3LA3A

Crystal structure of ntca in complex with 2,2-difluoropentanedioic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSRQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 58
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la3A01
3TO6A 2JPBA 3WU1B 5E1RA 1IAWA 2XUBA 2JT1A 2HS5A 4U7DA 1PUEE 5AIPA 3FHZA 1W7PB 3CDHA 3Q5FA 1JHHA 2Z9OA 1OYIA 2HYFA 4KMUX 4J1WA 2V1DA 5HVQC 4M6YA 4RGUA 4HOBA 4I01A 1J7KA 4BHPA 2O61A 1YQAA 2O03A 1J0RA 2VPVA 3UKVA 4DINB 3DFGA 4FX4A 1VP6A 3CJNA 3J80Z 2ZXJA 3LAPA 1JUHA 4EJOA 4A5MA 1QBJA 4KIGA 1H9TA 3RPUA 2OQGA 4XF9A 2XLAA 4NHJA 2RDPA 3PFIA 4LG0B 2EA2A 3GFJA 3JW4A 2B5HA 1IXCA 4HQEA 3PQJA 3IDBB 1LEBA 1MD0A 4KUMA 4ETSA 1G3YA 5BOXA 3SMHA 4U7BA 3BROA 2EWNA 5CADA 4UXAA 4EVIA 2C0ZA 3L7WA 1O3QA 4META 4O3MA 2O0YA 3LZZA 1U8RA 5HS8A 3FF5A 3K9TA 1GXPA 3ABTA 2XAQA 2BV6A 4HAMA 2WV0A 5FB2A 1EH8A 2XRNA 4WBBA 4WVZA 3K1MA 4M9XA 2RQPA 2HFHA 2VBWA 3PQKA 3DPTA 2P7VB 2HZTA 3U2RA 3BP8A 5JSPA 1QQIA 1QPMA 2JTVA 3HTSB 1R00A 4J1XA 3GYHX 1ZZ6A 1ZZ9A 4KN7X 3RJPA 1O5LA 5EEHA 4BHCA 3ZDSA 2D2WA 2MLGA 3OD0A 3V8LA 4LK0F 1T39A 4IEPA 2CYYA 2ESNA 1IRFA 4O9GA 1D8JA 3KP5A 4KIFA 2XAFA 2L3DA 3BPZA 4XETA 2HGCA 3BY6A 5BMZA 1Z1DA 4I0AA 3H7JA 1R36A 1RIOH 3L2CA 2IXCA 4P9GA 1BIBA 1LDKB 4GXOA 2KIMA 3QU6A 4Y13A 4EQQA 2W24A 5D6EA 4IXAA 1CAVA 4AQ6A 3H1YA 5JVTA 3WTXC 3DV8A 4G8XA 3V8JA 2IA0A 3WTZA 4HZFA 1X7NA 1BM9A 1MKMA 1ZRCA 1R5GA 1IXSB 3LQRA 4Q4ZF 3T1BA 4HSJA 3HHHA 4HMZA 5LGTA 3F22A 2E9QA 1KU2A 2VODA 5JAXA 1BBYA 5JFRA 3FHIB 1T0FA 3DQVC 2IXHA 1BI1A 1ZZBA 4IEVA 4D7SA 5CJ9A 5BPXA 2IT0A 5FLJA 4G7HF 1B59A 2W85A 1ZGAA 4RGXA 2A69F 4HN0A 2FQ3A 3VODA 1WSUA 3HRSA 5DDGA 3IDCB 2BE5F 5E1WA 1UD1A 1KA8A 2E7XA 3I0TA 3CJXA 2EK5A 1UHMA 4MGRA 4YARA 3N4MA 1C0WA 2ZKLA 2UXXA 1ZN2A 2V6CA 4FAHA 1RI7A 3MCZA 1B6AA 4IVNA 1LB2A 1REPC 3H92A 4HX7A 1ZLJA 2ZNYA 2IA1A 2FMYA 4L9TA 2TDXA 1XCVA 2UYBA 2FBKA 2FF4A 1UPIA 2F4PA 2XKOA 2X0LA 2EV6A 2F5CA 1QO0D 2DI3A 2ACJA 4G6QA 3RTRA 1X8MA 4MEXF 4JTOA 5E18F 1F9NA 3RPQA 4LGWA 1R1TA 3RKXA 2OZJA 3L00A 2VE9A 4AIHA 1MGTA 4EWDA 1SQ4A 4D0PA 1Z05A 2KJCA 4HW0A 5JI6A 2MNGA 5ED4A 4XLPF 3UKTA 4AVCA 4PZJA 4HLTA 5BY5A 4QM9A 3JAMZ 4XBFA 4HDVA 1IPJA 2CG4A 2X4HA 1TW2A 1DPRA 4KMFA 4ZU4A 2XL7A 1KQ9A 1O5UA 3I53A 5FLIA 5L3BA 2DBBA 2EFWA 3MAJA 5L3EA 4UBGA 2CFXA 2M45A 3I59B 4MGYE 5I0TA 2L01A 4KA4A 4FAGA 3VEPA 4BAYA 2QM3A 5E1XA 2QZ8A 1ZZCA 2QNKA 2RKHA 4L11A 4EJVA 1NYWA 2DPUA 1SFXA 1QXJA 2LKPA 1J59A 2M87A 2WC2A 5LRSA 5H6QA 3HYIA 4NB5A 4G7OF 1S29A 1FT9A 2FRHA 3DKWA 1J75A 2BGCA 4YFKF 1XSDA 4MUVA 2D40A 4Q0VA 2Q2EA 2CV6A 4LEJA 1SFUA 1ZRFA 4OIOF 3IWZA 2F5DA 2FBIA 3KEQA 3OGJA 4MQVA 2H6BA 4OINF 5HDNA 4RGSA 4EM1A 4L18B 1Y0UA 3CF6E 2WTEA 2P4WA 1MJAA 2DT5A 3D5LA 1EP0A 3HHGA 3D82A 3EUHA 2HQRA 1KU3A 2LF8A 3NSTA 3GBFA 4G7ZF 5L3FA 4F7ZA 4EGZA 3SHRA 2ZCWA 3KSCA 2A07F 2OAZA 4QGLA 3EYIA 1FYKA 4XFIA 1ON1A 3S0MA 4IRIA 1J3RA 1BC8C 3FWEA 3ZN0A 3KFWX 1DDNA 1TQIA 4XF0A 1SMYF 4MHGA 4XLNF 3UKNA 4IEQA 1X3UA 5T3NA 3F21A 1KQ0A 2E1NA 2P5KA 4BIFA 4KWLA 4EWEA 3J81K 2VT2A 1OI6A 3F8BA 2G7HA 1Z9CA 3RYRA 4QGMA 4HQMA 5I0UA 2QQ9A 2GZWA 2LSOA 3FE5A 3ELNA 3KZYA 5DV5A 3I64A 3RKYA 4ZYEA 5IT9Z 3FX3A 1OD5A 4PJYA 4FHTA 3WTSC 4OIPF 4XF3A 5DCMA 1XN7A 1ZH5A 3WGIA 4OFGA 4HVQA 4S05A 4WCGA 5E8GA 4P9UA 1YS6A 2VBXA 4IEXA 1ONVA 1YLLA 1OYYA 2QBYA 2QVSB 1IN6A 2NNNA 1ZYRF 3SQNA 3FXQA 3DP7A 1FYLA 2KJBA 2O3FA 3H50A 2V9VA 3HSFA 2ZMEA 2DCTA 3F8FA 2UYAA 2FNPA 1H0MA 2VBYA 1U5TC 2GA2A 4ON0A 1T98A 1P6RA 1W5SA 4U88A 2PTMA 1WRJA 4QXKA 3BOQA 2XROA 3HT2A 2UZKA 2FBHA 2W84A 4A0YA 5ICGA 4XEZA 1SD5A 4IRGA 5D1IA 1MDMA 3DF8A 4PGHA 1YYVA 1XE7A 1CAUA 5D8KB 4PIYA 3WW4A 1XDUA 4CHUA 2HTJA 2BNNA 4YYOA 1S7AA 4HX4A 1D5VA 4PCQA 2EAAA 5JCTA 3H1MA 3BCWA 5K1YA 4A0ZA 2R7DA 1WKMA 4KN4X 5DUIA 2D5HA 4LLOA 3E3VA 3S7IA 3KLNA 4L5IA 4YFXF 4OMZA 1V70A 4AIJA 3HUGA 3CUQC 3HSRA 1ZNPA 2K86A 2MH9A 5D5VB 3QRFF 5BUVA 3GXOA 2OPKA 1B4AA 3ES4A 3V7CA 2PAKA 5L3CA 5J7MA 3FXRA 2GXBA 3O14A 1IW7F 4WWCA 3GWZA 3REOA 1U5TA 4LLLA 5IT3A 3KLOA 4WXHA 1IZ1A 3J80K 2R7FA 3L9FA 5BS6A 3WTUC 4ESBA 3BJOA 4JK1X 1RUNA 2PHLA 3CO7C 1HKQA 3HRMA 3V8KA 5FDBA 3EETA 4ZH4F 4JV4A 5HDKA 3FJSA 2DQLA 5HOOA 4H0EA 3C3WA 2M30A 1QY4A 2VOPA 2PQQA 2XLGA 3E6MA 3H7YA 1I6XA 3SHFA 4L9NA 1SFEA 2COMA 3K1NA 2PAEA 2A3SA 3CEWA 1L0OC 1X8EA 4GCVA 2XVCA 1CF7B 1SFNA 2OA2A 4A12A 4MZUA 4QWQA 1XE8A 2XGXA 4EJTA 2HKOA 3CUQA 4X6RB 3LA3A 3MEXA 2GC2A 1PM7A 4M74A 2Y0MA 3D0JA 2P6SA 3IL2A 3I54A 5FFXA 4HBNA 5D8LB 4KL1A 3M8FA 1KGSA 1TLHB 1W7PD 3IWFA 4UVCA 4FT8A 1E17A 5KK1A 4WX9A 4MX3A 3IHUA 1W5TA 2PFBA 4N9HA 4O6JA 4LB6B 4M9SA 1QWRA 3QAHA 1V4RA 3NW4A 2Z99A 3VHRA 3EQLF 4EGYA 1HXDA 2ATFA 1HSTA 2FQPA 1D3YA 1OMIA 3K2ZA 1WGPA 5FLHA 2ZKZA 4MTEA 5KBFA 1LJ9A 3BDDA 4MEYF 3FXUA 3IKVA 4RB2C 1H1IA 1CX4A 1FXZA 3KP4A 1S6LA 5FD5A 2VECA 3LAGA 4JVAA 2JPCA 4BXUA 4L9JA 4XFCA 1P4AA 1TQPA 3HRTA 4KT5C 4GULA 1YFUA 2YX7A 1Q43A 3H3ZA 4LA3A 3GFLA 2E7WA 3HT1A 1ZLKA 3OCPA 2RC4A 3QP5A 3WU0A 4CZZA 2GH2A 2NNYA 3WW1A 1MJBA 1XB4A 1GXQA 2IXIA 1GHCA 3TGNA 2PA7A 1H9GA 5I91A 1FI2A 2L4AA 4AQ2A 3IC7A 1BJAA 1UW8A 3OTFA 1MJ9A 3COAC 4U0WA 2RN7A 4CYDA 2DQRA 3EDPA 3LSTA 3N97A 2IXJA 2KXLA 3BWGA 4HN1A 3TO9A 4P96A 1UB9A 4PIZA 1FSHA 3WTWC 2B0LA 1RUOA 3R0JA 5DEQA 2RGVA 3C7JA 3ZP5A 2VC0A 5FLXZ 1R1UA 4GYGA 4EJUA 4U0YA 1DGRA 4YIIA 3Q9VA 4HA8A 1S3JA 5E20A 3RIRA 4YSFA 3NRVA 3ST7A 5D5UB 3AAFA 3OF1A 5ERIA 2XAHA 1I27A 3FM5A 2IVMA 2VE8A 2WFPA 1TTYA 1Z7UA 4ESFA 4IHTA 1JXSA 2ZNZA 2IW5A 5E1ZB 4A0XA 3ZMDA 2PJPA 2CSOA 4XSXF 2PLYA 5FPZA 2IA2A 2RVCA 1UIJA 1AOYA 2F5FA 3JTGA 1XMKA 1QZZA 5C6CA 3TNQA 1JHFA 5FO5A 1CAWA 5CYVA 1XRUA 5H6RA 5JR3A 1HW1A 5LLQA 1R58A 2ETHA 3ELKA 1XGNA 1IXRC 1FBSA 3ZMSA 3JAMK 4L0ZB 3V7SA 5I0SA 5J8FA 2QYOA 1RTVA 1KQ8A 3DEUA 2IXLA 3HQXA 2UY9A 3QP6A 3CLOA 4IEWA 4DNCA 3E6DA 3EQEA 2Q30A 4HF1A 4MGKE 5ILSA 3PNAA 5J48A 1I1SA 2P8TA 2H09A 2CGPA 4HVRA 4WXCA 1NZCA 4LFUA 5KHKA 3GZ6A 1F1ZA 1YWKA 3ISPA 2D1HA 5L3GA 4XF1A 2JZYA 2D1VA 1FZPB 3F8MA 2DLLA 2BNMA 2ZMEB 5EZWA 1ZAOA 2DU9A 5J6XA 1YFWA 2VC1A 2PG4A 4MNUA 1RC6A 1ODDA 1SD4A 2P6TA 2UXNA 5HI0A 1RNLA 2EFPA 2IPQX 2DK5A 2BEOA 2V1XA 3USSA 1W7PA 4U0VA 2LNBA 1STZA 5FQ0B 3H1WA 3CUOA 4KWKA 2K27A 1SMTA 2YR2A 1WI9A 1HW5A 2HQNA 4BQAA 4S04A 2C6YA 1CAUB 2QQBA 3NKTA 1XCBA 3RNSA 3RKWA 4D7TA 4IF4A 1J3QA 5HLIA 1DUXC 1Z6TA 2GIVA 3LWCA 3EO6A 1K78B 4E2GA 1BI2A 4LLNA 3M3IA 4LG0A 2OQRA 2QUFA 5I93A 3GEZA 1K6OA 1X82A 5FGMA 3TQNA 5LHGA 3QU3A 3V4GA 1WA4A 4NVPA 1YO5C 3TNPB 2VXZA 1NE6A 3CTAA 4M72A 1ZG1A 2UWMA 3SCGA 3FMQA 4ZZLA 5ILUA 1UCXA 3GFIA 3ZMVA 3L09A 1U5TB 3IIAA 1BN5A 4N0BA 1O4TA 1MZBA 5BQTA 1LNWA 4HF2A 5IT9K 2IJLA 2KKOA 3IRRA 2Y48A 4B8XA 2EV5A 1JGSA 3F3XA 5D6FA 4L9VA 2HWVA 3C18A 2DW4A 4P55A 5KHGA 2YSRA 1YLFA 2J5PA 3KETA 3SZPA 3C3VA 5JR7B 2H0VA 4RAYA 3GVAA 4GYIA 1YFXA 2A6EF 4Q0PA 3I58A 2JRTA 2CW0F 5FFZA 3JSOA 4K8FA 2XLFA 1WWXA 3G7DA 1GQGA 5D4RA 4YIFA 3T8RA 4E70A 4MQ9F 4ORFA 1TNTA 4I09A 4JTNA 4JQFA 4GO1A 1KU9A 4G94A 2MD5A 5D4SA 4ZU7A 1EPZA 1WLTA 3VFZA 2M8EA 1YFYA 4XFBA 1SD7A 3K0LA 5LGUA 3MPBA 1Z91A 3NQOA 2MH2A 1LVAA 1P4WA 2ISYA 2J5OA 2V09A 4JBAA 2ISZA 3WW3A 3LA2A 1UCRA 1XGOA 3U11A 4YRDA 3HSEA 5H20A 3BZ6A 1QXRA 1O3SA 4ENMA 3ULQB 1FP2A 4KU7A 3P9KA 2PAMA 2NYXA 4KDPA 1XDSA 3GF2A 5HS9A 3WE3A 3GW2A 2GC0A 1PDNC 3BALA 1EYBA 4HDUA 2XASA 4M9ZA 3MFKA 4R79A 4LA2A 5AONA 2YX4A 1OFNA 1K79A 4RAZA 5F6FA 2RV8A 2GQQA 3LA7A 2CO5A 2K9ZA 4WZCA 1O7FA 1T2KA 1K7AA 2HDCA 4MGZE 1FPQA 3EBRA 3RZZA 3M7GA 1HKSA 3LOIA 1I5ZA 3V7RA 4AVPA 2D93A 4BYYA 4I2OA 1G3WA 4XFHA 5JSRA 1YW9A 4IERA 1CGPA 2XAGA 5A2QZ 4CDGA 1H1MA 2HR3A 1USSA 2PI0A 1ZREA 4P5OA 1IN7A 2EJRA 3RYKA 2LDUA 3KZZA 1CAXA 1TQMA 1SD6A 3M1EA 4LB5A 3SCHA 3WE2A 2L54A 4F8AA 1Y3TA 3ML6A 3C1DA 3ZN1A 2QWWA 2QDRA 3E6CC 2MA3A 3J7AO 1UIKA 3FM3A 4AVAA 2PN6A 2QCSB 4FX0A 4UVAA 2NRAC 1CAVB 4K2EA 1ZARA 1QGPA 1R5HA 4KNYA 2EV0A 1SEFA 1BI3A 5KHHA 4EROA 2ADUA 5CVJA 1ZG5A 3MZHA 4IJAA 4UUVA 4XSZF 3I59A 1UHWA 1B9NA 5I8YA 3KP2A 2UY8A 2G7UA 3I7DA 1EH7A 2O8XA 5DCFA 3KP7A 2QQAA 5HDGA 2F5EA 3CO2A 2ZBKA 2DFIA 2GWRA 2Y0OA 5CVUA 1YG2A 4EM0B 2PEXA 3JSPA 3KP6A 4N9IA 3KP3A 1VTNC 2ET7A 4RB0A 2QVOA 3K1PA 5AIQA 4BNCA 1R23A 3IRQA 1DP7P 2BYVE 2K7LA 1FOKA 4I0BA 3ZMUA 4LLGF 2FSWA 1U6GA 5F64A 4YNIA 4ASNA 4IHSA 2W25A 5CVVA 1XGSA 5KHJA 2IXKA 4HYEA 1ZGJA 1EV7A 4M73A 1BIAA 2CAUA 4LUMA 5HLHA 1U2WA 5BPDA 4IESA 1P92A 3TKYA 4IEUA 4YFNF 3NVCA 2EA7A 3S2WA 4MH0E 1EH6A 2XHKA 5LHIA 1ZHFA 4EV0A 2N7GA 2G9WA 3HOSA 4HV5A 3P9IA 2F2EA 4O5VA 4M71A 3DL3A 4ENKA 5FLXK 2FA5A 1FBUA 1FP1D 2EFQA 4WXDA 3D0SA 4ENNA 3M70A 2XIGA 3ROUA 2KIUA 4KFCA 1ZX5A 1G3SA 1J58A 3W6KB 4EWAA 3R60A 4BH9A 1O3TA 4UV9A 3H3UA 1XSXA 1Q5OA 1B1BA 2VBZA 2CQKA 5EFUA 4XFGA 3S7EA 4Q29A 2L4MA 5DYMA 4AWXB 5BV6A 1NHAA 3U10A 2KIFA 4HBLA 5BXXA 3GYDA 1O57A 4I3PA 4QMAA 4OLLA 4EMSA 3WTVC 3I71A 2BNOA 1Q1HA 4ZYDA 3F6VA 4KICA 3NL1A 5EEGA 2VONA 3BU7A 1FY7A 1EY2A 3SZTA 4CO8A 3SFZA 4LUKA 1YS7A 4BHBA 4I7HA 3SXYA 1W4MA 4AD9A 1LDDA 2EB7A 4KU8A 1ULYA 3TDUC 6PAXA 3LQQA 2EVXA 1J2XA 1RZ4A 3ZPLA 2H6CA 2MPFA 3Q9SA 2Q8KA 2WWYA 2HEOA 2Z5UA 4QX5A 4B29A 5FD6A 4LK1F 2L02A 1XSVA 1USTA 2NAZA 4A2UA 1PP8F 1LEAA 4I98B 4UBHA 4UHTA 5D5WB 1XMAA 3WG9A 4FBFA 4RB1A 5J8CA 3GLXA 1PMIA 2A5YB 3GFMA 2GC3A 1O7LA 3O6BB 3GO5A 4WF2A 1R7JA 2NS0A 1HSJA 3B02A 1BC7C 4PDKA 5CVRA 2MC3A 1OYWA 1R1VA 3LWFA 3BJ6A 3TO7A 3BJAA 3R4KA 2FNAA 4KWJA 2ESHA 2IC1A 3RI4A 1QNTA 4H7LA 1IN5A 4EJWA 3DPLC 1LR5A 4IPAA 2MHFA 2JSCA 4KYWA 3ES1A 3P7NA 2QJVA 3FMSA 2K02A 2HOEA 5C8WA 4R52A 3P9CA 3O3KA 2QLZA 1LDJA 4PIXA 2OD5A 3L2HA 2XL9A 2AS5F 2P5VA 5JHUA 3B73A 2OA4A 1XGMA 3E5UA 1JE8A 2QENA 4LMYA 3M9AA 3K69A 2FMLA 3ERED 4ESJA 2DAOA 1Q3EA 4P9FA 3W6JB 2OZ6A 5DCMB 2D45A 4EM2A 2PMUA 3F72A 1QZYA 1CF7A 1G3TA 2FU4A 3TDZC 4A6EA 4L2NA 2GXGA 3DXJF 3F6OA 2P7CB 4HLXA 5DD8A 2QBYB 2GU9A 1TW3A 4L5JA 1ZG3A 1FSEA 4CICA 1D8KA 1DZTA 4R1HA 2K4BA 1LRHA 2OBPA 2XAJA 4MV2A 2W57A 4UNOA 2Z3YA 2KRFA 5CVIA 5I8SA 3MWMA 2STTA 2O6GE 1OPCA 5JSOA 3WGGA 1ZVFA 4HLYA 2YU3A 2B9UA 3E97A 1R22A 3ZMZA 4G9YA 4YG2F 3ZMTA 3ECOA 2O8QA 1MDMB 5F1RA 1YW8A 3MYXA 2MBFA 1E2XA 3CLPA 3ETQA 3CL1A 4Z2YA 2VOOA 1CAXB 3EYYA 4A6DA 4HSLA 2H27A 5D5XB 5KHIA 3IBMA 4NQWA 4QGNA 1P4XA 4XFFA 5CLSA 1J3PA 2I45A 2OYZA 4ZYHA 4CXFA 1F5TA 1I1GA 2ET1A 2V79A 2FEZA 4E2QA 3NJZA 4OIQF 1RGSA 2HKXA 3BPXA 1HW2A 1NXMA 4XRFA 1Z6RA 4QLCU 5ICCA 2DPDA 4LD5A 1GVJA 1HQCA 2PYTA 5LBQA 1OR7A 3SCFA 1BOAA 1ZZ7A 5DUKA 3E5XA 4QM8A 4ZYGA 5TRDA 3JZVA 2K4JA 1S7OA 3VB2A 3GX4X 2M5WA 3IKTA 2B8MA 4CGZA 4Z07A 3GUDA 3LAJA 4MGIE 5K5QA 2A61A 3G73A 1KYZA 5K5RA 3KE2A 1KYWA 1O3RA 3T5XA 4RB3C 2A68F 3LFKA 5KVRA 1G4DA 1J9IA 2EFOA 3WODF 4B09A 1HKTA 2PMHA 1G6NA 1NE4A 1L3JA 4KIBA 3F8NA 3OOPA 1YFHA 2DK8A 4Y17A 3PVBB 3CUQB 4R8HA 3WW2A 3HOTA 4IEYA 2ELHA 3WGHA 4M6XA 4OIRF 3FZVA 1ZRDA 3JTHA 3GZ5A 1U3EM 2Z69A 1HBXG 4IETA 4ONUA 2Q1ZB 5DD4A 1AWCA 5L3DA 5ICFA 5A2QK 1ZZ8A 2LF7A 5LGNA 2Q0OA 3KMHA 3KGLA 3E5QA 2PQ8A 4Y15A 5LRRA 5FCCA 1FX7A 2OZUA 3HIFA 2DO7A 1RL3A 4LTAA 1XD7A 3G3ZA 5K5OA 3KEOA 5J3UA 4DQ2A 4WK8F 4HVOA 3MDPA 3H9AA 3QOPA 4RS8A 1DZRA 1B9MA 5K8SA 4UV8A 2BBYA 3HTUA 3E6BA 3RYPA 3BB6A 4E2SA 5E17F 2PHDA 3EJKA 3FFQA 4O9EA 2PFWA 3DN7A 3T8TA 3U0ZA 1YW7A 3HRUA 2O1QA 3R61A 2Y75A 1YUDA 4PGGA 2Q4SA 1ZRRA 2IRFG 3U9GA 3ZQ7A 1YTYA 1KU7A 1IUYA 1FNNA 5E16A 3QACA 4AVBA 3BPVA 1LKNA 1U78A 1T38A 1VJ2A 2IP2A 5LEJA 5I8TA 4UXNA 4IRHA 4OOIA 3RDIA 4TV7A 3OV8A 1PP7U 3FMRA 4UVBA 4Q5SF 3O2PE 4IEOA 4A5NA 3QPHA 3T0YA 4XF4A 1A04A 2GA1A 2CWEA 1ON2A 1DPUA 3VOEA 1L3LA 4HV6A 4AXOA 3MZYA 1IF1A 4I02A 2HYGD 3ECHA 3R0AA 3M8EA 5TJJA 5ICEA 2CAVA 3EHKA 4GGGA 2VQAA 4Q0UA 3WTTC 1V3FA 1FYMA 1FWZA 3PLQA 5HS7A 5E8IA 5LHHA 3F23A 1TNSA 3ABUA 2MLKA 3KCCA 5FQ0A 1IRGA 2ZO4A 1TQ5A 3I5UA 1F4KA 1UFMA 4X6QB 1IPKA 4ENJA 1YIOA 4XFAA 2Z33A 2Q0AA 1OKRA 1FBQA 2H94A 3U1DA 4ZZDA 3J81Z 2P5LC 4RD7A 2FOKA 4TLFA 5CU1A 3F8CA 1K78A 4L0YB 3MQ0A 1YHFA 4HF0A 1IN8A 4LULA 3CO6C 1FC3A 4Q47A 1LQ1A 2ZJ2A 3R6SA 4AIKA 2AXLA 5FPXA 4IEZA 4RGRA 4G6DA 2OU2A 2HTSA 2K0GA 2VT3A 1TBXA 3QPTA 2R3SA 2FE3A 3TOBA 2E1CA 2FXAA 1CAWB 1GQHA 1P2FA 4Q48A 4OU0A 4OMYA 3I4PA 1BI0A 3TOAA 1J5YA 4LJZF 2P17A 3SXWA 1VR3A 5LEKA 1U12A 3WTYC 2STWA 2M1BA 2VN2A 4ZU5A 2RNJA 2YPRA 2HJIA 1SAXA 1IN4A 2A6HF 2EA4A 2GC1A 1Y9QA 2Z2SB 1FLIA 3H8UA 4MTDA 3ACLA 4Q0QA 2ZFWA 5HLGA 2DTRA 4Q0SA 2V1UA 1DGWA 5AVPA 3NEUA 2GAUA 2EFNA 4Z82A 5BPIA 5ILVA 5I0RA 2XKPA 2ETEA 1J1LA 1WQ2A 1T6SA 2PBIA 1S8NA 2XV4S 4HX8A 3FZ3A 2D5FA 3KGZA
chains in the Genus database with same CATH superfamily
4AGVA 3M1CA 3TO6A 4XBNA 1AA7A 3CJQB 1IAWA 2XUBA 4UAPA 5JXIA 4U7DA 1ZKGA 4HG2A 1K61A 2IFWA 3BYWA 1W7PB 1J1TA 3DBRB 2J1TA 3MKWB 2WNVB 4BHPA 4HPKB 4RFT0 5DUUA 1O8PA 4LKFA 1AKHA 2IEKA 4GWMA 4AUXA 3DFGA 1VP6A 2ZX1A 3CJNA 1GP6A 4YW7A 2ZXJA 3LAPA 1RPWA 3H8RA 3BCAA 1CIWA 4KIGA 4G9SB 1H9TA 5GZEA 3U4SA 2XLAA 4NQWB 1MZEA 2MSYA 3PFIA 2VOXA 4LG0B 3RWKX 1RR7A 3OGRA 2NN8A 1KS5A 3MKYB 1H8TC 3PQJA 3IDBB 1LEBA 4KUMA 4ETSA 2W3JA 2QQLA 3BROA 3B00A 2P4EA 4UXAA 4EVIA 5CADA 1G9BA 4PF1A 3LE0A 4HSTA 3L7WA 4O3MA 2XWJB 1PVXA 4Q1PA 1U8RA 3HJRA 4AHWA 3K9TA 1GXPA 4KI5M 1OF3A 3ABTA 3VHNA 2A75A 4QPIB 2JA7J 3K1MA 4M9XA 2RVAA 2RQPA 3OL3A 4CA0A 1W8UA 3DPTA 3VBHA 2KHMA 2HZTA 1XNTA 1QGLA 5T52A 2O8KA 4E4DX 1W6PA 3HMYA 3LEMA 1ZZ6A 2GIZA 1VRH3 1ZBE1 2XRLA 4BHCA 4D6RA 2MLGA 3DU5A 4M3FA 3OD0A 1JT6A 3WSOA 1OCPA 1T39A 3PVEA 2X5IB 5DM6F 4CEWA 4MVTA 2NXNB 1W9WA 4ISQA 3I49A 2IXCA 1W6OB 1TWGJ 1GV9A 2R042 3CLQA 3QU6A 4Y13A 1CAVA 3SZGA 2VUAA 4N53C 3KPHA 3DV8A 4YW3A 2IA0A 4BUPA 1TP4A 1ZRCA 2PLV1 4JC1A 3OS2A 4H55A 4A3LJ 1DQUA 2BHZA 3HHHA 4Q1RA 3TEXA 3ZXLA 4E4SA 1HXS2 4UW4A 1BBYA 4GXLA 3HKZA 3M4FA 1AR62 3DQVC 2IXHA 1BI1A 2IT0A 3DXTA 3HG9A 4DUVA 2FZ2A 1VBE1 3G2BA 4BE3A 2W85A 4QDRA 3UNGC 4NAOA 1FEXA 2R7UA 5GKAC 4XDOA 4YW5A 1WSUA 2OQ7A 3AXDA 4JGYC 1H8VA 5C9AA 4CCDA 5ERLA 3IDCB 2BE5F 3S3MA 4AEDA 1LGNA 1KA8A 2CV1A 4D1QA 2R7VA 5T5PA 4YARA 1C0WA 4CDUC 3LKJA 2ZMNA 3U4XA 3MCZA 3Q8EA 2WADA 3RZLA 1LB2A 1REPC 4JCKA 3IDAA 2ERFA 3K3OA 2TDXA 4XNFA 1D0GA 1T08B 4LR4A 3VKFC 2X0LA 2F5CA 1R4NB 1OLRA 3RTRA 1X8MA 4BQNA 4MEXF 4IV1B 1F9NA 4LO5B 4LGWA 3AL6A 4L92A 1R1TA 1US2A 1R091 2Y8KA 2BTVC 1SQ4A 2R0FA 5F8PA 2KJCA 4XM3A 5JI6A 5D8AA 1IO2A 4XLPF 2CU7A 4HNUA 4HLTA 2PHXA 4HDVA 1DGWY 1IPJA 2NP0A 1QVTA 2VIXA 2X4HA 1N1VA 5FZDA 1DPRA 1UYYA 2XL7A 5FRAA 5F3IA 3I53A 2VOTA 1ZA4A 1FPN2 4DZPA 5L3EA 4D0QA 4J01A 4UBGA 5FK8A 3AZZA 2M45A 1LECA 4MGYE 4KA4A 2VGDA 2JIGA 3SQOA 4BAYA 2L5QA 5DG1A 2QNKA 2QKMB 4QPGA 1OPOA 2QCOA 5C3RA 4PT6A 3G6EI 1CZTA 1QRYA 2LKPA 1LKXA 5EWSA 2M87A 4NROA 2RR11 3HYIA 1I3QJ 1S29A 3HJEA 1J75A 1ETVA 1N3PA 3AZWA 1XSDA 4OIOF 3KCXA 2FBIA 4MQVA 1VAVA 3N7MA 3FC0A 5BNNB 1VBA3 2X1EA 4OINF 4EM1A 5EYYA 4DY5A 4OAZA 4DIQA 2WTEA 3MZ8A 5C7GA 1MJAA 2DT5A 1W9SA 4NC7A 3NSTA 5FLMJ 2BXYA 4BDZA 5CFCA 3C2HA 5F9TA 3UT0A 3SHRA 2AREA 2A07F 2JEMA 2X10A 2OAZA 3U1XA 4NHLA 3EYIA 3NKGA 4MO3M 1FYKA 1XNAA 2P6HA 1XOYA 5JI7A 4Q4X1 4BXSV 3WF2A 2P0WA 3S0MA 4DZJA 1DFQA 2JJ6A 3FWEA 3KFWX 1TQIA 2L9RA 3O8HA 4F93B 3I4IA 2HOTA 1BQPA 2D98A 1R4MB 5T3NA 3QH6A 1X4OA 2P5KA 4BQ5A 4II3A 4EWEA 2FJ1A 3J81K 1NAEA 3AMHA 2QQ9A 2VOKA 4ZYEA 5IT9Z 1DIWA 1HRV1 1OD5A 4TYSA 5F0FA 4F83A 5FJHA 2JD9A 1IKPA 2DYRH 2WBMA 1B35B 5DCMA 2Y38A 5E8GA 4GH4C 4P9UA 2VBXA 1CIYA 5IT6A 1M4WA 5A6ZA 2NNNA 3RZDJ 1W9FA 3SQNA 3ATGA 1GU3A 3VDCA 3DP7A 5CPRB 1FYLA 4QKDA 3LSGA 3H50A 2Z79A 2A05A 2DCTA 3F8FA 2RMU3 2UYAA 3FUQA 4XVHA 2VKEA 1YEWA 3UGGA 1RUD3 4GD4A 4YZ5A 4M4PA 4ZONA 4Q4W2 5DAWA 2VZ1A 2X51A 4LIVA 1IV8A 5FZAA 5JMOA 2KMUA 2LLKA 3WW4A 3OYWA 2HTJA 4ZDLA 4LPLA 4HX4A 4XYXA 2COBA 3ECQA 2VUJA 4LITA 3VKNA 2R7DA 5DUIA 5T54A 4A7ZA 4OMZA 3GJAA 1Y6IA 2FCUA 3BI3A 2VOVA 5A33B 3CUQC 2HWB3 1NCQA 3K4NA 2ZX0A 5B4NA 5EV7A 3USUA 4WM7B 3GTKJ 4QPYA 4NRMA 3BTYA 3ES4A 3ZOIA 2X6OA 5L3CA 4WWCA 3WNKA 4BA6A 5IT3A 3KLOA 2A6VA 1IZ1A 3FKIJ 3J80K 2VQUA 3L9FA 5BS6A 3BJOA 4JK1X 2KA3A 5EXOA 4AZZA 4UFJA 2TUNA 3HRMA 1UOBA 5LK5A 5IJRA 4D69A 3C3WA 4ATFA 1QY4A 2SBAA 2BY0A 2VOPA 4NPLA 2OTLI 3VSLA 1I6XA 3RQIA 4L9NA 4Z2WA 4ZTFA 1HRI1 1ND2A 2PAEA 2R49A 3CEWA 4Y5SA 1UU6A 2JWPA 3IKWA 3W2VA 3ABMH 2PJRB 2DFHA 2XH6A 4A12A 1XE8A 2DA4A 5H9RA 1D1CA 5JOYA 1RJ8A 4JP0A 4YGDA 3AYCA 3P5JA 2HKOA 4X6RB 5F7UA 3MEXA 2GC2A 3CCLI 4R4ZA 3ETPA 4CYCB 5L9VA 4IV3C 1ENHA 3I54A 4BCUA 2L7MP 2WR9A 3LGRA 2RS31 3PMSA 4GWJA 1NG6A 4C90A 2HEYF 1KGSA 4O65A 1GNHA 1W7PD 4LMFA 3VBOC 1ENRA 4WX9A 2R7EB 4MX3A 4RQPC 5E3LA 1SAUA 1QWRA 3QAHA 1V4RA 3NW4A 1SFKA 1F8VA 3AJYA 2NZ9A 3J4UH 4K20A 4NR1A 5LA0A 1DLLA 5K0UA 1HSTA 1AYN1 2XG3A 3CCUI 1OMIA 3QOEA 1WGPA 5KBFA 5A7QA 1LJ9A 1HXS1 2M9HA 3ZXGA 1Z7LA 4RB2C 1X58A 3KF3A 1CX4A 2E2JJ 2CGOA 3OYNA 3J8F2 4IX7A 1RUF2 4A7KA 5FJKA 4R9CA 4AR2A 2IGKA 4AK3A 2LY1A 2JPCA 4L9JA 5FY7A 3M3OA 1W2TA 1YFUA 2BOJA 2WAQN 2WS93 5DZEA 2P1BA 2NNYA 3WW1A 4YW1A 1MJBA 4JX4A 4Q4Y1 2ZHKA 2XSDC 2IXIA 1XPXA 1OCCH 2PA7A 5G05L 2MW8A 3OB8A 3IAQA 2L4AA 1OBNA 4AQ2A 4CDXC 2X6WA 3BR0A 1RHI3 3OTFA 3HBZA 4U0WA 5BNPB 4CYDA 2PHUA 3N97A 3IV5A 1GZCA 4YPJA 2KXLA 3BWGA 1GWMA 3TO9A 3BG7A 1UB9A 4PIZA 1AR81 3BZKA 4YIRX 2CQNA 3B01A 5DEQA 1D0HA 2VC0A 5FLXZ 4UUSB 3CKHA 4OHWA 5HXMA 4JDNA 4AYBA 5E20A 3RIRA 4YSFA 3HGGA 1TNFA 2R5ZA 1ST8A 2XAHA 3OF1A 2IVMA 1Z7UA 4UOJA 1U9OA 2VJJA 5C4XJ 4CU7A 2Y6GA 2AC1A 1MBFA 2CSOA 4FVVA 2J1RA 4GB32 4CXWA 3K70C 3NAUA 5FPZA 1LVKA 4D6QA 2IA2A 4MOAA 2F5FA 5FP3A 4MGTA 5C6CA 3TNQA 4C0HA 4XXPA 5CYVA 3OR1C 4JX0A 2Q8DA 5LLQA 2GP3A 2XQRA 2XJQA 3ELKA 3WF3A 1FBSA 3B9CA 2K46A 5J47A 2Y9ZA 1KQ8A 4DW6A 1F43A 2UURA 2L2OA 4IEWA 3WHCA 3E6DA 3EQEA 1YQ5A 1BR2A 1VQKI 2P8TA 2H09A 1UZYA 4HVRA 3BT9A 3H36A 3HZJA 4DGWB 5FYZA 5KHKA 2ARCA 4MSVA 2B42B 1MQTB 2D1HA 2AEYA 5L3GA 1AF9A 3KT7A 2D1VA 3M3EA 1EJ9A 2O14A 1YFWA 2VC1A 2XGCA 1NLRA 3IZOA 2P6TA 3JRIA 3HM5A 2V5DA 1AX2A 4U0VA 2FDGA 1BBT1 2Z5WA 1J84A 3H1WA 4KWKA 2K27A 3BOPA 3TEYA 2YR2A 2E7AA 3W6VA 1IPSA 1S72I 3LOCA 1R1A2 3RNSA 3S30A 3RKWA 4IF4A 1J3QA 2DYCA 3OYFA 2KDZA 1KFXL 5HODA 3V0AB 3CP8A 1BI2A 1V5GA 4JGZC 3T09A 5I93A 1SLAA 4NIDA 4AHYA 4NVPA 4YELA 1YO5C 3TNPB 2OW4A 2VXZA 1NE6A 1IC8A 4CDQB 1IRXA 4U36A 1HQWA 5IVYA 2WO1A 3SCGA 2B9VA 1S2KA 4HXCA 5ILUA 5KR7A 3FK6A 3L09A 3CJIB 2PX9A 1Q8PA 3ZFFA 3NNJA 1BN5A 1O4TA 5F0HA 4QKNA 1LNWA 3T0AA 4HF2A 1JZ5A 4QU2A 1AYM3 5F37A 1IUFA 4Q4W1 1S55A 2OXBA 3K4DA 4E7JA 4C30A 4KNCA 2YSRA 1KDMA 1NCRC 1DF0A 1O91A 4QQHA 3C3VA 5K7FA 1DYOA 4RAYA 1ZA7A 3IPVA 2VW1A 5B1BH 2K3FA 3GVAA 2LKXA 5EQUA 2E7TA 4Q0PA 3RZGA 4S2GA 2HH9A 2CHHA 2WB1A 4RR3A 2CW0F 1HDDC 1ZR2A 4M3GA 1QJFA 1ALYA 3RI9A 4ZS2A 4Q5OA 1GQGA 1U5IA 3OY8B 1GYKA 1P7IA 2EZHA 4XCAA 4XAEA 3ACFA 4I09A 4CP2A 1DQ6A 1V9U2 2C4XA 4G94A 1GZWA 2D3SA 4CP9B 4XFBA 1W6QA 5IK8A 5AVAA 5FTTC 1VBC2 3VSKA 2ISYA 2V09A 2WYSA 4N90A 3ZGKA 1C8M2 1W0NA 3SNMA 1WMDA 4BQ3A 5EJZB 2VXJA 4XONA 5AC92 4XZPA 4XDQA 2WZ8A 1FOXA 3HOUJ 2BY2A 3ULQB 4NRQA 2WWJA 1RRJA 4KU7A 5IOYA 5K7ZA 4YVSB 2NVXJ 2VXRA 3RVHA 3KV5A 1HOMA 5HS9A 3BALA 1C57A 1DQ0A 1EYBA 4DS0A 4M9ZA 3MFKA 3DYMA 5EYXA 1K79A 4RAZA 3OSGA 5IVJA 4G4FA 1LNSA 1PIV3 2VJIA 1YQ2A 1O7FA 2EIKH 1UMQA 1K7AA 5HBAA 1G2HA 4LHNA 4Q8LA 4Z2AA 1RB8G 2VXDA 1WJCA 1MVEA 1GBGA 3JRCA 1JMUB 2D93A 3R4SA 4H2AA 2DXIA 1IGOA 2WN2A 1CGPA 5A2QZ 4ASKA 5CQGA 3FKJA 2HR3A 4E7SA 2PI0A 2F5VA 4P5OA 4HKOA 4N43C 3FDYA 3ZYJB 4WVMB 2OV7A 1MMGA 1JTYA 2LG4A 1KJRA 1MS8A 4CE8A 4IE6A 4R9DA 2JG8C 3HNBM 3WE2A 3VBSA 3CJRB 3JUUA 1H8TB 3ZN1A 2DA1A 3DPRA 4NPMA 2PHWA 4NHMA 1GV5A 4ZDOA 4LBLA 2PMWB 3J8F1 1RUF1 4K2EA 1QGPA 3WNMA 4KNYA 3ZXAC 1SEFA 1JI6A 2ZGTA 2ADUA 4E8CA 3MZHA 4UUVA 3CF5F 3PDQA 4XSZF 2WINB 3AMQA 1UHWA 1EAH3 1B9NA 3CNAA 1DP0A 1IS5A 1S0BA 5EIYB 5IP7J 2OX0A 1TC3C 5A3WA 1SVLA 3AVRA 1OLQA 1A34A 1LOBA 2CS3A 3OYKA 1VRH2 4PFOA 4FTBA 2L9SA 1PK6A 4RBOA 1LESA 5IYCJ 3ZR5A 3PNYA 2ET7A 2E5NA 2ZOEB 4RB0A 1SBFA 3K1PA 4PI2A 4BNCA 5HPOA 1OFSA 1ULFA 2VBDA 5DPNA 4EN6B 5HV4A 3ZFGC 2QQNA 2RREA 5CVVA 1XBFA 3NWTA 1EV7A 2P3JA 2CAUA 1U2WA 3P1IA 5BPDA 4IESA 1P92A 4ITCA 4N53B 4MYEA 2KPMA 3KV9A 1QNWA 2XQXA 3TBIA 4RMNA 5FZKA 1POV0 1S0GA 2N7GA 3W21A 4M01A 1LOFC 5CFDA 4GB31 1KFUL 1PVC3 4QX7A 3HN1A 1W28A 3GCXA 3T3YA 4GMP3 2FA5A 2R073 2L7KA 5FMOL 3M70A 1KEXA 1ZELA 4B3NA 3C7EA 1G3SA 1DCSA 1E5SA 3CJTB 4QKBA 4UV9A 4CEYC 1XSXA 4OI1A 1JUPA 1Q5OA 3POEA 4JGYB 1DYKA 4FPJA 2JSPA 3H5NA 2J42A 2KIFA 2D97A 5IVEA 4I3PA 4DBQA 4CDUB 3I4NJ 4BB3A 2HDWA 3I71A 5IHRA 1A8DA 3OBTA 5IYDJ 3F6VA 2VONA 3CZJA 1UMIA 5CKNA 5BYNA 3SFZA 1Y9GA 1U0AA 3NV3A 3VDAA 4KU8A 1ULYA 3TDUC 2Y64A 5GAEJ 3LQQA 3NV1A 5ACA2 4OWRB 2LY2A 3H9JA 2LS6A 1K5MC 3Q9SA 1LODA 4XMAA 2Z5UA 2WDBA 1A3KA 4ISRA 1PMHX 2NAZA 1USTA 2NM1A 3QODA 2RDQA 4A2UA 1PO23 2CQ7A 3ASOH 1YRNA 1H9WA 1R1A1 3GFMA 4WF2A 1W6MB 1JYVA 4FOYA 3ZYRA 1DHKB 1PUFA 3ZPOA 5CVRA 1D0YA 3OOUA 2L9LA 2G9FA 4XK4A 2XGDA 3BJ6A 2H1LA 2E5ZA 1QNTA 4Y20A 1IN5A 3DPLC 2JSCA 4CXYA 4KYWA 3ES1A 3GTJJ 3RZJA 3KHCA 3FMSA 1PO11 1YC61 4KG8A 1GDTA 1LDJA 4PIXA 1RKTA 3NNLA 2R0HA 3L2HA 2AS5F 2BVVA 4FSJA 4B8EA 3O7OA 3E5UA 4GRIA 4CUBA 3MLLA 2QENA 1PHMA 5ISLA 1VBA2 1JW6A 4GFBA 3W6JB 1H2MA 2OZ6A 2D45A 1VRBA 1NOVA 2PMUA 4MXVA 5M5XJ 3F6OA 1S5LC 2QBYB 5DM7F 5FMOS 4LE4A 5FYUA 5FZ6A 3C2GA 2CQXA 1RXGA 2WA3A 2CH0A 2GALA 3KVBA 3Q8CA 4B47A 4R1HA 3WUDA 4M00A 1OR7C 2VY0A 4XKWA 1D4M3 3TL4X 2W57A 1NQDA 2Y0IA 3H0OA 5ABJA 5JHFA 3MWMA 5A3MA 3ZFEC 4B1LA 2Y6HA 1OPCA 1F9KA 1V0AA 2WJSA 1MSFC 1SVOA 3EMRA 2YU3A 2B9UA 4MXWB 1I1EA 3ZMZA 4R9BA 2WNVA 1V9U1 3AKQA 2MEV3 1MDMB 1FTZA 3G1LA 2ZGUA 2W48A 1AX0A 2VOOA 3JREA 3ASIA 1CAXB 3PVNA 4HSLA 4LBQA 3QWLA 3POBA 3J7ZI 1MEC1 1G7YA 4NQWA 1A6CA 4NIIA 4QGNA 4BJ6C 1FTTA 4OUEA 1JYTA 4ES8A 1C8M1 4XFFA 4GH4B 1W1WE 1UZ0A 2I45A 2OYZA 2CW8A 3LB9A 4ZYHA 2W2IA 1F5TA 4YZ4A 1I50J 3ZN4A 3KYCB 4OIQF 1RGSA 4M4RA 4ZTJA 3G6JB 2RMU2 4QU1A 5IOZA 5LBQA 4FOWA 1RUD2 2I2SA 2WZR1 3LFIA 3E5XA 3FLTA 2I5UA 3JZVA 2YFZA 4CP0A 3KV6A 2ZGMA 3NAPC 4BE0A 2E32A 2B8MA 3IKTA 4CGZA 4MGIE 2ARAA 4UB6C 1ETXA 4S2HA 3K48A 4XJUA 1KONA 1D5YA 2WSUA 1SVMA 3GHNA 1FJLA 3LFKA 3THTA 2D6MA 2W92A 1QJZA 2RS13 1G4DA 1J9IA 1UZCA 1OQDA 2OVUA 2EFOA 1RC9A 4YG0A 5IK4A 4BY7J 3LD8A 1UN1A 1NE4A 4RA2A 3LEIA 1MNDA 4X6AJ 1O8SA 3AZYA 3S6PA 3D5OA 4FPKA 4NC6A 3CUQB 4R8HA 4ATEA 3WGHA 4OIRF 4L8QA 4YZ1A 3FZVA 1YCIA 3JTHA 2Z69A 3BG9A 4A7YA 1QJX1 3BG6A 1HBXG 2VQHA 3WNXA 5DD4A 5L3DA 5ICFA 4KBBA 1ZZ8A 2LF7A 4AI0A 2Q0OA 1W06A 1R1ZA 1ETOA 3WQ7A 3JR9A 4FI9A 5IVVA 1FX7A 1RL3A 3IT8A 2ZFUA 3DYPA 1XD7A 4W6XA 1HLVA 5HV0A 3AP7A 3MDPA 3BR5A 3ACIA 4RS8A 3M3YJ 1N1SA 5K8SA 3RPUD 4UV8A 2HYXA 4M3CA 3E6BA 3BB6A 2A5WA 2HBTA 5E17F 3MW3A 1LFPA 3N35A 2VPLA 4HFSA 1RESA 2Y31A 4YGCA 1HB2A 2O1QA 3ZM8A 3PJRA 4NE9A 1YUDA 1ZBE3 2Q4SA 1ZRRA 1WA6X 3EXUA 1OLTA 3SDBA 1JZ7A 4IV3B 2KISA 4LO8A 3UETA 4F3QA 1XTAA 3LDBA 3VD5A 4QPWA 4OOIA 4XN0A 1PP7U 1BW6A 4IEOA 3TP3A 4A5NA 4IGOA 4XF4A 4J00A 3G1OA 2CWSA 3VBOB 2CWEA 1DYPA 3OYGA 3IH2A 2P34A 4RQPB 3WF1A 5A7WA 1X3WB 1IF1A 2J22A 2ECBA 2HYGD 4YGEA 4ZKTB 3B3QE 3M8EA 4FOQA 5KXEA 5ICEA 2RG4A 3AZXA 4GGGA 3HKZN 1T33A 3WTTC 1V3FA 5E8IA 3FBIB 4QAWA 3Q8FA 4C3JJ 3S14J 3ABUA 1UU4A 2WUHA 2JXAA 1OH3A 3KCCA 1NA1A 1TQ5A 3I3DA 4XQDA 3G1MA 4X6QB 1YIOA 1G9FA 1OKRA 4IDZA 3MUY1 2TCTA 1YX5A 2WS92 3OBRA 1XE0A 1Y8QB 4RD7A 3F8CA 2ARBA 4DOZA 1K78A 5GLWA 3RSNA 2J1AA 1ND3A 1DQ1A 3KT4A 3V65A 4LXLA 2UUZA 4LULA 1FC3A 3S32A 2A73B 4BEHA 4AIKA 2AXLA 1SEUA 4NIGA 2HTSA 3BOWA 4CDXB 1YQ8A 4D9JA 3TOBA 5J4VA 1OCTC 4DYQA 3IAM2 2JJ7A 4Q48A 2BDRA 4LOSA 4OU0A 3ONQA 1OLMA 4GA9A 4RDUA 2WT0A 4LJZF 1XU2A 1U12A 5FZHA 2CJJA 2STWA 2VN2A 4XIKA 4PQ9A 2WA4A 5DQ0A 1JYNA 4WVWA 3NNFA 2A6HF 1FLIA 3ZN6A 1XMXA 5FY9A 4GZ9A 2DTRA 4LIUA 2L9NA 2ZAAA 5AVPA 3NEUA 4B3AA 3O1RA 3SC7X 4Z82A 4XILA 5JMCA 5BPIA 2CY6A 1NY71 2PBIA 2G9ZA 5JDBA 3ALQA 2FZ1A 1KQRA 3WU1B 3OYEA 3FXKA 1YYNA 2HS5A 5KHDA 4QHOA 4LHLA 3A22A 5AIPA 3WXPA 4LBQD 3O1UA 4IOCF 1JHHA 1OYIA 4BOWA 1XQNA 3A01B 4J1WA 3FXLA 2CW7A 3VBHC 2IGNA 3BN6A 1LEDA 4S2DA 5KC6A 4I01A 1J7KA 3MN2A 1NX9A 3QYEA 4M6VA 1ZBA3 1YQAA 2EBIA 1BCXA 2VPVA 3UKVA 4FX4A 1C28A 2AQEA 1H8AC 1QBJA 1VPHA 4GDFA 1FV2A 4UFHA 2QUOA 2OQGA 1VBA1 2RDPA 3TWIA 5FPUA 2EA2A 1S9HA 3GFJA 5KWRA 1T56A 1IXCA 2QSHX 4HQEA 4YM3A 3VKMA 3GTPJ 3PURA 5BOXA 2DOAA 2OIIA 3QD6A 2EWNA 5IAVA 2C0ZA 3HOBA 3THDA 4META 2O0YA 3LZZA 5A7SA 2HYJA 3TBDA 2XAQA 3NARA 2XJVA 4S0HB 4WBBA 2OUMA 5CG9A 3RS6A 4LOCA 5F08A 5J37A 4B4RA 4HSRA 1K3IA 4INDA 3MW4A 3EPZA 1W3XA 2GNTA 4IQJA 1QPMA 3DXUA 3HTSB 2NVTJ 3VPRA 3VL8A 3GYHX 1ZZ9A 4KN7X 3RJPA 2FX0A 1JTZX 4RS5A 1O5LA 5A32B 2D2WA 1BHGA 3RKQA 2DBNA 4AVVA 4EATA 4JGZB 4U2AA 3OUIA 2CYYA 2ESNA 4AE2A 1IRFA 1XYPA 4XAAA 1YQ6A 1DZQA 1D8JA 4KIFA 2L3DA 1TWCJ 1Y8RB 4XETA 3KQRA 2HGCA 5C9AC 2VTFA 4PUSA 2ZJRF 5A6YA 2SLIA 1RIOH 4P9GA 5EZGA 3L2CA 1ULCA 4AEDC 2Q5TA 2YDEA 4GXOA 3IP4B 4EQQA 1WKYA 2VL8A 4CSWA 1J09A 1HC8A 1GLNA 4G8XA 2RMU1 2QF7A 4HNTA 2W0XA 1IXSB 2KD7A 4AYUA 3T1BA 4HMZA 1AYM2 5LGTA 2XJUA 4CUAA 5JFRA 1WBFA 2BXZA 4HONA 3OYDA 1DGLA 3JRAA 1NCRB 5BPXA 4G7HF 2ICWG 3OR2C 5D8AC 4B48A 4HN0A 3VODA 2DT7B 3HRSA 2HWB1 3WNPA 4CYCA 3MW2A 4X0GA 2ENRA 5E1WA 2J1UA 5FPBA 3I0TA 3CJXA 4QXBA 4QDQA 2EK5A 1UHMA 3WDVA 4XN3A 4TXWA 2XB5A 1CD3G 4PQQA 1ZN2A 2L0KA 1B6AA 2LBFB 4IVNA 1ZR4A 4HX7A 3WD5A 5LY1A 2ZNYA 2AO9A 2LALA 1QIQA 4QPGC 2FBKA 3GALA 1Q8VA 2GNMA 2F4PA 2DI3A 2ACJA 2Y33A 4DUWA 3SDGA 3RPQA 1BA5A 2YY1A 3L00A 5DMYA 4AIHA 1HRI3 5FOBB 1AR71 4D0PA 1Z05A 3PFYA 2MNGA 4IO9F 1RUI3 4NIHA 4FTEA 4PZJA 3VBRC 4QM9A 4XBFA 2LW8A 1PIV2 4OAYA 5DAPA 4ZU4A 5CFCC 1O5UA 1TME2 5L3BA 2Y60A 1R6RA 2DBBA 3U78A 1QOSA 2LFBA 5FKNA 4CZSA 1UU5A 2RJ2A 1OA3A 4L9BA 1H89C 2L01A 2ID4A 3BR6A 4FAGA 3VEPA 2GLOA 3S1NJ 2BVMA 1ENSA 2DPUA 3WP6A 4OHXA 1UG2A 3B93A 3WP3A 4N43B 4P9IA 5EPAA 2ZX2A 2V1NA 5H6QA 4NB5A 1FT9A 1X33A 1EV13 2JG8B 4BQXA 3T0DA 1AYN3 4AVTA 1DP3A 2Q2EA 1LU1A 3OGJA 3KEQA 1QU3A 4W4ZA 2V4JC 1ONAA 1RIRA 2YU1A 2ZGLA 3HNMA 5HDNA 4IXLA 5A1LA 1TMF1 2VMCA 1Y0UA 3CF6E 2PHTA 2P4WA 3DPUA 1EP0A 3HHGA 3D82A 4G6TB 2DURA 2HQRA 2W68A 2LF8A 3WDTA 3GBFA 1OHFA 4JQTA 5FZGA 4UF0B 4EGZA 2VCAA 1F15A 2BOIA 2YC4A 1JZ2A 5IYBJ 4LO6B 1EAH2 5FLVA 1YI7A 4BU2A 4ZC3A 4E7KA 1ON1A 4IHXA 3G71I 2VC9A 2W1OA 1J3RA 5GTHC 2MG4A 5GALA 5FK7A 4MHGA 1RHI1 3UESA 1K45A 1CPNA 4KITB 1WW4A 1S0IA 4XOGA 4KWLA 1OI6A 3RYRA 4A3DJ 3BG5A 4HQMA 4NOTA 5I0UA 2LSOA 1AR83 3KZYA 4AYBN 4PJYA 3ZFGB 3RG0A 4FHTA 3WTSC 3AG2H 4OIPF 5FYYA 4Y4RA 2PMZA 4XF3A 5E3OA 1BLZA 3WGIA 4HVQA 4S05A 3OBAA 4Y5Z0 4WCGA 2NOJB 2FD5A 4URTA 1NCQC 4URAA 4KGQA 1YO8A 1FNZA 3FXQA 1C4RA 3PIPF 2E19A 1WGXA 5C8CA 4HOOA 3PUHA 1PVC2 1E5HA 3S1MJ 1A36A 3HPNA 1UQXA 3OYJA 3LF7A 2R072 4EYUA 4ON0A 1T98A 1P6RA 4U88A 3D5RC 2NOGA 2XROA 2FBHA 2W84A 3LSJA 4A0YA 4BMBA 4XEZA 4IRGA 5D1IA 1ND2C 1RUC3 3GTLJ 4XORA 5FZIA 1S7AA 1Y43B 1JYWA 1D5VA 4PCQA 5K1YA 2VE1A 3M1HA 4JDOA 4PSXA 1XYNA 1U9NA 3EUAA 3HUGA 2MH9A 2LP0A 5D5VB 3VWBA 5KAFC 5BUVA 1XNCA 3GXOA 4XJAA 2LKSA 2OPKA 1B4AA 4NN0A 1UWWA 3V7CA 4D94A 2PAKA 5FZCA 3S5AA 2FD8A 3AL5A 2Z16A 5J7MA 3FXRA 3REOA 2R7RA 4LLLA 1VMHA 3PUFA 1JJ6C 2R7FA 4BDYA 2F4IA 4ESBA 5L36A 1RUNA 2VNOA 3EETA 4AI3A 1QH6A 2VQ0A 1K5MB 5FROA 3EB7A 2ORXA 4UFKA 3E6MA 5K0UC 3H7YA 1F36A 5E88A 1BBT3 1PO22 1RUJ1 3CU7A 5H9PA 2COMA 3K1NA 2HNHA 1L0OC 2DCJA 4GCVA 1SFNA 1CF7B 2OA2A 3HNYM 3T2QA 1OOPC 2DMNA 1E5IA 1OF4A 1TWAJ 2VCMA 2EIEA 2ZAHA 3K51A 5I0DA 3WHUA 4EJTA 2OF7A 4FISA 3LA3A 1Y39A 1PZ7A 5JPNB 5BNOA 1QJY3 1PM7A 4M74A 1XNDA 3M2MA 2ZZJA 1NLQA 2P6SA 5FFXA 1QVUA 5D8LB 4KL1A 1E3PA 2D3PA 2DVGA 3OY8A 3MFCA 3ZLIA 2VQLA 1VBD3 4XKBA 1SHWB 5SV8A 1VALA 2Y30A 1Z77A 4QXCA 4FT8A 1E17A 2EXJA 3IHUA 1W5TA 1UX7A 2RDSA 5IWFA 2BZTA 3N9LA 3O1PA 3K6GA 3EQLF 1HDKA 3APBA 4Z8BA 3WOGA 2WYFA 1VQNI 4FASD 4XIOA 5FRMA 2DA3A 2K2SA 4MTEA 3W2AA 4MEYF 1XC5A 4MFDA 1H1IA 3OGSA 4UY8I 1FXZA 3KP4A 2VECA 3LAGA 1W2OA 4FQGA 4RYDA 2P3IA 2W95A 4P9WA 4XQWA 1ZTRA 5TGTA 1TQPA 2DMTA 3HRTA 4KT5C 2WB1N 4MADA 1Q43A 2Y69H 1D4M2 4SBVA 4LO7A 3J9SA 3WV6A 3GFLA 2E7WA 3QP5A 1LHNA 3WU0A 2JDNA 4M3DA 2JQ7A 1Q1VA 3ZFEB 5A80A 2B45X 4DPNA 5I91A 3QBQA 1KXGA 3UYJA 2MEV2 1BEV1 3DTKA 1B72A 2O9LA 3MV11 1WJ5A 4HEA2 1A5JA 3LSTA 3DGTA 2XF7A 1A78A 2IXJA 2D5VA 4HN1A 4P96A 2Q8CA 1FOD1 2ES3A 4LBNA 3C7JA 3VYRB 3PNVA 4EJRA 2YS9A 3HWJA 4YIIA 3Q9VA 5C3QA 5T5OA 3NJYA 2YPDA 3K10A 5D5UB 5AFBA 3U75A 2QTWB 3TB0A 3FM5A 2AQFA 2VE8A 1MMDA 2D3RA 1Y0NA 3E1F1 1TTYA 5M3MJ 4IHTA 1JHJA 4XUOA 2E60A 2ZNZA 2IW5A 4PHZA 3AG1H 2JA5J 2ZKNA 3OD4A 2PJPA 3NAPB 2PLYA 2LTNA 5EF6A 1JT0A 1R9TJ 2RVCA 3ZIXA 1AOYA 1LEMA 4BIOA 2DJIA 5FO5A 1CAWA 5E79C 1XRUA 1YITI 5JR3A 2RS12 3ABZA 5IK5A 2A71A 1GKBA 3HOYJ 1IXRC 5DS9A 3ZMSA 3JAMK 4L0ZB 4BK4A 3DKQA 3RSJA 3BCBA 2G0EA 4XLAA 3GZAA 1RTVA 1V6IA 3DEUA 3HQXA 3QP6A 1W99A 3CLOA 4F3JA 3C7GA 4HF1A 5ILSA 5DG2A 2VLAA 2FDFA 1RUE3 3JRFA 2QQKA 4WXCA 4HL0A 3GZ6A 4LKSA 3ISPA 3V0BB 2GSYA 1C1LA 2QQIA 4XF1A 1FZPB 1WCMJ 3I2OA 5F2WA 2ZMEB 5FYBA 2DU0A 5J6XA 2B4KA 3AL0C 2P3YA 2PG4A 1EAH1 4YZ3A 1ODDA 1A35A 2JKXA 3ZX7A 2UXNA 3VKLA 5HI0A 3K4JA 2EFPA 3ZFFC 2V1XA 2KT0A 4UWDA 4KT6A 3POJA 3RMYA 2WIIB 1VQ4I 1VFCA 2HQNA 1HV1A 4S04A 1ZBE2 4L97A 2QQBA 3NKTA 2ZHLA 1WCSA 5TSWA 1GUUA 1ACCA 3OIOA 3IB3A 3BTZA 3W2WA 5FZOB 2P81A 3EO6A 2WAEA 1MS5A 2ELKA 3M3IA 2QUFA 3J7LA 2QZ2A 3WCRA 3K77A 2C24A 5LHGA 2HVQA 4RR3C 3V4GA 3D6EA 5F04A 2EILH 2DCZA 1MBKA 3DF0A 4M72A 4JYKA 3CCMI 1HJGA 3PJYA 5C33A 4AFCA 4ZY9A 3FLPA 3A0BC 3GFIA 5LZ6A 3ZMVA 1U5TB 5FMBA 3ILNA 1PVC1 2ZB9A 2HOAA 3IRRA 2Y48A 4DO0A 1W8HA 4GMP1 1UY0A 2R071 2YYOA 2EV5A 3IH4A 3F3XA 3C18A 2DW4A 2JE8A 3JXSA 4YRVA 2DVAA 5KNLA 3KETA 1H6XA 5KC5A 1FX5A 3HC7A 2YZ4A 1XG1A 1LJ7A 4ARYA 4FXGB 3CDZB 1ETYA 1W2UA 1T8IA 1W6MA 1LGBA 3GZNB 3OPWA 5L7OA 1H2LA 1DGRM 3DEMA 2JRTA 1U0JA 5FFZA 5CKTA 1WWXA 3O0WA 5D4RA 1APNA 4B4QA 4E70A 4MQ9F 4ORFA 1TNTA 4NHKA 1GT0C 4DFSA 4A3JJ 4E6KG 1GNZA 3AFKA 4GO1A 2YBSA 1Z0XA 5HCHA 5JIAA 3ZQLA 4OHVA 2MD5A 4ZU7A 4IGPA 3ZKUA 2M8EA 2KP6A 4FO9A 3HOWJ 3K0LA 1MMNA 4Q2FA 1AKHB 2R063 2DYSH 1Z91A 3NQOA 5C3OA 1P4WA 1EKEA 2J5OA 2ISZA 3WW3A 4MG2A 1E57A 2X6XA 2VQCA 5H20A 2LRDA 4XLFA 4AC0A 2A70A 2WT1A 5DAXA 3VBSC 4ENMA 1PO21 1FP2A 1V6LA 1P8JA 4O7XA 3P9KA 2PAMA 3DPRC 2ECCA 2NYXA 4KDPA 5IK7A 3ZRGA 3GW2A 2XASA 2C1FA 4F92B 1SPPB 4FP2A 1W5CC 1S0EA 1SZBA 3LA7A 2K9ZA 4NMIA 1T2KA 2HDCA 4MGZE 4JHZA 5FO7B 1W8WA 4JX5A 3EBRA 3FK7A 4AU7A 5GLTA 1HKSA 3LOIA 1IG0A 4W97A 3VL9A 3K4ZA 3V7RA 4KJZA 1WW5A 1PO13 3VBHB 4I2OA 1IS4A 3WU2C 1G3WA 5JSRA 2H0BA 2VW2A 3I2JA 2XAGA 4DQAA 1W6PB 1H1MA 4K40A 2K9NA 2QSFX 1ZREA 1HV0A 1IN7A 2R7TA 1PK6C 2O7OA 2V4AA 5F5AA 2LDUA 1CAXA 4RHV1 2XVLA 3M1EA 4LB5A 4A3XA 2L54A 3ZN5A 1UELB 3LIGA 4DRRA 3ML6A 4A42A 2XSJC 3U37A 3B5LB 4QQOA 2D6OX 3J7AO 1SDWA 3LFMA 4JRLA 3POSA 3PL0A 2FUG2 1RR8C 1NUKA 4FX0A 2VZRA 4UVAA 5IP6A 1CAVB 2UWAA 2GNBA 3N05A 4Q4X2 2R7QA 1ZG5A 3I59A 3KP2A 1BKZA 3WY6A 5CFDC 1AXYA 1EH7A 4BZ4A 4AI1A 2LH9A 3PIOF 5LATA 2B63J 3SEPA 3DEEA 1LULA 2JDZA 2GWRA 4NBQA 4XUPA 1US3A 5J96B 4EM0B 3JSPA 5M3FJ 3KP3A 1ZRIA 2CV0A 1VTNC 3PIJA 1HKDA 1OISA 3PVOA 2JG9A 1R23A 1TEIA 1F2NA 3H3VK 4PBOA 1FOKA 2DA2A 1QHHD 1MEC3 1A31A 3ZMUA 4LLGF 2FSWA 1U6GA 5A7PA 1QQP3 4XRMA 5C9AB 1BL0A 4XQ4A 3BR3A 4AEDB 5KHJA 2IXKA 1BIAA 2R5YA 3MFAA 5HLHA 2DMQA 3BTCA 4IE5A 2FDKA 2EA7A 3S2WA 5JUVA 4MH0E 2WZR3 4K9SA 1Y7BA 3GF6A 2IS2A 4EV0A 2G9WA 3PSIA 3LSEA 3JD73 4XMIA 4QX0A 1F35A 2VI6A 2AACA 4AEKA 3DL3A 4M71A 3VDXA 2R93J 1H6YA 2ZGQA 3CP2A 4WXDA 4QTRA 3GCWA 2KIUA 2NPIA 2RS11 4ZZ8A 4KFCA 4AIDA 3H35A 2HYKA 2HQ5A 1J58A 4M3BA 5D8AB 1O3TA 1WVRA 4AAPA 3H3UA 5GAGJ 4B4CA 5LY2A 4AGGA 1OA4A 3MIBA 1IRZA 3RQ0A 1PGL2 1BR4A 5DYMA 5FOJB 3AKPA 2HXIA 1O57A 4QMAA 4OLLA 2DTYA 1GP5A 3D8CA 4EMSA 2CSGA 1QJX3 3WTVC 3DBHB 2X8KA 3ME2A 5FBZA 3AM2A 1OLME 2WV1A 1Q1HA 1G8XA 3WLUA 4QPGB 4KICA 5ANQA 5E8AA 2HWE3 2AYHA 1FY7A 1GWLA 4CCLA 3SZTA 4BLIA 4CO8A 1JODA 3LEGA 1X9PA 4I7HA 3MLJA 1W4MA 5L9BA 1LDDA 2EB7A 1WCUA 1VBB3 2M7BA 1HRI2 1J2XA 5LA2A 4XJZA 2H6CA 5CEHA 1TT5B 3W5MA 3P5BA 2NVUB 2K9SA 1S4CA 5EHDA 1BK0A 2HEOA 1RUI2 3SJMA 4QX5A 4LK1F 3X2QH 5GM0A 1XSVA 4JKLA 1LEAA 4BQ2A 3VBRB 4AI2A 3LOBA 4UBHA 5FUIA 1MZ6A 5CFCB 1O7LA 3VGIA 1STMA 1RKWA 3GO5A 1C5HA 1R7JA 5FYCA 1HSJA 3BC8A 3DUIA 1UZWA 1OJLA 1BC7C 5CZKA 1VMFA 2RS32 3CIHA 2K5CA 1R1VA 1OYWA 3LWFA 1ACIA 3TO7A 3R4KA 2FNAA 1QOOA 2LR8A 5FR3A 1ETWA 1JBCA 4H7LA 4BM8A 3I2HA 4K1ZA 4B44A 1OUXA 3ZSKA 5ABJC 3OMYA 4LK7A 3WHTA 3P7NA 3M8JA 2QJVA 2VO5A 3WCSA 2HOEA 2MD0A 2WQZC 3NNGA 5ANNA 2NS7A 2QLZA 1EV12 5FZ8A 1IJWC 3H0GJ 1AYN2 1MBGA 4OULA 4XUNA 2OA4A 1XGMA 3CQZJ 1IDYA 4V2WA 4CA9A 1HCRA 4LMYA 3M9AA 3I3QA 4CH7A 3FL7A 3FN9A 4LBMA 1Q3EA 5FYMA 4XL9A 3O1OA 3D4KA 5DCMB 3FHQA 4EM2A 4BDVB 2DBIA 3TOJA 1RYYA 1G3TA 2FU4A 4L2NA 2GXGA 3VZKA 2NVQJ 4HLXA 2GU9A 3TMOA 4L5JA 3JRDA 3NV2A 1D8KA 4Q4Y2 1DZTA 4Y33A 2K4BA 1LRHA 3AFHA 4LLFA 3CHXA 4KG0A 2I07B 1G86A 2VL4A 5FKCA 4XURA 2Z3YA 2KRFA 3TAYA 2STTA 4A3GJ 3WGGA 2EXHA 1FMVA 2HXOA 3K7AJ 3DCFA 3A01A 1POV3 1R22A 3FBMA 1N77A 5LBBA 3WUCA 3ECOA 2O8QA 3MYXA 5FKOA 1AR82 2W47A 2MBFA 3OYWB 5A3OA 3TN93 3EYYA 4A6DA 2H1KA 2HZDA 5KHIA 3IBMA 1AXKA 4UW3A 1TWHJ 1JZ8A 3LSRA 1MZFA 3VBUA 5T5LA 4B43A 3U07A 1NCQB 1I1GA 2R1DA 2V79A 2FEZA 3USUB 4QB1A 5EZHA 2DPDA 4QLCU 3EUHC 1B8IA 4LD5A 1HQCA 1K42A 3SCFA 3FBYA 1BOAA 1ZZ7A 5DUKA 5C4WA 4YWAA 2WWUA 4QM8A 2W1WA 2GN3A 4ZYGA 5APAA 5TRDA 3VB2A 1MS4A 4A3KJ 1D4VB 2XJTA 1ULEA 4Z07A 1REDA 4DYCA 5K5QA 3MLKA 2A61A 1LE8A 5HCAA 1RUC2 2D6PA 3T5XA 2DMPA 4RB3C 4JKKA 4LO4B 2A68F 1ND2B 1UYZA 5LBFA 1ZBA1 4XUQA 5KVRA 1AR63 2WLQA 3H9GA 1S2BA 1HN1A 4KBZA 1HKTA 1L3JA 3L2WA 5A3PA 4KIBA 4Y4YA 3S57A 4JGZA 3HOTA 2Z42A 4RGKA 4IEYA 3R05A 4M6XA 5IPAA 2I74A 3W20A 1UOJA 4EN8B 1ZRDA 1XC6A 4P00B 2BY1A 2BERA 1WPKA 2CL2A 3INAA 4YGBA 1LOEA 1AWCA 4AFAA 3K75B 1KGYA 3MBWA 3RCOA 1JOJA 4Y15A 1RVF3 2OZUA 1CQ9A 5K9YA 3HIFA 2DO7A 3GXUA 1TL8A 2GMMA 1VB2A 3POIA 5F0CA 5J3UA 1BBT2 1YRZA 4HVOA 3QOPA 1MSEC 5K0UB 4XPVA 3J7MA 5J09A 2YGLA 2LD5A 2TBVA 2R7SA 2BBYA 3HTUA 1QJU3 5FP9A 4E2SA 2BWAA 1D0ZA 4I0WB 4BQ1A 1YIJI 1VNDA 4H7MA 1NA1C 2JENA 2XB0X 4O9EA 1OOPB 2PFWA 5HCBA 4PLMA 3T8TA 3U0ZA 5LW9A 3WNNA 2VH9A 2F6BA 4XJWA 2Y75A 1DG6A 3MIHA 4AFMA 1QJY2 2IRFG 3U9GA 3A2KA 5GLZA 2C9KA 3ZQ7A 3Q3SA 3SH4A 4C8DA 4FTHA 5LK7B 1U78A 1T38A 1UY2A 1VJ2A 2IP2A 4UXNA 4IRHA 3N9OA 1W8OA 1SCSA 3OV8A 1ND3C 4I3GA 3MD2A 3O2PE 1ASJ3 2BPA2 2YB7A 1OCZH 1GP4A 5E6HA 2WNUA 4GWNA 4AVZA 2DUQA 3VOEA 2WQ4A 1L3LA 4HV6A 5A6XA 2JDPA 2BJSA 3BQYA 3R0AA 3OYBA 5TJJA 1UKRA 2CAVA 3UNPA 5FZ1A 5IY5H 1JOPA 3F23A 1BW5A 3FHNA 1RUG3 4AQSA 5FQ0A 1SLLA 3VLBB 2RM23 3I5UA 2M7AA 5FPAA 1IPKA 4ENJA 5IW0A 3OSFA 3PO3J 2HWF1 2C5DA 1R081 4OZXA 5IUQA 3J81Z 1OCRH 1MH4A 2FOKA 2R5ZB 3UGHA 5CU1A 5C44J 1MS3A 3PJQA 3MMYB 1F4AA 3OSDA 4OYUA 3WG1A 1PGW1 4TZDA 4FFHA 4Q47A 1MS9A 1UX6A 2ZJ2A 1PGL1 2MABA 5H2FC 4IHYA 1RITA 1T6GC 2K0GA 4KGGA 2JE9A 3A0NA 4V19K 1JH5A 5LASA 4BLJA 1P2FA 2ME0A 3CC7I 4OMYA 1MNEA 2WL1A 3BIEA 2AH2A 2DFEA 3H8XA 3VZMA 3P3NA 3DBLB 2YPRA 2HJIA 3FXMA 1SAXA 5IVFA 2DVBA 2GC1A 3ZQFA 4DRVA 2OPWA 1FATA 4D8MA 2ZFWA 4FCYA 5HLGA 1AR73 4NHYA 2EPFA 4Q0SA 1QF3A 5EYRA 1RUI1 2GAUA 3URFA 1JUSA 2VZSA 4LNVA 1EA3A 2ETEA 1VF9A 3PL8A 2DFBA 3PUSA 2D43A 1U5ZA 1S8NA 4HX8A 3FZ3A 2QQPA 1Q8OA 2L7ZA 5E1RA 3WG2A 4BQ4A 2VZQA 2JT1A 3T1MA 4M0HA 1W3VA 3J7YJ 1PUEE 1RUH3 2LTPA 2W4SA 4XTPA 3FHZA 2JDAA 3Q5FA 3PU3A 5J98B 4UYBA 4KMUX 1XSQA 4CP1A 5HVQC 2N8GA 2JN6A 2Q8OA 3CC4I 2O03A 4B1RA 1W6NA 4AI8A 2Y9YA 5A1FA 4DINB 1EV11 3J80Z 2DOEA 1JUHA 3DKYA 4EJOA 4K6BA 2VM9A 5FKMA 2VNVA 1HQLA 3PUAA 1RUE2 4RS5C 3BTAA 4XF9A 4NHJA 4G3YC 1LHWA 3BIWE 1TMF3 2PQSA 5EJ1B 5C70A 4EN9B 4A93J 2VJ4A 2E33A 3B69A 3SEZA 1UKGA 1FIAA 5GAHJ 1UAAA 4XC9A 1O3QA 4BE2A 3AL0B 3W58A 4C91A 2E31A 3OWTA 2YU2A 3MIDA 4AAXA 3BR1A 5FXXA 3ZFFB 2VCCA 5FB2A 1EH8A 2VZ3A 3ZYIB 1GR3A 1X1BA 2HFHA 2VBWA 3N9NA 3PQKA 1BYHA 3BP8A 5JSPA 1QQIA 4IHWA 3IMMA 3OGVA 4LHSA 3OPZA 3VDDA 3KYDB 2ZGRA 3HBKA 2VR4A 4HRIA 2PMZN 2EZLA 3ZDSA 2DVFA 3CZ6A 3V8LA 4R9AA 2H8RA 3RZMA 4IEPA 4XHXA 3I3LA 1YJNI 3GZUC 2XAFA 4RR3B 4UI9L 2O8OA 2AXTC 3ITQA 2K9LA 3BY6A 3C7HA 3JRHA 5BMZA 1Z1DA 2I10A 4I0AA 2LM3A 4BISA 1BIBA 1LDKB 2DA6A 4B7KA 5IAXA 2C9AA 2W24A 5D6EA 2VZPA 4AQ6A 3H1YA 1ZGWA 5JVTA 3WTXC 4FQ4A 3V8JA 3WTZA 1JS9A 2F48A 4HZFA 1GZWB 1X7NA 2K85A 1M06G 3LQRA 4HSJA 2BFUL 3THPA 1AL23 4BBSJ 3F22A 2E9QA 3W3CA 3FHIB 1T0FA 3V42A 3SH5A 4XQFA 4D7SA 1ZZBA 2PHFA 3B7MA 1T6BX 1RUC1 4D5FA 1SC7A 1GZTA 1ZGAA 4LK6A 1QEXA 2VVEA 1REEA 2A69F 2OJED 2FQ3A 1NG7A 4XJ8A 4AHZA 2WLPA 1W2AX 1SLIA 1WLDA 2K3PA 1UD1A 3OOXA 1TT0A 3CMYA 1PYVA 3ZYBA 2V6CA 2VQTA 3MV01 2RHPA 3MIFA 3AYEA 4BWOA 4XRSG 3RFRA 1OD3A 3H92A 3KEYA 1ZLJA 2R062 5D2AA 2IA1A 5LA1A 3CCSI 3PU8A 2BBVA 5JI9A 1UPIA 4DUXA 2EV6A 4PSWA 4G6QA 5L19A 4IE7A 1W0UA 3LEKA 2CRGA 2VE9A 4E8DA 2UV1A 3VBSB 1RUJ3 4C3HJ 4W6YA 5LB6A 1D2QA 1F4HA 3DPRB 5ED4A 2VULA 3UKTA 2X09A 4AVCA 5BY5A 4R4XA 4P08A 5FUNA 4GKXA 4CU6A 3O0XA 4KMFA 2E26A 1KQ9A 1QJY1 5FLIA 3VZJA 5CA6A 3MAJA 4Q26A 3Q0WA 5JIUA 1PO12 5I0TA 1I3HA 2CUFA 1VBD1 4BS9A 4P02B 5LBCA 1AR93 3BGAA 5DN2A 5E1XA 1O4YA 2WT2A 2QZ8A 3K2AA 3JBG1 4XJ9A 3WX5A 4EJVA 4N4OB 5FPVA 3WQ0A 4C3IJ 1SFXA 1QXJA 2CQQA 4FETA 3BU0A 1PK6B 5LRSA 2TRTA 2ZC2A 3PM1A 2ZGSA 1XXNA 4YFKF 4MUVA 3DTIA 2D40A 4Z1VA 2BHYA 5B3SH 4LEJA 1ZRFA 3H5AA 3B9IA 4CDWA 2XR4A 1GV2A 4AEMA 2H6BA 3LPGA 3UR3C 1X1CA 5JLWA 3Q8AA 1T2XA 1K4SA 5GZGA 1E5RA 5FP4A 3D5LA 2A6WA 3F95A 5EG0A 5FZ9A 3DCQA 2QSGX 4F55A 2D6LX 4G7ZF 3Q8BA 5L3FA 4F7ZA 2ZCWA 1S7EA 2A3YA 4RSUA 4QGLA 4IGQA 5C8CC 2X05A 4Z6YA 4IRIA 5CFDB 5JVGF 3UJOA 4Q4V3 5TISC 5JZGB 2JA2A 2RJKA 1DDNA 2V6EA 4XF0A 4BGDA 4XLNF 1AJOA 2RJLA 4IEQA 5JWPA 1BEV3 5A1AA 1X3UA 3AMPA 1KQ0A 2E1NA 2JK3A 1MR5A 1UZZA 3F8BA 4CCNA 2E1OA 2LRPA 1Z9CA 4AW7A 2CUZA 2WWSA 3A7QA 1MEC2 3FE5A 1QQP2 1FOD3 5DV5A 2XC7A 1JZ3A 1ZH5A 2VKVA 4GKYA 4WZFA 3A23A 1VI0A 1YS6A 4IEXA 1YLLA 1MIJA 1OYYA 2QVSB 2DDBA 5B66C 3WZ1A 3ZQIA 2WZR2 1ZYRF 1RMU1 5D21A 4DMIA 2O3FA 2V9VA 3JD72 1ENQA 3K4CA 2ME6A 3HSFA 2ZMEA 1JGGA 1WMXA 3E7LA 2A6ZA 1H0MA 2VBYA 2GA2A 3VB9A 3RZKA 1JTXA 4NDLA 4Y24A 1Q8SA 4CVUA 1DQ4A 1OXCA 4QXKA 3BOQA 3HT2A 5JR2A 5GLVA 2UZKA 4LBJA 3I55I 5ICGA 3KF5A 2XF5A 1SD5A 2IBDA 2RNGA 4A3MJ 1BJQA 3PUIA 3DF8A 4PGHA 1XE7A 5D8KB 4PIYA 4CHUA 3HN3A 2VZVA 1OQ1A 3H1MA 3BCWA 4B4PA 1WKMA 4LLOA 3S7IA 4L5IA 1FAYA 5A7OA 1LUJB 1SDDB 1PNFA 1V70A 2ZXHA 1PUFB 4AIJA 1RUE1 1QJX2 2XJRA 3HSRA 4PK4A 1ZNPA 2BGOA 1LOCA 5BNOC 1PGSA 3C7FA 4OHYA 1PX3A 2EIBA 1RJ7A 1G59A 3ZYPA 1GOHA 1U5YA 2VMEA 4Y20B 4UT5A 2HWE2 1L7QA 1AL0G 2JICA 1YI2I 4NWVA 2GXBA 1R49A 3VD3A 4DB5A 1U5TA 1AX1A 4WXHA 1VBB2 5DAQA 3WTUC 5GLUA 1D1AA 2XHNA 2PHLA 3CO7C 2VUMJ 5FAXA 3V8KA 5FDBA 4ZH4F 4JV4A 5HDKA 2Y6JA 3FJSA 1KS4A 4ZPIA 5HOOA 2M30A 2PQQA 3SHFA 1SFEA 4QB6A 1VBC3 2JB8A 3WINE 3F2ZA 2A3SA 4LQRA 3C7OA 4V1PA 4PJMA 1HF0A 2CDOA 1SLTA 2ZX4A 3OGGA 2XVCA 3HB9A 4QWQA 2JUGA 5FKKA 3NRUA 1WJDA 5FKLA 2WN3A 2QQVA 3HQUA 4LORA 5M5WJ 1C3HA 3VZNA 3MPPG 3O1SA 4C2TA 3D0JA 2JRMA 1URXA 1Y1WJ 3AYAA 4FPYA 2DVDA 5ABJB 2VVDA 5EP9A 3M8FA 1NLSA 2BGPA 1CQTA 4UVCA 2EALA 5M0TA 1Q8QA 5KK1A 2X1DA 4LB6B 4N9HA 4O6JA 4V2VA 3HEIA 3I2FA 1V5FA 3B6AA 2OC6A 2AZ5A 4BQOA 4EGYA 2R7OA 1OURA 4YW6A 1HXDA 2ATFA 4COVA 2A6TA 4LBQB 2FQPA 3K2ZA 3CBNA 5FLHA 2ZKZA 4EEFG 3BDDA 1SFYA 3SH3A 4BMEA 1MS1A 2G4IA 1S6LA 3J7HA 4JVAA 1TWFJ 4YVWA 4BXUA 4XFCA 2E1MC 1BR1A 4QXHA 3V56A 3ZXKA 4GULA 2R0QC 1UG0A 3VBFC 1SPPA 1ZLKA 3OCPA 1D0XA 3LSKA 1XB4A 1G9AA 4H14A 4N8MA 4BKXA 1YJLA 3TGNA 2FCTA 2YBKA 5FRNA 3HEFA 1OQEA 3IC7A 3O1MA 4UFLA 1BJAA 1UW8A 2E6VA 3COAC 1B09A 1H1AA 1ITYA 2JX9A 1ULDA 3LSHA 2RN7A 2DQRA 2V7FA 2GP5A 3TN92 3O12A 5FPLA 2R061 4RGAA 1FMD3 4GJZA 1COV3 5FZ0A 2V9PA 3WTWC 1WMEA 1RUOA 3R0JA 2IS6A 3OUHA 1R1UA 4GYGA 2V73A 4EJUA 5B4XA 4PJJA 4DXRA 4U0YA 1DGRA 2JB4A 5FREA 3NRVA 3AG4H 1NY72 1O59A 1I27A 4ESFA 4ARXA 1JXSA 2W7NA 4A0XA 3ZMDA 1OPMA 4XSXF 2VTXJ 2YUSA 4MHUA 3OYMA 4C2MJ 4TLGA 2BVLA 4QPQA 1UIJA 3JTGA 1XMKA 4QIWN 1JHFA 3ZMOA 5FXWA 3GM8A 1VQ6I 5BNQA 3FIWA 1UNBA 4HNVA 1HW1A 4M3CB 2LYCA 1R58A 2CFOA 1XGNA 3A4CA 5J1RA 2NVYJ 5J8FA 2QYOA 4Q8KA 2ZBJA 4RHV3 4AF9A 3IUOA 4RAGA 1NH3A 5J36A 4W8JA 5K7HA 4GJYA 4A3EJ 4DNCA 2Q30A 3A03A 3I4MJ 4MGKE 5FZMA 3PNAA 5J48A 3S2DJ 2M3AA 3L2YA 4IE0A 1YIFA 1NZCA 3UK9A 4LFUA 1Z0HA 2UWBA 5HNFA 4NC8A 2VMHA 1BOBA 1D1BA 1HDPA 1YWKA 3ZXDA 3TW7A 1RVF2 1LFBA 1MBJA 4L0PA 2JZYA 5A7WB 1JKPC 1E0EA 2DLLA 2BNMA 3WF4A 1ZAOA 1HB3A 4WM8A 3WG4A 2Y2ZA 1DBNA 1POQA 3AZVA 2WA0A 3ZYFA 2DK5A 1QJU2 2BEOA 3USSA 5CKMA 4P1WA 1W7PA 2LNBA 1GUIA 2HEWF 4AWDA 3ZQQA 1NA1B 1SMTA 2DUPA 5ACA3 4HPKA 1W2NA 4BQAA 5FXZA 1CAUB 2F4MB 1XCBA 1TVGA 5F6KA 4D7TA 2DN0A 1H2KA 2P5BA 1DUXC 1Z6TA 2GIVA 4OI4A 2WY8Q 2JECA 3LWCA 2EH3A 2DA5A 1K78B 1Z67A 3AKTA 4LLNA 1ASJ2 4LG0A 2OQRA 1ND3B 1QQP1 4OMDA 3NMBA 5L7OC 1K6OA 4AVSA 2YFUA 5DZGA 3ERMA 1X82A 2YU9J 3KV4A 1UMHA 4K8RB 3T2OA 3TQNA 4FP3A 4NWWA 3QU3A 3ENRA 5F32A 3OPTA 5KAIC 4BEHB 3CTAA 1ZG1A 2UWMA 3FMQA 2OS2A 4ASMB 1UCXA 5IATA 2HWD3 3HBLA 4PJ0C 3JD71 3NV4A 5BQTA 5F1JA 1RUG2 4QPIA 2E2IJ 2K9QA 5IT9K 4HANA 1PZ9A 2IJLA 5DZFA 2RM22 3ZYHA