3LAEA

The crystal structure of a functionally unknown conserved protein from haemophilus influenzae rd kw20
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
SNAIQQSDGSMIIDGSANLRDLNKMFNWELDTEDARTFNGLILEHLEEIPDEGTICEIDGLLITILEVGDNMIKQAKVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0053 protein HI0107
publication title The crystal structure of a functionally unknown conserved protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3laeA00
2BVHA 2PLSA 2VFSA 5AE1A 1AHUA 1W1RA 5FXFA 1W1QA 1JRPA 4PYTA 2EXRA 2QKNA 1HSKA 3W8XA 1UXYA 4MLAA 2VFRA 3NVZB 1N63C 2E3TA 3NVVB 2W3RA 3AM9A 1W1LA 1ZR6A 3JS8A 1DIIA 1N61C 1VDVA 3HRDC 1N62C 1QLUA 2RK5A 1E8FA 4OALA 5FXEA 2QPMA 2GQTA 3NVYB 1DIQA 1FIQB 3NS1B 4JAYA 5G5HB 4BC7A 2VAOA 2MBRA 3PM9A 2AXRA 5HMRA 3S1EA 2Q4WA 2VFTA 1AHVA 1MBTA 4XLOA 1DZNA 1QLTA 1RM6B 4BC9A 1FO4A 2W3SA 5HQXA 1SB3B 3SR6B 4ZOHB 3KJMA 3AN1A 2W55A 2O3GA 1E0YA 5FXPA 2Q85A 2NQWA 3W8ZA 3C0PA 2R8DA 3ETRB 3DQ0A 1AHZA 2YVSA 1F0XA 3W8WA 2PLIA 5HHZA 1W1MA 1FFVC 3S1FA 1FFUC 2VFVA 2OAIA 5AE3A 5ADZA 1N5WC 4ML8A 3S1CA 4JB1A 1MBBA 1VAOA 3LAEA 3NVWB 2BVGA 2BVFA 3DEDA 1V97A 2W54A 4O95A 2GQUA 5FXDA 3S1DA 1E8GA 1W1SA 4BBYA 1E8HA 1WVEA 1T3QC 1WYGA 2P4PA 3I99A 1I19A 1N60C 3AMZA 5G5GB 3EUB3 3LLBA 3NRZB 2P3HA 5AE2A 1W1JA 2R2ZA 1JROA 1N5XA 1W1OA 1WVFA 3B9JB 3TX1A 3BW7A 4BCAA 2I0KA 1W1KA 2P13A 4HG0A 1ZXIC 2VFUA
chains in the Genus database with same CATH superfamily
2BVHA 2PLSA 2VFSA 5AE1A 1AHUA 1W1RA 5D79A 3TSJA 2WDWA 5FXFA 1W1QA 1JRPA 3FWAA 4PYTA 5I1VA 2EXRA 2QKNA 3FW7A 1HSKA 3W8XA 1UXYA 4MLAA 2VFRA 3NVZB 1N63C 2E3TA 3NVVB 2W3RA 3AM9A 1W1LA 1ZR6A 3JS8A 1DIIA 4UD8A 1N61C 2UUVA 1VDVA 4PWBA 3HRDC 2Y3SA 1N62C 1QLUA 3RJ8A 2RK5A 3FW9A 1E8FA 4OALA 4PVKA 5FXEA 2QPMA 2GQTA 3D2JA 1DIQA 1FIQB 3NS1B 3NVYB 4JAYA 3PQBA 5G5HB 5L6FA 4BC7A 2VAOA 2MBRA 3PM9A 2AXRA 5HMRA 3S1EA 2Q4WA 2VFTA 1AHVA 1MBTA 4XLOA 1DZNA 1QLTA 1RM6B 3FW8A 4BC9A 1FO4A 3GSYA 2W3SA 5HQXA 1SB3B 3SR6B 4PWCA 4ZOHB 3KJMA 3AN1A 2W55A 2Y4GA 2O3GA 1E0YA 5FXPA 2Q85A 2NQWA 2Y3RA 3W8ZA 3C0PA 2R8DA 3ETRB 3DQ0A 5K8EA 1AHZA 2YVSA 1F0XA 4PVEA 3W8WA 2PLIA 5HHZA 1W1MA 1FFVC 4PVJA 3S1FA 4DNSA 1FFUC 2VFVA 2UUUA 2OAIA 5AE3A 5ADZA 3D2DA 1N5WC 4ML8A 3D2HA 3S1CA 4JB1A 1MBBA 1VAOA 3LAEA 3NVWB 3VTEA 2BVGA 2BVFA 5AWVA 3DEDA 1V97A 2W54A 4O95A 2GQUA 4PVHA 5FXDA 3S1DA 4PZFA 5I1WA 3RJAA 1E8GA 1W1SA 4BBYA 3TSHA 1E8HA 1WVEA 1T3QC 1WYGA 2P4PA 3I99A 1I19A 1N60C 2IPIA 3AMZA 5G5GB 3EUB3 3LLBA 3NRZB 2P3HA 5AE2A 3POPA 1W1JA 2R2ZA 1JROA 1N5XA 1W1OA 1WVFA 4EC3A 5L6GA 3B9JB 3TX1A 3BW7A 3HSUA 2Y08A 4BCAA 2I0KA 1W1KA 2P13A 4HG0A 1ZXIC 2VFUA
chains in the Genus database with same CATH topology
2BVHA 2PLSA 2VFSA 5AE1A 1AHUA 1W1RA 5D79A 3TSJA 2WDWA 5FXFA 1W1QA 1JRPA 3FWAA 4PYTA 5I1VA 2EXRA 2QKNA 3FW7A 1HSKA 3W8XA 1UXYA 4MLAA 2VFRA 3NVZB 1N63C 2E3TA 3NVVB 2W3RA 3AM9A 1W1LA 1ZR6A 3JS8A 1DIIA 4UD8A 1N61C 2UUVA 1VDVA 4PWBA 3HRDC 2Y3SA 1N62C 1QLUA 3RJ8A 2RK5A 3FW9A 1E8FA 4OALA 4PVKA 5FXEA 2QPMA 2GQTA 3D2JA 1DIQA 1FIQB 3NS1B 3NVYB 4JAYA 3PQBA 5G5HB 5L6FA 4BC7A 2VAOA 2MBRA 3PM9A 2AXRA 5HMRA 3S1EA 2Q4WA 2VFTA 1AHVA 1MBTA 4XLOA 1DZNA 1QLTA 1RM6B 3FW8A 4BC9A 1FO4A 3GSYA 2W3SA 5HQXA 1SB3B 3SR6B 4PWCA 4ZOHB 3KJMA 3AN1A 2W55A 2Y4GA 2O3GA 1E0YA 5FXPA 2Q85A 2NQWA 2Y3RA 3W8ZA 3C0PA 2R8DA 3ETRB 3DQ0A 5K8EA 1AHZA 2YVSA 1F0XA 4PVEA 3W8WA 2PLIA 5HHZA 1W1MA 1FFVC 4PVJA 3S1FA 4DNSA 1FFUC 2VFVA 2UUUA 2OAIA 5AE3A 5ADZA 3D2DA 1N5WC 4ML8A 3D2HA 3S1CA 4JB1A 1MBBA 1VAOA 3LAEA 3NVWB 3VTEA 2BVGA 2BVFA 5AWVA 3DEDA 1V97A 2W54A 4O95A 2GQUA 4PVHA 5FXDA 3S1DA 4PZFA 5I1WA 3RJAA 1E8GA 1W1SA 4BBYA 3TSHA 1E8HA 1WVEA 1T3QC 1WYGA 2P4PA 3I99A 1I19A 1N60C 2IPIA 3AMZA 5G5GB 3EUB3 3LLBA 3NRZB 2P3HA 5AE2A 3POPA 1W1JA 2R2ZA 1JROA 1N5XA 1W1OA 1WVFA 4EC3A 5L6GA 3B9JB 3TX1A 3BW7A 3HSUA 2Y08A 4BCAA 2I0KA 1W1KA 2P13A 4HG0A 1ZXIC 2VFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BVH A;  2PLS A;  2VFS A;  5AE1 A;  1AHU A;  1W1R A;  5FXF A;  1W1Q A;  1JRP A;  4PYT A;  2EXR A;  2QKN A;  1HSK A;  3W8X A;  1UXY A;  4MLA A;  2VFR A;  3NVZ B;  1N63 C;  2E3T A;  3NVV B;  2W3R A;  3AM9 A;  1W1L A;  1ZR6 A;  3JS8 A;  1DII A;  1N61 C;  1VDV A;  3HRD C;  1N62 C;  1QLU A;  2RK5 A;  1E8F A;  4OAL A;  5FXE A;  2QPM A;  2GQT A;  3NVY B;  1DIQ A;  1FIQ B;  3NS1 B;  4JAY A;  5G5H B;  4BC7 A;  2VAO A;  2MBR A;  3PM9 A;  2AXR A;  5HMR A;  3S1E A;  2Q4W A;  2VFT A;  1AHV A;  1MBT A;  4XLO A;  1DZN A;  1QLT A;  1RM6 B;  4BC9 A;  1FO4 A;  2W3S A;  5HQX A;  1SB3 B;  3SR6 B;  4ZOH B;  3KJM A;  3AN1 A;  2W55 A;  2O3G A;  1E0Y A;  5FXP A;  2Q85 A;  2NQW A;  3W8Z A;  3C0P A;  2R8D A;  3ETR B;  3DQ0 A;  1AHZ A;  2YVS A;  1F0X A;  3W8W A;  2PLI A;  5HHZ A;  1W1M A;  1FFV C;  3S1F A;  1FFU C;  2VFV A;  2OAI A;  5AE3 A;  5ADZ A;  1N5W C;  4ML8 A;  3S1C A;  4JB1 A;  1MBB A;  1VAO A;  3LAE A;  3NVW B;  2BVG A;  2BVF A;  3DED A;  1V97 A;  2W54 A;  4O95 A;  2GQU A;  5FXD A;  3S1D A;  1E8G A;  1W1S A;  4BBY A;  1E8H A;  1WVE A;  1T3Q C;  1WYG A;  2P4P A;  3I99 A;  1I19 A;  1N60 C;  3AMZ A;  5G5G B;  3EUB 3;  3LLB A;  3NRZ B;  2P3H A;  5AE2 A;  1W1J A;  2R2Z A;  1JRO A;  1N5X A;  1W1O A;  1WVF A;  3B9J B;  3TX1 A;  3BW7 A;  4BCA A;  2I0K A;  1W1K A;  2P13 A;  4HG0 A;  1ZXI C;  2VFU A; 
#chains in the Genus database with same CATH topology
 2BVH A;  2PLS A;  2VFS A;  5AE1 A;  1AHU A;  1W1R A;  5D79 A;  3TSJ A;  2WDW A;  5FXF A;  1W1Q A;  1JRP A;  3FWA A;  4PYT A;  5I1V A;  2EXR A;  2QKN A;  3FW7 A;  1HSK A;  3W8X A;  1UXY A;  4MLA A;  2VFR A;  3NVZ B;  1N63 C;  2E3T A;  3NVV B;  2W3R A;  3AM9 A;  1W1L A;  1ZR6 A;  3JS8 A;  1DII A;  4UD8 A;  1N61 C;  2UUV A;  1VDV A;  4PWB A;  3HRD C;  2Y3S A;  1N62 C;  1QLU A;  3RJ8 A;  2RK5 A;  3FW9 A;  1E8F A;  4OAL A;  4PVK A;  5FXE A;  2QPM A;  2GQT A;  3D2J A;  1DIQ A;  1FIQ B;  3NS1 B;  3NVY B;  4JAY A;  3PQB A;  5G5H B;  5L6F A;  4BC7 A;  2VAO A;  2MBR A;  3PM9 A;  2AXR A;  5HMR A;  3S1E A;  2Q4W A;  2VFT A;  1AHV A;  1MBT A;  4XLO A;  1DZN A;  1QLT A;  1RM6 B;  3FW8 A;  4BC9 A;  1FO4 A;  3GSY A;  2W3S A;  5HQX A;  1SB3 B;  3SR6 B;  4PWC A;  4ZOH B;  3KJM A;  3AN1 A;  2W55 A;  2Y4G A;  2O3G A;  1E0Y A;  5FXP A;  2Q85 A;  2NQW A;  2Y3R A;  3W8Z A;  3C0P A;  2R8D A;  3ETR B;  3DQ0 A;  5K8E A;  1AHZ A;  2YVS A;  1F0X A;  4PVE A;  3W8W A;  2PLI A;  5HHZ A;  1W1M A;  1FFV C;  4PVJ A;  3S1F A;  4DNS A;  1FFU C;  2VFV A;  2UUU A;  2OAI A;  5AE3 A;  5ADZ A;  3D2D A;  1N5W C;  4ML8 A;  3D2H A;  3S1C A;  4JB1 A;  1MBB A;  1VAO A;  3LAE A;  3NVW B;  3VTE A;  2BVG A;  2BVF A;  5AWV A;  3DED A;  1V97 A;  2W54 A;  4O95 A;  2GQU A;  4PVH A;  5FXD A;  3S1D A;  4PZF A;  5I1W A;  3RJA A;  1E8G A;  1W1S A;  4BBY A;  3TSH A;  1E8H A;  1WVE A;  1T3Q C;  1WYG A;  2P4P A;  3I99 A;  1I19 A;  1N60 C;  2IPI A;  3AMZ A;  5G5G B;  3EUB 3;  3LLB A;  3NRZ B;  2P3H A;  5AE2 A;  3POP A;  1W1J A;  2R2Z A;  1JRO A;  1N5X A;  1W1O A;  1WVF A;  4EC3 A;  5L6G A;  3B9J B;  3TX1 A;  3BW7 A;  3HSU A;  2Y08 A;  4BCA A;  2I0K A;  1W1K A;  2P13 A;  4HG0 A;  1ZXI C;  2VFU A; 
#chains in the Genus database with same CATH homology
 2BVH A;  2PLS A;  2VFS A;  5AE1 A;  1AHU A;  1W1R A;  5D79 A;  3TSJ A;  2WDW A;  5FXF A;  1W1Q A;  1JRP A;  3FWA A;  4PYT A;  5I1V A;  2EXR A;  2QKN A;  3FW7 A;  1HSK A;  3W8X A;  1UXY A;  4MLA A;  2VFR A;  3NVZ B;  1N63 C;  2E3T A;  3NVV B;  2W3R A;  3AM9 A;  1W1L A;  1ZR6 A;  3JS8 A;  1DII A;  4UD8 A;  1N61 C;  2UUV A;  1VDV A;  4PWB A;  3HRD C;  2Y3S A;  1N62 C;  1QLU A;  3RJ8 A;  2RK5 A;  3FW9 A;  1E8F A;  4OAL A;  4PVK A;  5FXE A;  2QPM A;  2GQT A;  3D2J A;  1DIQ A;  1FIQ B;  3NS1 B;  3NVY B;  4JAY A;  3PQB A;  5G5H B;  5L6F A;  4BC7 A;  2VAO A;  2MBR A;  3PM9 A;  2AXR A;  5HMR A;  3S1E A;  2Q4W A;  2VFT A;  1AHV A;  1MBT A;  4XLO A;  1DZN A;  1QLT A;  1RM6 B;  3FW8 A;  4BC9 A;  1FO4 A;  3GSY A;  2W3S A;  5HQX A;  1SB3 B;  3SR6 B;  4PWC A;  4ZOH B;  3KJM A;  3AN1 A;  2W55 A;  2Y4G A;  2O3G A;  1E0Y A;  5FXP A;  2Q85 A;  2NQW A;  2Y3R A;  3W8Z A;  3C0P A;  2R8D A;  3ETR B;  3DQ0 A;  5K8E A;  1AHZ A;  2YVS A;  1F0X A;  4PVE A;  3W8W A;  2PLI A;  5HHZ A;  1W1M A;  1FFV C;  4PVJ A;  3S1F A;  4DNS A;  1FFU C;  2VFV A;  2UUU A;  2OAI A;  5AE3 A;  5ADZ A;  3D2D A;  1N5W C;  4ML8 A;  3D2H A;  3S1C A;  4JB1 A;  1MBB A;  1VAO A;  3LAE A;  3NVW B;  3VTE A;  2BVG A;  2BVF A;  5AWV A;  3DED A;  1V97 A;  2W54 A;  4O95 A;  2GQU A;  4PVH A;  5FXD A;  3S1D A;  4PZF A;  5I1W A;  3RJA A;  1E8G A;  1W1S A;  4BBY A;  3TSH A;  1E8H A;  1WVE A;  1T3Q C;  1WYG A;  2P4P A;  3I99 A;  1I19 A;  1N60 C;  2IPI A;  3AMZ A;  5G5G B;  3EUB 3;  3LLB A;  3NRZ B;  2P3H A;  5AE2 A;  3POP A;  1W1J A;  2R2Z A;  1JRO A;  1N5X A;  1W1O A;  1WVF A;  4EC3 A;  5L6G A;  3B9J B;  3TX1 A;  3BW7 A;  3HSU A;  2Y08 A;  4BCA A;  2I0K A;  1W1K A;  2P13 A;  4HG0 A;  1ZXI C;  2VFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...