 3S14J 3PNVA 3O7OA 2LC2A 3AZVA 2AEZA 2RJLA 2YMZA 3AP7A 3ECOA 3OTFA 4GDFA 2O6GE 3F8MA 3KP2A 3FFQA 4G9YA 1ZRFA 2O0OA 1TW3A 3FC0A 2DO7A 3LWCA 4UUVA 3T30A 3VBFC 4A3LJ 4AIJA 4EGZA 4Q8LA 5C7GA 2COBA 3ZFEA 2AS5F 4A3BJ 1YYNA 1VP6A 3RJ2X 1SD4A 4BBRJ 2Q8DA 4E7HA 2X1DA 1TME3 3J81Z 3S93A 4PK4A 1V9U3 4QB2A 4IJAA 5K1YA 2DMNA 3VKOA 2XPJA 2JDPA 5KAFC 4EZ4A 4A44A 4YYOA 3RGBA 2CU7A 1DGWA 4C90A 3WU0A 2VZUA 1FC3A 4BY7J 1DZQA 1QVTA 2WC2A 3O1OA 4PSWA 1XG1A 2E63A 1MD0A 3PUHA 4G6DA 1K78A 2AO9A 2VPVA 3HMYA 1H6YA 4C2MJ 1ZELA 3D0SA 1Y7BA 2VUJA 1CZTA 5FWEA 3GFIA 5F5QA 1KJRA 3L09A 4UOJA 1JTZX 1VRH2 1R23A 2OZ6A 2R042 2QENA 3OYBA 3MDPA 4RB3C 3ZXJA 3RJRA 1AYM3 1PVC2 4Y4YA 3BTAA 3K4AA 2YZ4A 5BPDA 2PJRB 1D2QA 1LOFA 4AFCA 1BW6A 4F55A 3U14A 2WYFA 3ZSJA 3T3YA 2X4HA 4NWWA 2JUCA 2JKXA 4RS5A 5DABA 3FKJA 2R062 4BGDA 4QX2A 1RUD2 1B6AA 5C3RA 3BZ6A 1PO23 2IFRA 2PG4A 4IEUA 1GVDA 5J6XA 3KVBA 1ZGJA 3S57A 2VQTA 2W91A 1W3VA 4HK8A 4LK7A 5KHHA 5DUIA 2K4JA 4IOAF 2D44A 1XSRA 1WBFA 3ROUA 1Q8PA 2JEMA 1TG7A 2VXZA 1Y0NA 2YU1A 4M3BA 1QJY2 3DCQA 3TEYA 4BACA 1GUUA 2Y0SN 1GZWA 5BV6A 5IOYA 2R32A 1T6SA 1K5MA 2ZGKA 3LF7A 4M6VA 4FE7A 3P1IA 2KRCA 2QTWB 1OR7C 3T09A 4Q0UA 3MZHA 1T38A 1ONAA 1MBKA 2E5ZA 3ACFA 1ND3C 4ZU7A 1VBB3 1W6PB 2V73A 2RNJA 4HPQA 2RJ2A 2I45A 3VL8A 3HL2A 1AR71 4PJ0C 2D45A 2KIMA 2RJKA 2MHFA 4HSTA 1VMJA 2Y0MA 3J8F1 2R072 4N43C 5K0UA 2NYXA 3TP0A 2J1TA 1I1EA 1EV11 4MOAA 1LDKB 3V0BB 1ULYA 2VZ3A 1AR83 1WHUA 3CBNA 4BLJA 1MZEA 1LULA 1S7EA 4E4DX 4ZS3A 4GALA 5C5TA 2JE8A 4JRLA 2RS33 3TN91 3AKQA 4YEJA 3NKGA 3ABKH 2DTRA 2NZ9A 2PHWA 1G2HA 1R081 1MIJA 1S29A 4IQJA 1LE8B 1Z7S1 3JBG1 1XE0A 4NRMA 4GCVA 1DGLA 1YRNB 1OUSA 3OGGA 4A12A 1S0FA 3B69A 2YX7A 1C57A 4HSJA 1C8M2 2Y0IA 3KF5A 1J3RA 3D6EA 1QH6A 3B9IA 1DPUA 1RIOH 2JA2A 3MEPA 1RHI1 2M7BA 4KA4A 1UZ0A 4CCEA 2BOJA 5EZHA 1J3QA 5FLVA 3I3MA 5IUQA 4B43A 3IC7A 4B4PA 2GMPA 1R71A 4LMYA 3MV01 1G8XA 5CYVA 2PAKA 1ETKA 2QYOA 2HJIA 4XFFA 3MWMA 1RI7A 2I74A 1D4M1 3M3IA 1VBE2 4K8FA 3BKZA 1N1TA 3ZMNA 4BB3A 3GTKJ 4M01A 3W20A 2K86A 1S0EA 3E7LA 3IM0A 4CVUA 2Q1FA 1TW2A 5ANNA 2QQIA 5J3LA 2JX9A 2HWVA 2C26A 2HBUA 3WNKA 2XL7A 2NYYA 1LGCA 1XNAA 2W1SA 3NARA 3MLLA 3FF5A 2IAIA 4BH9A 1BI1A 3PUFA 3KEYA 2YR2A 2VMIA 4E7ZA 5IY5H 3LSPA 3I97A 5M5WJ 2J42A 5J8CA 3WW4A 3AKZA 2YC4A 5F5AA 4TLGA 4OHZA 1W6OB 2QSFX 4NC8A 2P5VA 1SLIA 1SFEA 2OTLI 1RUNA 5CFCA 3FBIB 1XX5A 2DUPA 1U5ZA 3M2MA 2M3AA 2ZX1A 2OQGA 2CNAA 4I2OA 2UWAA 2PTMA 2RS51 1T39A 2EXKA 2NS0A 3GCMA 3ABZA 1AX2A 2WJSA 4MGYE 1VZ0A 1J9IA 1QIQA 4Q4X3 5AFBA 3UGGA 3NW4A 3ZXLA 3LKJA 5LB6A 2FQ3A 3UKTA 2CAVA 1Q8SA 1QDCA 1I3HA 3H50A 2GNBA 1CF7B 4XNFA 2XJQA 4YLZA 4CEYB 4M3CA 2LR8A 1WCQA 2M0CA 1OVPA 5D5VB 4M6YA 4A6EA 1ZBA3 2KM2A 4KT6A 4OHWA 3WU1B 3N97A 2ZC2A 4JGZA 2Z16A 1NY71 3V7RA 4K1ZA 4UF0B 1UMZA 1K79A 1IG3A 3ML6A 4XFIA 4JX6A 3BCWA 4XKCA 3B6AA 1ULFA 5APAA 1DIWA 1MMAA 4AGVA 4YM0A 5BNQA 3IMNA 1MBEA 1HB4A 4CZZA 3AFHA 1GWLA 4IEQA 2XJUA 5IK5A 2D1HA 4O5VA 4WM8A 4DEVA 2DMUA 4FPHA 2EXHA 2H6CA 1FIPA 4HLYA 4CCKA 1GT0C 3C3VA 2OA4A 2QLZA 2O0YA 3TB0A 2CHHA 4I09A 2LKPA 3NWTA 3ILRA 1U5XA 2FZ2A 2JDMA 5GTIC 4RS5B 1SEUA 3DPLC 3WG2A 4CDUC 4A3EJ 1RUH3 4LJZF 4EJUA 2A71A 1I9RA 1SZBA 3CUOA 4Z07A 5I91A 5F1RA 2WO1A 1AR82 3WQBA 3GWZA 5KHJA 5E16A 1P8JA 2AR6A 4BMEA 5CG9A 2Y8KA 4E6KG 2YX4A 5KHDA 4AE2A 2XJTA 5DCMB 2XIGA 2BE5F 2ZTNA 4N7IA 1C3HA 4YZ3A 3NNFA 4JHZA 4MZUA 5CVVA 3I3DA 3K48A 1K78B 2VZQA 3H42B 4H7LA 2OC6A 1HXS3 1K5MC 4Y1UA 3A4UA 3ZOIA 5IK8A 2NRAC 3ZXEA 4CXXA 1UPIA 3ZDVA 3CP2A 2IXJA 3OYWA 1A6IA 3POJA 2DFEA 1V6OA 2G7HA 4LO6B 1ZK8A 4R4ZA 2XPWA 2BVVA 3CZJA 2JE7A 4XTMA 1C0WA 2O8OA 2AYHA 1OI6A 4QWQA 1RNLA 5J96B 5LY1A 1VAKA 3TGNA 2ZGTA 1AYM2 3AC0A 2K46A 4DS0A 3ZSEA 3CJIC 4B8XA 2X05A 2CQ7A 2MLKA 3JD71 2BFUS 1LVKA 2W68A 4YG0A 1UJ8A 4FVVA 5DPNA 5J1RA 1W99A 4HN0A 1ZBE3 5A1LA 4MX3A 1FBSA 1H9WA 4RGSA 3V7CA 1U5TB 1X19A 2R0QC 3ME2A 4WK8F 3K4MA 3VBUB 4P9UA 2W5FA 4WWCA 2VBYA 5FMDA 4MVTA 4PI2A 3BB6A 3ZRGA 3ENRA 2KMUA 2Q8CA 3DYPA 3RI4A 1MNMC 3S5AA 2CW8A 3AYCA 1VRH3 1Z3YA 1AF9A 1HRV2 3VDBA 2KZVA 3HVDA 2HWF1 3WDVA 1W6PA 1R1A3 1NCQB 1NCRA 5A3PA 2NNYA 3LA7A 2ERFA 3ZYIB 1ULPA 1B72A 2RGVA 4LFUA 5D1IA 3KP3A 1VI0A 2KPMA 3S3MA 5JI6A 2ZGSA 3PM1A 2KIFA 2VUCA 1UYPA 3ORJA 5F3IA 4Z2YA 1WMEA 2AACA 2D3RA 2GC2A 1VBC1 1V6IA 1C28A 4QX0A 1I3AA 5C70A 3B7MA 3L2RA 2ZCWA 1NG6A 5H9PA 1D5YA 5J48A 3EUAA 4NOTA 2EIJH 3IAM2 3IV5A 1VB4A 3V64A 5HS9A 4XETA 5JZGA 2XUMA 1PO12 3EUKL 1IRXA 3PLQA 1FJLA 1ZKGA 4L0YB 3GTMJ 4AVPA 3SQOA 3S1MJ 3CCLI 4E4HA 2WFF1 1QXJA 1YG2A 3OV8A 3GZAA 1ZG5A 5LFAA 4AI1A 1YYVA 1NKGA 1LHVA 4D7SA 1AL23 4IE5A 2HVRA 4Q27A 2XGEA 3C2HA 1C5HA 5C3EJ 3KVAA 3KIOA 3VYRB 1W6QA 2KHMA 1NLSA 3OYAA 3BGAA 2CUJA 5A6ZA 4BXXJ 1D2SA 2VOVA 4HYEA 1GHCA 5IFPA 4COUA 4DRRA 2XVGA 2ORZA 2KQRA 3P7NA 4PCRA 5EFUA 5J98B 4IZZA 3MQ0A 2A7AA 2RMU2 1JTXA 1OR7A 3J8F3 3ZQCA 4CYCA 2DT5A 3ERED 4D6QA 1BR1A 2RHPA 3KM5A 4Q1RA 1N1VA 2CAUA 2IGKA 5TISC 4QKDA 3FL7A 2BY0A 3PSIA 4N9HA 1CAVB 1B8IB 2DU0A 4HANA 4XSXF 3AZZA 4RGUA 4GULA 1VQMI 5F3EA 4YELA 3PU3A 2OV7A 1CPNA 4BWOA 4Q5OA 1J1TA 1GANA 5JOXA 4MYEA 3WEZA 3APBA 4UW4A 2WNUB 2D6PA 1LCLA 1OC1A 1RUD1 1JXSA 4BCUA 4DXTA 4FSJA 2ZZQA 5DDJ1 5CFCC 1UU5A 3O0XA 2JWTA 3EUHA 3RFRA 1LGNA 2RNGA 2ATFA 4L92A 2LY1A 3DKWA 3ZVXA 5F2SA 2DCTA 4AEDB 3AAFA 3K51A 1W6NA 2W08A 4ATEA 1OCTC 2DTZA 3ZFEC 4ON0A 1E5HA 5F9TA 4K9SA 3JRIA 5C9AC 3H36A 4S2HA 3ERMA 4GB31 1ZZ7A 3WTYC 2ZEWA 5EXOA 4JYKA 3F3XA 2H6BA 3KP4A 3FDYA 3M9AA 2BVLA 4XFBA 5DUWA 1ENSA 3KT7A 3PNAA 3RZJA 2JICA 5F5CA 3VBSC 3JW4A 5FKBA 5IT9Z 4ZXKA 4KU8A 2E71A 4PSXA 1QOTA 4B44A 4HF2A 4LOCA 4X6AJ 2BBVA 2M87A 3SZPA 2RREA 3WINE 2VGDA 2MABA 1ZGAA 4YVSA 1JHJA 1QJZA 5L3EA 1QQIA 4XDQA 1ND3B 3U10A 2HWF3 4RSUA 4CICA 1WFXA 5D8KB 2QEXI 3EUHC 5E18F 1ZBE1 4NHJA 4OZXA 2F5EA 3PVNA 2HFHA 2BW8A 4TTGA 3FUQA 1SLBA 5ILVA 4HBLA 5L3GA 1VBC3 3ITQA 3VD7A 3VHRA 2AZ5A 1WW7A 2IXHA 5H2FC 3RI9A 1E5RA 3AVRA 4P9XA 2HDCA 4ES9A 5E8AA 1WZXA 2VJIA 3P9IA 4QT6A 4TYSA 5FXWA 2BWCA 1Q8OA 2ORXA 1SPPB 5F6LB 4M4PA 3MUY1 1SFNA 3FE5A 3LAPA 2HEYF 4M6XA 5AC91 4UAPA 1PGL1 4BQAA 1ENQA 5FLJA 1JGGA 3MW4A 1ZREA 1P4WA 4JKMA 4QGNA 1MPXA 2E2IJ 3F72A 1ULCA 1BEV2 3IKWA 5GPCA 3G1MA 3A01B 1C8M1 3BPSA 2QQNA 4IXLA 1R00A 4BZ4A 4P96A 2DVAA 3H9AA 1ULDA 5JSRA 2X53S 5ABJA 1P4AA 1ND3A 1H2KA 4UFLA 5E8GA 5FUNA 1MGTA 3SYTA 3VSKA 2WABA 4L0PA 3U1XA 3CEWA 1S9HA 5EIYB 3LSHA 4ESFA 4DFSA 1ETWA 1TZLA 3VDDB 5JXIA 2CDOA 2ZXQA 4AI8A 3CKHA 2J1EA 4E4ZA 1OLTA 2ZABA 3DBRB 3MD2A 2M9HA 1IXSB 4PQ9A 5JVTA 3H7YA 2BU9A 3SEQA 3O5SA 3PMSA 1WJEA 2JQ7A 3ZXSA 5FZ1A 5BUVA 2XR4A 2R7DA 5FO8B 1RC6A 3RSJA 5IAVA 5BYNA 1XNTA 5EEGA 1BMV2 1UB9A 1QJX1 3TEDA 2P1BA 2WA3A 1BBT1 1NLQA 2ENRA 4LA3A 5AC92 2VKHA 1CGPA 3CDLA 2RS52 3IWFA 4AQSA 1KU7A 1FMD3 4XDPA 2NP0A 2O8QA 5H9QA 3VSLA 5GTHC 2ELJA 5L7OB 2Z2SB 3LCPA 2DCKA 3VYTB 1K42A 2HYFA 3RKYA 3C7EA 3F23A 5LBEA 3GTOJ 4CPBD 1WCDJ 1CAXA 3POBA 4D9JA 4G7OF 2ZKLA 3LDKA 2VNOA 1QPMA 2VUMJ 3O1SA 4ZHNA 1V6NA 3ULQB 1FOD3 1O57A 1JZ8A 4IV3A 1HKTA 1ZBE2 4M3CB 2IT0A 2Y26A 1QZZA 2X29A 2F48A 1OCRH 5FZ9A 2AREA 5KK1A 1R5HA 4D5CA 5IYDJ 4UXAA 4HFSA 4QPGB 3ZOBA 1VBD1 4LHNA 1NG7A 1KQ0A 4KUMA 2EZIA 1LUJB 4NPLA 1D1BA 1Y9MA 1R5ID 5CVUA 1W6NB 5F3CA 4A42A 5FZHA 2EJRA 2Y75A 3VHOA 1Z3XA 4E9KA 4MGIE 1VBD3 1YFUA 1BI2A 5FMOS 1DGRA 1NZIA 1UOGA 4KL1A 3R4KA 4IXAA 5DYMA 2ZEXA 3GZUC 1PO21 2Q1ZB 4MEXF 3K4ZA 1N47A 1W36D 5CPRB 1WLDA 2IC1A 1RUE1 2W3JA 1O8SA 4PJYA 2KISA 3OEAA 3RPQA 5FBZA 1R5GA 4ZC3A 3T0DA 3BCAA 3WP4A 1FOD1 1O4XA 1YW7A 1UX7A 3GDBA 3FFZA 3A4CA 1QGLA 1JUMA 2IZWA 2R7ZJ 1C5IA 4HKLA 3G7DA 4MH0E 1D0XA 3I64A 4BIOA 1ENRA 4AC0A 3QH7A 4LG3A 3BTIA 4MNUA 1UOBA 1X33A 1SDWA 2BV4A 2E9QA 3HWJA 4HA8A 4Y1VA 1OH3A 3BR2A 3JBG2 5HCAA 4XKVA 2AUYA 3J9SA 1MS3A 2EF6A 3FISA 3AL6A 3SHFA 1RZ4A 3N9PA 3GZNB 3LZZA 2A6ZA 2B9UA 4Q29A 4AHWA 3FXMA 4D7MA 4GFBA 1CX1A 3LL7A 4NIAA 5FKCA 2KIUA 1W7PA 3H1MA 3OB8A 4XF4A 1BVP1 4BQOA 4E7KA 1SBEA 1Z7S3 2JPCA 3PIJA 3J7YJ 2O3FA 4AU7A 3SFZA 4I76A 1ND2B 2CH0A 2Q8OA 2PLV3 2L9SA 3VDCA 1G9AA 3PTRB 1V9U2 1IN7A 1UO9A 1UL9A 1J7KA 5J1YA 5DAQA 1A3KA 1LJ7A 3CCRI 4GD4A 2WWSA 4KWJA 4AR2A 4PDWC 5FZIA 1BL0A 1FBUA 3C2BA 1V00A 5A80A 4MG2A 4HNTA 4CDUB 5C6CA 4XFHA 1XD7A 3O1UA 2V9KA 2PAEA 4RAYA 2WZR1 2VXRA 4XFGA 4NBQA 1GNYA 4BM8A 4C30A 5JUVA 1P92A 1SDDB 4KT5C 1BEV3 3ZXDA 1GP6A 4JVAA 2LDUA 4OMZA 2K5CA 5A2QK 4WXCA 1RESA 2BFUL 3NV1A 2GZWA 2Z79A 3KE2A 4YFWA 1UW8A 3ZQIA 3VBRA 5EP9A 1EPWA 3RMXA 4LLOA 3M7AA 1HN1A 1PO11 4BHBA 4HPKB 2QKMB 3F8FA 3GCXA 1FV2A 5JDBA 4CDQB 2X6YA 2O8XA 1O4ZA 1D0HA 1R1TA 2D6KA 2KDZA 3Q9SA 4M0HA 5BNPC 2FBKA 4CEWC 2AXLA 2XVCA 3RG0A 5I8SA 2R061 1VBC2 1NHAA 1ODDA 4DO0A 2XBO1 1VBA1 3D1NI 2LNBA 4C3HJ 2W1QA 4AEKA 1UYZA 2COMA 1QXRA 5EYRA 4U88A 1LOCA 3EXUA 1TNTA 4WBBA 2BOLA 2VBBA 1V3FA 1AR62 3RS6A 2WA0A 1G6NA 2H0BA 3HOTA 3TAYA 3T0BA 2DUOA 2MA3A 1UAIA 1Y8QB 3GFJA 4Y22A 2O5RA 3JB8A 1URXA 4RYDA 2WADA 5FLHA 2Z33A 2VT3A 4L11A 1JKQC 4FPCA 3HYIA 2BGPA 4HONA 2BWAA 4E2QA 4PFPA 1BM9A 3MMYB 3KCCA 1QHDA 2VKEA 4KWUA 1DU3D 3M3YJ 2ETEA 4BK4A 2MFZA 4WM8B 1HCRA 2XHKA 4KISA 1LDDA 1MBFA 2AENA 4QPIA 3N4MA 2BUKA 3BOQA 2R5YB 2FCTA 2CU5A 3V8LA 3JD72 3I2KA 4Q4ZF 4CEWA 1X1PA 3EYPA 5FD5A 3G6JB 5IJRA 4FAGA 1CJPA 2HYKA 5DXDA 3LQCA 1AYM1 2RMU3 2XLGA 1JYCA 3GJAA 4DJAA 4P02B 3BG6A 3OOUA 4COZA 4FOQA 4NPMA 2TRTA 2Y69H 4R79A 5DTDA 2L9RA 5J8FA 3KHCA 3GTJJ 1OURA 2MBFA 4LITA 1PZ8A 2RMU1 3BODA 1IPJA 2HQNA 3HOSA 4RQPC 3VBFA 4D6SA 3BR3A 2FMLA 1ZX5A 2IPQX 3VWBA 3SDGA 2HWD1 2IXKA 2OX0A 2K9SA 1AL21 1N75A 1NA1A 1IN4A 2OCEA 5HDKA 2Y0OA 4LHKA 1GWMA 2HLEA 1HRI1 4ABZA 1WH7A 3W5MA 2YROA 2RDPA 1E2XA 3RZGA 2J1VA 3DU5A 4FTBA 3I58A 1IRGA 4HETA 2XGDA 2R5YA 1LB2A 1YUDA 3CUQC 2K85A 5E17F 3NAPB 4QX1A 1IQDC 4BXFA 2ZFWA 3PURA 3O1PA 2P3IA 4LR4A 2E7AA 4Y20B 1VQ8I 2V26A 2KZGA 3AKPA 1JOPA 1JTYA 5C44J 2GMMA 3POWA 5EG0B 3GHNA 1SLAA 3VBSB 4MGTA 3HRMA 2VTFA 4NR1A 4XMYA 3VBOC 2XROA 4Q47A 1PMIA 5H9SA 1E0EA 5HDNA 2VNGA 1OPCA 5FYUA 4A3FJ 2CL2A 5KC5A 5C5UA 4FPLA 4RR3C 5ICGA 2XQRA 4XAEA 4ZZLA 3D5OA 3GALA 5JHUA 2LKXA 4L97A 3DKQA 1D8JA 4XLFA 1NY72 1IS5A 4PJNA 4OIRF 3IP4B 5FP3A 1RHI3 4LO5B 5FK8A 4A6DA 1ULEA 2EPFA 4Y1XA 2ME0A 3Q8AA 4GQ7A 4RGGA 4LULA 1UCRA 1D0YA 4UT5A 1R1A2 2M30A 1TP4A 4CP2A 2BY2A 4RGKA 1ODNA 1CIWA 3H1CA 1QEXA 3M1EA 1BIBA 3NMBA 1TWGJ 4XBQA 2JB8A 1GZCA 3PMEA 2R0FA 4R8HA 3DUIA 3BROA 3QU3A 2ZEYA 3CCQI 4A3ZA 2NM1A 3AYDA 3TN93 1N1SA 1J5YA 4CUAA 3FIWA 4UW6A 3OD0A 1EP0A 3Q3SA 1DF0A 2VUAA 3VDXA 3DKYA 4XQ4A 4QHZA 4NC6A 1YC61 4GGGA 1SHWB 2R063 1POGA 4D69A 5HLGA 5T5OA 3ZSMA 1DPRA 4O3MA 3O1TA 4HN1A 1S0BA 2J5PA 3GZ5A 5GJ6A 1QJEA 3UJOA 2K4BA 2XVKA 1FSEA 2ETHA 1MDMA 1AUYA 2W0XA 3ZR5A 2CRGA 2XGXA 3TNQA 2W39A 5B3SH 4XBLA 3B01A 4LBQB 1UKRA 4B1RA 4AVBA 1YQAA 2V1DA 2VBDA 1UOJA 3HNBM 4XK4A 1GMMA 2M8EA 4MLOA 1BOAA 4U7BA 2XB6C 5CKTA 3I56I 1EAH2 2VUDA 5LBQA 3OIOA 2HOSA 3POGA 1TWHJ 4RR3B 4UBGA 4U0YA 1X7NA 4XOPA 4S05A 1MEC1 1JH5A 5D8LB 4B7KA 4WM7A 1RUH2 2OT7A 4CEYC 4QX7A 5FRAA 2PYTA 1QA6A 3C18A 1POQA 3G71I 1NK3P 3A21A 1VQ6I 4AVTA 3CJNA 2NXNB 2M4KA 3ALQA 3J7AY 1APLC 1CAVA 4MGRA 5DZFA 2BBYA 1YO5C 3CF2A 2NVXJ 1BIAA 4Q4W3 1H1IA 4LE3A 5F8PA 3K69A 1E3PA 1FATA 2VE1A 3I9V2 1W3XA 2ZGUA 1YFXA 4YM3A 2X0LA 3I0TA 3Q0VA 3CQZJ 4Q26A 5FP4A 1WMXA 2BNMA 2UXXA 3Q5FA 3PUQA 3WNNA 1UZYA 1BJQA 4LMFA 2DOEA 1NCQC 1KGSA 1GOGA 2UUZA 5J3UA 2LM3A 5L73A 1MBHA 1DU6A 1PVXA 2B63J 1COV2 1P6RA 1Z7S2 1IXCA 3TEWA 1BI3A 3KZYA 3MGUA 4LKSA 4YWAA 3USSA 3WDTA 1RITA 2QQUA 2VBPA 3TEZA 4LD5A 5HBAA 1OLME 3S5QA 1FPN2 2DWRA 1MBGA 2VZPA 5I8TA 2P5KA 2GN7A 4G12A 4HL0A 4JP0A 4A3DJ 3RPUD 2VBWA 1QHHD 1UF2C 3HOWJ 2O61A 1O5UA 5H9RA 2NS8A 1BK1A 2QF7A 2FRHA 5KXCA 1REPC 2DOFA 4AYUA 3NJZA 2FNAA 3R0JA 2LS6A 1A5JA 1W9WA 2WNVC 1LKXA 4PF1A 3M3CA 2GA1A 1DQUA 2R92J 2XLAA 3TO6A 4RMNA 2JDKA 1AR72 2PEXA 1AL0G 4DRVA 1VBA3 5D5WB 1B4AA 3GTQJ 5LRSA 3T0YA 2VH9A 2VOOA 4HX7A 3SC7X 3ECHA 2CFXA 2FJ1A 2HI3A 1RINA 2VMFA 1OD3A 1LFUP 5L3CA 3M1HA 4IRIA 5DCMA 3JAMZ 3DCFA 2P3JA 4DW6A 1CAXB 5CAZA 2ZMNA 4LK6A 1VQ7I 2DVFA 1YCIA 2I07B 4QQLA 5FLXZ 1OPMA 4X8NA 1KQ9A 1YQ8A 3GBFA 4E7SA 4P9GA 4PFOA 2JPBA 1CWPA 3I2OA 4HK9A 2OZJA 4XUTA 1XSQA 2QKDA 2E1MC 1LOGA 4UYBA 2M7AA 2BEOA 4HV5A 1JU3A 2IXCA 3ZPYA 4OHYA 2IRFG 2N7GA 1UMHA 3H9JA 1JGSA 2AXTC 3O0VA 3SZTA 5BMZA 3LE0A 4ITVA 1TQMA 1IKQA 2WS91 2HEVF 5CBLA 2XBO3 2ZX0A 4NHXA 5EDNA 3E1SA 1FBQA 1N25A 5K5RA 2PMUA 2XH6A 2E1OA 3N7JA 4B8EA 4YW7A 4RHV1 1XYNA 2LROA 3A1YA 2QCOA 3JAMK 1PVC1 2JA7J 4HF1A 3SCFA 3S2HJ 1JYWA 5E89A 3ZMSA 1UG0A 3CU7A 1AR63 2QQLA 4XICA 1VRH1 5FQ0A 3I8TA 1HJGA 3I55I 3WE2A 2WT0A 4PLNA 2DVBA 4BLIA 2ZJCA 3NWKA 4IE7A 1Z67A 3RZLA 3IH2A 5I8YA 3GUDA 3REOA 2GXGA 1RKTA 3PUIA 2CWSA 4C1WA 3BOPA 2VZSA 2GSYA 1A31A 4EE2A 1WJFA 1RVF3 4AAXA 1ZZ6A 3UGHA 4FQ4A 2WQZC 3GYDA 1IZ3A 4R52A 2Q5TA 3U75A 5HDGA 5GAGJ 3FLRA 1AKHB 1GZ9A 1IUYA 1PMHX 5BNOB 3VBRB 2YPJA 3Q9VA 2P6SA 3ETQA 3ACIA 4KWLA 4RR3A 4DYRA 2BQPA 1YJ9I 5C3OA 3KP7A 3WE3A 4AIKA 2YBKA 1UHWA 2H0VA 3L2QA 1PJRA 4BA6A 1EV12 5IFTA 1SMTA 3GM8A 4IKFA 3D5SC 2VLAA 2BP6A 2Y6GA 1KU9A 3GYHX 3RYPA 3DECA 1FXZA 2CJJA 5IVCA 2J1RA 1H9TA 5FZ3A 4RD7A 2K9MA 3ABLH 5F0HA 3AG4H 2FMYA 1JYIA 1YITI 4NE9A 4MIMA 3GFMA 5LWBA 3M3OA 5ACA1 2VNRA 5K9YA 1PUFA 3WTUC 1BN5A 4NVPA 3PFYA 2GXAA 1ORKA 2HWE2 1S7OA 1S2EA 3K2ZA 3NVCA 4TZDA 5TRDA 2VXDA 4A3CJ 2R7FA 5LA9A 2WAOA 1DQ6A 4HT1T 2WY8Q 1NTCA 3MBWA 5FP7A 3FZ3A 3F22A 2FBIA 1IZ1A 4DPNA 4XLNF 1GZTA 1JBCA 2QDRA 2NOGA 1VQPI 2UY9A 2IA0A 3TO7A 5K5OA 2QDNA 2VE9A 3Q9OA 3KFWX 4MGKE 5FOBB 3CF5F 2KFDA 2VI6A 2HVQA 3H8RA 4FHTA 4DXSA 5C8CB 2K3PA 2PBIA 1YXWA 4FX0A 4E2GA 2VZRA 1W2TA 1KYWA 1EAH3 1LHWA 3BT9A 3I4NJ 2Q1MA 1RUF2 2GNTA 3WU2C 2C5DA 2OAZA 2A6XA 4IGQA 3W6KB 3IPVB 2ELHA 3BDDA 4K3UA 5FZ7A 4Z6YA 3VBHA 2VOXA 4LKFA 4ZZ5A 2ARXA 4U36A 3JRGA 3LWFA 2PQSA 1X3WB 1LE8A 3A02A 1X1DA 2Y6HA 3DQVC 3AJYA 1UELB 1OYYA 3L9FA 5LHGA 2E33A 4DYCA 1G8WA 2K0GA 3AZWA 3HQRA 2JRTA 3HPHA 3Q8CA 2GDFA 1I27A 4B3AA 3AX4A 3I4MJ 1US2A 1V4RA 1W0TA 1S2KA 4A3JJ 5EJ3A 4UUSA 3FBYA 2Z42A 1VFCA 1TT5B 2DA4A 3FXOA 3LEKA 4CCOA 4GYIA 3ZDSA 2P6HA 4L0ZB 4IHXA 1XQNA 2B4KA 4K40A 1QNWA 2GC0A 3MF6A 1Q43A 2WIIB 1LKNA 4M3EA 4XFCA 4CYCB 2HWC2 2OQ7A 4DY5A 2BXYA 4WM7C 4XE9A 4ZY9A 5T5PA 4CCMA 4M00A 2IVJA 1LHOA 4LKDA 4XIDA 3WOGA 3O0WA 1JKPC 3IAQA 2Q8EA 2NQYA 3DF8A 1RJ8A 3T1MA 5B1BH 1YIJI 5E88A 4F3QA 1ZG1A 1G3SA 4PDKA 3ZQLA 4FTHA 4FAHA 2HU9A 1R6RA 5FPAA 4Q4V1 4QQ2A 1JJ6C 2KDOA 4ENMA 2IA1A 1W9FA 2QSHX 3ABUA 4QAWA 1B09A 1N3OA 4CU8A 2O03A 2XSJC 1MEC3 1KU2A 4J01A 5FJHA 4DGWB 1SLTA 1EV7A 2P0WA 1IRFA 2E1CA 3J7HA 1YJKA 2XQXA 2VNVA 3KZ4C 1FIAA 1ZAOA 3LD8A 5DMYA 1TME2 2M45A 1PGW2 1AOYA 4S0HB 3GNEA 1OH4A 4I3GA 4O7XA 1OCZH 2FDIA 4YW6A 4P9FA 2HPMA 1AJOA 4FP2A 5IW0A 4GWNA 4GXOA 2OF7A 2CGNA 2JTVA 1SLLA 3S0MA 3CCEI 1REFA 4U0WA 1FP2A 3I2HA 2STWA 1YI9A 3ZQQA 2HYJA 1U0AA 4BS9A 1NYWA 1XU2A 3TKYA 4QKNA 2A75A 1HF0A 5CVIA 1D1CA 1DLLA 1FT9A 3FMGA 4PF5A 2ZHKA 2FF4A 1C8M3 3VGIA 1T2XA 2YG0A 3NAPC 1HV1A 4MO3M 4IEVA 2CV0A 1VQNI 5D2AA 3CUQB 3BJOA 2QQPA 2Y38A 3BZCA 1NK2P 4QGLA 3LQRA 1R082 4N8MA 4RL7A 1HJFA 3B5LB 5IP6A 4YSFA 2J7MA 4UI9L 5GM0A 3KCXA 3DU6A 3PTYA 3NJVA 3BP8A 3DWLE 2GIZA 5F7UA 5B4NA 4LBMA 4Q0VA 1POV0 3J7ZI 2K7LA 3BPVA 3H92A 3KS7A 5FY4A 1RUG3 1VBB2 1CAWA 3PIPF 4CDGA 4DZGA 4EEFG 3QODA 3GVAA 2WNVB 4BE1A 3L9JT 5A6QA 4LBKA 3DGTA 3HKZN 1V6KA 2LG4A 3UV9A 2R071 1PX3A 2X09A 2XKOA 1UCXA 4KH9A 5KC6A 4M4RA 3CF6E 2DYRH 3K77A 2B46X 1SVMA 3AM2A 5D5UB 2QNKA 3CJQB 4WV8A 3U1KA 3RSNA 1YFYA 1A35A 2RM23 2VTXJ 3WP3A 1FNNA 3AKRA 4IE6A 2HDWA 2YC2A 2BGOA 2XWJB 4IESA 1ZZBA 1GLNA 4EWAA 1YS7A 4CP1A 3CO6C 2CW7A 2V1UA 2A3XA 1XGSA 5D4SA 1XMAA 1W8FA 2M5WA 2GC3A 2EXJA 2ET7A 1W7PD 4LBJA 2G4IA 3VN4A 5JI9A 4V2FA 4CZSA 5JLVA 1F5JA 1WKYA 4XF0A 1TC3C 5A3WA 3AMMA 1TT0A 1IW7F 2R043 4Q4X2 1SQ4A 5FLXK 1IPKA 1JW6A 3C2GA 4MHRA 3OSFA 1R093 2IW5A 4OMYA 4YG6A 4RAGA 1H8TC 4QQOA 3NQHA 4QXBA 4CO8A 4XOGA 2HS5A 1BC8C 2R5ZB 1W2NA 3WCSA 4DB5A 2HTJA 3W2VA 1QJU2 4W6YA 5EQUA 1GQGA 2IS1A 5E1ZB 1F9KA 4MXVA 1C1LA 5FZAA 2PXJA 2TCTA 3VDDC 1W9TA 1LOFC 3FUOA 4XF3A 1OD5A 4W50A 1U8BA 3OYIA 2H94A 4YIRX 3DV8A 4XJ8A 3BTJA 4NAOA 1SC7A 2XAGA 5FZGA 2H1LA 1AHDP 1ASJ3 5IYCJ 3MKWB 2RN7A 3F21A 3FN9A 4FPJA 4NMIA 5EYYA 4EQVA 1BR2A 4NPRA 2Y0SA 5AC93 4UB8C 1RR8C 3LFUA 2BXZA 1K4SA 2PMWB 3OGSA 4AGGA 4Y13A 2SLIA 3AK0A 2YSRA 2L2OA 4PDWA 2KA3A 1SG3A 1DFQA 1NA1B 5GALA 3JTGA 3THPA 4XACA 2E51A 1YFHA 4A93J 5TGTA 1SFPA 5FO7B 1W36C 4UWDA 4A7YA 3LIHA 4EM2A 4TN7A 1S0CA 1QH7A 2CQXA 3K4KA 2FU4A 3ZQ7A 4KGQA 5GZEA 5L7OC 1W2AX 2G9FA 3AFKA 2XB5A 5BQTA 1POV1 3MKZA 3WHTA 4BBSJ 4ET7A 5HV0A 2CW0F 4EN7B 2Y30A 1AX1A 4PIZA 3NAPA 1CR7A 5FKLA 3N9OA 1LESA 3WW1A 4EMSA 2XMLA 4GMP1 1PM7A 2EIDA 4D7YA 4V1PA 1EA3A 4W8JA 2FDKA 3IAS2 5F0CA 3T4VA 2DVGA 4P9YA 4XYXA 1KONA 3OD4A 2RV9A 3LB9A 4BXUA 1Z05A 1TNRA 4OZOA 1WJBA 2GU9A 4MTEA 2E2HJ 4FFGA 3MYXA 1RUG1 4W65A 3J4UH 3WNMA 1B9NA 1EPZA 1PMJX 4XW3A 3TW6A 2R7WA 1UY0A 3JREA 1DQ0A 4RBOA 2PLV1 4QLCU 4CDUA 2WINB 1XTAA 4GRIA 3SHRA 5DUVA 4KITB 3LSRA 2CS3A 2XB0X 3L2VA 2CV6A 3HSEA 3KEQA 1BHGA 2EA7A 2L7KA 4RS8A 5FKMA 2JG9C 4MHGA 4N4OB 4JV4A 4LBQA 4JQRA 2ZKZA 3A03A 5FPXA 3V0AA 3IB3A 4MFDA 1FP1D 4KBBA 4QX3A 2LP0A 3LPGA 2V1XA 3FHZA 5FZDA 4A3IJ 4ZZDA 1MMDA 4JBAA 4BQ1A 1XYPA 2D40A 2RS13 3FWEA 1EH6A 2XF5A 4UV8A 3N9LA 2KLOA 5K7ZA 2HPIA 4YG2F 3RNSA 2V4JC 2E26A 2P17A 3J7MA 3U78A 5IAXA 1OA2A 4QDSA 3ZN6B 2IA2A 2E1NA 1UYXA 2VCAA 2YV8A 3H1YA 5EV7A 1BLZA 4CE8A 3WDUA 1E3HA 1MQTB 4QPWA 2E35A 4DXRA 4OI0A 3C7JA 5FYYA 4CCNA 1MDMB 1ETXA 4XZPA 3SFIA 2DYCA 5EGOB 4A6SA 1W03A 1F31A 1WA6X 2A5YB 4WXDA 1TL8A 3V8KA 3LFKA 3QCWA 1LFPA 2VMHA 3CHXA 4C1XA 4P9JA 2JG9B 2ID6A 1D5VA 2ESHA 3GLXA 2A69F 1W0PA 1WGXA 1ERDA 3B3QE 3WLUA 1EH7A 3HOXJ 2WN2A 4OMCA 5IT3A 3VBHC 2JVHA 1UY2A 1BC7C 3E6DA 5JZGB 1HB1A 3HRTA 5F1JA 3V4GA 1LOAA 1AA7A 5A3LA 5DCFA 3ZN4A 2VULA 4BHCA 1X3UA 1J1LA 3RZMA 2DCYA 1JJ8C 5LHHA 2ILMA 2J1UA 4A6OA 2D6LX 2XJVA 2PHUA 1ZYRF 4KN4X 3ABTA 4RGRA 1S1AA 4NO4A 3K4JA 4FPFA 4INDA 5L3FA 4MEYF 1U6GA 5IPAA 2CMPA 3M7GA 1YIOA 2LRDA 2CTVA 3WTXC 2A5ZA 3OS0A 5TSWA 2F4OB 5C9AB 1JN2P 4XLHA 1FMVA 2ZXHA 4A0YA 5EYXA 4BE3A 3Q0WA 5GPAA 4FQZA 3LSMA 5A32B 3M8EA 3ELNA 1W4MA 2IWGB 2VL8A 4R1HA 4EN9B 4QSHA 5LBFA 2RM22 4B4RA 3D3AA 2QBYB 2ECBA 4XJUA 1W6MB 5KXDA 5L3DA 4O9GA 4XIOA 1UY1A 2DA6A 3ZXGA 1U78A 1FNZA 3RYRA 2D43A 1CF7A 3OSDA 2WV1A 3CMEI 2VOPA 2IGNA 1GNZA 1F5FA 1DBNA 3MI8A 5T50A 3S30A 4WM8C 2K27A 3HG9A 3LGRA 1NCQA 2DA2A 5FZCA 2DODA 2DCEA 2A3WA 4QTRA 1NLRA 4Y24A 1CESA 2A6EF 3BTCA 4IPAA 1TVGA 3ILFA 4MXWB 1BBT3 4IETA 4JDOA 4QM8A 3CMYA 3BPXA 4XN3A 5H20A 3BU0A 4JK1X 4N43B 1OJLA 1DZRA 2VW1A 4Q48A 4LOSA 2LBFA 1CAUA 2EIBA 3S6PA 3OWTA 1R1UA 1E57A 1H2LA 4UB6C 4QKBA 1IV8A 3BTYA 3H0OA 1B8IA 4ZU5A 1IDYA 2HQRA 4Y26A 2VJ4A 3O12A 3HN3A 4GKYA 1PGW1 1W5TA 2Y6JA 1ZA4A 3WUCA 4WF2A 4ASKA 3SEZA 2WA4A 5D6FA 4S2FA 4N53A 3CMGA 3MIDA 3J80Z 4UHTA 2WZR3 1XPXA 4DXZA 1O7FA 2W46A 2UWMA 4YM2A 1TWAJ 3VKNA 3KGZA 4FFIA 1H89C 2NVQJ 1B35B 3U1DA 4BJ0A 1OOPB 3BY6A 1RRJA 1LEDA 5J1XA 2R0HA 3OY8B 2ZMEB 1IS4A 3MICA 2ISZA 1U0JA 2VN2A 1L3LA 3VUOA 2EFOA 4FTSA 5ERIA 1X9TA 5K7PA 4GYGA 2LF7A 3BR0A 4GIQA 1PP7U 4IHWA 3OBAA 4W1UA 2FMDA 1E5IA 1BVVA 5IVBA 4DOUA 5FZOA 4KYWA 2VY0A 3F9KA 1JZ5A 4CTEA 3G2BA 3DEEA 2BHYA 3F8NA 2DV9A 1OFCX 3VODA 1NH3A 3C2UA 1KU3A 3N35A 4UFMA 3RMYA 1JZ3A 3S3OA 4L9NA 3ZFGA 3HEFA 4GJZA 1WH5A 2ES3A 1RB8G 2JSCA 1J0RA 5E1RA 1JT0A 4H4KC 1UWWA 4LNVA 4E7LA 3K3NA 4XJAA 4P9LA 3IDBB 4LOTA 3QWLA 3HQUA 4P9WA 2VVFA 1GXQA 4OUSA 3EJKA 4I0AA 2VW0A 3R4SA 4CUCA 2WSVA 2XOMA 2XBO2 4DZPA 4LJHA 2X6WA 4G4FA 1LGBA 4KG8A 2EALA 3W58A 1PUEE 2VCCA 1RUF1 2HOTA 4GH4C 2WN3A 4IQPA 2XC7A 1ZBA1 2MD0A 5K7FA 4YNIA 2CQKA 1JS9A 3H3LA 1BW5A 1US3A 4ZTJA 1YW8A 5BOXA 1QOSA 4OQ9A 1CD3G 4AHYA 2PMHA 3LDRA 5LD2C 2DFFA 1QMJA 4JAAA 3K6GA 3CCJI 3CMMA 4V19K 2E7QA 4E8CA 4H7MA 1ZZ8A 3WW2A 1YO8A 3ZFGC 1IXRC 4LB5A 4XONA 2K02A 2W57A 1L3JA 4XEZA 1B72B 2VU9A 2DAOA 3E6MA 2EV0A 1CVNA 2GN3A 1XE8A 4KMQA 4WZCA 1ZA7A 3RJPA 2VQUA 2EFNA 1RUJ1 1T56A 5DG1A 2G9WA 3ZSLA 3H3ZA 4OULA 3PNYA 3SCHA 2B39A 3WCRA 4IHTA 3QU6A 2IXLA 1DDLA 3PQJA 1SBDA 5D4RA 3CCVI 2K9LA 3SJMA 1NCRC 1FNYA 4UFJA 2WT1A 1Z6RA 2VMCA 1HQCA 4E4SA 1V9U1 5GZGA 1X4OA 4K7JA 4CU9A 3T1BA 3PUSA 2QCSB 3CCSI 3SKVA 5ACA3 1REEA 4HQMA 4XBNA 5FFXA 1KS5A 4HDVA 1KDMA 3HOVJ 2KJCA 4P5YA 2ZGMA 4YFKF 4QXHA 1AXZA 3HOYJ 4QPGC 3M8LA 4AWDA 2Y6LA 4QDQA 4GO1A 3N9NA 5B2GB 1W0NA 1UNBA 5FP8A 1W9YA 3FJSA 1WGPA 4LK1F 2EFQA 4Q2FA 2I2SA 5FYMA 5A3UA 5GAEJ 3MLJA 3VD5A 2XAQA 5FLMJ 3VKFC 5BS6A 1AKHA 1Z1DA 2E32A 5DAWA 3OOXA 2QUFA 5JPMB 2WAQA 2P34A 1DLCA 3RZDJ 4CU6A 2MH9A 3FXUA 4ES8A 3AMQA 4JGYC 1W90A 5FGMA 3CJTB 2W94A 3PQKA 5EJ1B 1DGWX 1W28A 2RM21 1VQKI 1JHNA 1BOBA 2EB7A 4D0QA 1LOBA 2BZDA 2XGCA 3OGRA 4CCDA 4AM3A 1RUE2 3GXUA 3S7IA 4I3PA 2EV5A 4G6TB 4YGEA 2Z4FA 2ZPXA 4NIIA 3ZIWA 1W8HA 1V5FA 5AFEA 3NAUA 4KI5M 2B9SA 1JUIA 1EUUA 3ETPA 3GX4X 3BZKA 1ZH5A 3DPTA 2C9KA 4UNOA 4IV3C 1FOYA 3WODF 3K7AJ 1TME1 1YS6A 1W2OA 3F8BA 2GALA 1H2NA 2FNPA 1O4TA 4V2GA 1HDDC 3AXDA 1K7AA 2V7FA 3OYCA 3RVHA 2N8GA 3ABMH 5FPLA 2JDNA 2F5VA 4Y3OA 3R4UA 3BG5A 4LEJA 3EO6A 1QU3A 1Q1HA 2FX0A 4XLAA 3JTHA 3ZR6A 4OMDA 2L54A 1NQJA 3J81K 4NDLA 5HODA 3RZOJ 4MSVA 4Q4V2 3WTVC 2YU9J 4XUOA 3TNPB 4B09A 2V6CA 1ZRRA 4AVVA 3LFIA 3KMHA 1F4HA 1XMXA 4UVBA 1ND2A 4A45A 3UL2A 2HBTA 3K4LA 4GWIA 4RB2C 2VC9A 4DUXA 4OFGA 5CVRA 1S55A 3THTA 4H3WA 4OI2A 3O2PE 3J80K 2OS2A 5T54A 1R1A1 3VDDA 4JCKA 1L7QA 3ZXKA 2A68F 4QWNA 4U7DA 3T2PA 2WYSA 1JZ7A 1FMD2 2ZB9A 3MFAA 2GLOA 4AD9A 2BBAA 2HYXA 4NUBA 1PUFB 4OWRB 1W04A 5I93A 1MZBA 1FOXA 1DHKB 3K75B 4Q5SF 1HA8A 2RAEA 3KB5A 5C4WA 1J3PA 4XMIA 4BQYA 2JKBA 5T5JA 1UMQA 1AR61 1OF3A 4KU7A 1XGMA 2EWNA 3AL0B 3I59A 4C3IJ 5FRMA 3L00A 5KCMA 5HCFA 5ANQA 3PJQA 2WRAA 5FB2A 3CUQA 3E5XA 3PFIA 4L9TA 3POEA 4E7JA 1R64A 4PIXA 3M70A 4GKXA 2QA4I 1AX0A 1VBA2 3TOJA 1LFBA 4M9ZA 3CIHA 4F91B 2XXZA 3QPSA 3DXTA 3H1WA 2GH2A 1AZDA 1TEIA 1CN1A 2OU2A 4HDUA 5EEAA 1TMF3 2E31A 5L9VA 4AI9A 1K12A 4JGYA 1W5CC 4X6RB 5GZFA 1ACIA 2W1OA 2ET1A 3WQ0A 2Y2ZA 3W5NA 1ST8A 4AG4A 4D3WA 4EJVA 5BNNC 2R6QA 2VVEA 4ANJA 3VBHB 2WNVA 3OOPA 2ARAA 1F35A 1HSJA 1OBNA 4K20A 2X5IA 4UFIA 3K9TA 3NNMA 4AVZA 5GAHJ 4MO7A 3SXYA 2ZXJA 3ON7A 1PNGA 3RTRA 5IVJA 5DAPA 4LB6B 2ELKA 2DYSH 5CIRA 3WF2A 2EAAA 1RR7A 2DDBA 4Y22B 4G8XA 1MMGA 1J59A 5FP9A 4MV2A 5GZCA 3AL0C 3WDXA 2Z1DA 1FPN1 4HF0A 3HJRA 4Q4W2 1KEXA 1NZCA 2VPLA 2YFZA 2CGOA 4RGXA 3BJAA 4PHZA 4BKXA 4YVSC 2XPUA 5LASA 1PDNC 1Y43B 2DVDA 5ILSA 2KRFA 3KQRA 3KT1A 2PMZN 1KA8A 4E7IA 1S0IA 1BA5A 3HT1A 4RM2A 2HDDA 4F7ZA 3CC4I 1EY2A 5KHIA 1HSTA 5FLIA 1MZ5A 2X48A 2WQ8A 2ICWG 3DN7A 4NC7A 1O6UA 3VZJA 2WR9A 2VE8A 5CISA 5IYYA 2FD8A 1YFWA 5DS9A 4WVWA 5C4WC 4BDVB 1D7PM 2YUEA 3ELKA 2QFEA 1PVC3 3VBOB 2G1MA 3OY9A 5FUPA 3TMOA 2V4VA 1QXPA 3HJEA 2AEYA 1STZA 2UXNA 4A0XA 1GV5A 3I2FA 1AR93 1GZWB 5FY0A 2LREA 1W6OA 2VO5A 4AFMA 1IQAA 5CEHA 1MEC2 1WBLA 2PX9A 1Q1VA 1FOD2 5FYCA 4QB1A 5D6EA 4XTPA 2PAMA 2ZGRA 2KIQA 1IGOA 4XQFA 1BJZA 4LLGF 1XU1A 2P8TA 4XFAA 5FYTA 3MPBA 4XQWA 5FZ8A 2IFWA 3VKLA 2DLLA 4HW0A 3H8XA 1TNFA 5JOWA 3RCOA 1UU4A 4FBFA 4NIHA 2HTSA 2WWYA 3JRDA 2D6NA 2ZHMA 2CV2A 2DA5A 4HAMA 1O59A 3GTLJ 4RQPB 2VJXA 4J00A 4IHSA 2RDNA 5JSPA 2BRTA 5L36A 3NJYA 2DFHA 4NIGA 2DURA 2AC1A 3CC7I 5D8AB 1QJFA 2VQAA 2A6YA 5DEQA 4MGZE 1OCCH 1OQYA 2HXOA 5CB7A 2ZGNA 3WQ7A 2ADDA 5FJ8J 4QXCA 2F5FA 4B7EA 4RAFA 4LUKA 2XASA 3ZYFA 3MV11 4QMAA 5J7MA 3LEMA 4W6XA 1JUSA 2DJNA 1QBJA 4LBQD 1K6YA 2FA5A 1DG6A 1OCPA 4L99A 4IEZA 4F52A 5C4WB 3VPRA 2FCVA 1A36A 1XYOA 1WLWA 1R083 2V5DA 3ZYRA 4YFZA 3WG7H 1W8TA 3HRUA 3G4SI 1SPPA 5B66C 1MS9A 1OKOA 1FPQA 2E36A 5BNNA 1W6QB 2WB1N 1REDA 3KYLA 1BBT2 4QU2A 3ZFEB 4YGDA 4YIIA 1VJ2A 2DA1A 1K83J 2VQCA 3KLNA 3P3PA 3KV9A 4ZTFA 2JVGA 3SH5A 3RWNA 3UESA 3HAGA 3QOPA 3ZFFA 4NB5A 1AR73 1LODA 3TYJA 2QQVA 3KYCB 3V0AB 3WVJA 4YG3A 3OEBA 1AWCA 4R9BA 5ISLA 2FUG2 3VOEA 2GOXB 4DBRA 4FPGA 2ZGOA 5IYBJ 1S2BA 3FX3A 2JJ6A 5DD4A 1PK6C 2VR4A 3VLBB 3DLAA 3ACLA 4GZ9A 4LO7A 3TDZC 2Z9OA 3D0JA 1IOAA 1MKMA 2O9LA 2DU9A 2D97A 1IKPA 1I3QJ 1XMKA 4M3CF 3JU9A 2CO5A 5FO5A 4A5MA 4IW3A 3S16J 3BPZA 2IJLA 5LA2A 4XKBA 1MNDA 1PIV2 3OMYA 1XSVA 3IUOA 2A6VA 1WI9A 1AVBA 2QSGX 2K9QA 2MD5A 5B1AH 3HD8B 2WTEA 1UZWA 1FI2A 1FV3A 4CGZA 2L4AA 4UFKA 1TZOA 4CDXB 3RZHA 2HQ5A 3UNGC 3O3KA 4XOTA 5FIXA 4XHXA 3FLTA 2M34A 3D4KA 4CDWB 5DM6F 1VQOI 3EBRA 1Z7UA 1QY4A 5A1AA 4PI0A 1L7RA 2MLGA 2DT7B 5EG0A 3MIGA 2C4XA 4YZ5A 1GV9A 2VONA 3VBFB 3U21A 4AFDA 1BI0A 2XRNA 5F6KA 4F92B 1HB3A 1QNYA 5FZLA 3FK7A 4ZPIA 5FRNA 1QJU3 2XKPA 5DDJ3 1O3RA 1WJDA 5T3NA 2BJSA 1TE1B 5L3BA 4R4XA 3BUCA 1WW4A 4B1LA 1SFOJ 1MJAA 4L9JA 3N9MA 3H5NA 5LRRA 5BY5A 2X85A 5J1UA 1Y6IA 2OPKA 4ZXEA 5A7PA 1H1MA 1Q8VA 3C7GA 3AZYA 3ZMOA 1Q56A 1UX6A 3S15J 4MQ9F 1C1FA 4FPEA 1ON1A 3CLQA 5K8SA 2R7RA 1BXHA 3K46A 1GQHA 1G9CA 2BYVE 3PJRA 1ULOA 2AQEA 2RQPA 3F6OA 2KR2A 4MTDA 3FHNA 5CFDA 3K70C 1UOFA 2CUZA 1MJ9A 1T2KA 4Y52J