3LA3A

Crystal structure of ntca in complex with 2,2-difluoropentanedioic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSRQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
molecule keywords Global nitrogen regulator
total genus 58
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la3A01
1Q43A 3RKXA 1BC8C 1V3FA 2D5FA 2VN2A 3ES1A 3GFMA 5AIQA 2GA1A 3JSPA 4L0ZB 2C0ZA 4ZH4F 4M6YA 2P17A 5FLIA 2F5EA 2OZUA 3WGHA 2JPBA 4LK0F 5BS6A 3O14A 1UW8A 3MAJA 5CJ9A 4NVPA 3JW4A 2VPVA 3TDZC 4QWQA 1YLLA 5DCFA 2XASA 2VC0A 4WWCA 4IEQA 4Q0QA 4HYEA 2H6CA 2Q30A 2GC2A 4U7BA 2WV0A 2V79A 4K2EA 3Q9VA 1OD5A 1G3YA 4ENNA 4A5MA 2PFBA 4LJZF 2DT5A 5HLGA 4MGKE 2GXGA 3F3XA 5L3FA 2QBYB 1Y3TA 2K9ZA 3QU6A 4IF4A 4GO1A 1AOYA 4RB3C 2E1NA 2O61A 2P5VA 4M71A 1R1VA 1G4DA 3WTXC 2EWNA 3R6SA 4HN0A 2RGVA 3RPUA 1UD1A 1R58A 1TQMA 2OAZA 4YSFA 2ZBKA 2E1CA 2Z99A 4MTEA 3FWEA 2GA2A 2V09A 1R7JA 1GVJA 5HI0A 4WXHA 2PAMA 4FT8A 2IXLA 1YYVA 3MZHA 4UXNA 5LGTA 1MZBA 1KYWA 2PMHA 1WSUA 3EHKA 4I02A 1ZAOA 1MKMA 1QO0D 4BHCA 2ZNYA 3M9AA 4Q29A 4I01A 2YR2A 4Q48A 1MJ9A 4MGRA 3MZYA 3QPTA 3IL2A 3LA2A 4TV7A 3LWCA 4JV4A 4AWXB 3HSRA 1REPC 2RQPA 1NXMA 3C18A 2DLLA 1O3RA 4HBNA 4KN4X 2PYTA 4LK1F 4P9GA 4LGWA 2MA3A 4MTDA 1GXQA 1XSXA 3ABUA 3MPBA 2P6TA 2L02A 4FAHA 4CICA 5BPXA 1T98A 3IWFA 4CHUA 3E5XA 5L3BA 4BQAA 2E7WA 4BAYA 4QX5A 5HDNA 4EQQA 3ECOA 3L2CA 5H6QA 1YW7A 5KBFA 4YYOA 1K7AA 3CUQB 5E8GA 4AVAA 2FNPA 2EB7A 4FX4A 4U88A 3F6OA 2A68F 2EFPA 5TRDA 2Y48A 1FOKA 4HA8A 1NYWA 4ONUA 2B0LA 3WW2A 1BOAA 3U10A 3E3VA 3M1EA 3R61A 1R00A 1XCVA 2K7LA 2O1QA 5BPIA 4KU8A 1TQPA 4MEYF 5DCMB 2PQ8A 3USSA 4HLXA 2V6CA 3I5UA 1SD4A 2H6BA 4MX3A 1W7PA 4RB0A 4HX8A 1WGPA 3QP5A 3SQNA 5C8WA 2KIUA 3SHRA 2XL7A 3MYXA 1I27A 1I6XA 5DD8A 3NSTA 5DEQA 3FE5A 3MWMA 3COAC 4WXCA 2CO5A 5HDKA 4EWEA 1UCXA 2RKHA 5D5WB 3F21A 1LDJA 4IRGA 3JZVA 2FMLA 4G7OF 4WZCA 1ZH5A 5KHKA 4PIZA 2PN6A 3IWZA 2Y0OA 2KIMA 3GUDA 1L3JA 2GIVA 4AD9A 1X8EA 3SCHA 3DP7A 1U6GA 3IIAA 4DNCA 5J8CA 2WFPA 4BIFA 4UV9A 3TOAA 2O8XA 5FGMA 2Q2EA 2H0VA 4P55A 2QVSB 3MCZA 4MGYE 2IT0A 3DPLC 2QBYA 4IJAA 5D4SA 5H20A 4F7ZA 4TLFA 1O3TA 4B09A 5K5QA 4KA4A 2CYYA 2XIGA 2YU3A 3SCFA 3ZPLA 1R1UA 3E5UA 1YFXA 4KMUX 4ZU7A 3TDUC 1H1IA 5DYMA 2ADUA 1S8NA 5BOXA 3PQJA 3HHGA 1T38A 2M45A 4LA3A 5H6RA 1VTNC 4YRDA 3C7JA 4Q4ZF 1YS7A 1K79A 4XETA 1SMTA 3FM3A 3QACA 4OFGA 1PP7U 1SD6A 1EV7A 3V7RA 4H0EA 2QCSB 3ST7A 1IZ1A 2FBKA 2HFHA 2DCTA 1RTVA 2Q4SA 4MV2A 1HW5A 5LEJA 2Y75A 4IXAA 2VE9A 4EJWA 3B02A 5CVJA 4ZU4A 3UKVA 3IDBB 2Z9OA 3WTWC 3QOPA 1J58A 3JTGA 3S7IA 3ZQ7A 4LTAA 4ZYHA 5CVRA 3FZVA 4ASNA 1JE8A 1J2XA 4G9YA 2UY9A 4HDVA 4M9SA 2CAVA 1XSVA 1H0MA 3CLOA 1ZREA 2Z2SB 5ICFA 3CUQA 4Q47A 3V7SA 4IEUA 4HOBA 3CJNA 3D82A 3S0MA 1JUHA 3HRSA 5EFUA 3BJAA 2EJRA 4L9NA 4Y13A 2CV6A 2H94A 3TO9A 4HW0A 5ICGA 3CUQC 1NHAA 2BEOA 5DV5A 4XF3A 3F72A 3BPZA 1NE4A 1G3WA 4P9UA 2Q0AA 5E1XA 3CJXA 2DPUA 3S7EA 1BI2A 1K6OA 1IN4A 2A69F 3OD0A 2HDCA 4MGIE 2B8MA 5JR3A 2W84A 3GFLA 1KU2A 2PMUA 5A2QZ 5KHHA 1XGSA 1EH8A 1S6LA 4M74A 4Z2YA 3P9CA 1R36A 2K0GA 5I91A 1SAXA 3DF8A 3DV8A 2MH9A 3T0YA 3BJ6A 1E17A 1YFYA 1SFNA 5JFRA 1NZCA 2QYOA 3VHRA 3ELNA 5J3UA 3H7YA 4AQ2A 4IEZA 1PUEE 4IHSA 1ON2A 3GFJA 4I0AA 2IPQX 2QZ8A 1ZRDA 2MD5A 1U8RA 1Q3EA 1STZA 4XRFA 4PGHA 1RNLA 4A0YA 4PZJA 1KU3A 2AXLA 2Z69A 1H9GA 5BXXA 2HS5A 4X6QB 1Z6TA 3E5QA 3LA3A 4LFUA 2ISZA 3GEZA 3RTRA 2Q8KA 2F5DA 2XLGA 3VODA 2HQRA 2XUBA 3BDDA 3TGNA 1CGPA 3TOBA 1HKTA 4Y15A 1I1SA 4BXUA 5BPDA 2DBBA 4LB5A 3PVBB 3K0LA 3M8EA 1CAVA 2O03A 3NEUA 3KP2A 1FYMA 2Y0MA 4I3PA 2F5CA 4BHBA 4S04A 1BI1A 2EV6A 4FX0A 1ZG3A 1DDNA 5E8IA 1JHHA 1O4TA 1ZRFA 3I71A 3FMSA 2KXLA 1DPRA 4WX9A 2D1VA 4PDKA 1TBXA 4EJOA 1K78B 2GQQA 1ZVFA 3M70A 1HW1A 3WW1A 2ZNZA 2MPFA 4OIRF 3DL3A 5IT3A 1J3RA 2V1DA 3HHHA 4RB1A 5LEKA 2RN7A 3CO7C 1FYLA 1KGSA 1ZRCA 5DUKA 3ROUA 1HW2A 3WTZA 1XDUA 4MNUA 1O7LA 4A2UA 2MBFA 1SFUA 2PLYA 1SEFA 4HVRA 2CGPA 3BU7A 3C3VA 5CVUA 4Q0VA 2GC1A 1IPJA 1D3YA 4A5NA 1IRFA 2FF4A 3EDPA 2YSRA 1LQ1A 3T1BA 2I45A 3HUGA 4GCVA 4HDUA 3JTHA 1EH6A 2D93A 5JCTA 3GVAA 3FHIB 2IP2A 1W5TA 5C6CA 2UXNA 3HT2A 5TJJA 3LAPA 2FU4A 2LNBA 1CX4A 2CG4A 5JR7B 4IEXA 3HSEA 3OF1A 1WA4A 2UYBA 2W24A 2XAJA 5JSRA 2Q0OA 1BIBA 3KEOA 1SD7A 4M9XA 4LD5A 5D1IA 3QAHA 5FD6A 2K02A 1IN8A 4P5OA 2KJCA 4AIJA 1U78A 1Z9CA 4IRIA 5DDGA 2QQAA 3R60A 5ILVA 3MFKA 3BJOA 1KYZA 1LVAA 3WW3A 4GGGA 3DQVC 3NL1A 3L00A 4EJVA 4J1XA 5K8SA 4OU0A 1USTA 2OU2A 1IN6A 3H9AA 1KQ9A 1ZRRA 1H9TA 2XKOA 4HSJA 4AVBA 2Z5UA 3EYYA 3FM5A 1B59A 3RNSA 3SZTA 3GLXA 5D5VB 4EM0B 1JXSA 4NHJA 3V8JA 4ESBA 4CXFA 2GH2A 1WLTA 4Q0SA 4XFIA 4OIOF 1F9NA 4RAYA 4HN1A 4LG0A 1BIAA 4N0BA 2Z3YA 2FEZA 2JSCA 3BP8A 2V1XA 4IPAA 2D2WA 3M3IA 3ZN0A 2DO7A 3V7CA 2RNJA 1U2WA 3K1PA 4M9ZA 1FI2A 4QGLA 1ZNPA 2VONA 2F2EA 1B1BA 4HQEA 1HSJA 1USSA 1IUYA 5ILSA 1X3UA 3I58A 3WTUC 3HTUA 1TTYA 1S7OA 3I59B 3QU3A 1KU9A 3K9TA 2GU9A 4L9VA 2K86A 1CF7B 2BE5F 1IXRC 4R8HA 1T0FA 1J59A 1IPKA 3PLQA 2ZMEB 1O3SA 1W7PB 3E6MA 2HR3A 4WK8F 1YTYA 4L9JA 4AQ6A 1ZZBA 2ISYA 2IRFG 1DPUA 5I8YA 4QM9A 1Z05A 1XN7A 2L4AA 3LSTA 1QPMA 1F5TA 1PMIA 3T8RA 4UHTA 2XKPA 1DUXC 3F8BA 3L9FA 1XE8A 4U0WA 1X82A 3BCWA 4M73A 4KUMA 1VJ2A 4PIXA 4EM2A 3UKTA 2MC3A 3HOSA 3WTYC 2P7VB 2DPDA 1ZX5A 4UVAA 4IERA 3CL1A 3RKWA 2BNOA 5FQ0A 2ZJ2A 1FNNA 1IW7F 5L3CA 2P5KA 4LLGF 1YG2A 3DKWA 3KLNA 4HLYA 4YIFA 3JAMZ 3O2PE 4NQWA 1EPZA 2B9UA 4ENMA 2QUFA 4O9EA 1J0RA 2VE8A 1Q1HA 1XGOA 2W57A 1LDKB 1XDSA 1G3TA 1XB4A 5I0SA 4O5VA 3FX3A 3W6KB 1GHCA 5I93A 4YIIA 2X4HA 3HRMA 4M72A 2COMA 1FBSA 3N4MA 1E2XA 4ENKA 3U2RA 5FDBA 3UKNA 1ZYRF 4YG2F 5BQTA 3EETA 4QGNA 1YFHA 4UBGA 2F5FA 2K27A 5LHHA 5FQ0B 4ZYEA 4KL1A 3NVCA 2EA2A 2M30A 4A12A 3VB2A 1S29A 4ZZDA 2FOKA 2ESNA 4I09A 3ZP5A 1PP8F 2WTEA 2ETEA 1ZZ8A 2PFWA 2KRFA 5HDGA 2QM3A 2HKOA 3NW4A 1FYKA 2L3DA 3ZMTA 3REOA 1I1GA 5ERIA 1TW2A 2IXCA 3W6JB 3SHFA 2L01A 4K8FA 3L09A 3M7GA 3H92A 2XLFA 1QZZA 4JTOA 1ONVA 1EYBA 3IDCB 4WXDA 3V8LA 4Q0UA 1W7PD 1ZLKA 2KKOA 3V8KA 5IT9K 3TO7A 2XAHA 1J3PA 1P4WA 2HTSA 1KQ8A 1F1ZA 1RGSA 2HQNA 1P92A 5I0TA 3CUOA 3IHUA 2MH2A 1ZZCA 2XV4S 3HQXA 5FPXA 3L2HA 4O3MA 3KP6A 4UV8A 4G94A 4XF4A 4D7SA 4FHTA 1ZG1A 2EFWA 4CO8A 5FD5A 4Q5SF 5I0UA 3K2ZA 1TW3A 3KCCA 4GXOA 1EH7A 3WGGA 3S2WA 1CAWA 4M6XA 4ON0A 3I7DA 5KK1A 3OTFA 1SMYF 5JI6A 1XRUA 3GW2A 1MD0A 4AVPA 4Y17A 2GAUA 2XAFA 4RGXA 3DN7A 2OYZA 3D5LA 3ZN1A 4RGUA 1D8JA 3O6BB 1FBQA 3FMRA 5D6FA 3P9KA 1CF7A 2MHFA 2IXJA 1KA8A 4DQ2A 5L3GA 1Y0UA 3HOTA 3TO6A 4KNYA 3GF2A 2EAAA 2A6EF 1OFNA 2M87A 3RPQA 4KWLA 1QY4A 3V4GA 3E97A 3KZYA 3HSFA 2A07F 1XCBA 2NNNA 3KZZA 1MGTA 5CADA 1FSEA 1O7FA 3VFZA 4GYGA 1IN5A 1ULYA 2FBIA 2X0LA 1X7NA 3SCGA 4LLLA 3R0AA 1O5LA 2P8TA 2DI3A 1YWKA 1WWXA 5HLHA 2QQ9A 2L54A 2QLZA 2HEOA 1PM7A 4ENJA 3CDHA 2D1HA 3I54A 1YIOA 1VR3A 1U5TB 5FFZA 3FXRA 2UY8A 2QNKA 3RYKA 3ETQA 4Q0PA 5KVRA 3JAMK 2V1UA 2R3SA 3CO2A 3EBRA 5I8SA 4OIQF 2FQ3A 2XVCA 1KU7A 3WW4A 1Z91A 1QXJA 3KE2A 3G73A 1W5SA 2EVXA 2ZKLA 3WG9A 3H3ZA 4AIHA 2PHDA 3WTSC 2XAGA 4HF2A 4MEXF 1V70A 1G3SA 2DU9A 3EQLF 3IKVA 3NKTA 4HF0A 3EYIA 2G7UA 4JK1X 4E2SA 1CAUB 4AXOA 3RIRA 4MUVA 1K78A 4HF1A 1GQGA 3K1NA 3CEWA 4FBFA 2ZO4A 3AAFA 1UHMA 1UIJA 2BGCA 3DPTA 2VC1A 1ZLJA 2JRTA 2MLKA 4RD7A 2NNYA 2A6HF 5FO5A 1LEAA 1RIOH 2RC4A 4G8XA 5JVTA 1BI0A 1XGNA 4PCQA 4F8AA 1U5TA 1DGRA 4L5JA 3LAGA 2BBYA 2C6YA 1I5ZA 3G3ZA 5AVPA 1VP6A 4EGZA 2CW0F 2J5PA 2GC3A 2MNGA 5BV6A 1WQ2A 3GZ6A 5CVVA 3L7WA 3LFKA 3EO6A 1O5UA 2ESHA 1QWRA 4MGZE 3RDIA 3BROA 1R22A 4I98B 2PG4A 4A0ZA 3FMQA 1RI7A 1ODDA 2E9QA 3CLPA 2E7XA 5ICEA 1FZPB 2W25A 2UWMA 1XMAA 2MLGA 1RC6A 3E6CC 3TNPB 2VXZA 2H09A 2EV0A 4EGYA 4KICA 1SD5A 3B73A 3ABTA 4G6QA 1DGWA 4I7HA 1CAWB 4GYIA 1ZZ7A 4L0YB 4ZZLA 2VECA 2KJBA 4EMSA 3GYHX 3ELKA 2HJIA 1DZTA 2J5OA 1U3EM 2O6GE 5KHJA 2ZFWA 2IA0A 4YNIA 3HIFA 2PAEA 2BV6A 3F8FA 1UIKA 3KSCA 3F8NA 1J3QA 4XFGA 3RI4A 4IEOA 4ETSA 2P7CB 4L18B 1B4AA 2IA1A 2B5HA 4ZYGA 1XD7A 4WBBA 4R52A 2HOEA 3SMHA 1BJAA 4HQMA 3H1MA 5HS8A 4RS8A 1LJ9A 1YO5C 1YHFA 5L3EA 4OLLA 2VBZA 4XLNF 2G9WA 2GXBA 3HRUA 2PA7A 3KLOA 1GXPA 5LRSA 5FPZA 4ZU5A 2LF8A 4PGGA 4OIPF 1KQ0A 4BYYA 3CTAA 4KWKA 3GZ5A 4RGSA 4CZZA 2P6SA 5LLQA 4HLTA 4HSLA 4PIYA 1ZN2A 2RDPA 2PEXA 1YFUA 3WGIA 4KN7X 1BC7C 4YFNF 1WI9A 3I59A 3M8FA 2R7DA 4KIBA 4JQFA 2VOOA 1PDNC 3LOIA 4G6DA 2GZWA 4P96A 2ZMEA 1FY7A 1BI3A 2EA4A 3F23A 2H27A 2QDRA 3I53A 4RB2C 1R5HA 2XGXA 5E1RA 3PFIA 1CAUA 1OYIA 3P9IA 2BYVE 5J7MA 4U0VA 3FXQA 3ISPA 5I0RA 5JSPA 3BALA 1UCRA 1LNWA 2XHKA 1TQ5A 1RUOA 2OA2A 2HGCA 2ATFA 1SFXA 2QVOA 2PBIA 2HKXA 1ZZ6A 2JTVA 5EZWA 1A04A 2M5WA 2VT3A 3BPVA 2OA4A 3IRQA 3WE3A 3GYDA 1TQIA 5ICCA 4L9TA 3LA7A 2EK5A 2O3FA 5CU1A 1LDDA 4HV5A 3F8MA 1B9NA 2PAKA 3LQRA 3K69A 3FFQA 2IVMA 5BMZA 1WRJA 3PNAA 3H1YA 2XL9A 5E20A 4IEVA 4ESFA 2STWA 3TNQA 3LAJA 3ECHA 3VOEA 2IXHA 2L4MA 3KP7A 1SQ4A 2IA2A 4LEJA 3NQOA 1YUDA 3J7AO 2XAQA 3I64A 1CAXA 4HAMA 4UVBA 1QXRA 2YX4A 2LKPA 1FLIA 2QENA 4G7HF 2VOPA 3RZZA 4L5IA 5K1YA 4Z07A 2CSOA 3T8TA 1FSHA 4LUKA 1J75A 3EUHA 4H7LA 2HWVA 1BN5A 3QP6A 1HBXG 5L3DA 4I2OA 2FNAA 4UBHA 3U0ZA 4LUMA 2HYGD 5F1RA 3J81Z 2ZCWA 3KETA 3RYPA 5CLSA 1U5TC 3N97A 3NRVA 2NS0A 3BZ6A 5F6FA 5DD4A 3FF5A 1HQCA 2HTJA 3MQ0A 4LA2A 4L11A 2NAZA 3E6DA 2ZXJA 2OQRA 1S7AA 4P9FA 4KIFA 2DAOA 4META 5LHIA 3PQKA 3R4KA 2HZTA 5K5OA 2PTMA 3SXYA 1J9IA 1FX7A 1TLHB 2R7FA 2FXAA 4R1HA 3SFZA 2FQPA 1RL3A 3LZZA 1OR7A 3ZMSA 4MQ9F 3SXWA 5E1WA 2IW5A 2OZJA 4ESJA 2DFIA 1P6RA 4XSZF 1AWCA 4AVCA 1RUNA 3BB6A 4X6RB 4WVZA 2N7GA 5JSOA 2A61A 2DW4A 2DQLA 5D5XB 1ZHFA 2P4WA 4Z82A 1FC3A 2GWRA 1ZGAA 3U11A 4BH9A 1U12A 4QXKA 2FBHA 5KHIA 1T39A 4XEZA 1ON1A 3RKYA 4XF9A 1QZYA 4OMZA 1UPIA 2IXKA 4E2QA 6PAXA 4LB6B 5FLXK 1D8KA 1IAWA 3P7NA 1LR5A 2PQQA 3OCPA 4E70A 1Q5OA 3TKYA 4EM1A 1HXDA 5HS7A 1LEBA 1H1MA 4HX4A 2ELHA 4D7TA 5CYVA 3HRTA 1LB2A 4EROA 1HKSA 2NYXA 3H3UA 1WKMA 3RJPA 4HV6A 5JAXA 1D5VA 3HYIA 2XLAA 4KFCA 1B9MA 4A6DA 2CWEA 4LG0B 5E1ZB 2DQRA 1ZGJA 4IEPA 1QQIA 2QQBA 4RAZA 2P5LC 4WF2A 3R0JA 3GXOA 4XFBA 3BY6A 1YS6A 3ML6A 3WU1B 2V9VA 4CGZA 5K5RA 2ZKZA 2FRHA 4U0YA 2CFXA 1P4XA 1R23A 5AIPA 1FWZA 3J80K 2OQGA 5ED4A 4JVAA 1Z7UA 1OYWA 1MJAA 5EEGA 2D45A 1FT9A 3O3KA 4NB5A 1S3JA 3ES4A 2D40A 2ACJA 5LGUA 1YLFA 2A5YB 4MHGA 2HYFA 4RGRA 1B6AA 5LGNA 2IC1A 3H7JA 2K4BA 1F4KA 3H50A 4XBFA 2YPRA 3JSOA 4KYWA 4UUVA 1IN7A 1R1TA 1Z1DA 3KMHA 2WWYA 2FA5A 3KEQA 2D5HA 3FXUA 3KGZA 3GWZA 4HBLA 1MDMA 1ZZ9A 3WTVC 5T3NA 2EFQA 4J1WA 2CQKA 3I4PA 4MZUA 1XMKA 4IVNA 2RVCA 4O9GA 3E6BA 3WE2A 2LSOA 5J48A 3J80Z 1GQHA 4N9HA 3FZ3A 3IRRA 1LKNA 2JPCA 5DCMA 1TNSA 1LRHA 2O0YA 5FFXA 1NE6A 2IXIA 3RYRA 1UHWA 2TDXA 2Q1ZB 1CAVB 5D8LB 3IBMA 5CVIA 3GBFA 1IXSB 5LBQA 4PJYA 4LMYA 4XSXF 3WTTC 2JZYA 4CDGA 2VBXA 4XFAA 3IC7A 5LRRA 1FXZA 2ET7A 4LLOA 2OPKA 1DP7P 4DINB 2DTRA 1ZARA 4U7DA 5J8FA 3Q5FA 1P2FA 4HZFA 2BNNA 4N9IA 4EWDA 4XFHA 5BUVA 4AIKA 1TNTA 3WODF 1MJBA 2WC2A 3FJSA 2OBPA 3ERED 4ZYDA 2GC0A 3H8UA 5KHGA 1YW8A 1L3LA 5EEHA 2LDUA 4UNOA 1BBYA 3LQQA 3F22A 2VQAA 2VT2A 3ZMDA 4KMFA 2IJLA 4KIGA 5DUIA 5HOOA 4EJUA 1OYYA 4KT5C 5FLHA 2ETHA 1IRGA 3OOPA 4G7ZF 1OPCA 3T5XA 1EY2A 4HVOA 4XF0A 1EP0A 4LLNA 4QGMA 1UFMA 2JT1A 5HVQC 2A3SA 1SFEA 5AONA 4LULA 5J6XA 3CO6C 4MQVA 3EJKA 3FHZA 4I0BA 3EQEA 3Q9SA 2NRAC 1FPQA 4OOIA 4R79A 4BHPA 3MDPA 1C0WA 1BM9A 2ET1A 4D0PA 2VBWA 4XFFA 4A0XA 3OGJA 2M1BA 5E18F 2XRNA 3G7DA 3H1WA 2AS5F 3I0TA 2DK8A 1J1LA 4IRHA 4EV0A 1IF1A 4BNCA 3HTSB 5A2QK 2EV5A 2PI0A 4QMAA 4JBAA 2DK5A 4YARA 4OINF 5D6EA 3QPHA 1IXCA 1DZRA 2PHLA 4FAGA 2OZ6A 2FE3A 2W85A 1Y9QA 4B8XA 3J81K 4XF1A 1XE7A 2OD5A 2XROA 5D4RA 1Z6RA 1FBUA 2VODA 3TQNA 3C1DA 4HVQA 3OV8A 2BNMA 1J7KA 4QM8A 1G6NA 3KP3A 5E17F 1JHFA 3BOQA 3ZMZA 3LWFA 5E16A 3U1DA 4XLPF 2EFOA 2K4JA 1QBJA 3DFGA 4IEYA 3DXJF 3KFWX 2RV8A 3D0SA 4IEWA 4ORFA 2KIFA 3GX4X 2FMYA 5FB2A 1MDMB 1UB9A 3ZMUA 3F8CA 5IT9Z 4EJTA 4EWAA 1O57A 1QNTA 4A6EA 2F4PA 4UXAA 3ZDSA 4CYDA 2STTA 2M8EA 1OI6A 3D0JA 3VEPA 2YX7A 1OMIA 2G7HA 3SZPA 3WU0A 1YW9A 4JTNA 3U9GA 1XGMA 4GULA 5FCCA 5FLXZ 5BY5A 2UZKA 3GO5A 1P4AA 3F6VA 2QWWA 3GFIA 1YFWA 4UVCA 5HS9A 4KU7A 1O3QA 3BPXA 1X8MA 4IHTA 4E2GA 3IKTA 1FP1D 5FLJA 5HLIA 3ACLA 2UXXA 4MH0E 2PJPA 1ZG5A 5JHUA 4L2NA 2FSWA 2O8QA 4YFXF 4XFCA 4IESA 1QGPA 1J5YA 4HX7A 4OMYA 3BWGA 3NJZA 3DEUA 3ZMVA 1CAXB 1T6SA 3K1MA 1FP2A 2EA7A 1W4MA 1HSTA 2UYAA 3KP5A 3HT1A 2EFNA 5D5UB 5ILUA 1RZ4A 3MEXA 4S05A 1XSDA 2VBYA 5F64A 2LF7A 3KGLA 3QRFF 2Z33A 1OKRA 4EVIA 3ULQB 5LHGA 4KWJA 4KDPA 4WCGA 1HKQA 3KP4A 4QLCU 1JGSA 4O6JA 1YQAA 5I8TA 3CF6E 2CAUA 5D8KB 3C3WA 1V4RA 1R5GA 4B29A 1L0OC 4HMZA 4IETA 1T2KA 2QJVA 4YFKF
chains in the Genus database with same CATH superfamily
2Z5WA 3SEZA 4M3CE 1ACCA 1V3FA 2VN2A 4WM7C 2GA1A 1ONAA 3MIHA 1KQRA 4M6YA 1G2HA 3PIJA 2JPBA 1VMFA 2BOLA 1HQNA 4XKVA 4DNYA 4Q4Y1 4F91B 3TDZC 4QWQA 2WT2A 2XSDC 1GNYA 2QFEA 4Q0QA 1IG0A 2Q30A 3SKJE 4LBQD 1OLMA 4XJAA 1G3YA 4X8NA 3CCVI 4NC8A 5HLGA 4GWMA 3VDDB 2QZ2A 3HJEA 4L9BA 5IYYA 4DBQA 1PUFB 4OMCA 1XOYA 2P5VA 1C1LA 3JXSA 5FZ3A 1G4DA 1TWFJ 3R6SA 2HEYF 3RPUA 1UD1A 1TQMA 1TE1B 4MHUA 5F27A 1DQ4A 1R7JA 2VB6A 1AU7A 1MS5A 3KM5A 4LOCA 4ZTFA 5KXEA 1MS9A 1YYVA 5J1XA 3BTYA 1KYWA 1PJRA 5AVAA 3EHKA 1GWKA 3ENRA 4DS0A 3IH2A 3M9AA 2G9GA 2YR2A 4Q48A 2Z4FA 3LWCA 1Y39A 4H14A 2RQPA 2ID3A 1VRBA 1CIWA 3OJBA 4S2HA 2VZTA 4LGWA 3AKSA 2WZ8A 1XSXA 4R9DA 3ZFFB 2XWJB 2XPJA 5C4WC 4FAHA 4CICA 3ZFGC 5BPXA 3S5QA 1T98A 4AI0A 4BAYA 4QX5A 3ECOA 2ID6A 1PVEA 1N3OA 3JB8A 1K7AA 4AVAA 2FNPA 3WR0A 4Q4Y3 4Y52J 4P5HA 2LTPA 2VASA 1ETXA 3KT7A 2IVIB 2QUOA 3GALA 3KV4A 1HV0A 4M00A 2G4IA 5FZBA 5IVCA 3P5BA 3K46A 2O1QA 1W6QB 4GRIA 4QHZA 2CV1A 4UB8C 1QU3A 5DCMB 2M9HA 1MEC2 1UYPA 5EWSA 1POV0 5LY2A 1ENHA 4XDQA 1WUVA 1V6JA 2B9VA 1IKQA 4RB0A 2BV4A 4Y1VA 4AIDA 2HPMA 2FDFA 4Y1UA 5DPNA 1I27A 2LUWA 2HYKA 3R0RA 2NS7A 3MFAA 2VZUA 4NPRA 5A3OA 2CO5A 5HDKA 4W6YA 4S2FA 3CDLA 4Y20A 4DW6A 3T08A 2R7RA 2EZIA 1ZH5A 1RMU3 5GZCA 3DTIA 3RPUD 3TEWA 1W8NA 2FDGA 2Y0OA 3AL0C 2E6VA 2KDOA 1L3JA 4QB6A 3SCHA 3JRAA 2WS92 3IIAA 4CDXC 4UV9A 3TOAA 5JOZA 1LE8B 5DDJ3 5FGMA 1YRNA 3ZSJA 4YVWA 1FPN1 4CCMA 5A7OA 2VTFA 2DA3A 2Q2EA 2R6QA 1C8M2 4OULA 1G9AA 4IGPA 2ZX1A 3DPLC 1TMF2 1SLTA 5D4SA 2W95A 4WM8B 1FPN2 4B09A 1LVKA 4KA4A 4DUXA 2A1XA 3HQRA 3TDUC 1H1IA 2WNVA 2CS3A 2CUJA 4NHYA 1BLZA 2LBFA 3VKNA 2GSYA 1SMTA 1MNDA 3Q9OA 3JRBA 4LIVA 1PP7U 2W92A 2JRMA 2E71A 1EV7A 4JGYA 4XHBA 4A45A 4H0EA 2QCSB 3RVHA 1TWAJ 3N7LA 3BR1A 2BFUS 2DCTA 2Q4SA 4GH4C 1V6MA 5IPAA 1YQCA 1IS4A 1VRH1 4Q8KA 4DUWA 4NAMA 4FCYA 2P3IA 2Z9OA 3M3QA 3QOPA 2G1MA 3KB5A 2KP6A 4BXFA 4B44A 3B9IA 1J2XA 5F5CA 2VJ5A 2AEZA 4OVEA 1D1BA 5ICFA 4Q47A 4IEUA 2WAEA 1OA3A 5HNFA 3S0MA 4A3ZA 4XLEA 3BJAA 2P4EA 2VCBA 4Y5TA 2H94A 4HW0A 3LSMA 3CUQC 3BG3A 3GTLJ 1JHJA 3F72A 3VBFC 4IGQA 3N7KA 3EXUA 4P9UA 2Q0AA 1EV11 4YW2A 1DYPA 1ULCA 5FY8A 3BOWA 4ZZ5A 5FYBA 4Y4YA 2CMPA 2A69F 2ZZQA 2HDCA 2B8MA 1J84A 2W84A 5F04A 1KU2A 2RJKA 4AHYA 5KHHA 1ENXA 4GXLA 4XUTA 1S6LA 4Z2YA 1AVBA 3P9CA 5I91A 4RQPC 1GLNA 2MH9A 1IQAA 2J42A 1PO21 1E17A 2JB8A 2QZ3A 4YM0A 1I3HA 5DTDA 4LO4B 3JUUA 2BOIA 4II2A 1NCRA 3GFJA 3J7NA 3KIOA 1ZRDA 3AP6A 2C4XA 3TN93 5C33A 5DAVA 3MIGA 5F7UA 1RNLA 3M1CA 4A0YA 1TME2 1KU3A 3G1OA 1W0PA 1FOD3 2Z69A 2HS5A 2J7MA 1WJDA 4LFUA 4COYA 3W2AA 1JMUB 5LFAA 1AJOA 1JOJA 1RB8G 1ZR4A 2VJIA 3BDDA 3TGNA 3LEMA 1HKTA 4Q4W1 1I1SA 4BXUA 2UWBA 2Y9ZA 2UUZA 3M8EA 4CCJA 4FPGA 3KP2A 1RUC1 3DPRA 2Q1FA 2F5CA 2ZKNA 2ZJRF 4FX0A 2LKXA 1ZG3A 4K21A 3DPUA 3NWTA 1DDNA 3VKFC 1OD3A 1ZRFA 2BXZA 1DU0A 1OPMA 4YW4A 4WX9A 2GALA 3N7MA 1TBXA 3KHBA 3VZNA 3AL6A 3OYEA 1HW1A 3WW1A 5J1YA 4YGCA 3CO7C 5FPBA 2LTNA 3OYFA 3WTZA 2LD5A 4XUNA 5C3RA 4MG2A 2PLYA 4M01A 2UURA 4HVRA 1AR61 3D3AA 5EP9A 2W91A 3C3VA 2DYRH 4E6KG 1YJKA 4XUOA 1D3YA 4CDXA 2FF4A 3EDPA 4NQWB 2DURA 5FMCA 4AVSA 2V5DA 1PK6C 5CKMA 3T1BA 4BE1A 2I45A 2DMUA 3Q0WA 1S2EA 2BW3B 1LJ7A 4FE4A 1NK2P 4HDUA 1VB2A 4F83A 3AZVA 1E57A 3NJVA 3ZN5A 5FP8A 1M4WA 1HDKA 1CX4A 3DXTA 2ILMA 3WNLA 4YGEA 4LXLA 4UFMA 5A7NA 3VZOA 3WG7H 3T09A 1W9YA 1G8XA 1JJ8C 4KGQA 5C71A 3JRGA 1QHDA 4FOQA 5JSRA 3A22A 1LEDA 4N4NB 5B1BH 1RVF1 2A6YA 2WFF2 1QJU3 4R9AA 3ACIA 1V6LA 4Y24A 5FD6A 4P5OA 4TXWA 1UPSA 3OUIA 1AR73 3BJOA 1LVAA 5FKNA 1IHMA 3NAUA 5LBEA 2L5QA 2EXJA 1T95A 1O8SA 4L8QA 2R7WA 5DS9A 5K8SA 1ENSA 5H9SA 4ZDPA 4LR4A 5JWPA 5HCHA 5FZ8A 2C1FA 5C5TA 3U4XA 1UG2A 3FM5A 2NQYA 3SZTA 3GLXA 4CCOA 4K8RB 3FXJA 5FZ9A 4EM0B 5HXVA 5FXVA 5FZ1A 3F0CA 2WL1A 1XMXA 1H89C 2XBO2 3I2FA 1AX2A 1DCSA 3GZUC 4GDFA 4JHZA 4IQ4A 2DFBA 3ZN4A 5F3IA 1F9NA 4HN1A 1O59A 3AYAA 3MUY1 2D2WA 1GT0C 3ZN0A 2VBBA 2YUEA 4BOWA 1VBE1 2F2EA 1Y1VJ 2R0HA 2EIKH 1IUYA 5A6ZA 1TTYA 1S7OA 1DZQA 3LSIA 4L9VA 4IUGA 4H2AA 2BE5F 4N43B 2DN0A 4Z6YA 3UT0A 2MEV1 4QHOA 4L92A 1O3SA 1YTYA 4XE9A 4YEJA 3THCA 5I8YA 1XPWA 4OAYA 1SMVA 2L4AA 1YIPA 1PMIA 4RGKA 3LSDA 4FASD 3T8RA 4UHTA 2XKPA 5FWEA 1XE8A 4QPWA 2HWE2 4IE7A 4U0WA 4QDQA 1JOBA 2I2SA 3VSKA 3B00A 3PUAA 4KUMA 2Y2ZA 1VJ2A 4XN3A 4CEWC 3VDXA 3OIPA 2MC3A 2P7VB 1OOPB 5GPCA 1BEV3 1T6BX 2ZB9A 1LE8A 1S9HA 2P5KA 5D21A 1MMGA 4LLGF 5FJHA 5CQEA 3AZZA 5C4XJ 1JODA 3KLNA 5A33A 2JVHA 3O2PE 3NWKA 5A1LA 2VE8A 3K4NA 3PURA 1LDKB 3ZR6A 1XDSA 5IVBA 2WINB 5I0SA 3FX3A 1WCDJ 1YJ9I 5I93A 2A7AA 4YIIA 2X4HA 1UXZA 3P3NA 3GTJJ 4OYUA 3BOPA 1FBSA 3KZIC 2M4GA 1OUSA 1M06G 1DQ6A 2Y31A 3HOWJ 3ASIA 3JBG2 2WR9A 3LSRA 2P2KA 3ZQHA 4CU8A 1KS4A 4QGNA 1PZ7A 5LHHA 5FQ0B 2CDOA 3QPSA 2DBNA 4MO3M 1X1CA 3S15J 1S29A 1LFPA 3VBSB 4FP3A 1OLTA 3ZP5A 4DYCA 1PP8F 4K6BA 2ETEA 1ZZ8A 2PFWA 2KRFA 3NW4A 2K2SA 2VZ3A 1FYKA 1I1GA 1D2QA 2IXCA 1ZBE3 2L01A 5KR7A 1N75A 4HPQA 2XLFA 4RDUA 5F6LB 1EYBA 2NS8A 3K75B 1W03A 1W7PD 1ZLKA 1J3PA 3A02A 2HTSA 4ITCA 3K7AJ 3A7QA 5F1JA 5LBCA 3CUOA 2RDSA 2FHRA 3RJ2X 4YFWA 3HQXA 4MIMA 1HDDC 1W3XA 3D5OA 3WF3A 4UV8A 3HB9A 1RINA 2FCUA 4XF4A 1PO13 3B3QE 4FHTA 4Q5SF 3K2ZA 5A3NA 1EH7A 3S2WA 1CAWA 3OTFA 3A0KA 3THPA 5TISC 1MD0A 4AVPA 4CP1A 4Y17A 5ISLA 4EYUA 3GXUA 4BLIA 3PMSA 3OL4A 2OYZA 2B46X 3D5LA 4YZ1A 1ND3C 3N05A 2E34A 1PVXA 2KQRA 3POBA 4FFHA 2DT7B 4IQPA 1AHDP 2VU9A 1OFNA 1UZYA 2OC6A 1CZTA 2O8KA 2VUDA 3H42B 3HSFA 4MGSA 2A07F 4EZ4A 3FXOA 5FYYA 5CADA 1O7FA 3VFZA 2WLQA 2X0LA 1K12A 3BR6A 4ZONA 4PK4A 3ZIXA 2DI3A 1YWKA 3RZLA 4TYSA 3LQCA 5J98B 1LGBA 4HSRA 2QLZA 4ENJA 4OI1A 1RMU1 1YIOA 4QPOA 2WFF3 5DG1A 1U5TB 3CJQB 3W6VA 2BVMA 2UY8A 2QNKA 2E31A 2RDRA 2WS93 2YMZA 2WNEA 1C8NA 4Q0PA 4C0HA 2P37A 5E89A 2WB1N 4XOPA 3JAMK 2R3SA 3ZXKA 1SLLA 1RUJ2 3WLUA 3CZJA 2EVXA 3WG9A 4AIHA 3WTSC 3FK7A 4HF2A 1V70A 3IKVA 2HWD1 2Y6LA 3USUA 4HF0A 3EYIA 1GZ9A 4JK1X 4AXOA 3RIRA 5FRAA 2R4GA 1B8IA 3CDZB 1UIJA 5IAXA 2VC1A 1ZLJA 2JRTA 2M7BA 2MLKA 4RD7A 4CDUB 4COVA 4MVTA 1RIOH 1ND2A 3CCJI 5IT6A 1BI0A 5C5UA 3KD4A 4P00B 1A8DA 4C2UA 4DBRA 4F52A 5CYYA 1US3A 3M8JA 1BOBA 3MLJA 4QPGB 5DZFA 1WLCA 2JDKA 2VUCA 3VDCA 3BTJA 1XTAA 4MXVA 1WQ2A 5CVVA 2B63J 5LATA 4GQ7A 1W8ZA 2PLV1 4MGZE 1RYYA 3BROA 2KR2A 1R22A 4I98B 2PG4A 1UKRA 1LOAA 4F92B 3PSIA 3LDKA 3WOGA 4OQ8A 4JQTA 2E7XA 2JDMA 1STMA 4PDWB 2W25A 1JTXA 2GXAA 2VUJA 3B6CA 1UOFA 1RC6A 3S1MJ 2PN5A 2HWE3 5GAHJ 3LMMA 1SD5A 3ABTA 4YFZA 1D0XA 1DGWA 3ZSLA 2WAQN 4I7HA 3PVEA 2VMCA 4ZZLA 2ARAA 4Y7NJ 3J26N 5KHJA 2ZFWA 3WDVA 2ZEZA 1HCRA 2IA0A 5FY9A 3UYJA 3HIFA 5E8AA 1D0GA 1R1ZA 4CZCA 1HB2A 3F8FA 4MADA 2WQZC 2JUCA 3RI4A 3TW6A 2P7CB 4N43C 1BVP1 2BFUL 3TW7A 2Z1DA 4IV3A 2B5HA 1YJWI 3WQ1A 5IAVA 1HKDA 4R52A 3SMHA 1BJAA 4FPKA 5H9QA 4MXWA 1ND3B 1LJ9A 1JOPA 2WBKA 4XCBA 4OLLA 2VBZA 1DQ2A 3CQZJ 2G9WA 2GXBA 4E27A 3KLOA 1PZ8A 2BU9A 3UK9A 2LC2A 2LF8A 5E6HA 1WW5A 5K0UC 1Z7S1 1KQ0A 3HOYJ 2P6SA 2WY7Q 2LY9A 2QQKA 4K9SA 3R4DB 4PF1A 1ZN2A 2RDPA 4KN7X 3AJYA 3TBIA 1L7LA 4YFNF 3VPRA 1NA1A 1CPMA 3PIGA 2R7DA 2E36A 2VOOA 3LOIA 2ZABA 4N43A 3PMEA 3RI9A 2AC1A 4ASMB 4P96A 3WCRA 1W2AX 2NMOA 1VBD1 2GMMA 1FY7A 2H1KA 2FZ2A 3L9JT 2BY1A 1VBE2 5DZGA 3CKHA 3CCSI 2JG9B 4BQQA 4A42A 5E1RA 1CAUA 3MPPG 1XBFA 1JZ5A 4MSVA 3FXQA 2R7XA 3ISPA 3AKRA 5I0RA 1A36A 1TQ5A 1W6PA 1HB1A 4F93B 1SFXA 2A6ZA 3OYWB 2JTVA 3DF0A 3A01B 3QYBA 3ZIWA 4COUA 2VT3A 3R4SA 3L2WA 1OURA 3GYDA 1RR8C 1UZCA 2MGQA 1TQIA 1VQ5I 1PGL2 4UF0B 4BACA 4KGGA 4L9TA 5LWBA 4HV5A 3F8MA 3BKZA 1B9NA 2HWC3 3K69A 2IGNA 3HOBA 5FZ7A 1SFYA 3FFQA 2LH9A 5E20A 1CN1A 1MSFC 2HEWF 3GDBA 3TNQA 3B6AA 3A1YA 2XHNA 3ECHA 3VOEA 4QX8A 2ARXA 3GMEA 1SQ4A 4LEJA 3Q8CA 4M3CA 1QJZA 1YUDA 3J7AO 3NQHA 2XAQA 3I64A 4QX7A 2WS91 2O0OA 1DP0A 4HAMA 1HQLA 1ETOA 4JX0A 5FYUA 2LY2A 4G7HF 1UQXA 3ZYJB 2Z42A 4H7LA 3OBAA 4PCRA 1OA2A 3T2OA 1HBXG 2L9SA 2QSHX 2J22A 3U0ZA 2HYGD 4XNFA 5F1RA 4C3IJ 4ZDLA 2CQ7A 3A4CA 3N97A 2PHUA 1LOGA 2ES3A 2ZPXA 3BZ6A 2UV1A 5F6FA 3W5MA 4L11A 2HWB1 4UY8I 1Y8QB 1CPNA 2VC9A 3SEEA 2DAOA 4B3AA 3VZKA 2XBO3 2RREA 1K5MC 3OS0A 3FXKA 2R7OA 2JDUA 1TLHB 5FZLA 4HT1T 1C5IA 4Z1VA 3WHCA 3CQOA 4R1HA 3ZMSA 4MQ9F 5E1WA 5M5WJ 2IW5A 1CVNA 3O1TA 1YIFA 4XC9A 4ESJA 4C3HJ 4XMYA 4XQ4A 5J1RA 1P6RA 4I6ZA 4B48A 3BB6A 4X6RB 5GLWA 2A61A 5CEHA 2DQLA 4UW4A 2ZAHA 3WNOA 4BDZA 1QOTA 1N1TA 3GTQJ 1ZGAA 3GTKJ 4QXKA 5GLTA 2BXYA 2FBHA 1I9RA 1JYNA 2EPFA 1V5EA 3DKXA 1RUF3 1TWGJ 1SBEA 1TC3C 4K1ZA 1WD4A 3ZQLA 3P7NA 1H88C 4QDSA 3TKYA 2BZTA 1SBFA 1HXDA 2Y33A 2QKLB 1H1MA 5BNPB 4HX4A 9ANTA 1CJDA 5FAXA 1HKSA 3BGAA 2QQLA 5IATA 3PU3A 4HV6A 5JAXA 1W04A 1Q8PA 3HYIA 3N7JA 2CWEA 5E1ZB 1ZGJA 4IEPA 4CUGA 3K4AA 1H6XA 3RZJA 1IKPA 2TUNA 4LKEA 2XB0X 4BY7J 2ECBA 2A6VA 3POFA 4W50A 2OF7A 1IUFA 3ORJA 3WU1B 2V9VA 3LPGA 4DXZA 2DVAA 3VBFA 3F95A 1RXGA 2C26A 5K5RA 4I0WB 2GNDA 2FRHA 4XIKA 1R23A 2XGEA 5AIPA 4PLNA 1FWZA 3IV5A 2OQGA 5ED4A 4JVAA 2CJJA 2NP0A 2D45A 3O3KA 3ES4A 2ACJA 1FYUA 2PHWA 2WAQA 4RGRA 2YY1A 4UFHA 2OXBA 3H7JA 5JLVA 1F4KA 3DBHB 1GZWA 1R1TA 4NPLA 3GBGA 3GTGJ 1REEA 1BEV1 4PBOA 4P9YA 1Z7S2 1ZZ9A 5CKQA 1IG7A 5T3NA 2VXRA 2RVCA 3WE2A 1TZOA 5J48A 3J80Z 5BNOC 2E53A 3OBZA 1LKNA 1A5JA 2JPCA 1V5FA 2ZXQA 1FOD2 1OCTC 3BT9A 2RS53 1PGSA 4NIDA 2VQTA 5D8LB 3IBMA 1FMD1 4L97A 4PI0A 3CJIC 1T33A 3H8RA 4PJYA 5APAA 1PZ9A 1DG6A 3NO8A 4D94A 4AI3A 4CDGA 3FISA 5ANQA 4XFAA 3IC7A 3G71I 2ET7A 4DEQA 1OXCA 1JT6A 4NIAA 1DP7P 2ZAAA 3VUOA 2ZX3A 2ELJA 1R1A3 4AK3A 4A3CJ 4Q1RA 4XILA 4G3YC 3H8OA 1WLWA 2E1OA 3ZYPA 2JE7A 3S3OA 2EXIA 2QQPA 5C7GA 2K9LA 2A5ZA 2GOXB 3FJSA 4ZYDA 2GC0A 1YW8A 1Z3YA 5BYNA 1HDPA 5CQGA 5FO9B 4KMFA 1K5JA 4OHYA 4FFGA 2XGDA 4FQ4A 4KT5C 3LSPA 4TN7A 3OOPA 4XK4A 4G7ZF 3JB4C 3T5XA 1EY2A 4XF0A 4QB1A 1EP0A 1UFMA 3N9PA 3OSFA 4AQTA 4XQDA 3NNMA 3CU7A 2UU8A 4V19K 4R4XA 3EQEA 2W47A 4XIDA 5FPLA 2VMIA 3WNNA 4BHPA 1BM9A 2ET1A 4NC6A 4W6WA 4RS5C 2VO5A 3RZMA 3GZAA 4ISRA 1DBNA 5E18F 1YQ8A 2XRNA 3M3OA 2VNRA 1IF1A 4NR1A 4QMAA 2I5UA 1RMU2 2WN2A 5FYVA 4YARA 1X1BA 5BNOB 5D6EA 3QPHA 2M0MA 1QPIA 1R092 4B4RA 1RKTA 1X58A 2PHLA 3TEZA 2M34A 2FE3A 2W85A 3J81K 4XF1A 3OSGA 2XROA 5D4RA 1Z6RA 2VVEA 4NE9A 3NNGA 2PHRA 4C3JJ 3BTAA 1G6NA 1QMJA 1RHI2 1FOWA 4PBPA 2AQFA 3LWFA 3HMYA 3Q8FA 2Q8OA 3JRCA 4FCAA 4AVTA 4XZPA 3THDA 4NBQA 2EFOA 1QBJA 4IEYA 2DXIA 3DXJF 3KFWX 3D0SA 4AG4A 5CPRB 3OYKA 3DECA 1OCOH 5A3PA 3VB9A 3NNJA 3OYWA 3ZVXA 3F8CA 5EEAA 4EJTA 3JREA 1LU2A 4ZPIA 5FYCA 2DFHA 3VEPA 1YHQI 3SZPA 2RS12 1YW9A 3RWKX 4CUBA 5FLXZ 4AF9A 4XVHA 1P4AA 3I2OA 2QWWA 3AG3H 1R9TJ 4UVCA 4XKWA 2A6WA 4AGGA 3PO3J 4UFKA 1RUI1 1D0ZA 3D5SC 3KCYA 3IKTA 4LE4A 5GM0A 1O6UA 1FP1D 4AOCA 1V55H 3ZFFA 5HLIA 5ABJB 3ACLA 4CYCA 4P9JA 2JKBA 3M07A 4BQ5A 1S0EA 3VDBA 3DKYA 4L2NA 3S14J 5FKKA 2X1CA 2JDAA 4XFCA 2HVSA 4RHV2 4IESA 1LOFC 4DOUA 1X9PA 2XQRA 3I3LA 3ZMVA 1GNZA 3ZYRA 2EA7A 2H1LA 5BNQA 1XC5A 4B4QA 3HWJA 2QKDA 1PIV1 2UYAA 1SHWB 1IDZA 3KP5A 5D5UB 5ILUA 1B35A 5F64A 1BVVA 4CU6A 3KGLA 3MIDA 1ETYA 4LO8A 3IPVA 3I4IA 4EVIA 3ULQB 5LHGA 2DTYA 1UNBA 1TMF1 4WCGA 2RM23 2WN3A 1HKQA 5FZGA 4QLCU 5I8TA 2OVUA 4GJZA 3WU2C 2CAUA 3CC4I 3I56I 5FYHA 1V4RA 1R5GA 3VL8A 4EZHA 3BYWA 1J83A 3WNXA 2YGLA 1H8AC 1T2KA 3IUOA 4JDMA 2FBEA 4IXLA 4XCAA 5CZKA 4XRSA 3SEQA 4HKWA 3GFMA 3LSHA 1X4OA 4QPYA 4Q8LA 2M0CA 3DEEA 1SFOJ 2HWC1 2E32A 1H8VA 2F5EA 3CP8A 3K4BA 3WGHA 3SJMA 2LYCA 3P1IA 3O14A 3EMRA 3WF2A 2VPVA 2XASA 1Z7S3 3C7GA 4ATFA 4LORA 1AJKA 3OB8A 2WRAA 2WV0A 3WDXA 1V6KA 1Y4WA 4KMQA 1X2MA 2PFBA 1MVEA 1R6RA 1RUI3 4MGKE 4GWJA 1KFUL 2E1MB 5L3FA 4UWDA 3AKQA 1AOYA 2E1NA 2O61A 2BW8A 2RMU2 2VKDA 3WTXC 2EWNA 1MEC1 1WJCA 2RGVA 4CP9A 3WP5A 1R58A 3ZQCA 2ZBKA 2GLOA 2Z99A 2GMEA 4MTEA 3FWEA 2V09A 1MBHA 1ORKA 1MMNA 1W6OB 2IXLA 4B47A 5LGTA 3JD73 1MZBA 3RG0A 4CH7A 2PMHA 1WSUA 3J7LA 2D98A 1BR2A 3N35A 4LO6B 4WVWA 2ZNYA 3N9OA 3VHOA 4CCLA 1UU4A 4Q29A 2WKKA 5FKMA 4XKCA 5JHFA 5AFEA 5FYSA 4JV4A 3ZCOA 4AWXB 1MMDA 1DYOA 1REPC 1UOGA 3C18A 4NIIA 2VY0A 4HBNA 3BTZA 2ERFA 1OF4A 5B4NA 2MA3A 4MTDA 5A32A 4R9BA 3DU5A 1IG3A 3ABUA 2XR4A 1S4CA 4CHUA 4COZA 5L3BA 5HDNA 3L2CA 3VBOC 5H6QA 4YYOA 2K85A 4OAZA 3H5AA 2TCTA 1MIJA 2LRPA 2EB7A 3FBNB 1JZ4A 1ENQA 2A68F 4CVUA 1AR72 3LSKA 2EFPA 2Y48A 1AYM3 2ZXIA 2ZX4A 4ONUA 2EALA 1CESA 1R4NB 2B0LA 2HWC2 5L73A 5K0UA 4XZUG 3WD5A 3WW2A 1KDMA 3WHUA 3U10A 3M1EA 4CEYA 3R61A 3H3LA 4IE5A 4QX3A 4KU8A 2VVFA 1TQPA 3HBZA 2PQ8A 5C3SA 1NUKA 3H8XA 1SD4A 2DWRA 1W7PA 4HX8A 3HDDA 5EJCA 2RE9A 3GLLA 3SQNA 2VOVA 2KIUA 3DBRB 1LODA 3WQ0A 2XL7A 2R7SA 1AYN3 2NXNB 5DEQA 2YBKA 3COAC 4EWEA 3BCBA 1UCXA 4LKFA 2XONA 3F21A 1REFA 3EUHC 5F0FA 4ZYAA 4G7OF 5KHKA 1SFKA 3IWZA 2O14A 4HSTA 4AFBA 1YRZA 1MMAA 2GIVA 3H9JA 1X8EA 2Y26A 1XPXA 5T50A 5CG9A 4DNCA 2Y6HA 1LKXA 2O8XA 1XXNA 5JR2A 3ACGA 3VBRC 1JU3A 1OOPC 2PHFA 4AVZA 1BJQA 2X5IB 3B5LB 4RR3C 4ZXKA 4P55A 4MGYE 2IT0A 3CMGA 4TLGA 3FHAA 3T1MA 4Q4W3 2QBXA 1FNYA 3KPHA 3ATGA 1IS5A 5K5QA 3IT8A 5JUVA 1UO9A 3ZPLA 1R1UA 1H2KA 1DGWX 3SC7X 2X1EA 3DGTA 2ADUA 4H3WA 4XMAA 5DAPA 5BOXA 4YG6A 3WDYA 3HHGA 2N8GA 2YFUA 4KH9A 4LA3A 4PJNA 1HXS1 3C7JA 3Q8BA 1NT0A 1ND2C 2ZMLA 3QACA 5DM7F 4AYUA 4NO4A 4OFGA 2HXOA 1SD6A 3UETA 2XQXA 1LOBA 4EE2A 4GB31 1TP4A 3HNMA 1RUC2 2WNUA 1SLBA 2Y75A 2ARBA 4IXAA 1GQPA 4DZJA 2J1EA 5CVJA 1WMXA 4ZU4A 2BW3A 1T08B 1J58A 2R063 2Z16A 3JTGA 4QXHA 1X4PA 1YX3A 3ZQ7A 4LTAA 2E5NA 5CVRA 4UI9L 4ASNA 2K3FA 4YW1A 1XSVA 3QLQA 3CUQA 5GJ6A 3HC7A 4Z2AA 4NJ4A 3V7SA 4Q4X3 2BPA2 1Q1VA 1I5PA 3D82A 3HOXJ 2H8WA 3WDWA 2EJRA 4L9NA 4PUSA 4Q4X1 4M3GA 1MS1A 1QJY1 3O1RA 5F5AA 4P9XA 1UELB 4RAFA 1NHAA 1N47A 3VGIA 4XF3A 1QJX1 2AZ5A 1QVUA 2OPWA 4FI9A 3AKPA 1BI2A 1W9TA 1K6OA 3OGRA 1UMHA 1CWPA 4FPYA 1Z3XA 5EZHA 3GFLA 2PMUA 2V1NA 3RI8A 3UESA 1XGSA 3WF4A 2Q5TA 2E5ZA 1SAXA 4XM3A 1XNCA 4DO0A 2ZHMA 3T0YA 2WNUC 4CDQB 1W2OA 1NZCA 2J1AA 1RHI1 5KAIC 1HLCA 5FXXA 2Y34A 5J3UA 2ICWG 4A3XA 4JRLA 3OYLA 4BEHA 5FZFA 1ON2A 1HRV1 4PGHA 3CJIA 1X3WB 1D1CA 4BIOA 5GLVA 4A3FJ 1H9GA 5LY1A 5IYCJ 1Z6TA 1WJAA 1ITYA 3E5QA 3LA3A 2DDBA 1B35B 3CJTB 4S0HB 5J96B 4D7NA 5F3GA 3UGGA 2YC0A 2C5DA 4Y15A 1ERDA 1MS4A 4GB32 1B09A 1CAVA 1R1A2 4JAAA 5FZAA 1OT5A 2E7AA 4BHBA 2G0EA 2EV6A 3HNYM 4FE7A 1GSLA 1C4RA 3UJOA 1QIQA 4JHTA 2RVAA 3HKZA 4ZKTB 4DXSA 3LEGA 3I71A 2AGSA 4PDKA 2R49A 1ETVA 2GQQA 1ZVFA 3OS1A 2MPFA 5FZMA 3CDIA 1J3RA 5IUQA 2CUFA 3HHHA 4RB1A 2C9AA 2RN7A 4D7YA 1FYLA 5A1AA 2KRCA 1VBE3 1ZRCA 5DUKA 5DABA 2DMNA 2NZ9A 2HBUA 4P5YA 2ZGQA 4M3CF 2VUAA 4ZY9A 1O7LA 4A2UA 2BHYA 2MBFA 1SEFA 4QPGC 4DRRA 5M3MJ 1QJY2 5IW0A 2XJQA 5CVUA 2WAAA 2VJ4A 3P5JA 1IPJA 4GKYA 2HQ5A 3ECQA 3AL5A 3WP6A 2VOXA 4UYBA 5FO7B 4BE3A 3RQIA 2W68A 4EQVA 3VBUA 1GUUA 2VD7A 1US2A 3HUGA 3GF6A 1IS3A 4GCVA 1EH6A 2A5WA 2D93A 5EJZB 2CQNA 1T2XA 1W5TA 5C6CA 1F5FA 3HT2A 4JGZA 5TJJA 4UB6C 5F08A 2DT6A 2MEV2 4CEYC 2W7NA 3HSEA 4QPIC 2LW8A 3OF1A 2QQNA 2W24A 1W6OA 1RR7A 2MC4A 3KEOA 2Q8CA 5EQUA 4M9XA 1SDWA 2K02A 4AIJA 1U78A 4CXYA 2QQAA 4AM3A 3MFKA 1OFSA 2VMDA 3PVNA 1ULDA 2DYSH 2VZSA 3WW3A 4GGGA 1YC61 1VBB2 4IE6A 3BI3A 3NL1A 3GBWA 5SV8A 3L00A 2E2JJ 4EJVA 1V9U3 4J1XA 1OA4A 1USTA 1IN6A 1KQ9A 1AR93 1ZRRA 3U07A 1WA6X 5C3EJ 2XKOA 1H9TA 4CEWB 5GZEA 4AVBA 2EIGA 3JU9A 5GZFA 3QYEA 1URXA 5L36A 5CB7A 1WMDA 1VBB3 4BISA 1W0NA 5D5VB 4XQWA 3VYRB 1JXSA 3ZYGA 1TT0A 3FN9A 3OY8A 3V8JA 3O1MA 3I3DA 4ESBA 5B2GB 1WLTA 4D5CA 4OIOF 4LG0A 1NAEA 2FEZA 2JSCA 4IPAA 4GMP0 1O91A 4EN6B 3K1PA 4M9ZA 2VZPA 4NRPA 4QGLA 1ZNPA 3KVBA 2CW8A 2WZR2 3M8LA 1B1BA 4HQEA 1HSJA 1OCPA 1USSA 4L5EA 2FMDA 2VG9A 3I2HA 1HJGA 3PNVA 1QHHD 3JR9A 2XPWA 1Q56A 4FPEA 4PF5A 4W4ZA 3URFA 3POEA 1IXRC 2E7QA 4R8HA 1T0FA 4XL9A 2ZMEB 1W7PB 4WK8F 1OR7C 1ZRIA 1N77A 2ISYA 1DPUA 3V42A 4QM9A 5A6YA 1Z05A 3LSTA 5A3WA 1N1SA 4GD4A 3L9FA 2C24A 4YPJA 1H8TC 1N1YA 1NLQA 4JDNA 1X82A 2L9NA 3BCWA 3CCYA 4N53A 3VZJA 1RUG1 3GGLA 3HOSA 3WV6A 3M7AA 5FUNA 1ZGWA 3V0AA 4JCKA 3WG1A 4IERA 3RKWA 1BA5A 2ZJ2A 4GKXA 4K1YA 2OCEA 1FNNA 2PQSA 1KZHA 3KWVA 1ULPA 5FROA 3G1LA 2QQ8A 2WUHA 2ZEXA 3PU8A 1WLDA 1VBA1 1YG2A 3PTYA 3JAMZ 4BQWA 4NIGA 3GZEA 3RZDJ 1DHKB 1H9PA 1OF3A 1G3TA 2Y9YA 4HKLA 1LHWA 1GHCA 1JUPA 1OLRA 4HPKB 4QTRA 2D3SA 3CBNA 1VIWB 4M72A 1UYZA 3I2GA 1U0AA 3TEXA 3N4MA 4ENKA 3U2RA 5GLUA 1S72I 1WJBA 1ZYRF 4YG2F 4IHWA 2Y6JA 3IAPA 1ND2B 1YFHA 1VBC2 3T4VA 1HN1A 2VTXJ 4HETA 2NLRA 2AYHA 4KL1A 1XYNA 3VB2A 4NRMA 1F31A 5C8CC 5FBJA 2RAEA 3LCPA 4J00A 3VV1A 5FLVA 3AX4A 4DQAA 4ARXA 2ZS6B 2HKOA 1ODMA 1YEWA 3HOZJ 4BQ4A 2L3DA 3VDDA 2SBAA 5ERIA 1JU4A 4BGDA 3W6JB 3M7GA 1PUFA 1PK6A 3MF6A 4DUVA 1ONVA 3S93A 2W1SA 5JVVA 4Q0UA 3MKYB 3MEPA 4XONA 2WSVA 4AEDB 4GIQA 3O1OA 1P4WA 3Q0UA 1KQ8A 1F1ZA 3E1SA 2HQNA 4FXKB 1P92A 5C4WB 5I0TA 2W46A 1JYIA 3IHUA 2BWCA 2WADA 1ZZCA 3W58A 2XV4S 4O3MA 5L19A 2FD8A 2ZZJA 1AKHB 4BXXJ 1TW3A 3WGGA 1JKPC 4M6XA 4DYRA 3WUDA 5AC93 2M4KA 2YGMA 1BR4A 1A6IA 4JOMA 2CU7A 1AA7A 1KRIA 4Y3OA 1XYPA 1FBQA 3FMRA 4DZPA 3P9KA 2MHFA 1QZEA 1KA8A 3F2ZA 1CX1A 4DQ2A 5L3GA 1IC8A 1B72B 2UWAA 4IHYA 2W52A 4KNYA 2M87A 1U9OA 4BK4A 3RPQA 1UKGA 2VQCA 1QY4A 2DMTA 3TP3A 4MXWB 1OQYA 2DDAA 4KBZA 2WAFA 3ABLH 3Q8AA 1EAH3 2YDEA 4GYGA 4BCUA 2FBIA 2XF6A 4LLLA 2MFZA 1O5LA 2P8TA 1WWXA 2DA7A 4XYXA 2HVQA 3HGYA 3IZOA 4C91A 2L54A 1N1VA 1NG0A 1NY72 2HEOA 1EAH2 4NHKA 1PM7A 3CDHA 2M8GX 2ZGTA 1VR3A 5HXMA 1JBCA 3HEIA 5FFZA 2BBVA 2ZGMA 1W6QA 3N9NA 2DU0A 1HRV2 4E4SA 2JJ7A 3BTIA 5JLWA 1HN0A 2VZVA 1LHUA 4EATA 2YROA 5FZEA 2R93J 2Y0SN 2XVCA 1Z91A 5T5JA 1W6NA 1SCRA 3HL2A 4D0QA 2XAGA 1G9BA 2RJLA 4QHBA 3WZ1A 2E2HJ 4BB3A 1C28A 1ULFA 4E2SA 1CAUB 4HF1A 3K1NA 4FBFA 1VQNI 2E51A 3AAFA 1UHMA 2BGCA 3DPTA 5HODA 2GOMA 3MBWA 1SAUA 3LB9A 4FPCA 2A6HF 1QJX2 1JZ2A 3C2UA 3J8F3 3L2YA 2RC4A 3MV01 4Y5Z0 3A01A 4RBOA 2HVRA 5FPAA 3H9QA 4R9CA 3D5RC 1DGRA 4L5JA 3L2RA 2BBYA 4PFOA 2C6YA 1T56A 1F4HA 3BN6A 5AVPA 4BJ6C 2EH3A 4EGZA 1O8PA 3B7MA 3UV9A 2Y60A 5FV3A 1W8HA 1ULOA 1RUD3 3KYCB 4JX6A 4XLFA 5H9RA 4LK6A 1R091 5JVGF 1OISA 1HRV3 3VBUB 1PM4A 3HUGB 3GCMA 4ZHNA 1O5UA 3SFIA 1JZ8A 4ES9A 4C9YA 4A0ZA 4CCEA 3FMQA 1VBC3 1ODDA 5J09A 3CLPA 2OX0A 5BNPC 5ICEA 4ASLA 2P5BA 2ZGPA 5GPAA 3FIWA 3IAS2 3JRFA 2LM3A 3GCWA 5CAZA 3TNPB 2H09A 4KICA 4KG8A 3MW4A 1KFXL 4GYIA 2NVTJ 1FMWA 2VCCA 2KJBA 4BS9A 2GNMA 4EMSA 3GYHX 3ELKA 2HJIA 1DZTA 2J5OA 1U3EM 2H8RA 2P3KA 4YNIA 1AF9A 1COV3 4AFDA 2BV6A 1UIKA 3KSCA 4RA2A 3QODA 1ZQ3P 1SC7A 4L18B 5FUPA 3VYUB 4ZYGA 2JENA 3CCUI 1XD7A 2JK3A 2IS6A 1MZ5A 2HOEA 3M3CA 5A80A 1AR81 2NVUB 2RS33 4PSXA 3VSLA 1K4TA 5KXCA 2PA7A 3TWIA 1HX6A 5LRSA 2L7ZA 2XJUA 4ZU5A 2NVYJ 2WNOA 2P81A 2R7EB 4BYYA 3CTAA 1VE0A 3ZYIB 1H8TA 3W20A 1ZBA2 4KWKA 2Y69H 2VL4A 4RGSA 5LLQA 2B7EA 4HLTA 1UY4A 1AL21 2JG9C 3ZFEB 5CNAA 4OI2A 3T3YA 5GLZA 1BC7C 4CUCA 2HLEA 1WI9A 3VKOA 2J1SA 3OWTA 2HEVF 2FCTA 4GMP1 3SEPA 3M8FA 4KIBA 4JQFA 4LBJA 1PDNC 4G6DA 4CXWA 5CG8A 1SFPA 2NVXJ 2P0WA 1VQ6I 1Z0HA 2AR6A 2ZMEA 2EA4A 1YYNA 2QDRA 2YYOA 1AR71 2MSYA 3WNKA 5CFCA 1SZBA 2A3YA 2BYVE 3VD3A 1WMEA 1GWLA 1GZCA 3MVPA 2ZEYA 1ZBE1 3BALA 3ZFFC 4CDWB 4M3BA 3CHXA 1LNWA 2XHKA 2HGCA 2EXKA 2QVOA 3L2VA 2IS4A 2DMQA 1IV8A 3FKJA 1XS9A 1FNZA 1A04A 2M5WA 3NKGA 4A3GJ 1QQP1 3BPVA 2OA4A 3WE3A 1UYYA 4AR2A 1NH3A 4RFT0 2O3FA 4YW6A 4BK5A 1UMZA 5LASA 1JYWA 3LFIA 5ACA1 2PJRA 3BG7A 5BMZA 1GP4A 1WRJA 3H1YA 3VLBB 1VBA3 1D2SA 3VBOA 3NJYA 2VNOA 4BJ0A 1GZWB 3HEFA 3KP7A 1ZBA1 2CL2A 3NQOA 1YI9A 4RM3A 3CESA 4KWUA 3ZPOA 1CAXA 4BQOA 1D4VB 2YHJA 2X51A 2JB4A 2LKPA 1FLIA 2QENA 2DFCA 2YPJA 2AQEA 4W97A 4L5IA 4FPHA 4L99A 4Z07A 1GZTA 4OUSA 1FSHA 3MKWB 1A6QA 4HKOA 1VMJA 2HWVA 2EBIA 2B45X 1E3OC 3J81Z 3KETA 3RYPA 2G9ZA 1E3PA 1U5TC 3HN1A 4TSVA 1E5IA 4TZDA 3LGRA 4AU7A 1DDLA 5DD4A 2HTJA 1RHI3 3UGFA 4LA2A 1MS8A 2VZOA 2JSPA 4QQOA 1UL9A 2ZXJA 3MKLA 2OQRA 1S7AA 3FXLA 5A3LA 3SH3A 4KIFA 5LHIA 3C2HA 3R4KA 1APNA 1VPHA 5KWRA 3BQZA 4P02B 4EN9B 3FBYA 2HZTA 5K5OA 2PTMA 3SXYA 4KISA 1R71A 2J1VA 4AEDA 2IGOA 2VNVA 2FQPA 3LZZA 3CCQI 3ZQGA 3LF7A 1YJLA 3S1RJ 2OZJA 5EJ3A 2BGPA 1DU6A 1AWCA 2BRTA 5E3NA 4AVCA 4LQRA 4LHKA 3RRDA 2DW4A 5D5XB 2MD0A 5HPOA 1U0JA 3I4MJ 3W2WA 2JDHA 2GWRA 1LULA 1A3KA 3ERMA 4NAOA 4BH9A 1U12A 1W28A 1T8IA 1AL23 4BU2A 1YOVB 1K5MB 2R32A 4Q2FA 2FDJA 1FTTA 3RCOA 1NXD1 3WF0A 1QXPA 3PUIA 1ON1A 3RKYA 2Y6FA 5CFDC 4XF9A 1QZYA 4YELA 2IXKA 4E2QA 4XKBA 2E2IJ 5HLTA 4IL6C 1GV2A 5HS7A 3AMMA 4XRSG 1RUD2 1LEBA 5A6QA 1D4M1 5FZ0A 2ELHA 4D7TA 3OIQA 5F5IA 3HRTA 5FFOC 4XABA 2DFEA 3H3UA 1BR1A 3RJPA 1UHSA 1GWMA 4CXXA 4ZDOA 3JQWA 3K4KA 3X2QH 5FKOA 2WWUA 2WQ8A 2HI3A 3W9AA 1ULEA 2ZACA 2XJRA 3S2HJ 3HOUJ 2EIMH 3BY6A 3U21A 2LK2A 1B35C 1H6YA 3WUCA 2F48A 2KHMA 2DUQA 4CGZA 3M3EA 1GP6A 2JEMA 2Q1MA 4LIUA 3J80K 4XBNA 4RN5A 4IO9F 2NOJB 2X6XA 5A1FA 5FK8A 3AZYA 1FT9A 5A3UA 1S3JA 1D0HA 2D40A 1GLHA 2DCJA 2ZJPF 4MHGA 4WVMB 1B6AA 5LGNA 4N4OB 2X10A 4KYWA 1ETQA 5FYIA 2K9MA 4UUSA 3KEQA 3FXUA 1LHOA 1EUUA 1QKQA 3KGZA 3PL0A 4SLIA 4CCKA 5L7OB 4J1WA 1WKYA 4RHV3 1XMKA 1SANA 4IVNA 4O9GA 2CUEA 4NOTA 4FETA 1WCKA 2BP6A 2ZGSA 3FZ3A 1NA1C 4RYDA 1TNSA 3AVSA 5FFXA 4A69C 2IXIA 3RYRA 5LCWL 3HM5A 3GBFA 4BQ2A 1QDOA 1X1PA 4C2MJ 4XSXF 2JZYA 1SVMA 4AZZA 3MKZA 1MZFA 4S2GA 2YXSA 2ZX0A 4DINB 2MW8A 5IJRA 5CFCC 2JIGA 1ZARA 3TB0A 2IZWA 4MYEA 3Q5FA 4IGOA 1P2FA 1TZLA 2GP3A 3MO4A 3A0BC 3RKQA 3S8PA 2W0XA 4XXAA 4N9IA 4AI1A 3AKTA 5JOXA 1QQP3 5C8CB 5BUVA 4AIKA 5FJ8J 4BE2A 2ZXHA 3WODF 4IKFA 3P6BA 5LK7B 4WM7A 1WWYA 3H8UA 4ZC3A 3ILNA 5KHGA 1OQDA 1L3LA 3FL7A 5EEHA 1QEXA 1BBYA 3LQQA 1WHUA 3L1PA 1KDKA 3ZMDA 5M5YJ 2IJLA 5DUIA 2RR12 2F17A 4IE4A 3BTCA 3O0VA 4DZGA 2XH6A 3BG5A 3C7HA 5FY5A 1AHSA 3POYA 2A3SA 1PVC1 2DTZA 4RR3A 2KM2A 1UY2A 1KGYA 1XNBA 1LEMA 4CA9A 4OHWA 3CO6C 1DQ0A 2OUHA 3RZGA 2YUSA 3U1KA 2QQIA 1RUI2 2EIEA 4D8MA 1OQEA 1FPQA 5JI7A 4QQLA 2IBDA 1D4M3 1C0WA 4BQNA 1Y9GA 3OEAA 1JTYA 4PLMA 2JMWA 2VBWA 2JXAA 4A0XA 2X53S 3CMEI 3WP4A 2R073 2DFFA 4G4FA 3IIIA 3G7DA 1FMVA 3OYBA 2AS5F 3H1WA 3O1SA 4A3BJ 1QJU1 1DF0A 2LLKA 2EV5A 5A2QK 2PI0A 1RVF3 4E7KA 2A3WA 3EPZA 1W90A 2JD9A 3WG2A 3OYCA 1J1TA 1ST8A 4N7IA 2OZ6A 2W2IA 2R071 4ZXEA 4B8XA 1S0BA 1S0DA 2E19A 4I3GA 3BLYA 1FBUA 1SLIA 1OLQA 3OV8A 1VQMI 1D5YA 3KP3A 5E17F 3ACHA 4M4PA 1JHFA 3BOQA 3ZMZA 4LBQA 5FY4A 3CD6I 2WZR3 5JLXA 1PO11 5DUUA 3POGA 2C9KA 2RV8A 4ORFA 1EA3A 2KIFA 2IUWA 2R0FA 2XBO1 3S1NJ 2XOMA 1QNTA 4A6EA 1PMHX 5B3SH 4XN0A 5FZOA 3ME2A 3U9GA 4GULA 1FTZA 1MBJA 2UZKA 2JG8C 3F6VA 4QXCA 4LK7A 5KC5A 1YFWA 4KU7A 1U5XA 2Y0SA 1X8MA 1UF2C 2JVGA 4OUEA 4IE0A 4WVVA 2UXXA 4MH0E 3OYDA 5JHUA 2EIDA 3Q3SA 3VBOB 3ZQFA 2FSWA 2O8QA 1NTCA 3LSJA 1QGPA 1J5YA 5BNNA 4HX7A 4BBRJ 4EN8B 3BWGA 4II3A 3NJZA 3DEUA 1OH4A 1W8TA 4LMFA 1A35A 1CAXB 4CPBD 5JZGB 1T6SA 1GR3A 3K1MA 1CR7A 1VRH2 5K7PA 1NQDA 5FP3A 4BBSJ 1HSTA 3IP4B 2L7FP 2NPIA 4HANA 2FCVA 1XSDA 4HOOA 4S05A 3TEDA 4YGDA 2LF7A 1A31A 1BK0A 3M4OJ 2PHTA 4YZ3A 1KEXA 2VVDA 3T2PA 2CQQA 3LDRA 1J09A 4HFSA 2ORZA 4H55A 1JGSA 1GYKA 1GKBA 3K70D 3CF6E 3T0AA 3KV6A 2AACA 2VMHA 2NOGA 4ZS3A 4B29A 4BZ4A 4HMZA 2VKVA 1BYHA 2XB5A 4FFIA 3JBG1 4ZTJA 3JD72 4IETA 5JDBA 3W3CA 4RGAA 5KC6A 1Q43A 5KCMA 1I3AA 1BC8C 2D5FA 4LBKA 3I3BA 1XNDA 3ES1A 3JSPA 2D97A 4A41A 4ZH4F 3ZXDA 2P17A 3I8TA 3CC2I 2OZUA 4HNUA 2Y6KA 5FLIA 4PHZA 3RQ4A 3VD4A 1IRXA 1UW8A 3MAJA 1PGW1 2DA5A 4NVPA 4QX0A 2GIZA 2EIBA 1MBFA 3DWLE 4DJAA 4AI8A 2VC0A 4WWCA 4IEQA 4HYEA 1IQDC 2H6CA 4XLHA 4W1UA 4GMP3 3HXLA 4U7BA 4IQJA 2V79A 3I3QA 5IP6A 1K5MA 2VPRA 4LNVA 4ENNA 1EAH1 4P9LA 1R083 3LEKA 2W1UA 3C7FA 4XURA 3I2JA 4LHSA 3F3XA 4D1QA 3QU6A 2VOWA 5K9YA 4IF4A 4GO1A 4RB3C 1CIYA 4IV3B 2BDRA 1IGNA 3OY9A 3FLPA 2D7FA 2OAZA 4MFEA 2D44A 1VZ0A 5DAXA 2E1CA 2GA2A 4G12A 3WDUA 2EILH 4RSUA 3L2QA 4FT8A 5F0HA 2Z79A 3MZHA 2QQMA 3SISA 4UXNA 3FMGA 1GV9A 3K4ZA 4K3UA 3UNGC 1X2NA 4BHCA 1QU0A 1AL0G 3RMXA 2LREA 4BDYA 2A6XA 4I01A 1MJ9A 3MZYA 3LA2A 4TV7A 5FZHA 1K42A 5ANNA 2DLLA 4XUPA 1O3RA 5IWFA 5F2WA 4P9GA 1W05A 1GXQA 3PUQA 3H9GA 4A7KA 1PVC3 3CMMA 4MO7A 3W59A 4C1WA 2VE1A 3FUOA 3BIWE 3IWFA 2XXZA 3BG6A 2LY1A 1W3VA 1AXZA 1JYTA 1YW7A 2EZLA 3CUQB 4AW7A 5E8GA 2JA7J 3S32A 4KI5M 3ZYHA 3PL8A 4N7UA 4Y22A 2B9SA 1NYWA 4I30A 2V9PA 3RQ0A 4RA0A 1BOAA 2M7AA 2ECCA 1MR5A 3E3VA 2ZOEB 3PNTA 1R00A 2VQLA 2K7LA 2YU2A 2XJVA 1YRNB 4MEYF 4UF0A 2VZ1A 4AEJA 3VD9A 3USSA 4HLXA 3H35A 4KQ7A 5SV5A 4CP0A 4E7JA 3IMNA 1G8WA 2DDUA 3I5UA 3NV4A 2VULA 4MX3A 2JE8A 5JXIA 1XU2A 1WGPA 5TSWA 5C8WA 4WM8A 3KQ4B 3SHRA 5LA9A 5DMYA 1I6XA 5DD8A 5GKAC 2AREA 4M3CB 3I49A 5ERLA 4WXCA 2CGOA 2X29A 1UAAA 2FJ1A 2RKHA 4JKMA 4OHVA 1EJ9A 4LJHA 1LDJA 4IRGA 3JZVA 3DYMA 3FK6A 4WZCA 3ZSMA 4PIZA 2PN6A 4AEMA 1XU1A 2BWAA 1PNFA 2EXHA 4AD9A 4DB5A 1AR92 5HNHA 5JZGC 4D7MA 5J8CA 2WFPA 4BIFA 4B1RA 5FOJB 2ZJCA 3AMPA 1W9SA 3HPHA 1LECA 3A0HC 4OHZA 2H0VA 4E9KA 2QVSB 3FBMA 3MCZA 4F55A 2QBYA 4IJAA 4NDLA 4RR3B 5EYRA 5H20A 4F7ZA 2R5ZB 1O3TA 2BGOA 2ZEWA 2ZSHB 3RSNA 3SCFA 4FP2A 3VZLA 4B3NA 2R92J 4KMUX 5DYMA 2FD5A 3MV11 1S8NA 3LPFA 5C3PA 2W1QA 3VBHC 1K79A 1JYXA 3NNFA 2ZGOA 1VQ9I 1NCRC 5EV7A 3WHTA 3V7RA 1NY71 1W2UA 2RM22 1QJX3 4RL7A 2JWPA 1RTVA 2F6BA 4MV2A 2WWSA 4DRVA 1UY0A 2D6MA 4ZS2A 3ZDVA 1AR82 4EJWA 3B02A 3IDBB 3WEZA 1QJEA 3KHCA 1DGLA 2K46A 2WA3A 4DY5A 4ZYHA 3ZLIA 4XICA 3JD71 3ZRGA 3LFMA 3QH6A 4JGZB 5DUWA 3AYEA 1TNFA 2RS31 4QWNA 4LBQB 2DVGA 2DTWA 4G9YA 1AR83 2P6HA 2UY9A 2CAVA 3CLOA 1ZREA 2Z2SB 2ZTNA 5EGOB 4E7SA 4JKKA 3RFRA 3VWBA 3PUBA 2VOTA 5F39A 1JUHA 3HRSA 1RUE3 1OJLA 1JYCA 1W36C 3ZXSA 3EYPA 3FXMA 4GB33 1AZDA 1S7EA 2RS52 2R7UA 2F5VA 3ONQA 2DPUA 3SZGA 4EJRA 3S7EA 4AHZA 3RJRA 2FDIA 4UFIA 5H9PA 3OD0A 1GDTA 4MGIE 5JR3A 4YM2A 3HPNA 4CEWA 1BK1A 5A2QZ 5G04L 1EH8A 3WSOA 5L7OC 4M74A 4Q4V2 3DF8A 1JGGA 1VQKI 1DLCA 1E0EA 4YVSB 5A7PA 1YFYA 4KG0A 1SFNA 1AYM2 3ELNA 3VYSB 3FLRA 2YC2A 2XDVA 5IK8A 3MFCA 4AQ2A 1LOCA 4IEZA 4IHSA 4I0AA 2IPQX 2MD5A 2YZ4A 3WG3A 1U8RA 4XRFA 2JX9A 3NMBA 3CMAI 2AXLA 1BJZA 5T54A 3LSEA 3AM2A 3L2UA 1TG7A 3GEZA 2ISZA 1D1AA 3RTRA 2X48A 5FY1A 5FO8B 4HG2A 2VQ0A 2XLGA 3QD6A 2XUBA 2OTLI 2O7OA 3J8F1 2RMU3 2JQ7A 4QIWN 3HBLA 1WJEA 2O03A 2GN3A 3NEUA 1FYMA 2Y0MA 1COV2 2QQJA 1BI1A 4E8DA 2V73A 1JHNA 3BZCA 4BKXA 2LALA 1MBEA 2KXLA 4FTBA 2IS1A 4IZZA 4RHV1 4IV1B 5DUXA 2ZGUA 3JQXA 4OIRF 3NAPB 2GNBA 1POV3 2K9QA 5LEKA 3U14A 1V54H 4N53B 1KGSA 2VZQA 4XTMA 1D4M2 5FMBA 2R5YA 2LROA 1S0JA 2K40A 5JPNB 4MGTA 1XDUA 4MNUA 1SFUA 3BU7A 4LKDA 3GNEA 2WA0A 2QEXI 5F0CA 4BJTA 2GC1A 5FR3A 4XJUA 4M6VA 3LIHA 3IB3A 4AI2A 3DPRB 3MD2A 1LQ1A 4HRIA 5C9AA 1HRI1 3JTHA 3FKIJ 3N36A 2YS9A 2DU1A 4K20A 3W2VA 2XVKA 3FHIB 4UAPA 4GH4B 4HPKA 4FO9A 3OYHA 2FU4A 1JKOC 2XF7A 2JDPA 2COBA 2CG4A 2D43A 4YWAA 1RUJ1 3MIBA 1R64A 2XAJA 3ILFA 1BIBA 3GCXA 1VBB1 5D1IA 2GM4A 3U4SA 3Q8EA 2KRHA 5DDGA 3R60A 2KZVA 5ILVA 5L9RA 3T0BA 3DKQA 5AC91 3DYOA 4M3EA 4D9JA 1X3ZB 2JDZA 4NWWA 4JGYC 2KL4A 1JUMA 4U87A 3RS6A 5H2FC 2OU2A 3A2KA 4ARYA 4CUAA 3K4LA 1W6MA 3BIEA 3MLKA 1HRI3 3O5SA 4Y1ZA 5EYXA 1B59A 3AP5A 4P1WA 3RNSA 5F3EA 3ZQQA 1VAKA 3AP7A 3DXUA 3R05A 5J3LA 1HF0A 4NHJA 4CTEA 2VQGA 2LVSA 5E79C 2CU5A 3ZGKA 2GH2A 4Q0SA 1F2NA 4XFIA 4YZ5A 2OW4A 3BP8A 2V1XA 4Y22B 4FOVA 4I99C 2RNJA 1FI2A 2X85A 2ME0A 3H0GJ 3AMNA 3KV5A 5FRMA 3OG2A 5BNGA 1VALA 5ILSA 3I58A 4DFSA 3HTUA 3AP9A 2ID4A 1KU9A 3K9TA 2K86A 5A33B 1XYOA 2EAKA 3AB0A 3PLQA 2PLV3 1Z67A 1JH5A 1BW6A 1P9QC 2HR3A 4L9JA 3OIOA 4CYCB 4AQ6A 2IRFG 3AMQA 1ZELA 1RUD1 2G9FA 2OQ7A 1XN7A 3PM1A 1F5TA 3JBG3 4AAPA 3IMMA 3U75A 4A44A 2XRLA 1IO2A 5K7ZA 1IJWC 4HNTA 1GICA 1GFF2 2R7TA 4EM2A 3WTYC 1JZ6A 1CZVA 3CNAA 1RUC3 3CL1A 1HOMA 2R30A 2BNOA 5FLMJ 3MIEA 5FQ0A 1QF3A 4NRQA 2RS51 4MHRA 1IW7F 3PSFA 1IPSA 3VBSA 2DA4A 5L3CA 4A93J 3DKWA 4HLYA 3S3NA 3S17J 1F5JA 3ZFEC 2DA1A 1EPZA 5FREA 2R16A 4A6OA 4ENMA 2QUFA 1J0RA 1TT5B 3CF2A 1Q1HA 4XAAA 3ZXGA 1FOD1 2W57A 5D8AA 3G6EI 1XB4A 2TBVA 1WD3A 1DQUA 2R072 4LOSA 3AFHA 4QXBA 5K7FA 3HRMA 2LG4A 3NV2A 4GAZA 1BCXA 1GUIA 1W36D 3BR0A 4A6SA 5C70A 2KT0A 2F5FA 2K27A 1OCRH 2EA2A 3HOVJ 4A12A 4ZZDA 2FOKA 5F5QA 1S0CA 4LOTA 4I09A 5FRNA 2BJSA 2YPDA 3Q0VA 2WTEA 4YGBA 5IFPA 1VBD3 5HDGA 2QM3A 1DU3D 1L7QA 4OZXA 1TME1 3ZMTA 2VH9A 4AFCA 1TW2A 3NARA 2XJPA 3L09A 3H92A 3DEWA 1QZZA 4WXDA 3EB7A 1K6YA 5HCBA 4CP9B 2KKOA 3V8KA 5IT9K 3TO7A 1VMHA 1X1DA 1BBT2 3IDAA 1PO23 4A3MJ 4A7ZA 3ON7A 3WVJA 4BM8A 2MH2A 3KT1A 2DJNA 3ZXFA 1VQPI 3L2HA 3I4NJ 1YIJI 1ZG1A 2EFWA 4CO8A 4YVWC 3C7OA 3KCCA 4GXOA 4UW3A 3I7DA 5KK1A 5IP7J 4A3IJ 2VM9A 2GBYA 2XAFA 4RGXA 3J9SA 3DN7A 1I3QJ 3ZN1A 3PDQA 3O6BB 1K61A 2WO2A 3QWLA 2XJSA 3GHNA 5LW9A 1CF7A 4PJMA 1Y0UA 3HOTA 2EINH 3TO6A 3GF2A 2EAAA 2A6EF 4KT6A 3GM8A 5FKBA 4ATEA 5DG2A 2NNNA 3KZZA 1MGTA 2O9LA 1Y6IA 1X7NA 3TYJA 3R0AA 1B8IB 4J01A 1FOYA 1ZK8A 3B94A 1JI6A 1JT0A 3O0XA 5HLHA 2KDZA 5B4XA 2L9VA 1RITA 1OVPA 2D1HA 2XPUA 3I54A