3LAEA

The crystal structure of a functionally unknown conserved protein from haemophilus influenzae rd kw20
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
SNAIQQSDGSMIIDGSANLRDLNKMFNWELDTEDARTFNGLILEHLEEIPDEGTICEIDGLLITILEVGDNMIKQAKVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0053 protein HI0107
publication title The crystal structure of a functionally unknown conserved protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3laeA00
5AE2A 5FXPA 5FXDA 2VFUA 1WVEA 3AM9A 4JB1A 5G5GB 1AHZA 2P3HA 2O3GA 1UXYA 2EXRA 1FO4A 1W1KA 2PLIA 2AXRA 2GQTA 2W54A 4BC7A 2QKNA 1FIQB 2BVHA 2W3RA 1WYGA 1ZR6A 5AE3A 1W1LA 3EUB3 1W1QA 2YVSA 3AMZA 1I19A 3SR6B 1FFVC 3W8WA 3DQ0A 4OALA 2GQUA 1MBBA 1E0YA 1QLUA 1FFUC 2W3SA 5FXFA 5FXEA 1N5XA 1RM6B 4MLAA 2Q85A 3LAEA 1N61C 1N5WC 5G5HB 1W1OA 1AHVA 2MBRA 4JAYA 1T3QC 3JS8A 1E8HA 1JROA 5HMRA 4BC9A 4PYTA 1SB3B 2VFRA 2VFTA 4ZOHB 3B9JB 5HHZA 3W8XA 3W8ZA 4BBYA 1N60C 3BW7A 3NVVB 1W1SA 1DZNA 3HRDC 1V97A 1QLTA 2R2ZA 1JRPA 4O95A 2E3TA 3TX1A 4HG0A 1E8FA 3I99A 1DIQA 3NVYB 3NVWB 1VAOA 2VFVA 4BCAA 2BVGA 3LLBA 2P4PA 5ADZA 3NS1B 3NRZB 5AE1A 2OAIA 2RK5A 1F0XA 4XLOA 2W55A 2QPMA 1ZXIC 3ETRB 1DIIA 3S1DA 3AN1A 1VDVA 1N62C 3C0PA 3PM9A 1W1MA 5HQXA 2PLSA 1WVFA 1E8GA 1MBTA 1W1RA 2I0KA 2BVFA 2Q4WA 2P13A 1W1JA 2VAOA 1HSKA 3S1EA 2NQWA 2R8DA 3S1FA 3DEDA 1AHUA 3NVZB 3S1CA 4ML8A 2VFSA 1N63C 3KJMA
chains in the Genus database with same CATH superfamily
5L6FA 5I1VA 5AE2A 5FXPA 3HSUA 5FXDA 3D2JA 2VFUA 1WVEA 3AM9A 4JB1A 5G5GB 1AHZA 2P3HA 2O3GA 1UXYA 2EXRA 4PVHA 1FO4A 4PVKA 1W1KA 2PLIA 2AXRA 2GQTA 2W54A 4BC7A 4DNSA 2QKNA 1FIQB 2BVHA 2W3RA 1WYGA 1ZR6A 5AE3A 1W1LA 3EUB3 1W1QA 2YVSA 3D2DA 3AMZA 1I19A 3SR6B 1FFVC 3W8WA 3DQ0A 4OALA 3D2HA 2GQUA 3VTEA 1MBBA 1E0YA 3PQBA 1QLUA 1FFUC 2W3SA 3TSJA 5FXFA 5FXEA 2IPIA 3TSHA 1N5XA 3RJAA 1RM6B 4MLAA 2Q85A 3LAEA 2Y3RA 1N61C 1N5WC 5G5HB 1W1OA 1AHVA 2MBRA 4JAYA 1T3QC 3JS8A 5AWVA 1E8HA 1JROA 5HMRA 4BC9A 4PYTA 1SB3B 2VFRA 2VFTA 3FW9A 4ZOHB 3B9JB 5HHZA 3W8XA 4PWCA 4PWBA 3FW7A 1N60C 3BW7A 3W8ZA 4BBYA 3NVVB 1W1SA 1DZNA 3HRDC 1V97A 1QLTA 2R2ZA 3FWAA 1JRPA 4O95A 2E3TA 3TX1A 4HG0A 1E8FA 3I99A 1DIQA 3NVYB 3NVWB 4PVJA 1VAOA 3POPA 2VFVA 5I1WA 4BCAA 2BVGA 3LLBA 2P4PA 5ADZA 3NS1B 5D79A 3NRZB 5AE1A 2OAIA 2RK5A 1F0XA 2UUUA 2Y4GA 4XLOA 2W55A 2QPMA 1ZXIC 3GSYA 3ETRB 2WDWA 1DIIA 3S1DA 3AN1A 1VDVA 4UD8A 1N62C 3C0PA 3PM9A 1W1MA 5HQXA 2Y3SA 2PLSA 1WVFA 1E8GA 1MBTA 1W1RA 3FW8A 2I0KA 2BVFA 4EC3A 2Q4WA 4PVEA 2P13A 1W1JA 2VAOA 1HSKA 3S1EA 2NQWA 2R8DA 4PZFA 3S1FA 2UUVA 3DEDA 5L6GA 3RJ8A 1AHUA 5K8EA 3NVZB 2Y08A 3S1CA 4ML8A 2VFSA 1N63C 3KJMA
chains in the Genus database with same CATH topology
5L6FA 5I1VA 5AE2A 5FXPA 3HSUA 5FXDA 3D2JA 2VFUA 1WVEA 3AM9A 4JB1A 5G5GB 1AHZA 2P3HA 2O3GA 1UXYA 2EXRA 4PVHA 1FO4A 4PVKA 1W1KA 2PLIA 2AXRA 2GQTA 2W54A 4BC7A 4DNSA 2QKNA 1FIQB 2BVHA 2W3RA 1WYGA 1ZR6A 5AE3A 1W1LA 3EUB3 1W1QA 2YVSA 3D2DA 3AMZA 1I19A 3SR6B 1FFVC 3W8WA 3DQ0A 4OALA 3D2HA 2GQUA 3VTEA 1MBBA 1E0YA 3PQBA 1QLUA 1FFUC 2W3SA 3TSJA 5FXFA 5FXEA 2IPIA 3TSHA 1N5XA 3RJAA 1RM6B 4MLAA 2Q85A 3LAEA 2Y3RA 1N61C 1N5WC 5G5HB 1W1OA 1AHVA 2MBRA 4JAYA 1T3QC 3JS8A 5AWVA 1E8HA 1JROA 5HMRA 4BC9A 4PYTA 1SB3B 2VFRA 2VFTA 3FW9A 4ZOHB 3B9JB 5HHZA 3W8XA 4PWCA 4PWBA 3FW7A 1N60C 3BW7A 3W8ZA 4BBYA 3NVVB 1W1SA 1DZNA 3HRDC 1V97A 1QLTA 2R2ZA 3FWAA 1JRPA 4O95A 2E3TA 3TX1A 4HG0A 1E8FA 3I99A 1DIQA 3NVYB 3NVWB 4PVJA 1VAOA 3POPA 2VFVA 5I1WA 4BCAA 2BVGA 3LLBA 2P4PA 5ADZA 3NS1B 5D79A 3NRZB 5AE1A 2OAIA 2RK5A 1F0XA 2UUUA 2Y4GA 4XLOA 2W55A 2QPMA 1ZXIC 3GSYA 3ETRB 2WDWA 1DIIA 3S1DA 3AN1A 1VDVA 4UD8A 1N62C 3C0PA 3PM9A 1W1MA 5HQXA 2Y3SA 2PLSA 1WVFA 1E8GA 1MBTA 1W1RA 3FW8A 2I0KA 2BVFA 4EC3A 2Q4WA 4PVEA 2P13A 1W1JA 2VAOA 1HSKA 3S1EA 2NQWA 2R8DA 4PZFA 3S1FA 2UUVA 3DEDA 5L6GA 3RJ8A 1AHUA 5K8EA 3NVZB 2Y08A 3S1CA 4ML8A 2VFSA 1N63C 3KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE2 A;  5FXP A;  5FXD A;  2VFU A;  1WVE A;  3AM9 A;  4JB1 A;  5G5G B;  1AHZ A;  2P3H A;  2O3G A;  1UXY A;  2EXR A;  1FO4 A;  1W1K A;  2PLI A;  2AXR A;  2GQT A;  2W54 A;  4BC7 A;  2QKN A;  1FIQ B;  2BVH A;  2W3R A;  1WYG A;  1ZR6 A;  5AE3 A;  1W1L A;  3EUB 3;  1W1Q A;  2YVS A;  3AMZ A;  1I19 A;  3SR6 B;  1FFV C;  3W8W A;  3DQ0 A;  4OAL A;  2GQU A;  1MBB A;  1E0Y A;  1QLU A;  1FFU C;  2W3S A;  5FXF A;  5FXE A;  1N5X A;  1RM6 B;  4MLA A;  2Q85 A;  3LAE A;  1N61 C;  1N5W C;  5G5H B;  1W1O A;  1AHV A;  2MBR A;  4JAY A;  1T3Q C;  3JS8 A;  1E8H A;  1JRO A;  5HMR A;  4BC9 A;  4PYT A;  1SB3 B;  2VFR A;  2VFT A;  4ZOH B;  3B9J B;  5HHZ A;  3W8X A;  3W8Z A;  4BBY A;  1N60 C;  3BW7 A;  3NVV B;  1W1S A;  1DZN A;  3HRD C;  1V97 A;  1QLT A;  2R2Z A;  1JRP A;  4O95 A;  2E3T A;  3TX1 A;  4HG0 A;  1E8F A;  3I99 A;  1DIQ A;  3NVY B;  3NVW B;  1VAO A;  2VFV A;  4BCA A;  2BVG A;  3LLB A;  2P4P A;  5ADZ A;  3NS1 B;  3NRZ B;  5AE1 A;  2OAI A;  2RK5 A;  1F0X A;  4XLO A;  2W55 A;  2QPM A;  1ZXI C;  3ETR B;  1DII A;  3S1D A;  3AN1 A;  1VDV A;  1N62 C;  3C0P A;  3PM9 A;  1W1M A;  5HQX A;  2PLS A;  1WVF A;  1E8G A;  1MBT A;  1W1R A;  2I0K A;  2BVF A;  2Q4W A;  2P13 A;  1W1J A;  2VAO A;  1HSK A;  3S1E A;  2NQW A;  2R8D A;  3S1F A;  3DED A;  1AHU A;  3NVZ B;  3S1C A;  4ML8 A;  2VFS A;  1N63 C;  3KJM A; 
#chains in the Genus database with same CATH topology
 5L6F A;  5I1V A;  5AE2 A;  5FXP A;  3HSU A;  5FXD A;  3D2J A;  2VFU A;  1WVE A;  3AM9 A;  4JB1 A;  5G5G B;  1AHZ A;  2P3H A;  2O3G A;  1UXY A;  2EXR A;  4PVH A;  1FO4 A;  4PVK A;  1W1K A;  2PLI A;  2AXR A;  2GQT A;  2W54 A;  4BC7 A;  4DNS A;  2QKN A;  1FIQ B;  2BVH A;  2W3R A;  1WYG A;  1ZR6 A;  5AE3 A;  1W1L A;  3EUB 3;  1W1Q A;  2YVS A;  3D2D A;  3AMZ A;  1I19 A;  3SR6 B;  1FFV C;  3W8W A;  3DQ0 A;  4OAL A;  3D2H A;  2GQU A;  3VTE A;  1MBB A;  1E0Y A;  3PQB A;  1QLU A;  1FFU C;  2W3S A;  3TSJ A;  5FXF A;  5FXE A;  2IPI A;  3TSH A;  1N5X A;  3RJA A;  1RM6 B;  4MLA A;  2Q85 A;  3LAE A;  2Y3R A;  1N61 C;  1N5W C;  5G5H B;  1W1O A;  1AHV A;  2MBR A;  4JAY A;  1T3Q C;  3JS8 A;  5AWV A;  1E8H A;  1JRO A;  5HMR A;  4BC9 A;  4PYT A;  1SB3 B;  2VFR A;  2VFT A;  3FW9 A;  4ZOH B;  3B9J B;  5HHZ A;  3W8X A;  4PWC A;  4PWB A;  3FW7 A;  1N60 C;  3BW7 A;  3W8Z A;  4BBY A;  3NVV B;  1W1S A;  1DZN A;  3HRD C;  1V97 A;  1QLT A;  2R2Z A;  3FWA A;  1JRP A;  4O95 A;  2E3T A;  3TX1 A;  4HG0 A;  1E8F A;  3I99 A;  1DIQ A;  3NVY B;  3NVW B;  4PVJ A;  1VAO A;  3POP A;  2VFV A;  5I1W A;  4BCA A;  2BVG A;  3LLB A;  2P4P A;  5ADZ A;  3NS1 B;  5D79 A;  3NRZ B;  5AE1 A;  2OAI A;  2RK5 A;  1F0X A;  2UUU A;  2Y4G A;  4XLO A;  2W55 A;  2QPM A;  1ZXI C;  3GSY A;  3ETR B;  2WDW A;  1DII A;  3S1D A;  3AN1 A;  1VDV A;  4UD8 A;  1N62 C;  3C0P A;  3PM9 A;  1W1M A;  5HQX A;  2Y3S A;  2PLS A;  1WVF A;  1E8G A;  1MBT A;  1W1R A;  3FW8 A;  2I0K A;  2BVF A;  4EC3 A;  2Q4W A;  4PVE A;  2P13 A;  1W1J A;  2VAO A;  1HSK A;  3S1E A;  2NQW A;  2R8D A;  4PZF A;  3S1F A;  2UUV A;  3DED A;  5L6G A;  3RJ8 A;  1AHU A;  5K8E A;  3NVZ B;  2Y08 A;  3S1C A;  4ML8 A;  2VFS A;  1N63 C;  3KJM A; 
#chains in the Genus database with same CATH homology
 5L6F A;  5I1V A;  5AE2 A;  5FXP A;  3HSU A;  5FXD A;  3D2J A;  2VFU A;  1WVE A;  3AM9 A;  4JB1 A;  5G5G B;  1AHZ A;  2P3H A;  2O3G A;  1UXY A;  2EXR A;  4PVH A;  1FO4 A;  4PVK A;  1W1K A;  2PLI A;  2AXR A;  2GQT A;  2W54 A;  4BC7 A;  4DNS A;  2QKN A;  1FIQ B;  2BVH A;  2W3R A;  1WYG A;  1ZR6 A;  5AE3 A;  1W1L A;  3EUB 3;  1W1Q A;  2YVS A;  3D2D A;  3AMZ A;  1I19 A;  3SR6 B;  1FFV C;  3W8W A;  3DQ0 A;  4OAL A;  3D2H A;  2GQU A;  3VTE A;  1MBB A;  1E0Y A;  3PQB A;  1QLU A;  1FFU C;  2W3S A;  3TSJ A;  5FXF A;  5FXE A;  2IPI A;  3TSH A;  1N5X A;  3RJA A;  1RM6 B;  4MLA A;  2Q85 A;  3LAE A;  2Y3R A;  1N61 C;  1N5W C;  5G5H B;  1W1O A;  1AHV A;  2MBR A;  4JAY A;  1T3Q C;  3JS8 A;  5AWV A;  1E8H A;  1JRO A;  5HMR A;  4BC9 A;  4PYT A;  1SB3 B;  2VFR A;  2VFT A;  3FW9 A;  4ZOH B;  3B9J B;  5HHZ A;  3W8X A;  4PWC A;  4PWB A;  3FW7 A;  1N60 C;  3BW7 A;  3W8Z A;  4BBY A;  3NVV B;  1W1S A;  1DZN A;  3HRD C;  1V97 A;  1QLT A;  2R2Z A;  3FWA A;  1JRP A;  4O95 A;  2E3T A;  3TX1 A;  4HG0 A;  1E8F A;  3I99 A;  1DIQ A;  3NVY B;  3NVW B;  4PVJ A;  1VAO A;  3POP A;  2VFV A;  5I1W A;  4BCA A;  2BVG A;  3LLB A;  2P4P A;  5ADZ A;  3NS1 B;  5D79 A;  3NRZ B;  5AE1 A;  2OAI A;  2RK5 A;  1F0X A;  2UUU A;  2Y4G A;  4XLO A;  2W55 A;  2QPM A;  1ZXI C;  3GSY A;  3ETR B;  2WDW A;  1DII A;  3S1D A;  3AN1 A;  1VDV A;  4UD8 A;  1N62 C;  3C0P A;  3PM9 A;  1W1M A;  5HQX A;  2Y3S A;  2PLS A;  1WVF A;  1E8G A;  1MBT A;  1W1R A;  3FW8 A;  2I0K A;  2BVF A;  4EC3 A;  2Q4W A;  4PVE A;  2P13 A;  1W1J A;  2VAO A;  1HSK A;  3S1E A;  2NQW A;  2R8D A;  4PZF A;  3S1F A;  2UUV A;  3DED A;  5L6G A;  3RJ8 A;  1AHU A;  5K8E A;  3NVZ B;  2Y08 A;  3S1C A;  4ML8 A;  2VFS A;  1N63 C;  3KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...