3LA9A

Crystal structure of the trimeric autotransporter adhesin head domain bpaa from burkholderia pseudomallei, iodide phased
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
167
Chain Sequence
STSISSITTNTTNLGNSTAAALGGGATYDPATGAISAPSYTTYNANGTTATNTSVGAAIDNINANGIKYFHANSTDPDSVATGTNSVAIGPNAVANVDYSVAIGSGATTSAAVPVASAFGGFAGSAPIGVFSVGAPGAERQITNVAAGRISAASTDAVNGSQLYATN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haemagglutinin family protein
publication title Structure of a Burkholderia pseudomallei trimeric autotransporter adhesin head.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transport protein
total genus 38
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 2010-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3la9A00
4I35A 1H71P 2Z8ZA 1GO7P 3ULTA 3A70A 5CVWA 3WP8A 2ZJ7A 1OM6A 1SMPA 1K7QA 2QUAA 3HBVP 1GO8P 3VI1A 1O0TA 3HBUP 1K7IA 2XQHA 3LA9A 1KAPP 1SRPA 2ZJ6A 3A6ZA 1AKLA 1OM7A 3HDAP 2YO0A 2AGMA 2Z8XA 3HB2P 5D7WA 3U1RA 1OM8A 1O0QA 1SATA 5CXLA 1P9HA 2QUBA 1AF0A 2YO1A 1G9KA 1OMJA 1JIWP 2ZVDA 2ML2A 3NTNA 1K7GA 3S6LA 3LAAA
chains in the Genus database with same CATH superfamily
4I35A 1H71P 2Z8ZA 1GO7P 3ULTA 3A70A 5CVWA 3WP8A 2ZJ7A 1OM6A 1SMPA 4DT5A 1K7QA 2QUAA 3HBVP 1GO8P 3VI1A 1O0TA 3HBUP 1K7IA 2XQHA 3LA9A 1KAPP 1SRPA 2ZJ6A 3A6ZA 1AKLA 1OM7A 3HDAP 2YO0A 2AGMA 2Z8XA 3HB2P 5D7WA 3U1RA 1OM8A 1O0QA 1SATA 5CXLA 1P9HA 2QUBA 1AF0A 2YO1A 1G9KA 1OMJA 1JIWP 2ZVDA 2ML2A 3NTNA 1K7GA 3S6LA 3LAAA
chains in the Genus database with same CATH topology
4I35A 1H71P 2Z8ZA 1GO7P 3ULTA 3A70A 5CVWA 3WP8A 2ZJ7A 1OM6A 1SMPA 1K7QA 2QUAA 3HBVP 1GO8P 3VI1A 1O0TA 3HBUP 1K7IA 2XQHA 3LA9A 1KAPP 1SRPA 2ZJ6A 3A6ZA 1AKLA 1OM7A 3HDAP 2YO0A 2AGMA 2Z8XA 3HB2P 5D7WA 3U1RA 1OM8A 1O0QA 1SATA 5CXLA 1P9HA 2QUBA 1AF0A 2YO1A 1G9KA 1OMJA 1JIWP 2ZVDA 2ML2A 3NTNA 1K7GA 3S6LA 3LAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I35 A;  1H71 P;  2Z8Z A;  1GO7 P;  3ULT A;  3A70 A;  5CVW A;  3WP8 A;  2ZJ7 A;  1OM6 A;  1SMP A;  1K7Q A;  2QUA A;  3HBV P;  1GO8 P;  3VI1 A;  1O0T A;  3HBU P;  1K7I A;  2XQH A;  3LA9 A;  1KAP P;  1SRP A;  2ZJ6 A;  3A6Z A;  1AKL A;  1OM7 A;  3HDA P;  2YO0 A;  2AGM A;  2Z8X A;  3HB2 P;  5D7W A;  3U1R A;  1OM8 A;  1O0Q A;  1SAT A;  5CXL A;  1P9H A;  2QUB A;  1AF0 A;  2YO1 A;  1G9K A;  1OMJ A;  1JIW P;  2ZVD A;  2ML2 A;  3NTN A;  1K7G A;  3S6L A;  3LAA A; 
#chains in the Genus database with same CATH topology
 4I35 A;  1H71 P;  2Z8Z A;  1GO7 P;  3ULT A;  3A70 A;  5CVW A;  3WP8 A;  2ZJ7 A;  1OM6 A;  1SMP A;  4DT5 A;  1K7Q A;  2QUA A;  3HBV P;  1GO8 P;  3VI1 A;  1O0T A;  3HBU P;  1K7I A;  2XQH A;  3LA9 A;  1KAP P;  1SRP A;  2ZJ6 A;  3A6Z A;  1AKL A;  1OM7 A;  3HDA P;  2YO0 A;  2AGM A;  2Z8X A;  3HB2 P;  5D7W A;  3U1R A;  1OM8 A;  1O0Q A;  1SAT A;  5CXL A;  1P9H A;  2QUB A;  1AF0 A;  2YO1 A;  1G9K A;  1OMJ A;  1JIW P;  2ZVD A;  2ML2 A;  3NTN A;  1K7G A;  3S6L A;  3LAA A; 
#chains in the Genus database with same CATH homology
 4I35 A;  1H71 P;  2Z8Z A;  1GO7 P;  3ULT A;  3A70 A;  5CVW A;  3WP8 A;  2ZJ7 A;  1OM6 A;  1SMP A;  1K7Q A;  2QUA A;  3HBV P;  1GO8 P;  3VI1 A;  1O0T A;  3HBU P;  1K7I A;  2XQH A;  3LA9 A;  1KAP P;  1SRP A;  2ZJ6 A;  3A6Z A;  1AKL A;  1OM7 A;  3HDA P;  2YO0 A;  2AGM A;  2Z8X A;  3HB2 P;  5D7W A;  3U1R A;  1OM8 A;  1O0Q A;  1SAT A;  5CXL A;  1P9H A;  2QUB A;  1AF0 A;  2YO1 A;  1G9K A;  1OMJ A;  1JIW P;  2ZVD A;  2ML2 A;  3NTN A;  1K7G A;  3S6L A;  3LAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...