3LAEA

The crystal structure of a functionally unknown conserved protein from haemophilus influenzae rd kw20
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
SNAIQQSDGSMIIDGSANLRDLNKMFNWELDTEDARTFNGLILEHLEEIPDEGTICEIDGLLITILEVGDNMIKQAKVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a functionally unknown conserved protein from Haemophilus influenzae Rd KW20
rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords UPF0053 protein HI0107
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3laeA00
2W54A 2GQTA 2OAIA 1UXYA 3EUB3 1FO4A 2VFUA 1W1OA 1W1SA 4HG0A 1N5XA 2RK5A 3DQ0A 3S1DA 1E0YA 5FXPA 4JAYA 1FFUC 1DZNA 3AM9A 4ZOHB 1ZR6A 5AE2A 1E8FA 3HRDC 2I0KA 3ETRB 1W1RA 3KJMA 1WYGA 3NVZB 3B9JB 5G5GB 2O3GA 2BVGA 4OALA 1N60C 1MBBA 3JS8A 4BBYA 3NS1B 3PM9A 2EXRA 1E8GA 1DIQA 3LLBA 1JROA 3C0PA 4JB1A 5G5HB 5AE3A 5FXDA 2P13A 4XLOA 1WVEA 1V97A 1W1LA 3AMZA 2E3TA 1W1JA 3W8WA 1I19A 5HMRA 3NVWB 2PLIA 4PYTA 4BC7A 2VAOA 1QLUA 1W1MA 1W1KA 3NVVB 2VFVA 2W55A 5HHZA 1N61C 2P4PA 1AHZA 5AE1A 2QKNA 2W3SA 2GQUA 5FXFA 2VFTA 5FXEA 3S1CA 1N62C 2QPMA 3BW7A 1VDVA 4BC9A 2P3HA 2VFRA 2R8DA 5ADZA 2YVSA 4BCAA 3W8ZA 2PLSA 3S1EA 1T3QC 2BVFA 1DIIA 1JRPA 3DEDA 1N63C 2Q4WA 4ML8A 1AHVA 1RM6B 1ZXIC 3NRZB 1F0XA 1MBTA 2NQWA 3AN1A 2VFSA 1FFVC 2MBRA 2BVHA 2AXRA 1FIQB 1W1QA 1SB3B 3SR6B 3TX1A 3S1FA 1VAOA 4MLAA 1QLTA 4O95A 2R2ZA 1N5WC 2W3RA 1HSKA 5HQXA 1WVFA 3I99A 3LAEA 1E8HA 3W8XA 2Q85A 1AHUA 3NVYB
chains in the Genus database with same CATH superfamily
2W54A 2GQTA 2OAIA 1UXYA 3TSHA 3EUB3 1FO4A 2VFUA 1W1OA 1W1SA 3FW7A 4HG0A 1N5XA 3FW8A 2RK5A 3DQ0A 3RJAA 1E0YA 3S1DA 4JAYA 5FXPA 1FFUC 1DZNA 3AM9A 4ZOHB 1ZR6A 5AE2A 1E8FA 2WDWA 3HRDC 2Y4GA 3VTEA 2I0KA 3FW9A 3ETRB 2Y3RA 1W1RA 3KJMA 1WYGA 3NVZB 3B9JB 5G5GB 2IPIA 2O3GA 2BVGA 2UUUA 4OALA 4PWBA 1N60C 1MBBA 3JS8A 5K8EA 3D2DA 5L6FA 4BBYA 3NS1B 3PM9A 2EXRA 3HSUA 1E8GA 3POPA 1DIQA 3LLBA 1JROA 3C0PA 5L6GA 4JB1A 4UD8A 5G5HB 5AE3A 5FXDA 2P13A 5I1VA 4XLOA 1WVEA 1V97A 1W1LA 3AMZA 2E3TA 2Y3SA 1W1JA 3W8WA 4DNSA 4EC3A 1I19A 5HMRA 3NVWB 2PLIA 4PYTA 4BC7A 2VAOA 1QLUA 3PQBA 4PVKA 1W1MA 1W1KA 3NVVB 2VFVA 4PVEA 2W55A 5HHZA 1N61C 2P4PA 1AHZA 5AE1A 2QKNA 2W3SA 2GQUA 5I1WA 3D2JA 5FXFA 2VFTA 5FXEA 3S1CA 1N62C 2QPMA 3BW7A 4PWCA 1VDVA 4PVHA 4BC9A 2P3HA 2VFRA 2R8DA 3D2HA 5ADZA 2YVSA 4BCAA 5AWVA 3W8ZA 2Y08A 2PLSA 3S1EA 1T3QC 2BVFA 1DIIA 1JRPA 3DEDA 1N63C 2Q4WA 4ML8A 1AHVA 1RM6B 1ZXIC 3NRZB 3TSJA 1F0XA 1MBTA 2NQWA 3AN1A 3GSYA 2UUVA 2VFSA 1FFVC 2MBRA 2BVHA 2AXRA 1FIQB 1W1QA 1SB3B 3SR6B 3TX1A 3S1FA 1VAOA 4MLAA 1QLTA 4O95A 3FWAA 2R2ZA 1N5WC 2W3RA 1HSKA 5HQXA 1WVFA 3I99A 3LAEA 1E8HA 3RJ8A 3W8XA 4PZFA 2Q85A 1AHUA 5D79A 4PVJA 3NVYB
chains in the Genus database with same CATH topology
2W54A 2GQTA 2OAIA 1UXYA 3TSHA 3EUB3 1FO4A 2VFUA 1W1OA 1W1SA 3FW7A 4HG0A 1N5XA 3FW8A 2RK5A 3DQ0A 3RJAA 1E0YA 3S1DA 4JAYA 5FXPA 1FFUC 1DZNA 3AM9A 4ZOHB 1ZR6A 5AE2A 1E8FA 2WDWA 3HRDC 2Y4GA 3VTEA 2I0KA 3FW9A 3ETRB 2Y3RA 1W1RA 3KJMA 1WYGA 3NVZB 3B9JB 5G5GB 2IPIA 2O3GA 2BVGA 2UUUA 4OALA 4PWBA 1N60C 1MBBA 3JS8A 5K8EA 3D2DA 5L6FA 4BBYA 3NS1B 3PM9A 2EXRA 3HSUA 1E8GA 3POPA 1DIQA 3LLBA 1JROA 3C0PA 5L6GA 4JB1A 4UD8A 5G5HB 5AE3A 5FXDA 2P13A 5I1VA 4XLOA 1WVEA 1V97A 1W1LA 3AMZA 2E3TA 2Y3SA 1W1JA 3W8WA 4DNSA 4EC3A 1I19A 5HMRA 3NVWB 2PLIA 4PYTA 4BC7A 2VAOA 1QLUA 3PQBA 4PVKA 1W1MA 1W1KA 3NVVB 2VFVA 4PVEA 2W55A 5HHZA 1N61C 2P4PA 1AHZA 5AE1A 2QKNA 2W3SA 2GQUA 5I1WA 3D2JA 5FXFA 2VFTA 5FXEA 3S1CA 1N62C 2QPMA 3BW7A 4PWCA 1VDVA 4PVHA 4BC9A 2P3HA 2VFRA 2R8DA 3D2HA 5ADZA 2YVSA 4BCAA 5AWVA 3W8ZA 2Y08A 2PLSA 3S1EA 1T3QC 2BVFA 1DIIA 1JRPA 3DEDA 1N63C 2Q4WA 4ML8A 1AHVA 1RM6B 1ZXIC 3NRZB 3TSJA 1F0XA 1MBTA 2NQWA 3AN1A 3GSYA 2UUVA 2VFSA 1FFVC 2MBRA 2BVHA 2AXRA 1FIQB 1W1QA 1SB3B 3SR6B 3TX1A 3S1FA 1VAOA 4MLAA 1QLTA 4O95A 3FWAA 2R2ZA 1N5WC 2W3RA 1HSKA 5HQXA 1WVFA 3I99A 3LAEA 1E8HA 3RJ8A 3W8XA 4PZFA 2Q85A 1AHUA 5D79A 4PVJA 3NVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  2GQT A;  2OAI A;  1UXY A;  3EUB 3;  1FO4 A;  2VFU A;  1W1O A;  1W1S A;  4HG0 A;  1N5X A;  2RK5 A;  3DQ0 A;  3S1D A;  1E0Y A;  5FXP A;  4JAY A;  1FFU C;  1DZN A;  3AM9 A;  4ZOH B;  1ZR6 A;  5AE2 A;  1E8F A;  3HRD C;  2I0K A;  3ETR B;  1W1R A;  3KJM A;  1WYG A;  3NVZ B;  3B9J B;  5G5G B;  2O3G A;  2BVG A;  4OAL A;  1N60 C;  1MBB A;  3JS8 A;  4BBY A;  3NS1 B;  3PM9 A;  2EXR A;  1E8G A;  1DIQ A;  3LLB A;  1JRO A;  3C0P A;  4JB1 A;  5G5H B;  5AE3 A;  5FXD A;  2P13 A;  4XLO A;  1WVE A;  1V97 A;  1W1L A;  3AMZ A;  2E3T A;  1W1J A;  3W8W A;  1I19 A;  5HMR A;  3NVW B;  2PLI A;  4PYT A;  4BC7 A;  2VAO A;  1QLU A;  1W1M A;  1W1K A;  3NVV B;  2VFV A;  2W55 A;  5HHZ A;  1N61 C;  2P4P A;  1AHZ A;  5AE1 A;  2QKN A;  2W3S A;  2GQU A;  5FXF A;  2VFT A;  5FXE A;  3S1C A;  1N62 C;  2QPM A;  3BW7 A;  1VDV A;  4BC9 A;  2P3H A;  2VFR A;  2R8D A;  5ADZ A;  2YVS A;  4BCA A;  3W8Z A;  2PLS A;  3S1E A;  1T3Q C;  2BVF A;  1DII A;  1JRP A;  3DED A;  1N63 C;  2Q4W A;  4ML8 A;  1AHV A;  1RM6 B;  1ZXI C;  3NRZ B;  1F0X A;  1MBT A;  2NQW A;  3AN1 A;  2VFS A;  1FFV C;  2MBR A;  2BVH A;  2AXR A;  1FIQ B;  1W1Q A;  1SB3 B;  3SR6 B;  3TX1 A;  3S1F A;  1VAO A;  4MLA A;  1QLT A;  4O95 A;  2R2Z A;  1N5W C;  2W3R A;  1HSK A;  5HQX A;  1WVF A;  3I99 A;  3LAE A;  1E8H A;  3W8X A;  2Q85 A;  1AHU A;  3NVY B; 
#chains in the Genus database with same CATH topology
 2W54 A;  2GQT A;  2OAI A;  1UXY A;  3TSH A;  3EUB 3;  1FO4 A;  2VFU A;  1W1O A;  1W1S A;  3FW7 A;  4HG0 A;  1N5X A;  3FW8 A;  2RK5 A;  3DQ0 A;  3RJA A;  1E0Y A;  3S1D A;  4JAY A;  5FXP A;  1FFU C;  1DZN A;  3AM9 A;  4ZOH B;  1ZR6 A;  5AE2 A;  1E8F A;  2WDW A;  3HRD C;  2Y4G A;  3VTE A;  2I0K A;  3FW9 A;  3ETR B;  2Y3R A;  1W1R A;  3KJM A;  1WYG A;  3NVZ B;  3B9J B;  5G5G B;  2IPI A;  2O3G A;  2BVG A;  2UUU A;  4OAL A;  4PWB A;  1N60 C;  1MBB A;  3JS8 A;  5K8E A;  3D2D A;  5L6F A;  4BBY A;  3NS1 B;  3PM9 A;  2EXR A;  3HSU A;  1E8G A;  3POP A;  1DIQ A;  3LLB A;  1JRO A;  3C0P A;  5L6G A;  4JB1 A;  4UD8 A;  5G5H B;  5AE3 A;  5FXD A;  2P13 A;  5I1V A;  4XLO A;  1WVE A;  1V97 A;  1W1L A;  3AMZ A;  2E3T A;  2Y3S A;  1W1J A;  3W8W A;  4DNS A;  4EC3 A;  1I19 A;  5HMR A;  3NVW B;  2PLI A;  4PYT A;  4BC7 A;  2VAO A;  1QLU A;  3PQB A;  4PVK A;  1W1M A;  1W1K A;  3NVV B;  2VFV A;  4PVE A;  2W55 A;  5HHZ A;  1N61 C;  2P4P A;  1AHZ A;  5AE1 A;  2QKN A;  2W3S A;  2GQU A;  5I1W A;  3D2J A;  5FXF A;  2VFT A;  5FXE A;  3S1C A;  1N62 C;  2QPM A;  3BW7 A;  4PWC A;  1VDV A;  4PVH A;  4BC9 A;  2P3H A;  2VFR A;  2R8D A;  3D2H A;  5ADZ A;  2YVS A;  4BCA A;  5AWV A;  3W8Z A;  2Y08 A;  2PLS A;  3S1E A;  1T3Q C;  2BVF A;  1DII A;  1JRP A;  3DED A;  1N63 C;  2Q4W A;  4ML8 A;  1AHV A;  1RM6 B;  1ZXI C;  3NRZ B;  3TSJ A;  1F0X A;  1MBT A;  2NQW A;  3AN1 A;  3GSY A;  2UUV A;  2VFS A;  1FFV C;  2MBR A;  2BVH A;  2AXR A;  1FIQ B;  1W1Q A;  1SB3 B;  3SR6 B;  3TX1 A;  3S1F A;  1VAO A;  4MLA A;  1QLT A;  4O95 A;  3FWA A;  2R2Z A;  1N5W C;  2W3R A;  1HSK A;  5HQX A;  1WVF A;  3I99 A;  3LAE A;  1E8H A;  3RJ8 A;  3W8X A;  4PZF A;  2Q85 A;  1AHU A;  5D79 A;  4PVJ A;  3NVY B; 
#chains in the Genus database with same CATH homology
 2W54 A;  2GQT A;  2OAI A;  1UXY A;  3TSH A;  3EUB 3;  1FO4 A;  2VFU A;  1W1O A;  1W1S A;  3FW7 A;  4HG0 A;  1N5X A;  3FW8 A;  2RK5 A;  3DQ0 A;  3RJA A;  1E0Y A;  3S1D A;  4JAY A;  5FXP A;  1FFU C;  1DZN A;  3AM9 A;  4ZOH B;  1ZR6 A;  5AE2 A;  1E8F A;  2WDW A;  3HRD C;  2Y4G A;  3VTE A;  2I0K A;  3FW9 A;  3ETR B;  2Y3R A;  1W1R A;  3KJM A;  1WYG A;  3NVZ B;  3B9J B;  5G5G B;  2IPI A;  2O3G A;  2BVG A;  2UUU A;  4OAL A;  4PWB A;  1N60 C;  1MBB A;  3JS8 A;  5K8E A;  3D2D A;  5L6F A;  4BBY A;  3NS1 B;  3PM9 A;  2EXR A;  3HSU A;  1E8G A;  3POP A;  1DIQ A;  3LLB A;  1JRO A;  3C0P A;  5L6G A;  4JB1 A;  4UD8 A;  5G5H B;  5AE3 A;  5FXD A;  2P13 A;  5I1V A;  4XLO A;  1WVE A;  1V97 A;  1W1L A;  3AMZ A;  2E3T A;  2Y3S A;  1W1J A;  3W8W A;  4DNS A;  4EC3 A;  1I19 A;  5HMR A;  3NVW B;  2PLI A;  4PYT A;  4BC7 A;  2VAO A;  1QLU A;  3PQB A;  4PVK A;  1W1M A;  1W1K A;  3NVV B;  2VFV A;  4PVE A;  2W55 A;  5HHZ A;  1N61 C;  2P4P A;  1AHZ A;  5AE1 A;  2QKN A;  2W3S A;  2GQU A;  5I1W A;  3D2J A;  5FXF A;  2VFT A;  5FXE A;  3S1C A;  1N62 C;  2QPM A;  3BW7 A;  4PWC A;  1VDV A;  4PVH A;  4BC9 A;  2P3H A;  2VFR A;  2R8D A;  3D2H A;  5ADZ A;  2YVS A;  4BCA A;  5AWV A;  3W8Z A;  2Y08 A;  2PLS A;  3S1E A;  1T3Q C;  2BVF A;  1DII A;  1JRP A;  3DED A;  1N63 C;  2Q4W A;  4ML8 A;  1AHV A;  1RM6 B;  1ZXI C;  3NRZ B;  3TSJ A;  1F0X A;  1MBT A;  2NQW A;  3AN1 A;  3GSY A;  2UUV A;  2VFS A;  1FFV C;  2MBR A;  2BVH A;  2AXR A;  1FIQ B;  1W1Q A;  1SB3 B;  3SR6 B;  3TX1 A;  3S1F A;  1VAO A;  4MLA A;  1QLT A;  4O95 A;  3FWA A;  2R2Z A;  1N5W C;  2W3R A;  1HSK A;  5HQX A;  1WVF A;  3I99 A;  3LAE A;  1E8H A;  3RJ8 A;  3W8X A;  4PZF A;  2Q85 A;  1AHU A;  5D79 A;  4PVJ A;  3NVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...