3LA3A

Crystal structure of ntca in complex with 2,2-difluoropentanedioic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
198
structure length
198
Chain Sequence
b'VETFERNKTIFFPGDPAERVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGNKSDRFYHAVAFTPVELLSAPIEQVEQALKENPELSMLMLRGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFGVPCADGITIDLKLSHQAIAEAIGSTRVTVTRLLGDLREKKMISIHKKKITVHKPVTLSRQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Global nitrogen regulator
publication title Structural basis for the allosteric control of the global transcription factor NtcA by the nitrogen starvation signal 2-oxoglutarate.
pubmed doi rcsb
source organism Anabaena
molecule tags Transcription
total genus 58
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3la3A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3la3A01
3ABUA 2RQPA 3QAHA 1P92A 4CZZA 2ETEA 1IRFA 5C8WA 2P7CB 3MDPA 3RNSA 3TQNA 3T1BA 1QXJA 1YHFA 1JHHA 5FGMA 1DZTA 1HW1A 2PMHA 1QY4A 4KDPA 2EFQA 2ZFWA 3ZQ7A 1HXDA 1LJ9A 4LTAA 2O3FA 4IEPA 1TLHB 5CVIA 3IL2A 1OFNA 5E1RA 5D5UB 4IF4A 3G7DA 4MEYF 2QVOA 5J8FA 2NAZA 4LULA 1XN7A 4PZJA 2VQAA 4IVNA 2FBKA 4LFUA 4G7OF 4PJYA 4KT5C 1B59A 1KQ8A 2EJRA 4G9YA 3LA2A 5LHHA 3I59A 4IHSA 3WGIA 3WG9A 4HSJA 1BC8C 5F6FA 4WCGA 2MLGA 4EM2A 1LEBA 1T0FA 5FLXK 1R23A 4A5NA 4JVAA 4ESJA 4BHPA 4ETSA 1O3QA 3QOPA 5F64A 2KIMA 4RD7A 2ETHA 1FP1D 2PJPA 5JR7B 2MC3A 2Y0MA 2ZNZA 3N4MA 5D4RA 1YTYA 2H0VA 2Z3YA 1D3YA 3DFGA 3Q9VA 3ETQA 5K5QA 4XF3A 1SFNA 2CW0F 1LVAA 2FA5A 4L2NA 3M1EA 3FZ3A 2PI0A 4GXOA 2K7LA 3WTZA 4FAHA 2ZBKA 3I71A 3R0JA 2BNMA 5CU1A 1RC6A 4D7SA 3F8BA 3HIFA 1D8JA 1T98A 3D0SA 4U88A 5ILSA 1FSHA 2Z69A 5FLXZ 1MDMB 2FQ3A 4A0XA 3VOEA 1HW5A 4UVCA 2XKOA 4MNUA 2JPCA 4ESFA 4UV8A 3ECOA 4ZH4F 5IT9Z 2K27A 4QWQA 1DDNA 2ELHA 1EPZA 1XE8A 3WTYC 1OMIA 2XAGA 1CAXB 1O7FA 3LA3A 4ON0A 4LK1F 2GXGA 4X6RB 1YWKA 3HT2A 2DTRA 4ENKA 2IP2A 3FE5A 2K4JA 5DD4A 3DN7A 1Y9QA 1J2XA 5LGUA 4EGZA 3P7NA 3I5UA 3KSCA 3PLQA 3IIAA 4ZZLA 3WW2A 1JE8A 5FO5A 1U3EM 2YX7A 5BPIA 3M70A 2MA3A 4XF9A 3J81Z 1WGPA 4QGMA 2QQBA 2W57A 3LOIA 3WW1A 1S3JA 2YR2A 2IXCA 1ZH5A 4WVZA 4XFFA 1GQGA 3C3VA 4Y15A 2B5HA 4EWAA 5J7MA 5ED4A 2VECA 4HDVA 3REOA 2ZO4A 4YG2F 5JHUA 3NSTA 1NYWA 3HOSA 1T39A 2PFWA 3R61A 1CX4A 3HRMA 2OZ6A 2O8QA 3HRTA 1QBJA 3GZ6A 5L3CA 4QM9A 1U78A 2V1DA 3BJAA 5DV5A 2MLKA 2EA2A 2EFOA 3N97A 5E17F 4IEXA 5E20A 2EFPA 4X6QB 2GQQA 2IJLA 4L0YB 1ZZCA 2OA2A 4WK8F 3WGGA 3FF5A 1XGSA 5L3GA 1IXCA 1IUYA 3RZZA 2HR3A 4Y13A 3K69A 3ZMUA 1MGTA 3WTSC 3GBFA 2K9ZA 1OI6A 5DEQA 1B1BA 3P9IA 4Q5SF 3KEOA 2J5PA 4L5JA 1OKRA 1RNLA 1Q1HA 3V7RA 4ZU4A 4KFCA 5FCCA 2YX4A 5LHIA 3BY6A 2PN6A 1UIJA 2IXKA 2R7FA 1SD5A 3L7WA 5K1YA 4PCQA 2MH2A 2XIGA 3GYHX 4HF2A 2GC0A 5CVRA 1XD7A 2WFPA 3HSEA 2V09A 2H6CA 3GX4X 2QQAA 2XUBA 4JTOA 1YIOA 3S0MA 2EVXA 3QP6A 4BNCA 4KIGA 1OPCA 4YFXF 3MFKA 3SHRA 4E2QA 5I8YA 4OMZA 4LG0B 3ZMSA 5D6EA 4G8XA 3ZN1A 3LWCA 1UHMA 1AWCA 2QLZA 5D8LB 2RNJA 1ZRCA 3TOAA 3T5XA 1PUEE 1U5TC 3F8MA 2QENA 1B9NA 4EROA 2VBXA 3QU3A 1UCRA 4BHBA 1T6SA 4P55A 5JAXA 2QZ8A 5HS7A 1YLLA 1SFUA 1TQ5A 5CADA 1YQAA 3KP6A 2DU9A 3LAPA 2CGPA 2DBBA 1U12A 2JSCA 1SEFA 3GFMA 4FX0A 2PAMA 3PVBB 5EFUA 4R1HA 3AAFA 2HEOA 4HF1A 3Q5FA 3JSOA 3HRUA 4ASNA 1IAWA 1RUOA 1DGWA 2OBPA 4QGLA 1YUDA 3ZPLA 2FSWA 5FFXA 4RS8A 5E8GA 3K0LA 3E6DA 3QP5A 3EJKA 2UY8A 1QZYA 3CTAA 1B6AA 2X0LA 3JW4A 4I7HA 3EHKA 5JCTA 4G7ZF 5IT3A 3FHIB 2B8MA 3H50A 5KHKA 4IEZA 1WA4A 2DK5A 2O03A 1D5VA 3BPVA 4IEQA 1XMAA 2K02A 3ZN0A 1FBUA 1KU2A 1ZLJA 3F8CA 3WGHA 1XGOA 1GVJA 2RDPA 3FM3A 3BCWA 3ZDSA 4Q48A 2F5CA 1LDJA 2EA7A 1G3YA 1V4RA 2Z2SB 4AIHA 3KLNA 3OD0A 4HV6A 1ZREA 2LKPA 2WC2A 5J48A 2QVSB 4IEVA 1YFUA 3GO5A 3LSTA 2ADUA 2HYGD 4O6JA 4AIKA 3V8KA 2EFWA 2UXXA 1SAXA 4RB0A 3GFJA 1WKMA 4L11A 4XLPF 2H94A 4U0WA 1CAWA 4ORFA 2R3SA 2W25A 2V79A 3V8LA 3PQJA 1ZZ7A 1XDUA 1HKSA 2WWYA 1BI1A 3FMRA 3TKYA 3ZMDA 3SCFA 2VN2A 4P9FA 2D1HA 5L3DA 2KKOA 2GXBA 2PBIA 3F72A 2FEZA 1CAUB 5D5XB 5JSRA 4IESA 3HHHA 1X8EA 5I8TA 2JPBA 5TRDA 1QZZA 2LSOA 1P6RA 4KIFA 4PIYA 3SXYA 4MGRA 2KIFA 1HSJA 3FWEA 4XF1A 4Q4ZF 2MNGA 1ZGJA 4KMUX 2BNNA 3IDBB 4IEUA 1BI2A 4LA3A 5CVVA 2QDRA 2IA2A 4KYWA 3F21A 1A04A 3RIRA 4G94A 1FOKA 3H92A 5KK1A 2QUFA 2ZXJA 2OA4A 1ULYA 1QQIA 4ZYDA 4OLLA 2JT1A 2YU3A 4WZCA 4GCVA 4OIPF 1XCVA 4A0ZA 4RB3C 2IRFG 1W5TA 2EWNA 2HTJA 4KIBA 2STTA 5LGTA 2OAZA 1EH7A 1J59A 3EYYA 2DW4A 1W7PA 2ESHA 3DP7A 3K1MA 4KWJA 3R4KA 1JHFA 3ELNA 4QX5A 1FNNA 3G3ZA 1ZX5A 2ISYA 1EV7A 4GO1A 3WE2A 3E3VA 1EYBA 4RGRA 3T8TA 1S29A 2COMA 5D6FA 1BIBA 2PLYA 3RPQA 4JQFA 2H6BA 1PDNC 1FYKA 3MYXA 1J7KA 3HYIA 2LNBA 2KJCA 4IEYA 2OZUA 2PTMA 2HFHA 2G7HA 2JTVA 3GFLA 1U8RA 2GC1A 3OTFA 3GUDA 1YW7A 4AD9A 4HMZA 4FHTA 3M3IA 2O8XA 1YLFA 4AIJA 2DO7A 4ENMA 4LLOA 2EFNA 4A12A 2IC1A 1J5YA 1ZZ9A 4XEZA 3BWGA 1B9MA 4QXKA 3RYKA 2R7DA 2VC0A 3RI4A 2OU2A 3KCCA 2ET1A 5K5RA 3O2PE 4FT8A 5BY5A 2PQ8A 1P2FA 2XAFA 1IXSB 4EGYA 5DUIA 2P6SA 3F22A 3S7EA 2PA7A 4OU0A 1KA8A 3TDZC 4HVOA 4KN7X 2RC4A 1Y3TA 2P4WA 3CJNA 1HKTA 1YYVA 1CAWB 1FPQA 4EVIA 4Q0VA 2P5KA 3LAJA 3I54A 3U0ZA 2HGCA 2ZKZA 5KHIA 5DCMA 2E9QA 3CO6C 5D1IA 3R6SA 2XAHA 1QO0D 5BUVA 3KEQA 3ES4A 4XFAA 3KP4A 3FZVA 2F5FA 1I6XA 1R1UA 2XGXA 4A6DA 4GYGA 4AXOA 3TO7A 2FMLA 1QWRA 4EM1A 3M8EA 5FD5A 3K9TA 3KP7A 1RGSA 5FQ0B 1DPRA 1LKNA 3J7AO 3EO6A 4EM0B 2L01A 3IWZA 2GU9A 2PMUA 4EJWA 4TLFA 2FMYA 4PIZA 1O4TA 3FJSA 1J75A 4L0ZB 1W4MA 3EYIA 1G3TA 3MWMA 1F1ZA 5FPZA 2QBYB 4ESBA 3CJXA 4O5VA 1EH6A 3RKYA 1WWXA 3BU7A 2K4BA 5JSOA 1RI7A 2UXNA 1YFHA 2BBYA 2NRAC 1K7AA 3DQVC 4G6QA 4S05A 1FC3A 3QU6A 3IKVA 2UYBA 2CQKA 1TQMA 4BXUA 5D5VB 1UFMA 3ERED 3H1WA 2A61A 1RTVA 4AQ6A 1S8NA 4ZYEA 4HVQA 4NQWA 3LZZA 4RB1A 3ULQB 5T3NA 3I58A 3IKTA 5DUKA 4FAGA 4CO8A 3TO6A 3CLPA 5AIQA 3WODF 1G6NA 2L02A 2LDUA 3HRSA 2F5EA 1EH8A 4PDKA 1ZARA 4RGSA 4Q0QA 2B0LA 4GGGA 2VBZA 3WTWC 4LA2A 1MZBA 2H27A 4LGWA 4JTNA 1P4AA 4UUVA 3M7GA 2GH2A 4HA8A 2O1QA 3MZYA 5CJ9A 5F1RA 3I7DA 4K2EA 4EJOA 1OYWA 2GZWA 3C1DA 2VT3A 4KICA 2Z33A 4WF2A 5I91A 3KZYA 3BPXA 2H09A 3CL1A 4HDUA 3F8FA 1SFEA 1PP7U 2LF8A 4EV0A 1H0MA 4WBBA 2M30A 5CVJA 3JTGA 4LLNA 4XF4A 3CDHA 4RAZA 1XRUA 2YSRA 3BJOA 5BXXA 3C3WA 2DK8A 1BC7C 4AWXB 4KMFA 1VR3A 1V3FA 4IPAA 1S7AA 3V4GA 1OYIA 2WTEA 1QGPA 5DCMB 4FX4A 2VBYA 5LEKA 3EQEA 1ZVFA 3JZVA 4LJZF 4QGNA 4JK1X 4L9JA 4CGZA 2FRHA 1QPMA 3GZ5A 2DAOA 4HBLA 4MHGA 3CUQC 1XE7A 4XRFA 1J3RA 4HZFA 1JUHA 1LNWA 4GYIA 4QLCU 3DXJF 3I59B 5I0UA 2OQGA 4LEJA 4Q29A 1IN4A 2WV0A 2PAEA 2Q4SA 3C7JA 4M72A 3L09A 4L9VA 3RKXA 2XAQA 1SMTA 1YFWA 4XFCA 3GW2A 1MJ9A 3DV8A 4PGGA 2FOKA 5A2QK 5HI0A 4M6YA 5H20A 1HSTA 1GQHA 2XRNA 3FM5A 3BROA 1S6LA 4FBFA 1XSVA 3SCHA 4XFBA 4EJTA 4LUKA 4H7LA 4HLXA 3CLOA 2IA0A 2XAJA 5KVRA 2QQ9A 2W85A 3ZMTA 4U7DA 1HW2A 5ICGA 5I8SA 4I3PA 5E1WA 2CFXA 3IC7A 1U6GA 2HQNA 5EEGA 4B09A 1XB4A 5E8IA 3P9KA 3TO9A 3J80K 4M71A 3LWFA 2GC2A 4EQQA 1USTA 2Z9OA 1ZG1A 3HT1A 5LRRA 2A69F 3D5LA 2VT2A 4LLGF 1JXSA 1O3TA 3ACLA 5CYVA 5DD8A 1QNTA 4A5MA 4M9ZA 2PHLA 4AVBA 2JRTA 1FWZA 3HQXA 4HX8A 2PEXA 3S7IA 2QM3A 2GA2A 4RGXA 3MQ0A 2IXIA 3IBMA 5BPXA 4AVPA 2UWMA 1J58A 1KQ0A 3GWZA 1TW2A 4U0YA 4O3MA 2UY9A 3KLOA 1L3LA 1ZYRF 3I4PA 3RTRA 1VP6A 1YS7A 4ZU5A 1UB9A 5HLIA 2D2WA 3H9AA 1I27A 1J1LA 4D0PA 4IERA 4GULA 1Z6TA 5ICCA 1T38A 4KU8A 1BOAA 4ONUA 3OGJA 3VB2A 3HHGA 1R7JA 2ZNYA 4HBNA 3GEZA 3NQOA 1KYZA 2EV0A 4L9TA 5I0TA 3USSA 3K2ZA 2QCSB 3QACA 2XVCA 3H8UA 1LDDA 2E7XA 3NJZA 3F8NA 1LEAA 1LDKB 2VBWA 5CVUA 4YFNF 1H1MA 3U1DA 2KJBA 4YIFA 2IXHA 4YIIA 4EWDA 2V6CA 5J6XA 2HTSA 2FNPA 3I64A 3D0JA 1P4XA 2DFIA 4LMYA 1G3WA 2RGVA 2HWVA 2GIVA 1FT9A 3WU0A 2XL9A 3F6OA 1F5TA 5HVQC 3I53A 2DPDA 2DQLA 4HW0A 1AOYA 5FLHA 4R8HA 2EA4A 2FBHA 1SD6A 2ZMEA 2HDCA 3CO7C 6PAXA 4HLYA 3M8FA 1DPUA 1Q43A 3BOQA 3WW3A 4I02A 4E70A 2AS5F 4UNOA 3SQNA 1PM7A 4HQMA 3OCPA 3E5XA 4WXHA 1B4AA 2PHDA 3NL1A 3VEPA 2HKOA 2D93A 2F4PA 1H9TA 1ZRRA 3JSPA 1I1GA 4UVBA 2DPUA 3H3UA 4N9HA 2VPVA 3ZP5A 2G7UA 1LR5A 2CAVA 4AVCA 2E1CA 1BI3A 5H6RA 2OD5A 3MAJA 3K1PA 5JI6A 1I5ZA 1K78A 2Q2EA 2Q1ZB 3CUOA 3FMQA 2VOOA 5I93A 4HAMA 1X7NA 3PNAA 3E6BA 4WX9A 4P9GA 1CAVA 3M9AA 4A2UA 2A6HF 1NE4A 4I98B 3ABTA 1MD0A 5FD6A 4EJUA 4KNYA 2HS5A 4J1WA 2IPQX 4G6DA 5HDGA 1ZG5A 1RUNA 3KGZA 1ZZBA 1IN6A 1J0RA 4AVAA 1KQ9A 1IW7F 3HSRA 3EETA 2NNYA 1PMIA 1IN7A 2XL7A 5CLSA 2PAKA 4HN0A 3I0TA 1X8MA 3B73A 2DCTA 5BMZA 4IRGA 1H9GA 5E16A 5KHHA 4HX7A 1IF1A 4M73A 1BIAA 1ZN2A 2O0YA 5HDNA 3WE3A 3HSFA 1U5TA 3R0AA 3ZMZA 3W6JB 4ENNA 2BE5F 1KU9A 1Q3EA 1O57A 2NYXA 2L4AA 2MBFA 2Y75A 4XLNF 1ZAOA 1XDSA 2O6GE 1RL3A 3O3KA 1KGSA 2XLAA 4ZYHA 3C18A 4IXAA 4KWKA 4HLTA 3Q9SA 1K79A 4MTEA 3RJPA 3NVCA 3KGLA 1KU7A 2BNOA 3OOPA 5D4SA 2A07F 4HQEA 2M1BA 2VXZA 1R00A 3KMHA 4NHJA 1YW8A 2AXLA 3V8JA 1S7OA 4QMAA 4MGYE 2XLGA 3F6VA 3ROUA 1OYYA 1G4DA 3IHUA 1O3SA 2O61A 1WI9A 2G9WA 3MPBA 3WTUC 3WTTC 3FXRA 1H1IA 1MKMA 4XETA 4Z2YA 2W84A 1HQCA 1R22A 1IRGA 4IHTA 4I01A 2ZMEB 4MQ9F 5DDGA 5KHGA 1X82A 5JSPA 4LB5A 4OMYA 1FYLA 3CF6E 1SD4A 4O9GA 2P5LC 2NS0A 2VE8A 4BQAA 4Y17A 2OQRA 3BALA 5LRSA 1O7LA 2FXAA 1VTNC 1CAXA 5L3FA 1GXQA 2UYAA 3FFQA 1F4KA 3V7CA 1L3JA 4HN1A 3NKTA 4A0YA 2IW5A 4N0BA 4R79A 2D45A 4YYOA 1FY7A 2A68F 4PGHA 2KXLA 4NB5A 1FLIA 3FXUA 3K1NA 5K5OA 1J3PA 1EY2A 2GWRA 5HLGA 3SZPA 2OPKA 4LUMA 3SZTA 5ILVA 4F7ZA 3H3ZA 3T0YA 1K78B 2CYYA 5L3EA 4IJAA 4MZUA 4B29A 3FXQA 1P4WA 4YRDA 3E6CC 1SQ4A 1ON1A 2DLLA 4S04A 1PP8F 2XASA 2X4HA 3UKVA 1TQIA 3EQLF 1Y0UA 4BYYA 5TJJA 3DPLC 1UHWA 1CAVB 3BB6A 3QPTA 2ET7A 3KP2A 1WLTA 1CGPA 3L00A 1GHCA 4META 4N9IA 3WTVC 4H0EA 1XSXA 2ZCWA 4Z07A 3L2HA 3RKWA 1TW3A 1YFXA 2P6TA 1IPKA 1LB2A 1O5LA 2E7WA 3HUGA 4ZYGA 1REPC 2QYOA 1TNSA 3EDPA 2XKPA 1UIKA 1UCXA 4I0BA 3WU1B 4IRIA 1U5TB 3P9CA 5JFRA 4LLLA 5BS6A 4UXNA 4HYEA 5FPXA 1VJ2A 4KU7A 1WQ2A 4LD5A 1KU3A 4EJVA 3SCGA 2BV6A 4YFKF 4NVPA 3VHRA 1ZRFA 5I0SA 3VODA 5IT9K 1W7PB 2HOEA 2M87A 2OYZA 3IRQA 4CYDA 2RV8A 2ATFA 2Q0OA 2K0GA 5D5WB 2IXLA 1BM9A 1EP0A 4O9EA 1J9IA 5BPDA 4RAYA 4MEXF 1XSDA 2DQRA 1BN5A 5DYMA 5AONA 4HOBA 2VE9A 4IEWA 4DQ2A 1DP7P 5EEHA 3E5QA 2I45A 1J3QA 1ZZ6A 2FBIA 4J1XA 4WWCA 1L0OC 3DPTA 2VONA 3ST7A 2MPFA 1ON2A 2W24A 5D8KB 3D82A 3LQQA 4IEOA 1D8KA 3DKWA 3J81K 4ZZDA 3UKTA 4LG0A 3GFIA 3F3XA 1Z9CA 4I09A 2XLFA 4WXCA 3U9GA 1ONVA 1FZPB 1FBQA 1XMKA 2PQQA 1FSEA 3BDDA 2K86A 2HZTA 1Z1DA 2D5HA 2ESNA 2GAUA 2ZKLA 5JVTA 3H7YA 5FLJA 1TQPA 2KRFA 3RPUA 3H7JA 3GYDA 4L9NA 1GXPA 2FNAA 1SD7A 4UBHA 2V1XA 5L3BA 4CXFA 2XROA 2CV6A 3TDUC 4A6EA 5E18F 2QNKA 4XFIA 2A6EF 4CHUA 3DF8A 3CO2A 1DZRA 4M9XA 2Q8KA 5HS9A 2KIUA 5K8SA 4XFHA 5H6QA 4UXAA 4LK0F 4KWLA 3RDIA 3SHFA 4DINB 1YW9A 3LA7A 2TDXA 2PYTA 5LLQA 3OV8A 2N7GA 4BIFA 4UV9A 3BJ6A 1YG2A 1WRJA 3IWFA 3IDCB 4KUMA 2MH9A 1W5SA 2RKHA 1UPIA 3HTUA 3KE2A 4EMSA 1E17A 1W7PD 4I2OA 2EB7A 4WXDA 1LRHA 3CEWA 4BHCA 5J3UA 3R60A 4OIOF 5HLHA 3DEUA 2GC3A 4MGKE 4HV5A 3TOBA 3KFWX 4Q0UA 5C6CA 5JR3A 3ISPA 4Q47A 3T8RA 4OFGA 4XF0A 4MGIE 2F5DA 4YNIA 1Z6RA 4Q0SA 5BOXA 2C0ZA 3FMSA 4MTDA 5EZWA 1BJAA 3MCZA 2ACJA 4CDGA 1OD5A 5FB2A 2P8TA 1LQ1A 2L4MA 2YPRA 5ERIA 3ELKA 1FX7A 3SXWA 2VODA 3GLXA 4U0VA 1DUXC 1UW8A 3TGNA 1NXMA 5DCFA 1ZLKA 1ZGAA 3KP5A 3SFZA 5LHGA 2XV4S 4PIXA 1ZG3A 1CF7A 5A2QZ 3BZ6A 3DL3A 4R52A 1CAUA 2A3SA 2Y48A 4JV4A 2L54A 4XSZF 1ODDA 4AQ2A 1XGMA 4L5IA 4P9UA 1BBYA 2E1NA 2ZJ2A 4BH9A 1E2XA 1U2WA 2JZYA 3L2CA 4ZU7A 1XCBA 4TV7A 3GF2A 3ML6A 4ENJA 2CAUA 2IT0A 3E6MA 4HVRA 3J80Z 1ZZ8A 1I1SA 3U11A 4P5OA 1WSUA 1MJBA 1FXZA 4UHTA 5HDKA 1IPJA 4BAYA 1FP2A 3H1MA 2DI3A 1FI2A 3WW4A 4CICA 3EUHA 3S2WA 4U7BA 4KL1A 1NZCA 1TNTA 2RVCA 3F23A 5FDBA 4IRHA 4KN4X 2L3DA 1RZ4A 5BV6A 1IXRC 5AIPA 3JAMK 5E1XA 3HTSB 1IN5A 1R58A 3NEUA 2FF4A 3UKNA 3KP3A 1BI0A 5J8CA 4OIRF 1IZ1A 1TBXA 1HKQA 3FX3A 1OR7A 2P17A 1RIOH 1Z05A 3RYRA 2PFBA 1XGNA 1NHAA 2VC1A 2Z5UA 2IA1A 4UBGA 2Z99A 3O6BB 1YO5C 3CUQA 1TTYA 4D7TA 5KHJA 2HKXA 4MX3A 1G3SA 4JBAA 5E1ZB 1KYWA 4Q0PA 1SMYF 2P5VA 1JGSA 3JAMZ 3FHZA 3QRFF 2HJIA 4MQVA 3L9FA 3RYPA 4DNCA 1HBXG 1NE6A 1R1TA 2EV6A 2M8EA 1DGRA 1UD1A 3HOTA 2UZKA 2MHFA 1R5GA 1V70A 5ICEA 2RN7A 2NNNA 2B9UA 5AVPA 3V7SA 3JTHA 4MGZE 3E97A 3MEXA 4MH0E 5I0RA 4OOIA 3EBRA 2IVMA 5LEJA 4RGUA 5ILUA 1T2KA 1K6OA 3E5UA 2Y0OA 2LF7A 2EAAA 3PQKA 4MV2A 2CG4A 3IRRA 1CF7B 3H1YA 4OINF 2Q0AA 4P96A 3GXOA 1O5UA 4M74A 5LGNA 2D5FA 3G73A 3LFKA 3LAGA 3ES1A 3QPHA 2VOPA 4MUVA 3BP8A 5LBQA 2IXJA 4UVAA 4F8AA 4HF0A 1O3RA 1YS6A 2CSOA 5FQ0A 4G7HF 3U2RA 1FYMA 1Q5OA 2GA1A 3W6KB 5KBFA 2A5YB 1R36A 4RB2C 3TNQA 1ZRDA 4HSLA 2HYFA 5FFZA 4KA4A 3COAC 3TNPB 4YSFA 2FE3A 2QBYA 1FBSA 4IETA 2HQRA 1SFXA 1Z91A 4I0AA 3ECHA 3B02A 3OF1A 4OIQF 4YARA 4EWEA 2CO5A 2ISZA 2CWEA 2J5OA 3VFZA 5BQTA 1Z7UA 1ZHFA 5HS8A 4XBFA 1X3UA 4Z82A 2QWWA 3LQRA 2QJVA 2V9VA 1C0WA 3O14A 1MDMA 5HOOA 3BPZA 2P7VB 2C6YA 4K8FA 2D40A 1STZA 2M5WA 2Q30A 1F9NA 3WTXC 2STWA 2M45A 5FLIA 2DT5A 3U10A 4L18B 3KZZA 4B8XA 1R5HA 2V1UA 2F2EA 3CUQB 2XHKA 3MZHA 1USSA 3ZMVA 4E2GA 1QXRA 2D1VA 4M9SA 2BEOA 2EK5A 4M6XA 3SMHA 4LB6B 1IN8A 4E2SA 1R1VA 2OZJA 2EV5A 2FU4A 3KETA 4XSXF 1YFYA 2MD5A 2BYVE 4QM8A 1MJAA 3NW4A 2BGCA 5ICFA 1ZNPA 4XFGA 2PG4A 3GVAA 2FQPA 3NRVA 3PFIA 4HX4A
chains in the Genus database with same CATH superfamily
3A01B 3UETA 4NHXA 1P92A 4CZZA 3WF1A 2ETEA 5C8WA 2VBBA 1UJ8A 3LSDA 2GNTA 1QXJA 2UWBA 2KHMA 2JVGA 5ABJC 1JOPA 2ZFWA 3CCMI 4N53C 1HXDA 1LJ9A 1DGWY 2XQRA 2HWE1 3IL2A 4FE4A 5LBFA 1CQTA 1QNWA 1W06A 3G7DA 3WNXA 3GGLA 5CG8A 1HB2A 2X05A 4E8CA 5J8FA 2NAZA 4PZJA 2FBKA 4KT5C 2WIIB 5B2GB 3OYEA 2EJRA 2AXTC 1SPPB 1FV3A 3N7JA 2AUYA 2G9FA 1GZCA 4IHSA 3WG9A 1YRNA 5F6FA 3MKWB 4WCGA 3GTLJ 1W9YA 3ZVXA 4EM2A 1T0FA 1G9FA 5E6HA 1FPN1 2MEV1 3I55I 4EYUA 5F64A 2KIMA 4QDSA 5JR7B 4D6QA 5FYMA 5APAA 1SMVA 2Y0MA 1D1CA 2ZNZA 2WB1N 4W6WA 2LTNA 3N3HA 5DDJ2 2F4LA 4I3GA 3AYAA 2KRCA 5LD2C 4XF3A 1RUI3 1DP0A 1FMD1 2AQFA 1RC9A 4OHYA 3M1EA 2JE9A 4XKBA 2FCTA 2K7LA 4JYKA 3C7OA 5FZ6A 1W8HA 2AEZA 3I71A 3HZJA 4TTGA 3HIFA 3D0SA 2VMFA 3G6JB 3VZJA 2DMTA 4Y3OA 5A3TA 2VNGA 3M8LA 1MDMB 2FQ3A 4CDUB 3FL7A 2QKMB 5IY5H 3RZLA 4A0XA 3VOEA 1GU3A 4UVCA 2XKOA 3RFRA 4KT6A 2JVHA 4QPGC 4QWQA 4ISQA 4NOTA 2E6VA 1DDNA 2VD7A 2ELHA 1EPZA 1Z78A 2NOJB 4QX7A 1CAXB 2L7ZA 1SCRA 3CQZJ 3OGGA 5FJKA 2QEXI 3LA3A 2OXBA 1WW4A 3K4JA 4ENKA 2K4JA 1RVF3 2JA5J 1W2OA 3VL8A 1OD3A 2PJRA 4COWA 5FXXA 1MQTA 4YGEA 4NNJA 1Y1WJ 4GXLA 3VBOC 4QPOA 2QUOA 4KGGA 1MH4A 1LEMA 1X2MA 4AHWA 5JOZA 2KISA 3M70A 2WS93 5FYSA 2QQBA 3VBSC 1RVF2 3WW1A 3C3VA 1Y0NA 4QQHA 5C33A 4BJTA 3BI3A 1H89C 1I6HJ 1H2LA 3CESA 2V73A 1MNDA 3HOSA 3JUUA 1IRXA 1OT5A 3R61A 2DCEA 3NV4A 1CX4A 3NNJA 1NLSA 1W0OA 4FETA 4E27A 1QBJA 2V1DA 4XXAA 5E17F 2EFPA 4LMFA 4URAA 4YVWC 1N3PA 3ABMH 3WOGA 2TBVA 1ZZCA 3OPZA 2AQEA 3B9CA 2W68A 4Y13A 3K69A 3H9QA 4F92B 3KQRA 1MGTA 2O8KA 1LODA 3GBFA 3QWLA 1OI6A 2P6HA 5IW0A 3P9IA 3ZXAC 3AMPA 3KV6A 1VQPI 5GLZA 4E7HA 2CUFA 3V7RA 3OUIA 2ICWG 1VBE3 4ZU4A 3DLAA 1XYNA 2DMPA 4L5EA 3HNMA 1NCRC 5H9PA 2MH2A 4NAOA 2NMOA 4LKEA 2GC0A 5C4WA 3USUA 1XD7A 3H8RA 3HSEA 1HDPA 1OKOA 2QQAA 1F4AA 1R093 1L7LA 1TME2 1YIOA 4MG2A 4AU7A 2EQRA 4C3HJ 4XMYA 2Y8KA 4BNCA 3VV1A 3BCBA 2XVGA 2XGCA 1VBE2 4E2QA 3OYLA 1TP4A 1E5HA 1YRZA 3ZMSA 4UF0A 2WNVC 1Z3XA 3CMEI 1ZRCA 1R092 5CNAA 2KM2A 3F8MA 4DOUA 2QENA 3RQ0A 1B9NA 3M2MA 3AG2H 1WW6A 3QU3A 4OULA 1T6SA 3DXUA 1TQ5A 5CADA 4FPOB 1TNRA 3KP6A 1UHSA 3EB7A 5FP7A 3AAFA 1JN2P 3JSOA 3VBOA 1PVEA 2OBPA 5DZFA 3C2HA 1YUDA 4XONA 4BJ6C 2UY8A 4CE8A 3WF4A 3LF7A 2HWC1 3RGBA 4C1WA 3UNPA 2X0LA 3JW4A 5JCTA 1OF3A 4AM3A 2B9VA 1F2NA 5EG0A 4LBQB 5FZFA 3DEMA 4EN8B 4IEZA 2BY3A 3BPVA 3CP8A 3MFAA 2P1BA 2K02A 1YIPA 1E5RA 1YHQI 2UUZA 5JWPA 3T2TA 1XGOA 3FM3A 2LROA 4Y1YA 3ZYHA 2JD9A 1HV0A 4ZONA 2VI6A 5FPBA 1PK6B 4N43A 3KLNA 4LHLA 2X48A 3QLQA 4BLJA 2WC2A 3PHMA 1B35A 1PGSA 4I99C 4JQRA 2HYGD 4E7LA 2VGDA 4AIKA 2UXXA 1SAXA 3SISA 3POIA 1WCKA 2I2SA 4L11A 4RYDA 4CDWC 3ZFFB 3L2UA 1CAWA 1H2MA 2R3SA 1JJ8C 2WZEA 3CF2A 1BVVA 3V8LA 1ZZ7A 4II3A 1BI1A 1KGYA 3FMRA 3TKYA 4BBSJ 2VASA 3SCFA 2VN2A 5L3DA 2XB5A 2GXBA 3F72A 1AR82 2FEZA 3INAA 5D5XB 1U0JA 1MNMC 4A3EJ 1X8EA 1QZZA 3S5QA 1P6RA 3ZFGB 4II2A 5F2SA 3FWEA 2ZX2A 1ULCA 4XF1A 4Q4ZF 1RUF1 2MNGA 2QQKA 1HQWA 4AEKA 5CVVA 5LFAA 1S0CA 3DYMA 3SQOA 5DAWA 5JPNB 1GZ9A 3F21A 3VBHC 3RIRA 1FOKA 1ULGA 1MS1A 3BR2A 2VOVA 2W7NA 5LA1A 5JDBA 4A3KJ 2C24A 2VULA 3G2BA 2VXDA 3W2WA 3C7EA 1O4XA 4HKWA 1JUMA 5HXVA 2OAZA 1KQRA 1J59A 2WT1A 5FJ8J 2YC4A 1IG7A 3DP7A 1F4HA 1VBA1 3K1MA 4KWJA 3JRCA 1VBC3 2BZDA 1VZ0A 1JHFA 2FBEA 3ELNA 3HOZJ 3LE0A 5EYXA 2ISYA 4RBOA 4AF9A 2ECBA 2DCKA 4A93J 2COMA 2FZ2A 1IPSA 3WQBA 4JQFA 1F5FA 4FPFA 3VL9A 2H6BA 2ZA9A 1KFXL 1S0IA 2A5ZA 3IH2A 3A1YA 4IEYA 5EV7A 2OZUA 5DUWA 2G7HA 2W39A 3NWKA 4NUBA 3OTFA 4M3CB 3M3IA 4LE4A 2BJSA 2VVDA 2PHTA 1ASJ3 4ENMA 3MV01 1SLTA 1J5YA 3RYKA 2E19A 1ALYA 3JBG1 5C8CC 2ZGRA 1Y9GA 2ET1A 5A3MA 4YM0A 1MS0A 4FT8A 2PQ8A 2OW4A 4EGYA 2P6SA 3S7EA 3HQRA 1ASJ2 1KA8A 4XL9A 4KN7X 2SBAA 3CJNA 1GLHA 1HKTA 1QHDA 3KM5A 1X58A 3ZYBA 3LAJA 3CMGA 3I54A 3AK0A 5FKNA 2DWRA 5FP9A 5DCMA 1TT5B 5D1IA 1VQ9I 2RS11 4LKFA 2X53S 2DOFA 3CJTB 2J1RA 3BR6A 3DBLB 1OA2A 4JGYB 2V4AA 5FZAA 3PIJA 4XDOA 3HKZN 1XMXA 3IPVB 1GZTA 3EO6A 5TGTA 5A6XA 2XJRA 4XUPA 2HWE2 3IWZA 2GU9A 4E4DX 3PIOF 1C1FA 2FMYA 4XILA 2RQQA 5J09A 1W4MA 2VZPA 1FPN3 1LEDA 5FPZA 2MEV3 3CJXA 5A7QA 3RKYA 2ZPXA 3B6AA 2K4BA 5JSOA 1YFHA 3LOCA 1S0FA 5BNQA 4BQXA 5F6LB 4V2WA 4D9JA 1FC3A 3QU6A 1UZWA 3CZUA 4BXUA 5M0TA 5JOXA 1JZ4A 4PJ0C 5ISLA 1FMD3 2M8GX 4M01A 1FPN2 4OI2A 2MEV2 2LYCA 3LZZA 3RI9A 3VZMA 2RDQA 3IKTA 2EIDA 5HXMA 3RG0A 4K7JA 5DUKA 3VBFA 5F3GA 3O8GA 1ZGWA 2ID4A 4OHZA 1KJLA 2BVLA 1GOHA 5AIQA 2PELA 2CHHA 1FMD2 2R7WA 3G1OA 1G6NA 3HRSA 5LA2A 1EH8A 4JKKA 3L2RA 5F0FA 2B0LA 3WTWC 4LA2A 2H27A 4CXXA 1XYPA 1NCQB 5FKLA 2XPWA 5H9RA 1GANA 1LGCA 4XUTA 1S9HA 2B45X 1VQ5I 4HRIA 1REDA 4LORA 4BDVB 2R041 3CL1A 2XJVA 1PP7U 4WBBA 2M30A 1W1WE 4JKMA 3CDHA 1VQNI 4RAZA 1XRUA 2ZGTA 3VBRA 2FJ1A 3BJOA 5BXXA 5FKKA 5IFPA 4BEHA 4KMFA 3JR9A 1WCSA 1VR3A 3C2GA 1V5FA 1X1DA 3RS6A 4P9IA 3WP3A 2VOKA 3CCJI 5FO9B 3KYLA 5K7ZA 5D8AC 1LU1A 3URFA 3QYBA 1OR7C 4BDYA 4BMEA 1QGPA 4Y52J 1IG0A 4GWJA 4COVA 2VBYA 3WDTA 1ZVFA 4ZXKA 1S0JA 5T55A 4PHZA 1BHGA 1JZ2A 1QPMA 4NE9A 3AJZA 1FV2A 1J3RA 4HZFA 4NC8A 3ME2A 1JUHA 1LNWA 3ACIA 3DXJF 4M3EA 4LEJA 4S0HB 3C7JA 4M72A 3L09A 2DTYA 2E33A 1MIJA 2YZ4A 3RKXA 3ZCOA 1A5JA 3CC7I 3GW2A 3DV8A 3GCXA 2FOKA 1UN1A 4GFBA 3FM5A 3BROA 4XFBA 2OQ6A 4LUKA 3X2QH 2A3WA 3KV9A 1YO8A 2R5ZB 1JZ6A 1KS5A 1RUC3 2QQ9A 2W85A 5ICGA 1KONA 1OC1A 2ZGQA 4FPKA 4CEWC 5E1WA 4AI3A 3H9JA 1B8IA 2YS9A 1XB4A 5E8IA 3TO9A 2GC2A 2D6KA 5H9QA 1GNYA 1ZG1A 5LRRA 2A69F 2A1XA 1BEV1 4LLGF 1JXSA 1O3TA 2OCCH 3ZYGA 5CYVA 2VQTA 1B72A 4TN7A 1WCDJ 2IEKA 5J40A 2I07B 1OA4A 3S7IA 3T08A 2QM3A 5CEHA 2IXIA 3IBMA 2VZQA 4HNUA 3THTA 3BUCA 1QZEA 4UFLA 1TW2A 2D6OX 1RUE1 1ZYRF 2ARCA 4WVWA 4ZU5A 4DGWB 4P9LA 2UURA 2D2WA 4AHXA 2BGPA 4KBZA 3OYHA 4IERA 1Z6TA 4KU8A 3ZDVA 4ONUA 3VB2A 3HHGA 4A42A 5FYTA 3GEZA 2VJ4A 2K9LA 3H8UA 3H0OA 2E7XA 1LEAA 4YIFA 2E2HJ 1PNFA 4EWDA 3RMYA 2OTLI 3I64A 3WNOA 4XBNA 3D0JA 1P4XA 2WQ4A 2DFIA 2RGVA 2HWVA 2YUEA 5DM6F 5M5XJ 2G4IA 4HXCA 3WU0A 1TZLA 4XJZA 3MVPA 1VQKI 3WCSA 2DPDA 4L92A 2HWC3 1YJ9I 5KXEA 3ZXLA 4IV1B 5FPAA 4LO7A 2LALA 1NQDA 2IGOA 1LJ7A 1W05A 4KBBA 2QGUA 2AS5F 2NMNA 1HQNA 4HQMA 3E5XA 4WXHA 3KZIC 3S14J 5F5IA 1DYKA 2HWC2 3NL1A 3BTLA 2OVUA 3LFUA 2XJUA 3JSPA 3HR9A 3ZN6B 1QPIA 2VPVA 5F04A 3ZP5A 4A3FJ 1VMHA 2LBFA 4A3BJ 2VJIA 4DBQA 2CAVA 2WO7A 3PUHA 5FMOS 1AKHA 1OUSA 3NJVA 3VKFC 4X6AJ 1OHFA 1E3PA 3K1PA 3VDXA 4QPIB 2Q1ZB 4QT6A 3ZSMA 3PTYA 1DCSA 2DA3A 3NJYA 1CAVA 1W8TA 4I98B 4ZYAA 2HVRA 5E8AA 4BGDA 1UL9A 1W8ZA 4KNYA 2IPQX 4G6DA 2BVMA 1RUNA 5DMYA 3T2PA 1J0RA 2FX0A 2D97A 1WMDA 4OI4A 4IQ4A 4P14A 2XL7A 2PAKA 4HN0A 3S15J 1VB4A 1RETA 2NN8A 5E16A 1RUF3 4HX7A 2KD7A 1BIAA 1ZN2A 3WE3A 3SC7X 3HSFA 1A8MA 1U5TA 1W6MA 3OD4A 1UOBA 4ENNA 1Q3EA 2X6XA 5FYVA 4H4KC 2DOAA 1V6KA 4INDA 1XDSA 5FKCA 2LG4A 4UFIA 3K4NA 2DBNA 5T5LA 4DXSA 2VVFA 1RUF2 3KHCA 1YQ8A 1WKYA 4FOWA 2WAFA 1LGNA 1QOTA 2BNOA 4M3FA 4BL0B 1C8M3 1VQ6I 1R00A 1FNZA 1UYPA 1YW8A 3HJRA 4PDWB 4CZCA 3VHPA 1Y43B 1WI9A 1MZFA 1R64A 3TEDA 4E9KA 4WM8A 3NWSA 4D6SA 4CDUA 3FXRA 3MIBA 1H1IA 2JG9B 3JCIA 1BVP1 1MKMA 4Z2YA 1C8M2 5AC91 1S2EA 4UW5A 2ZMEB 4MQ9F 1D4M1 5KHGA 2BHZA 1VBA2 3NAPA 4LB5A 4BQ2A 1FYLA 3CF6E 4O9GA 2P5LC 2VE8A 3DGTA 3RZGA 3LDRA 3BALA 2DFEA 3WNNA 4XHXA 1CAXA 2V4VA 1GXQA 3WNMA 4YFZA 1N78A 4HN1A 5FYHA 4Y1XA 3WZ1A 4YYOA 2VL8A 4CSWA 2OKXA 3Q0WA 1FLIA 4BE1A 3ACGA 2VCBA 1SLCA 3SZPA 4EATA 3CIHA 3LEKA 3KV4A 1DQ0A 2V72A 4XLHA 2JWTA 4B29A 3O0XA 2YROA 4YRDA 1ON1A 1N1VA 5TJJA 3JBG2 3IIIA 3IAM2 4XUQA 1H8TB 3KP2A 1NH3A 3JRGA 2HPIA 3ABKH 4XKCA 1H88C 2WBKA 3FFZA 1SFPA 2RAEA 1EPWA 2ZCWA 5CKTA 4Z07A 3RKWA 1TW3A 1YFXA 5FR3A 3B3QE 3Q0VA 4JQTA 1JS9A 2W9XA 4PF5A 4NIAA 4X1EA 3IDEA 2BHYA 2V26A 4BJ0A 1S5LC 1BR1A 3EDPA 4LQRA 1C4RA 1PK6C 4QIWN 1NK3P 3SEQA 5GAHJ 4I0BA 3IUOA 4ZY9A 2RS12 3HDDA 5BS6A 2QTWB 2ZEWA 2Y0SN 2XJTA 1VJ2A 1DYPA 3CZJA 1ND3A 1IUFA 3OYMA 1XNBA 4NVPA 3VHRA 3J7ZI 3ZFFC 3VODA 2Y2ZA 4Z92B 5E88A 4CYDA 2HEVF 2RV8A 3VYRB 2K0GA 3S3NA 2VZRA 3D5SC 4D1QA 2A6XA 3CDZB 4P9YA 1N1TA 4O9EA 1X9TA 5BPDA 3WP5A 1HB3A 1XSDA 1BN5A 5DYMA 3FXOA 3DU5A 1W0TA 2F17A 4IL6C 4ZS2A 3GZUC 4XQFA 1KJRA 3ASOH 1UYYA 3E5QA 5B66C 3I4NJ 5C44J 3QYEA 1R49A 4CYCA 2W24A 3POEA 2F6CA 4E7JA 4TLGA 4WXCA 3U9GA 1ONVA 1FZPB 1FBQA 1ACIA 4P9XA 4DEQA 4FCAA 4WV8A 4OVEA 1H4HA 2AENA 2ZXIA 3H7YA 2YU1A 4DW6A 1V6OA 4MHUA 1VQ7I 3GYDA 4L9NA 2CU7A 1N1YA 2FNAA 4QDRA 1US2A 4CXFA 2CV6A 4BY7J 2TNFA 4A6EA 2QNKA 4XQDA 5A3PA 4KG0A 3I2FA 2P3IA 1DZRA 5HS9A 5AFBA 4QPWA 5CFDA 3ZYFA 4IE4A 2HPMA 2LMDA 4QSHA 4AQSA 3HBKA 3BR1A 2NPIA 3I3LA 3WG7H 1QJU1 4BIFA 3BJ6A 3TL4X 3IDCB 2MH9A 1HXS3 4B43A 4A45A 2J7MA 1UPIA 3KE2A 4CA0A 5CZKA 1GFF2 4EMSA 1E17A 4I2OA 2EB7A 4WXDA 3MZ8A 3K4DA 4QHOA 2IS4A 5J3UA 3IAPA 3R60A 1TC3C 4P00B 4MGKE 2K9NA 1NG7A 1AL21 5K7FA 1W36D 2P3KA 1HXS2 4UUTA 3QH7A 4BQ5A 4MGIE 4HKOA 4B7EA 3BZKA 5BOXA 2F4IA 2C0ZA 4QX0A 1OQYA 5EZWA 4GA9A 3NARA 4CDGA 1OD5A 3HQUA 1TG7A 2WA4A 1VBB3 1DUXC 3GCMA 1NXMA 4WM7B 1WW7A 3KP5A 2XV4S 4NJ4A 2EZHA 3BZ6A 3DL3A 5ERLA 2FQ4A 3VSKA 2PLV3 4R52A 1RKWA 2WY7Q 4BY1J 5LB6A 2L54A 1K4SA 1VRBA 4JGYC 3ZFGA 3RKQA 1YI2I 3BTJA 1XGMA 2J1EA 4DO0A 1ULPA 2E1NA 2ZC2A 4BH9A 3PUAA 3VBUB 2WRAA 2GM4A 4Y20A 1JH5A 2BFUL 3J8F1 1SFOJ 3ML6A 2PHFA 2A73B 4FFGA 2DA1A 2CAUA 4L0PA 4URTA 1BEV2 5B4XA 3E6MA 1RUE3 1I1SA 4Y1VA 1QQP3 3SDGA 1FXZA 5HDKA 4YGCA 4FVVA 4AEDA 1AXKA 2HXOA 1FI2A 4CP1A 2DF7A 4KL1A 1NZCA 1TNTA 2RVCA 4KN4X 4EE2A 3MW2A 3OBZA 4AZZA 5BV6A 1IXRC 2BBAA 3GLLA 3JAMK 1GV9A 3WF3A 1RUE2 1GV2A 5LATA 5FTTC 2Z79A 2IGKA 3JXSA 2DYSH 2ZS6B 2HU9A 4XIDA 2P17A 1W8UA 4YZ1A 1XGNA 2CW8A 4XR6A 1LGBA 2CL2A 4AGGA 3KYCB 1F8VA 1N25A 2OV7A 1O8PA 2XJQA 3POGA 3RZKA 3SEEA 2IGNA 3TMOA 3H42B 5EQUA 4ARYA 3VDCA 4IX7A 3VD7A 2HKXA 1VMFA 1G3SA 1NCQC 5B1AH 1I3HA 4B3AA 1AR61 4IL7A 3JAMZ 3FHZA 3QRFF 1MSFC 4MQVA 2HDWA 5LZ6A 3T2QA 4EQVA 2ZJPF 4D3WA 5A7WB 4AK3A 1XNCA 5A3LA 2EZKA 2XGDA 2DFCA 3HOTA 5J98B 5LA0A 3HBZA 2VQGA 1JMUB 2A70A 3K70C 2W82A 2D7FA 1K61A 1Q8PA 3EBRA 1M1EB 4JKLA 1YQ2A 4CPBD 2HI3A 5ILUA 5CKQA 3QCWA 3E5UA 1ONAA 4XJWA 3WQ7A 2EAAA 1CF7B 4OINF 2Z1DA 3MIFA 4XTPA 3VZOA 1O5UA 4M74A 5LGNA 3Q8FA 4E7ZA 3A2KA 2RR11 3N9OA 3NNMA 2PHUA 2ZGMA 4GWMA 4QKFA 1BMV1 3LIGA 3U2RA 1FYMA 1LUJB 2M3AA 4XCBA 4AOCA 3OYNA 3TNQA 1S0EA 5EJZB 4IOCF 5FJHA 2DA6A 3COAC 1QJZA 5FRMA 5A7OA 5M5WJ 3U1XA 3BKZA 4I0WB 2W1QA 1VB2A 3VDDC 3LSKA 1ENRA 3CLQA 4KQ7A 1OCTC 1APLC 4YARA 1SZBA 2CO5A 3TBDA 5FZGA 3LDKA 3AMNA 3T30A 4IHVA 3A03A 2VKDA 1UYXA 2R49A 2QWWA 2JE7A 2QJVA 1C0WA 1KFUL 2P7VB 3HGYA 1XS9A 2Q1MA 2ZJCA 1STZA 4E7IA 5GALA 1M4WA 2J1UA 4XABA 5FLIA 1NK2P 1HDKA 5J47A 2DT5A 4HT1T 1PJRA 4L18B 1SLLA 2XQXA 4B8XA 2HWF1 2F2EA 4NRMA 4RR3C 3ZOIA 2RREA 4M9SA 2EK5A 4Z6YA 4PQ9A 1AXZA 2ZHKA 3UL2A 4BXXJ 5HNFA 2EV5A 4B1MA 3CJRB 2UV1A 3NW4A 1JODA 5ICFA 1ZNPA 2Y6GA 3NRVA 3PFIA 2HVQA 3KPHA 5AC92 1D4M2 1NX9A 1CQ9A 1X1BA 3QAHA 3RNSA 4M3GA 2HYJA 1JHHA 5M3MJ 4Q8LA 5J36A 5FGMA 1DZTA 5ANNA 1QY4A 2EIKH 4KDPA 5ANQA 2VXJA 2WNEA 4MGSA 3WHTA 4WVMA 1TLHB 5CVIA 4ZC3A 4KITB 1CJDA 2HBUA 2R0QC 5D5UB 3S8PA 1RMU1 1V5GA 2LVSA 2BY0A 3R4DB 2E60A 4IV1C 4LKSA 2QVOA 2FHRA 1MBKA 3FBMA 2Q8CA 4PJYA 1N47A 1J09A 3LA2A 3AMMA 3HOXJ 1RUH1 4AGRA 2BDRA 3WGIA 4HSJA 5LY1A 2B46X 5DG2A 5FLXK 3LSPA 2DUQA 1R23A 3N9QA 4ESJA 4BHPA 3NQHA 1YJLA 4E4ZA 2EICA 2ETHA 5GADJ 5BNNA 4FPEA 3DTIA 5CAZA 1LU2A 2I8DA 3HB9A 3N4MA 2H0VA 2SLIA 2CDPA 2X5IC 2Z3YA 2ILMA 1D3YA 4YGBA 2I10A 3WINE 3LQCA 1AZDA 4P1WA 4QPIC 2CW0F 2RM23 2FA5A 2WNOA 3KVAA 4GXOA 4B48A 3WTZA 2R071 4FAHA 3CJIB 2BNMA 3BQYA 2VZVA 1RC6A 3FHQA 1T98A 1U5YA 4U88A 4IOAF 3M8JA 2JN6A 1VQ4I 1RXGA 2NVTJ 5FLXZ 3M3CA 2RM22 3WG1A 2C9AA 5IVEA 4U2AA 4EEFG 1MZ5A 2ZOEB 3G6EI 5F08A 5JXGA 3RWNA 5KXDA 1K83J 3OYAA 5IT9Z 1JHNA 3K2OA 2K27A 4FFHA 2I74A 1MH3A 3WTYC 4W6YA 4A44A 2XAGA 4GH4A 3M3YJ 3WG4A 2GLOA 4X6RB 1YWKA 2XWJB 3FE5A 1ODMA 2LY2A 4FXKB 3PJQA 3DN7A 5LGUA 3T0BA 4ZDLA 3UJOA 1HIXA 4EGZA 1GT0C 3I97A 4PQQA 1RB8G 3P7NA 2XJPA 4A6OA 3PLQA 3IIAA 3AXEA 4ZDPA 4OUMA 4ZZ5A 2DT7B 1V55H 2CV0A 1U3EM 3RQIA 2MA3A 4XF9A 3J81Z 3ZQCA 4QGMA 2W57A 2HOAA 2IXCA 4PDWC 4XFFA 4Q4W1 1BLZA 4GIQA 2NS8A 4ANJA 4HPKB 3J7HA 5FO7B 2EXKA 4DPNA 3VKOA 2VECA 1YEWA 5CG9A 3S3MA 2QQNA 2Y69H 4HDVA 3AG4H 4XUOA 5FFOC 5BNPA 4BQ4A 2PHXA 1NYWA 4ZPIA 2ZMEC 1H4GA 1Z3YA 3TW7A 4EN0A 2OZ6A 4CU8A 2A3XA 5L3CA 2NLRA 4XXPA 3BJAA 5CA6A 2BY2A 2EA2A 1D1AA 5E20A 3B9IA 1YRNB 3T1MA 4X6QB 1NUKA 4BWOA 4A41A 1BJZA 1F43A 3UR3C 3RZZA 2D6PA 4FISA 3ZMUA 3OYGA 1E3HA 4FPGA 4F55A 4DYQA 3ZN6A 1FOD1 1T6BX 1AYM1 2IXSA 4HONA 4P08A 3KEOA 2ECCA 1Z77A 2J5PA 4NBQA 1QJX1 4L5JA 1RNLA 1Q1HA 5FCCA 3VPRA 4AW7A 3F9KA 2W4SA 2ZEYA 1POV1 3AP7A 2R7FA 1SD5A 1AL22 2ZAHA 2C5DA 2A7AA 3APBA 5JVVA 2X85A 5CVRA 4JGZC 3JQXA 3OBRA 4JTOA 3S0MA 4NPRA 3UKGA 4YFXF 2V5YA 4UYBA 5K0UB 4Q1RA 3ZXEA 3OYFA 3KF5A 2Q1FA 5I8YA 2M2EA 1NKGA 5D6EA 5IVFA 2D44A 1UHMA 5IYDJ 1AWCA 1K5MA 1G7YA 3BCAA 4R4ZA 2RNGA 4GMP0 2GNMA 2WO1A 1PUEE 3JRBA 3OUHA 2F4OB 3J8F3 5J3LA 1X19A 1N75A 2JB4A 5L19A 1JYWA 4AYUA 4BHBA 4IE5A 4P55A 5HS7A 3CCLI 1AX2A 1SFUA 4Q2FA 5F27A 2JIGA 5IWFA 1X1AA 2DU9A 3LAPA 2CGPA 2DBBA 1U12A 1ETOA 1SEFA 2PAMA 2O7OA 5BYNA 5K7HA 4MSVA 1FNYA 3J8F2 2JEMA 1DU0A 2IAIA 1N77A 3LEMA 1RUOA 2AEYA 4QGLA 2OPTA 3ZR5A 2GIZA 5F5CA 3K0LA 3E6DA 3QP5A 3CP2A 4PDWA 3CTAA 1JTYA 3HMYA 1B6AA 3I9V2 3EHKA 4BLIA 1ENQA 3GDBA 5FOJB 1PUFA 1RPWA 1Y6IA 5IT3A 1HC8A 2B8MA 5G04L 2JG9A 5EEAA 1WLDA 2ZGOA 1WA4A 4C0BA 2JECA 1D5VA 1UG2A 1XMAA 3AG1H 2M7BA 3ZN0A 1J1TA 5T54A 1FBUA 2Y9YA 3WGHA 3ZDSA 1GVJA 1AYN1 1LDJA 1UOFA 2R7UA 1AR63 1SEUA 1V4RA 2Z2SB 4PLNA 1MMAA 1RUD1 5HBAA 3OD0A 1Q8OA 1QXPA 2XH6A 4LE3A 3KX2A 4LITA 2LKPA 4IGPA 3MI8A 5J48A 1KITA 1YFUA 2JUGA 2W87A 3GO5A 2ADUA 4QQLA 3VLBB 2ME0A 3V8KA 2EFWA 4RB0A 5B5EC 1X3ZB 3POYA 3D4KA 1AR62 4XLPF 2H94A 2O8OA 4IGOA 4O61A 3PQJA 1HKSA 2WSUA 5LA9A 3JB4C 3AM2A 1ETKA 2D1HA 2AREA 2KKOA 5F2WA 1W5CC 4XAAA 3USUB 5C4WB 1AR73 1M06G 3OWTA 1H8TA 3HHHA 3GALA 5I8TA 1ERDA 3GM8A 1ZR4A 2KIFA 1WGXA 5EF6A 1VPHA 4QXBA 3HEIA 4KMUX 4IEUA 3TP3A 2QDRA 4CU7A 1NY71 1V0AA 3A7QA 1O6UA 1YE9A 2TEPA 2HZDA 3BYWA 2QUFA 2E32A 3Q9OA 5J4VA 2M9HA 4OLLA 4FPJA 1XCVA 4P9WA 2PMWB 5DG1A 4RLQA 4A0ZA 2JE8A 4DZJA 4KIBA 2STTA 3IDAA 3X29B 2G1MA 1BMV2 4X0GA 2DW4A 3M1HA 4C30A 4V2GA 3R4KA 1ETXA 4WM7C 3G3ZA 4TXWA 3WE2A 3PURA 4NAMA 2KMUA 1EYBA 3T8TA 5D6FA 3RPQA 3HN1A 1PDNC 3TRSB 5CB7A 2GDFA 1GKBA 3HYIA 1XU1A 4M6VA 5FWEA 3K4CA 5A7SA 5EG0B 3VBUC 2JTVA 4JX4A 2WFF1 4UAPA 4QHBA 1YW7A 4G12A 4AD9A 1ZBE1 4UFJA 2HWF3 2EZIA 2DO7A 3D3AA 5FBJA 4EN6B 2EFNA 5TSWA 1LOFC 1JXNA 2B39A 4XEZA 3BWGA 3CCUI 4QXKA 1H8VA 2VC0A 4MADA 3MPPG 2OU2A 3KCCA 2R7VA 1H9PA 2VQCA 3O2PE 3W2VA 4A7KA 5BY5A 5KWRA 2BRTA 2XAFA 1B35B 2A71A 2HWF2 1G9DA 1CZSA 1WCMJ 4MO3M 3TDZC 1OQ1A 3MKZA 5A3OA 4BKXA 1CAWB 1XPWA 4EVIA 4Q0VA 5D21A 2CQQA 4YZ4A 4MFEA 1NLQA 1WD3A 1W0NA 5C70A 2IS1A 3OY8B 4HOOA 1Y9MA 1SVOA 4MYEA 4YELA 4DZPA 5KCMA 3OEBA 2FCUA 3A23A 1QO0D 2NOGA 5BUVA 4IO9F 4XFAA 1UMHA 1RMU3 3ATGA 3IH4A 2ZACA 1R1UA 4YG6A 3J7MA 4PJMA 4AXOA 1QWRA 3PUSA 3K9TA 2BGOA 5FQ0B 4BACA 4GWNA 3PU8A 4XKWA 5DN2A 2EINH 3BTXA 3Q8EA 2H8RA 4PIZA 1RMU2 1JJ6C 1W6QB 5GP9A 1J75A 1HRV1 3MWMA 1LTEA 1ORKA 2J1VA 1F1ZA 3VYSB 1W6NB 5DXDA 3OR1C 1CPNA 3O0VA 3BU7A 2A6ZA 1OOPB 1RI7A 2F6BA 3ENRA 2O14A 1RUH2 1RUI1 4XLFA 2W94A 3ERED 2A61A 1S8NA 4HVQA 4QXHA 1COV1 5FY9A 2R073 4WM7A 4RB1A 3I58A 3UYJA 5CFCA 2ZGKA 3MFCA 3ZLIA 4ZZ8A 4FAGA 1QMJA 4CO8A 4IV3A 3WODF 3AL0B 1VALA 4ZDOA 5GAGJ 2DA2A 3CCRI 4Q0QA 2R072 3RVHA 3C8XA 3VBUA 3NRUA 2FMDA 5FZ8A 1P4AA 2XHNA 2O1QA 3MZYA 2WSVA 3I7DA 2E5ZA 3TN91 2JDYA 2VT3A 4KICA 1LOFA 1EUUA 3KZYA 5C9AA 2RV9A 2H09A 4HDUA 4BZ4A 3ALQA 3FK6A 4EV0A 1H0MA 2TUNA 3JTGA 2M7AA 2YSRA 3C3WA 3BU0A 4HFSA 2N8GA 3QOEA 3AYDA 2WS91 5GZGA 1V3FA 3ZR6A 4IPAA 4XICA 1S7AA 3V4GA 3I3EA 3ESWB 1YJKA 2WTEA 2VJXA 5KC6A 5FZ4A 5DCMB 5TISC 3KV5A 1IQDC 4FX4A 1TVGA 2FUG2 3WD5A 5LEKA 4Q4W3 4UFHA 3WEZA 4QGNA 3WNKA 2JDHA 4AYBA 2FRHA 4QXCA 4HBLA 1SANA 4MHGA 2Y31A 1WVRA 4QLCU 1PVC1 3I59B 5I0UA 4CH7A 1W6PA 5IK8A 5GTHC 4G9SB 2OIIA 4IEJA 4Q4W2 4YLZA 2Q5TA 1MJ9A 5A2QK 4K1ZA 5H20A 2XSJC 4LHKA 3PO2J 2P2KA 3G1LA 5E3NA 3SCHA 5A3UA 3DYOA 4EJTA 4BXFA 4H7LA 5GLTA 2JUCA 3VYTB 1LAJA 3NKGA 1UY3A 3ZFEA 5I8SA 3LFMA 1GP4A 4LOCA 3IC7A 2HQNA 5EEGA 3VD4A 3P9KA 3J80K 2L7MP 3ZYPA 1QJX3 5FUPA 5IVYA 3LEGA 3AP4A 5IYBJ 1FAYA 2O0OA 1FMVA 3GXUA 3KQ4B 2K3PA 2CFOA 2JA7J 2XONA 4JDNA 2DJIA 1W9SA 5DD8A 4RHV1 1Q56A 1QNTA 1VIWB 1WW5A 3GZTB 1AYM2 4M9ZA 5LY2A 4D5CA 2JRTA 4BXSV 1ULFA 4FCYA 4HX8A 3FLRA 2PEXA 1QJX2 2OTJI 4Q1PA 3MQ0A 4PLMA 4Q5OA 4AVPA 2Q8EA 4AI0A 3ERMA 1J58A 3QPSA 5GKAC 1KQ0A 1MBGA 2BXYA 3CCYA 2UY9A 1L3LA 5BNOC 1TEIA 3MUY1 1MNEA 2AACA 1J1LA 2D6NA 5C5UA 2QZ3A 2VZUA 5ICCA 2CSGA 1BOAA 3ZSJA 3OGJA 1R7JA 2ZNYA 2J42A 2K9SA 4LHSA 1NQJA 4HBNA 1EKEA 3M3OA 2VZ3A 2BOJA 1SHWB 3K2ZA 3QACA 3LPGA 3VBRB 2VBWA 2DTWA 3U1DA 2KJBA 2IXHA 4UI9L 4E8DA 1MSEC 3CJIC 3I4IA 3RRDA 1LOAA 4LMYA 5IOYA 1W8FA 3WF2A 1UZCA 1FT9A 2YBSA 2RE9A 3F6OA 1F5TA 5HVQC 1JZ3A 3I53A 1PGL1 4HW0A 1AR91 5FO8B 5FLHA 2EA4A 2FBHA 1MS8A 2JKXA 2JDAA 5DAXA 5A6QA 3OYBA 5EGOA 6PAXA 3M8FA 1DPUA 4Q26A 3AZVA 3WW3A 3K10A 3MN2A 1IQAA 2Z4FA 3K48A 4XJUA 3WDVA 4UNOA 3TEZA 3OCPA 1C5HA 1B4AA 4J00A 1W90A 2PHDA 4XCAA 2LKXA 1QHHD 2BU9A 1WLWA 2XSDC 4Q4X3 3VEPA 2HKOA 5C4XJ 2F4PA 3CDIA 1S72I 5FY8A 1ZRRA 1I1GA 1YIJI 5FLMJ 2HDDA 1RUD3 2RJ2A 2G7UA 5L73A 1WMFA 3SEZA 2EIGA 5H6RA 3KEYA 2KP6A 2P81A 4MO7A 1PO21 3MAJA 3T3YA 3ZMNA 1K78A 2Q2EA 2VOOA 1I3AA 4Q4X2 1AYN2 2ME6A 3PNAA 1B8IB 3B01A 1WJAA 2QQUA 4E7KA 3FC0A 3MW3A 1RUD2 3GTKJ 3M9AA 4A2UA 4V1PA 2A6HF 2ZGPA 1ETQA 2IGMA 5F3IA 5FD6A 2CUJA 4CCDA 2HS5A 3U75A 1B72B 3W3CA 1RYYA 3HSRA 2D5VA 4XUNA 3EETA 3L2QA 2EH3A 1IN7A 4A3IJ 5L7OA 1YC61 3H9GA 4IRGA 1H9GA 4AI1A 1YJWI 1A6QA 1XBFA 1T0FC 3FUQA 5HDNA 2CJJA 2VOWA 2QQIA 3R0AA 1S0BA 5EIYB 1VMJA 4OHVA 2BE5F 1KU9A 2NYXA 2IZWA 4V19K 1WMXA 2L4AA 2MBFA 3PNYA 4XLNF 4ZHNA 1ZAOA 4BS9A 3O3KA 1LHWA 3K75B 1KGSA 2XLAA 1HJGA 1Y8QB 3Q9SA 5FXWA 4AVZA 3OL4A 4DYRA 1LE8B 3RJPA 1KU7A 3KVBA 5IVCA 1NY72 2VZTA 3OOPA 1XU2A 3FLPA 5D4SA 4HQEA 2ADDA 2XOMA 1VBC1 3ZQGA 1YI7A 1PO13 3CJIA 2AXLA 4QMAA 2IWGB 2XF5A 2XLGA 3F6VA 3ROUA 2ENRA 1O3SA 1A36A 1TE1B 4RA2A 5K0UC 1BOBA 4UOJA 3GTGJ 4R9CA 3I3MA 1IRGA 4IHTA 4I01A 5DDGA 5A3NA 5JSPA 2AR6A 4OMYA 1SD4A 4R9BA 4CCLA 2E34A 1VFCA 2OQRA 5F32A 3W21A 1ZBE3 1O7LA 4DY3A 2DVAA 2ZJRF 1DQ2A 1VTNC 3EYPA 4QU2A 2UYAA 4YW5A 3FFQA 2R7TA 1F4KA 3V7CA 5FXZA 5A80A 2PMZN 4N0BA 2D45A 1V6MA 1RESA 1FY7A 1ULDA 4F3JA 2WAQA 2LREA 4AGVA 3PJYA 4JHTA 2Y34A 1J3PA 2GWRA 1S4CA 3GZAA 1ZBE2 2FZ1A 3ABZA 4XBLA 2LR8A 4F7ZA 3T0YA 3AFHA 3WP4A 3FXQA 4DXTA 2DLLA 5JPMB 4IQJA 2XASA 3J7YJ 3I2OA 1WLCA 1TQIA 4BYYA 3DPLC 3UJQA 1CAVB 3LFIA 1Y7BA 3QPTA 3EPZA 3AP5A 2ET7A 3BTZA 1X36A 2CYFA 4ABZA 5HNHA 4HPKA 1Y56A 4CUGA 3L00A 2HVSA 1GHCA 2R16A 5FZHA 2VUAA 4OUSA 1UPSA 4N9IA 1CD3G 4H0EA 1XSXA 1IV8A 2BUKA 1GLNA 1Y1VJ 3DEWA 3L2HA 3CZ6A 3MW4A 2FCVA 4C2TA 2IFRA 1O5LA 1YCIA 3M4FA 3BIWE 3HUGA 4ZYGA 4I6ZA 3OY9A 1TNSA 4RFRB 2WAEA 2YPDA 4IRIA 4QB1A 1U5TB 1PNGA 2C9KA 1W6MB 1OH3A 4GDFA 1W28A 4HYEA 5FPXA 2WYSA 1MEC1 1HRV3 4LD5A 3SCGA 4N90A 3S1RJ 1RUG1 3N9NA 4N4OB 2NYYA 1JUIA 3AZZA 2E63A 1YQCA 2ATFA 3DYPA 2CWSA 5D5WB 3P3NA 1LFUP 1J9IA 1HRV2 1W9FA 1VF9A 5C4WC 4ASLA 1DGLA 4HOBA 1COV3 1DQ6A 4IEWA 4N8MA 5FZEA 3ZX7A 5EEHA 4E6KG 1ZZ6A 2FBIA 4J1XA 2QE3A 4WM8B 1ZYBA 1RUI2 3DPTA 2MPFA 2PHRA 5K0UA 3D82A 5SV5A 1UY4A 4ZZDA 3UKTA 4BQQA 3NAPB 3GFIA 1H1AA 5FPUA 4I09A 1DU3D 1COV2 4LLFA 4XLCA 5FZ0A 5JLWA 1G2HA 1Z1DA 3K4AA 2D5HA 3LNQA 5JIAA 4ATFA 2ZKLA 1RKTA 5FLJA 2CQXA 3H7JA 3TN93 5FKMA 1SD7A 1WD4A 5EXOA 2W52A 1MS5A 1JW6A 1IJWC 2XROA 4J19A 2GMMA 2XPJA 4CZSA 5C3OA 2ZABA 3CO2A 4FE7A 4M9XA 5FLVA 3VYUB 2Q8KA 3TN92 5LK7B 4KWLA 3RDIA 3SHFA 3MIEA 5DM7F 2CUZA 2E51A 4UV9A 3ZQIA 1D2SA 4YVSA 3N35A 1W5SA 4A6SA 1UU5A 2RKHA 2Y64A 3U4XA 1IG3A 4K1YA 3IAS2 3KB5A 3HTUA 1R6RA 4CCKA 2WS92 3KCXA 3HPNA 1G59A 1POQA 2J22A 1PVC3 2WT0A 3CEWA 4YEJA 1LOCA 2HOSA 4CU9A 3DEUA 1UX6A 2GC3A 4N43C 3DTEA 5FY5A 4HV5A 3TOBA 5C6CA 1OLRA 3ISPA 2YMZA 3T8RA 4DUXA 4YNIA 2IS6A 1B35C 1PX4A 1ND3B 4MTDA 4PLOA 1RUC1 1PVC2 4PF1A 1IS5A 3K51A 5FRAA 3KWVA 3TYJA 4XRMA 2GH8A 1CR7A 3I49A 5FB2A 4EN7B 1LQ1A 2L4MA 4FTSA 1ETYA 2E7AA 2PHWA 3HOUJ 3WDUA 3SXWA 4U0VA 1UW8A 4XN3A 1GWLA 4S2FA 4RN5A 3K6GA 5DCFA 1ZLKA 3SFZA 1KEXA 4QHZA 3N05A 3GTPJ 2JG8B 5HODA 1R083 4OHXA 2FDIA 4AL9A 2VUMJ 2Y48A 3K4BA 4JV4A 4RHV3 5JZGB 4XSZF 1HA8A 1I5PA 1X9PA 2R0HA 2BOIA 4CYCB 1BBYA 1DGWX 3DPRA 3J7LA 4H3WA 2CDOA 3L2CA 2JZYA 3WG3A 4MXWA 1B09A 9ANTA 3IH3A 3GF2A 1SAUA 4ENJA 3GNEA 4AEMA 1BQPA 1GZWA 1R71A 1UNBA 3SDBA 4AFAA 1ZZ8A 2LUWA 5A1FA 1LHOA 3U11A 1WI3A 4UHTA 4RHV2 2C4XA 4BAYA 5IVJA 1FP2A 1GICA 5T50A 2DI3A 4KISA 3TEYA 2PN5A 4BJ5C 1OOPC 3S2WA 5CISA 2ERFA 1X4PA 1FTZA 3DBRB 1J83A 1RZ4A 4AHZA 3HBLA 3LSGA 3MO4A 1SLAA 5FUNA 2VW2A 5ABJB 4O7XA 2QQJA 3A0KA 1G86A 2LRDA 5C4JJ 2VMIA 4OIRF 4WVVA 1TBXA 1LESA 3DUIA 5CFDB 5FZIA 1JYIA 4L99A 3H3LA 3RYRA 3M3EA 2PFBA 1JKQC 4LO6B 3VZLA 2Z99A 1ND2A 4OZXA 1IS3A 3NV2A 4W6XA 2WR9A 1YO5C 3CUQA 1QRYA 1AR93 4D7TA 3JRIA 1DHKB 5KHJA 2CV2A 1QEXA 1D0GA 5GTIC 4MX3A 1WHUA 2NP0A 4JBAA 2KA3A 5E1ZB 1NA1A 1SMYF 4MXVA 2P5VA 1APNA 3UNGC 2G19A 3ITQA 2XB6C 4O65A 1VAKA 2HJIA 3RYPA 2VUJA 1RR8C 2GSYA 1PGL2 5GZEA 1R1TA 1CIWA 2K5CA 1AR92 1DGRA 1UD1A 4BQ1A 1SLIA 2UZKA 2MHFA 3NO8A 1WH5A 1G8WA 3IP4B 1T6GC 2NNNA 2B9UA 1GV5A 2BPA2 5AVPA 4MHRA 3V7SA 4MGZE 3E97A 4BE2A 1PO23 3K46A 2V9PA 5I0RA 4RQPA 2IVMA 5LEJA 5LCWL 1Y39A 3WQ1A 1T2KA 1K6OA 2HOTA 3N9LA 5IYCJ 2LF7A 3OY8A 4MV2A 1ODNA 2CG4A 1FYUA 1LECA 1MMDA 1GDTA 3UGGA 4P96A 3FIWA 2YXSA 2VCMA 5DUVA 3G73A 1PO22 3LAGA 3ES1A 5FPVA 2PX9A 2R7RA 3QPHA 3PUQA 4I76A 4QPGB 3SH4A 4ET7A 1X3WB 4CDQA 2HEWF 4RDUA 2XUEA 5FYUA 1O3RA 5FQ0A 5KXCA 4Y20B 2E5NA 1Z7S3 3AVRA 2OF7A 1UWWA 2X1DA 1E57A 5IPAA 3D1NI 1N1SA 3T09A 2DFBA 3VDAA 4H55A 4KA4A 1EAH3 1W6QA 3TNPB 4XMIA 4IE0A 3PNTA 4AEDB 1R9TJ 1W6NA 1FBSA 4NWVA 3GTQJ 3HOWJ 4GJYA 1OOPA 3OF1A 4AG4A 4OIQF 4EWEA 2P3JA 3M1CA 3BGAA 2OCEA 2ISZA 4C3IJ 4GRIA 3VFZA 2WLPA 3IB3A 5HS8A 4PI0A 3VBSB 1C8M1 3A0BC 1X3UA 3FLTA 2K85A 5HCHA 2BY1A 4AFMA 4DY5A 4CRQA 3OEAA 3S16J 1LPQA 4DYCA 5HOOA 3OSGA 4K8FA 3VBFC 3ZKUA 1I39A 3WTXC 1CPMA 3AMQA 3MMYB 1PMHX 3WHBA 5A6ZA 1DQ4A 3HGGA 5L9VA 2WAOA 1VBC2 4YZ3A 3MZHA 1USSA 2OUMA 1RINA 4E2GA 3K2AA 2ZAAA 3AYEA 2BEOA 2ZSIB 3W59A 3CCQI 2QKLB 5IK5A 1A6IA 1R1VA 4YG0A 3FXLA 3NWTA 3RSJA 1V6JA 1YFYA 4QWNA 4ZJZA 2BYVE 4QM8A 4Z8BA 3FHAA 4XFGA 2D98A 3P3PA 3GVAA 3IMMA 2RQPA 3VBRC 3GZNB 2MABA 5HV4A 1IRFA 2P7CB 3MDPA 4PSXA 3TQNA 2UU8A 1RUJ1 1EV13 4XJAA 3IMNA 1HW1A 3SFIA 5FMDA 2PMHA 3B69A 1NCRB 3ZQ7A 2ZMLA 1NAEA 4IEPA 1F35A 1OFNA 1ENHA 3ZQQA 3W20A 2ORXA 4D8MA 4DEVA 4MGTA 4MEYF 3GTOJ 3O1SA 1XN7A 1WFXA 3FBIB 3Q0UA 4LFUA 4G7OF 1B59A 1KQ8A 4G9YA 1QH6A 2E1MB 5LHHA 4RLFA 2VC9A 3I59A 3RQ4A 3S32A 2BWCA 1U0AA 4CU6A 1BC8C 4M3BA 2MLGA 1F31A 1W0PA 1LEBA 4YGDA 5FK7A 2LP0A 4A5NA 4B4PA 4JVAA 4JHZA 2VKEA 1GQPA 2V7FA 4ETSA 2VCAA 1REFA 1TWAJ 2Y33A 4RD7A 4FOYA 1FP1D 2PJPA 2MC3A 1SC7A 4XLEA 1GNZA 1YTYA 2ZGUA 1W6OB 1W2UA 1GP5A 3Q9VA 1MEC3 1SFNA 4JX0A 2BV4A 1LVAA 4BU2A 1RUG3 4L2NA 3FXKA 4ES9A 5GM0A 1NXD1 1W8WA 1MZEA 2DVBA 2ZBKA 3R0JA 5CU1A 4GKYA 1TT0A 1WH7A 3F8BA 2ARBA 1D8JA 4E7SA 2Z69A 3FDYA 4K40A 1MEC2 4FASD 4W65A 2DYCA 4F83A 1RUG2 3PDQA 1HW5A 3ZMOA 2O5RA 3JCUC 4MNUA 2JPCA 4DUVA 3TAYA 1MR5A 3OPWA 4CCOA 1P8JA 3ECOA 2YBPA 4ZH4F 4NO4A 5IK4A 1TMF1 1XE8A 4QPQA 1OMIA 4FFIA 1V6IA 5A33B 4ON0A 4LK1F 1Z0XA 3HT2A 2DTRA 3U07A 5DD4A 2QSGX 5JI9A 5IHRA 1VRH1 1J2XA 4Y5SA 4G3YC 2BVBA 1PX3A 4R9DA 3KSCA 2E2IJ 3BPSA 3KS7A 3PUBA 4MFDA 4CEYA 4CDWB 2X6YA 3PMEA 1NG0A 2CUEA 2ZHMA 1UX7A 1YX3A 1AF9A 2EPFA 2VM9A 1WGPA 2R4GA 4MGQA 2LS6A 1S3JA 1SBEA 2DN0A 3OS1A 1ZH5A 4WVZA 1OUXA 4E4HA 4GWIA 1QHGA 1TWHJ 2B5HA 5J7MA 1S55A 4WVMB 4IDZA 2ZO4A 3ZYJB 5JHUA 1KD7A 1T39A 1HXS1 2PFWA 1DGRM 4OQ9A 2O8QA 2JDKA 3MLJA 2P5BA 3HRTA 4QM9A 5K7PA 1O59A 1IGOA 1T56A 5L9RA 2MLKA 4IEXA 1D2QA 3WT3A 4M3CF 2VTFA 1MS3A 3B93A 2JDNA 1POV0 3ZXJA 5F5QA 2GQQA 2IJLA 2OA2A 4DJAA 2HXIA 2JSPA 5L3GA 1IXCA 1IUYA 3D5OA 5BNNB 2JENA 3V64A 4P9JA 2JB8A 4FPLA 3ONQA 3PMSA 2K9ZA 4TZDA 1B1BA 1WJFA 2DA7A 3CMAI 4Q5SF 3S1NJ 1OLME 1LHNA 2JMWA 4AAPA 1VBB1 2ARAA 4KFCA 4BQ3A 3BY6A 2PN6A 1UIJA 2IXKA 4YW7A 3L7WA 4PCQA 1UZYA 2XIGA 2ELJA 2WFPA 4UB8C 2H6CA 4IKFA 2XUBA 2KZGA 2PLV1 2EVXA 3QP6A 1RUC2 3N36A 3H5AA 3HEFA 2ELKA 3PSIA 4LG0B 4B44A 3ZN1A 1W8OA 4XORA 3LWCA 5EJ3A 1UZ0A 3ASIA 2QLZA 5D8LB 2RNJA 1LFBA 4GH4B 1U5TC 5FMCA 4EROA 5C8CB 1QQP1 1UCRA 4AR2A 2YUSA 2AHQA 3AMHA 1W04A 1YQAA 3HPGA 5FKBA 5FUIA 2JSCA 4FX0A 4HETA 3PVBB 5EFUA 4R1HA 2VTXJ 3GJBA 1UMZA 3Q5FA 1JKRC 1HX6A 3HRUA 1NG6A 1LE8A 3ZN5A 2WNUA 1IAWA 4MVTA 4LBLA 2FSWA 4RS8A 4NC6A 1WUVA 4LOSA 1QZYA 1QF3A 3W58A 3GCWA 3H0DA 1VAVA 4WM8C 3BR0A 4CDUC 4FPYA 3H50A 5BNPB 3DCFA 2DK5A 1AA7A 3NAPC 4IEQA 4LJHA 2QZ2A 3KT7A 5FP4A 2FDGA 3WDXA 1ZLJA 3JRFA 1QKQA 2RDPA 3BCWA 1C3HA 4Q48A 2F5CA 2EA7A 2YB7A 2DURA 2MYSA 5HCAA 3KF3A 1CIYA 1LCLA 3V0AA 2QVSB 2P6CA 4FI9A 3GFJA 1WKMA 4RS5A 3OS2A 2H1KA 3S3OA 5T5OA 5A7PA 2W25A 2V79A 3N7MA 2WWYA 2VMHA 3PVOA 2PBIA 2HWB1 4W8JA 2WWUA 2E71A 1CAUB 3BOWA 3RPUD 1X50A 2ZTNA 2JPBA 2A6WA 2LSOA 2WV1A 3L2VA 4KIFA 4PIYA 3SXYA 2R7ZJ 2G9ZA 3HWJA 3OGSA 4BM8A 3RZDJ 1JTZX 1ZGJA 2BNNA 5FZ9A 4CCJA 1BI2A 2IA2A 4V2VA 4YIRX 1S7EA 4KYWA 1LNSA 1K5MB 2BVVA 4CDXA 3EUKL 4AHYA 2ZXJA 3WSOA 2OA4A 3S57A 3PM1A 1QQIA 2JT1A 3CCVI 3KLSA 4WZCA 2FDFA 2GMPA 1P7IA 4BISA 1ND3C 2F5VA 4UWDA 5JOWA 4RB3C 2AC1A 2D3SA 1PIV1 5FP8A 5C3EJ 3EYYA 5EYRA 3H8XA 2W0XA 4Q4V3 3O1PA 3WY6A 1QNYA 3U1KA 2ESHA 1F9KA 3OSDA 4ATEA 1I50J 3O12A 1FNNA 1ZX5A 5FYYA 5LASA 2JG8C 3E3VA 4LK6A 1S29A 2CNAA 1JBCA 1BIBA 5FRNA 1TNFA 1VQ8I 1IO2A 4XMAA 2QQWA 1FYKA 3AXDA 1J7KA 2LNBA 2KJCA 1NLRA 1PUFB 2PXJA 3HG9A 2WYFA 2QA4I 2HFHA 2VNVA 3T0AA 3GFLA 1U8RA 3WDWA 1JGGA 2GC1A 3GUDA 3V0BA 1YLFA 2VPRA 1UO9A 2W1SA 1A3KA 4A12A 2BW8A 4AFDA 2IC1A 1HF0A 1ZZ9A 3N7KA 3OGRA 3RJRA 1B9MA 5GAEJ 2R7DA 5C3RA 2B63J 3RI4A 4DOZA 1ENXA 1OLQA 1ZBA1 2BZTA 1XNDA 1MMNA 3GHMA 1UQXA 3OG2A 4W50A 1P2FA 1IXSB 3DBHB 3H5NA 4NRQA 4P5HA 3F22A 2PA7A 4CEWB 4OU0A 4XQWA 3AG3H 5FYBA 1JTXA 2MSYA 3I8TA 4XOPA 2RC4A 1Y3TA 3UK9A 1IS4A 2P5KA 3S17J 1RUJ3 5KXBA 3MIHA 3RZOJ 5CFDC 1SFKA 1P9QC 5FZ7A 2GXAA 3ZSEA 2E9QA 3R6SA 2L9RA 3DECA 2VZOA 4LR4A 4B47A 3KEQA 5M3FJ 3FZVA 2E1OA 4XK4A 2GOXB 2F5FA 2XDVA 2W08A 5A3WA 4DB5A 4A6DA 2KDZA 3F0CA 5DDJ3 3TO7A 2RMU1 1RUJ2 3M8EA 5FD5A 4YM2A 1Q8SA 3KP7A 4ITCA 3VUOA 1OJLA 2BFUS 5IAVA 3IV5A 5GZCA 5CIRA 3J7AO 3MGUA 1D0HA 2RDSA 4QX3A 2PMUA 4PJJA 3DTKA 2DCZA 4EJWA 4TLFA 4A4AA 2Z16A 3FJSA 1JZ7A 2TRTA 5F9TA 3LSJA 1EH6A 3NNGA 3ZPYA 4CXYA 4QQ2A 2QF7A 1JZ5A 3B5LB 2UXNA 3ZM8A 2BBYA 2NRAC 2K46A 1K7AA 3S6PA 2BOLA 3DQVC 4G6QA 4S05A 2FDHA 2RM21 1Q1VA 3SEPA 2UYBA 4CTEA 5FZMA 1TQMA 1UFMA 5DZEA 1A6CA 3RSNA 1RTVA 5SV8A 4DBRA 3BG3A 2Y6JA 5T3NA 2XRLA 2JG8A 4NIGA 1ULOA 1MW7A 3AL5A 3TO6A 1CJPA 3MIDA 3CLPA 5F39A 2FDJA 3LGRA 3ZFGC 2L02A 3HOBA 3JD71 5JZGA 2F5EA 1SCSA 2KDOA 3CDLA 2NVQJ 1ZARA 4RGSA 3WP6A 2VBZA 1BL0A 1MZBA 2Y0IA 4LGWA 4JTNA 3OJBA 3M7GA 1TMF3 5CKMA 5IFTA 5IATA 4K2EA 1OYWA 4QTRA 4AEDC 2COBA 1XOYA 5F37A 5C71A 4RFT0 3F8FA 2NZ9A 2LRPA 5JXHA 1VRH3 4LLNA 3BG5A 2DK8A 1BC7C 2ZMNA 1TMF2 1DDLA 5ABJA 5HLTA 4N53A 4Y5TA 4HSRA 3S1MJ 1VRH2 4NPMA 3RI8A 3EQEA 2RJLA 5FROA 3JZVA 4LJZF 2OS2A 4JK1X 4RAFA 4L9JA 4CGZA 4IUGA 3MBWA 4D7MA 1SFYA 4XRFA 4XHBA 4GYIA 4M3CE 2H1LA 1IN4A 2WV0A 2J1SA 2PAEA 2Q4SA 3O7OA 4L9VA 1I3QJ 1FATA 2YC0A 1YQ6A 2XAQA 3KYDB 1UZZA 4I30A 4YM1A 4XFCA 3MLLA 5EDNA 3JRHA 1LULA 4PGGA 5HI0A 2ZFUA 3Q8CA 1S6LA 1XSVA 1Y8RB 4QX1A 4HLXA 3CLOA 1TME3 1UG0A 4AYBN 3N9PA 3UV9A 3WXPA 4XOTA 1XX5A 2MW8A 2DVDA 2XAJA 5KVRA 3ZMTA 1HW2A 4U7DA 3MIGA 3SKJE 2VQUA 2CFXA 2E7QA 1U6GA 5C3SA 4B09A 1DP3A 1CX1A 1XC6A 4M71A 4EQQA 1USTA 4FQGA 3DKYA 2NVUB 3QD6A 1GUUA 1SG3A 4BPZA 2VT2A 1JI6A 4QQPA 1HLVA 5CFCB 4D7NA 4A3ZA 5FY7A 4AVBA 4BB3A 4KWUA 1FWZA 5HPOA 5L9BA 3AZYA 4IV3B 2E1MC 2A6TA 4H14A 3RWKX 4OMCA 4RGXA 1VBB2 4QPGA 4COUA 5BPXA 2UWMA 4Z2AA 4NHMA 3GWZA 1VQLI 4O3MA 3AB0A 3KLOA 4FOVA 5FZ1A 3VB9A 2HYXA 3BG9A 3RTRA 1VP6A 3OMYA 2FD8A 4HK9A 2QQLA 3H9AA 1I27A 2PLV2 1SACA 4DNYA 1T38A 2E31A 4PBOA 4OQ8A 5C9AB 1UU6A 1J84A 3T1LA 2R7XA 4Y24A 4L9TA 5I0TA 3ZXDA 2QCSB 3ZKYA 4GMP1 4UB6C 1LDKB 3WNPA 2C6SA 4YIIA 1OCOH 1DLLA 2HTSA 5B3SH 4FP2A 2V5DA 3VBSA 3LSHA 2IVJA 1XNAA 2OPWA 1QQP2 3NAUA 2MGQA 3BG7A 1NT0A 1UXZA 1HJFA