3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
molecule keywords Arginine repressor
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
5JI6A 5HDNA 2E1CA 1BM9A 4LK0F 4A6EA 2KJCA 5H20A 2YR2A 1STZA 1IXCA 3MQ0A 1LB2A 2HFHA 5ERIA 2ZO4A 4IVNA 1KQ9A 4ZYGA 1A04A 2P6TA 3C7JA 3P9CA 2IW5A 3ELKA 3ULQB 3HUGA 1FYMA 1SFUA 4U7BA 4G7OF 4U88A 1BJTA 4GFQA 3TDUC 1MKMA 3ZMUA 2HDCA 3W6KB 4U0WA 2FBKA 2VONA 4KB4A 2NNYA 3DF8A 1GHCA 1J7KA 3DV8A 4A6DA 4OIPF 1IN8A 2ESNA 1WQFA 3JW4A 1SMTA 1O3RA 5IT9Z 1T98A 3GFIA 3FWEA 1S7AA 3GO5A 3NEUA 3FXUA 1YW7A 3HRMA 2V6CA 1I27A 5H6RA 1KU2A 5LHHA 2FA5A 1XB4A 4UV8A 3IKTA 2M5WA 2PMUA 1KQ8A 5TJJA 3BP8A 3WTTC 2BYVE 2PFBA 1SMYF 4KN7X 3VODA 3ZMDA 3IWFA 5HLIA 4I01A 4KMFA 1BI0A 4O3MA 2PJPA 1Z6TA 4GGGA 4KYWA 4HZFA 5ICCA 4CICA 1YFHA 2EV0A 1XGNA 2X0LA 3KZZA 1YQAA 5DCMB 2V1XA 3RKYA 4G0VA 4KB2A 3FZVA 3F8NA 2Y3PA 4ENNA 5KVRA 2VOPA 3KEQA 4RGSA 4ETSA 2NS0A 4ZYDA 4RB3C 2K7LA 1R5GA 1V4RA 1QPMA 3M8FA 2Z9OA 1FX7A 1F5TA 3F8CA 2FOKA 4KIBA 3RI4A 2XRNA 1LDKB 2JSCA 3ZMTA 2JPBA 2DI3A 1B4BA 3E3VA 3S2WA 4RAZA 1ODDA 3IKVA 5CVJA 5D6EA 3FXQA 4KFCA 5HDKA 3RYPA 2MLGA 1J0RA 2Q8KA 4RAYA 3JAMZ 3LAPA 4HDVA 1XGOA 1CF7B 1FNNA 3WGGA 5JFRA 1IXSB 4O5VA 5J6XA 5FFXA 1WI9A 3G3ZA 3Q5FA 1XN7A 2VBYA 5L3FA 2LNBA 4U7DA 3E6CC 2DT5A 2KRFA 5K5QA 4KDPA 2ZJ2A 2CWEA 1OYIA 1Z91A 4DNCA 4M9XA 2ESHA 1MJ9A 5TRDA 4YIIA 4IHSA 1O3SA 3OEPA 1ZLJA 4WK8F 3TQNA 5FGMA 3BROA 3R6SA 5EEGA 3L7WA 4ESJA 1X3UA 4QWQA 4G6DA 2LSOA 1G3SA 5BMZA 3GZ6A 1PP7U 4G7HF 4JK1X 3D0SA 3P7NA 2XKOA 1R5HA 2GA1A 2A68F 5LEJA 1FC3A 1B59A 2L4AA 2E7WA 1XSVA 3PQKA 5IT3A 1I1GA 4BNCA 2JPCA 4G7ZF 4GYIA 3ZQ7A 2L4MA 5J8CA 4MTDA 4MTEA 4HX4A 5LBQA 3DPLC 4HLYA 3PFIA 2RGVA 5D5XB 4KMUX 5DUIA 6PAXA 2RQPA 2EK5A 3HSFA 5FD6A 1Z9CA 5HDGA 3V8KA 5AONA 1O3TA 3ECOA 2M30A 5ED4A 4IHTA 3J80K 3CJNA 3E97A 2R7FA 1T0FA 2GXGA 1YO5C 2EJRA 4KC6A 5ILSA 4M9SA 2LF7A 3WTUC 1Z1DA 4L18B 4XLNF 1R23A 2W57A 4TV7A 2EFNA 2IP2A 4ZZLA 2DPDA 3HYIA 3RTRA 2HQNA 3R61A 1FPQA 3L4JA 3F72A 3QOPA 5E18F 2EFPA 2FEZA 1YG2A 4PCQA 3CO6C 3JSOA 1XGSA 2ELHA 2VBWA 2VC1A 2CG4A 5BPDA 3GVAA 1OYYA 1YS7A 4WF2A 4L9TA 5F1RA 2FU4A 5CVUA 2Q2EA 5F6FA 2K86A 4ENMA 3MMLB 1ZVUA 2EV5A 2MD5A 1UB9A 1YS6A 4EJTA 4P5OA 2GIVA 4EJOA 5CJ9A 5L3EA 1S3JA 2GAUA 2O61A 1S6LA 5E17F 2O3FA 3LPXA 3WTYC 2LKPA 1HXDA 3FF5A 3FX3A 1IAWA 2AXLA 2HWVA 4HF0A 3L09A 2XVCA 3SHFA 1GXPA 2XIGA 2P5MA 5LLQA 3B73A 4LD5A 3QAHA 1RIOH 5FO5A 1W5SA 2O0YA 2Y0MA 3KLNA 1WWXA 2F5FA 3E6BA 5J8FA 1G3TA 1P2FA 3TOBA 4EJWA 2ZNYA 4YFNF 1U8RA 2BV6A 5BPIA 3I54A 4LMYA 1F4KA 1K78B 3F22A 3DKWA 1V3FA 3EETA 1U5TA 3O3KA 2IA0A 2MBFA 1WQGA 5EEHA 4RS8A 2RKHA 1U3EM 4LB5A 3QPTA 4HOBA 3BOQA 3M8EA 4R1HA 1XDSA 3HRTA 2GA2A 4KN4X 2UZKA 4B09A 1ULYA 2XHKA 1JXSA 3JTGA 2QUFA 4G6QA 4J3NA 4PGHA 3ERED 5K1YA 3WU0A 1WQ2A 3FOEA 2ZKZA 5DCFA 3MZHA 2H27A 2KIMA 3Q9SA 1QZZA 2KWAA 3E6MA 1Z6RA 3WTWC 2CFXA 2ZMEA 4M9ZA 1IRFA 2BEOA 3BDDA 2P7VB 1HSJA 4G94A 3K9TA 1SD7A 2WV0A 1XCVA 2PG4A 2XCOA 4L9NA 4UUVA 4KIFA 2V1DA 3O2PE 4IRIA 4R79A 3LQQA 2VBXA 3KEOA 4ZYHA 4P55A 1IW7F 4I02A 3BJ6A 4Q5SF 3NRVA 3CLOA 2YX7A 2ZFWA 2KJBA 1LNWA 3JTHA 2D1VA 2ISYA 3C1DA 4UV9A 2P5VA 4GYGA 3KP3A 4OU0A 2LDUA 2DFIA 2IJLA 1FLIA 4N9HA 1XDUA 4MGRA 4OMYA 2V1UA 3ZPLA 4A2UA 2FNPA 4HX7A 2FQ3A 1ZREA 4HAMA 3DPTA 1Z7UA 4HLXA 4BHBA 1HW1A 5LHGA 2IT0A 2EA4A 4MQVA 2XAFA 2F2EA 2XKPA 3F8MA 2GQQA 3KCCA 2DBBA 2XV4S 4WWCA 1G6NA 2QBYB 4ENJA 3GFJA 4D0PA 4EM0B 2M8EA 2FBIA 1K79A 1BI3A 3P9KA 1XMAA 1ZG3A 4FT8A 5BQTA 3VA7A 3TDZC 3TKYA 3KP6A 1HKSA 2W84A 4Q48A 5L3GA 3WTZA 4M72A 5E1ZB 1S29A 3CUQA 1QNTA 2A6EF 3L4KA 4AVPA 4E70A 1RZ4A 4XLPF 4WXDA 3C3WA 3JSPA 2HKOA 3I71A 1O3QA 2QBYA 1I6XA 1FSEA 3KP7A 3I5UA 4FM9A 5FB2A 1ZHFA 3ZP5A 2P4WA 3NQOA 4WX9A 1G3YA 1KGSA 1RUOA 3ZMVA 4P9FA 3FHZA 3BUEA 2WWYA 4A12A 4LG0A 1T39A 2K02A 4GO1A 1IF1A 2VBZA 3GUDA 3GFMA 4Y15A 4NHJA 3I4PA 1UHWA 1OMIA 1AB4A 3VOEA 1P4WA 4L0ZB 1KU7A 3HHHA 4Z2YA 1F1ZA 4G0UA 3WODF 4O6JA 1UCRA 2XUBA 3F6VA 2D2WA 4Y13A 4XSXF 1ZRCA 1SD4A 3ZMZA 4PGGA 5E20A 2WC2A 3JAMK 1T6SA 5DCMA 5AIPA 1LEBA 2CSOA 2BE5F 3DXJF 2J5PA 2YPRA 4ZYEA 4K2EA 3F6OA 2CO5A 3OPFA 4P9UA 4AIKA 2FSWA 3U9GA 4UXNA 2X4HA 4UNOA 2PLYA 1XGMA 3E5UA 4CGZA 1ISEA 2L02A 4UVAA 2FF4A 3COAC 3WE3A 2PBIA 1FSHA 3U1DA 2Y48A 3E5XA 1TQPA 5HS8A 1SFEA 3V7SA 1BOAA 2DK5A 4UHTA 3VB2A 3BPXA 2A69F 1MDMB 3GLXA 4EJVA 2PEXA 4BHCA 3FM5A 1W4MA 4L5IA 1WIHA 1P92A 1TQMA 2B0LA 2XAGA 1UHMA 3KLOA 1HBXG 2XROA 2DK8A 1TLHB 1HQCA 4LK1F 4A0ZA 3L9FA 3MAJA 4A5MA 2QQAA 3RKXA 3KETA 1B9NA 1IN7A 1R1TA 1EV7A 4U0VA 4CXFA 4G0WA 1F9NA 1RNLA 3KFWX 2OQRA 2XAHA 2ACJA 1ZG5A 3M7GA 2K4BA 1Z05A 2OU2A 3TO9A 2MC3A 1MGTA 1AWCA 2P5LC 1PP8F 4I7HA 1E17A 3RPQA 3ABUA 5L3DA 2ZNZA 3VEPA 5DD4A 4EM2A 4BXUA 4RGXA 4M6YA 3E6DA 2G9WA 1E2XA 2A5YB 5LEKA 2HEOA 2W85A 2DQLA 1U5TB 5CLSA 5DUKA 1IRGA 1B4AA 2QENA 4NQWA 3WTVC 2P8TA 5D5WB 1IN4A 4FX4A 3BZ6A 3OREA 4G9YA 4IF4A 1TW2A 2L01A 2XAJA 4QLCU 1W7PD 3REOA 4I09A 3K1MA 3V4GA 4IXAA 4GCVA 1BBYA 5F64A 3SZTA 3QU6A 3LA2A 4EM1A 1ZARA 3J81K 5DV5A 2UXNA 1QQIA 4EQQA 2QZ8A 3V7CA 3K1NA 2P7CB 4I0AA 1HKQA 1EK8A 1D3YA 3QP5A 1FYLA 4AIJA 3ZN1A 2XAQA 1MDMA 3FMQA 5D4RA 3NUHA 4KA4A 2D45A 2P6SA 5LHIA 3GFLA 2WTEA 2G7HA 5D8KB 2JTVA 3CUOA 2EB7A 1CGPA 5D6FA 2QQBA 3EYYA 2FXAA 3E5QA 3DFGA 3R4KA 2COMA 3LQRA 2NNNA 2ETHA 1LEAA 3DEUA 1EH1A 3GZ5A 1LDDA 4DDQA 2F5CA 4YFXF 4U0YA 3BJOA 3GYHX 5JVTA 1LJ9A 3QRFF 1BC8C 3QX3A 1TNSA 3CDHA 1IS1A 1K78A 1FZPB 1QZYA 1J59A 2O03A 3SXYA 1EH8A 1XD7A 5E1WA 2HGCA 5HVQC 2Y75A 2IA1A 2QM3A 2KKOA 4H0EA 2EFQA 3I0TA 1JE8A 4JBAA 2VODA 3FXRA 4L0YB 2OD5A 2PHCB 5DDGA 3BPVA 1SD5A 4MQ9F 2OZUA 3T8TA 1DPRA 1SAXA 3SQNA 1ON2A 1XSXA 3DP7A 5HS7A 1OKRA 1P4XA 4LGWA 1KU9A 1R00A 4OIOF 4OIQF 4EV0A 3FM3A 3F3XA 4M6XA 2RGRA 1QGPA 3R0AA 2QQ9A 3B02A 3RJPA 3KZYA 3HRSA 1GXQA 1BJAA 2CQKA 5CVIA 1KYZA 2VC0A 3IWZA 1R58A 1BI2A 5D8LB 4M74A 2M1BA 4WXHA 5HS9A 4BYYA 2HYGD 2QWWA 1ON1A 4ESFA 3PQJA 1UFMA 4M71A 3K2ZA 4WXCA 4ZH4F 1XCBA 3GEZA 3GF2A 3I53A 4OINF 1WSUA 3IHUA 3ISPA 1C0WA 3AAFA 5HLHA 1B9MA 4ASNA 2Z5UA 2HKXA 2V9VA 5LRRA 2EV6A 2CW0F 1U78A 4N0BA 1USTA 5DD8A 3CUQB 1TNTA 1ZRFA 2IVMA 5ICFA 2BBYA 2JRTA 5L3CA 4CHUA 4HA8A 5A2QK 2STTA 4M73A 1FOKA 4HX8A 3KP2A 3N97A 2YSRA 1AOYA 3T1BA 4IRGA 2DPUA 1ZGAA 3CO7C 1L0OC 3FOFA 2HTSA 2HQRA 4IPAA 2DO7A 2A6HF 1RUNA 3EDPA 4HF2A 2FE3A 3I58A 4R8HA 3T8RA 1WQHA 1OYWA 2XGXA 4EGZA 5K5OA 4LLNA 3RDIA 4HBLA 1TBXA 2V79A 1MJBA 1T38A 3R0JA 1FBSA 1R1VA 1ZG1A 1U2WA 1DP7P 3EQLF 4A0YA 3GW2A 2GZWA 4I2OA 2O6GE 4S04A 4AWXB 5IT9K 1H9GA 3V8JA 3LA7A 4KUMA 5D5VB 3WTSC 1O7LA 1YW9A 1MJAA 2QYOA 1KYWA 3LSTA 3VFZA 4P96A 2HTJA 2VOOA 2PQ8A 1R7JA 2JT1A 4AD9A 2XASA 4MNUA 3H3ZA 3D5LA 2KIFA 3T0YA 3KP4A 2RNJA 1YW8A 2F5EA 3J81Z 2MA3A 5CYVA 5ILUA 1ZH5A 1DD5A 1J5YA 3HRUA 3TO6A 1TTYA 5KK1A 1W7PB 4XRFA 1JHHA 2E1NA 5FD5A 3L00A 1WKMA 2QLZA 3BY6A 3MEXA 3KP5A 3ABTA 1FBUA 3SFZA 4GXOA 1H9TA 2DU9A 4EVIA 1JGSA 3G73A 4DQ2A 1OPCA 2VE8A 2RC4A 3FMRA 4S05A 1FWZA 3F8FA 4ON0A 1HSTA 1BIAA 1BC7C 2HR3A 1BGWA 4ESBA 2H09A 2YU3A 2Z33A 4L9JA 1W7PA 2MH2A 1FBQA 4UVCA 4HYEA 3T5XA 1IZ1A 4NB5A 3Q9VA 3U2RA 2BGCA 1ZLKA 4HV6A 2OBPA 1H0MA 1R1UA 3LA3A 1LVAA 5LGNA 5L3BA 2NYXA 1TW3A 2IRFG 5HLGA 1S7OA 4A5NA 2UWMA 2RDPA 1ONVA 2F5DA 1P4AA 2EFOA 1D8JA 3P9IA 3HIFA 2XCRB 2G7UA 2Q0OA 3BJAA 4RGRA 3C18A 2DAOA 3HTUA 3EUHA 2R7DA 1YIOA 3ZN0A 2MH9A 3GWZA 3I59A 3IRQA 3WGHA 3CUQC 2IPQX 4MEXF 5HOOA 2DTRA 4BQAA 2EA2A 3FMSA 2UXXA 1DDNA 3CTAA 4MHGA 5LGTA 5JR3A 2RVCA 1RI7A 2L54A 4YG2F 1REPC 3I59B 3RKWA 2ZXJA 2JZYA 4Q4ZF 1U5TC 3IRRA 1FP1D 3W6JB 2ZFZA 2HZTA 4HF1A 1W5TA 2OQGA 1D8KA 2ZBKA 1BN5A 5FFZA 3OV8A 2W25A 1Y0UA 4G8XA 2TDXA 1HW5A 1Q1HA 4BHPA 5BS6A 4LB6B 2K27A 4F7ZA 1FP2A 1ZRDA 2PMHA 3F8BA 2FMLA 4B8XA 5A2QZ 4HDUA 4PZJA 2LF8A 3WGIA 3EYIA 5K5RA 5D4SA 1G4DA 4LFUA 2A07F 4XSZF 2VE9A 4MEYF 3TOAA 2STWA 1L3LA 5CVRA 4FHTA 4KAWX 2EWNA 5ICEA 3WE2A 2O8XA 4I0BA 1SD6A 4CYDA 1NHAA 1IN6A 2YX4A 1ZGJA 1DPUA 4A0XA 3ML6A 3QU3A 3QP6A 4UVBA 2HS5A 1B1BA 1WRJA 4HV5A 1GE9A 1J2XA 2FNAA 3MZYA 4KICA 2FRHA 3TO7A 3V8LA 1USSA 1QBJA 1FY7A 4EMSA 2CGPA 2KIUA 3J7AO 1U6GA 3V7RA 2AS5F 3HHGA 3LAJA 3K69A 3H92A 4IRHA 4HQMA 1DUXC 2HYFA 1FT9A 3WG9A 4JQFA 1KQ0A 2RN7A 1ZN2A 3M1EA 1J75A 4CDGA 3MWMA 4CO8A 2DLLA 2FMYA 4BH9A 1XMKA 3OOPA 5CVVA 2K4JA 2QVOA 3I64A 4ENKA 4HW0A 3GX4X 1HW2A 1KU3A 1HKTA 3L2CA 1YYVA 1D5VA 1BIBA 2M45A 3GXOA 5E1XA 3ZMSA 2D1HA 3MCZA 2ADUA 2L3DA 1T2KA 5H6QA 1MD0A 4IJAA 2H6CA 1LDJA 1O7FA 4EJUA 3K0LA 2OA4A 1TQIA 1PDNC 1OR7A 2GXBA 2VT3A 3IL2A 1O57A 2E7XA 3K1PA 3MFKA 1GVJA 2NAZA 1YTYA 1J9IA 4KT5C 1IN5A 4Y17A 3HOTA 5ICGA 1CF7A 3R60A 2Z99A 4EGYA 4HQEA 5FLXK 2CYYA 2A61A 2H6BA 4LG0B 2H94A 5BOXA 4LLGF 3LFKA 3H3UA 5D5UB 4I98B 3HTSB 3HSEA 2A3SA 3WTXC 1LQ1A 1I5ZA 4Q47A 1S8NA 3KE2A 1EH7A 4RB0A 2OZ6A 3RIRA 2W24A 3RPUA 4LLLA 2GWRA 1B6AA 4PDKA 1ZAOA 3BWGA 1XXBA 4WCGA 1XSDA 1MZBA 4KDDA 2ISZA 2EFWA 3M9AA 4YIFA 1XXAA 4N9IA 1EH6A 3O6BB 5LGUA 4LJZF 1XXCA 4KNYA 3LWFA 2R3SA 3N4MA 2ZMEB 3DQVC 1KA8A 3TGNA 4KIGA 3ROUA 1IXRC 4OMZA 1PUEE 5JHUA 1P6RA 3IC7A 3SZPA 2RV8A 2ZCWA 3HSRA 2VXZA 4BAYA 2HOEA 4RGUA 3F23A 2DW4A 2NRAC 2XCQA 2C6YA 4L5JA 3CAGA 1R36A 1VTNC 3RYRA 3J80Z 5FLXZ 5E8IA 2M87A 4CZZA 5JVOA 3F21A 4OOIA 4FX0A 1BI1A 2PI0A 1FYKA 3QPHA 1ZYRF 2J5OA 4RB2C 4ZZDA 1YLFA 1QO0D 1K7AA 3WU1B 1R22A 1I1SA 4L9VA 2P5KA 2PN6A 4RB1A 2MLKA 4XBFA 5E8GA 4YFKF 4AIHA 5DEQA 5ILVA 5AIQA 1K6OA 2IA2A 1G3WA 2VT2A 2DQRA 3HOSA 1JHFA 5DYMA 2OAZA 3ECHA 1IUYA 2Z3YA 1SFXA 4OIRF 2VN2A 5LRSA 2FBHA
chains in the Genus database with same CATH superfamily
5JI6A 5HDNA 2E1CA 1BM9A 4LK0F 4A6EA 3FKIA 2DMPA 4NNJA 2KJCA 5H20A 2YR2A 3L2RA 1FOXA 1SFOC 1STZA 1IXCA 1B72A 3MQ0A 2E71A 2B63J 4IOAF 3A01A 1LB2A 1NTCA 1I39A 4FE7A 2HFHA 1FIAA 5ERIA 2CFAA 3GTLJ 2ZO4A 2BXYA 4IVNA 1KQ9A 4ZYGA 2KIQA 1A04A 2P6TA 1D0XA 3C7JA 3P9CA 3V42A 2IW5A 3ELKA 3ULQB 4N4NB 3DBHB 3HUGA 3VYUB 3CCLI 2KL4A 4BKXA 1FYMA 4IQJA 3BR2A 3MVPA 4FETA 3K70D 5F0CA 5C44J 1QRYA 3S8PA 4U7BA 1SFUA 1IG7A 4IHVA 4G7OF 4U88A 4A3CJ 1BJTA 4GFQA 3TDUC 3CCYA 2ZC2A 2WAQA 1MKMA 4BBSC 3ZMUA 1YJNI 2HDCA 1X31C 3W6KB 4JOMA 5K7ZA 1P7JA 4U0WA 2ZSHB 1R5ID 2FBKA 4II3A 2VONA 4KB4A 2NNYA 2I5UA 3DF8A 1TWHK 1GHCA 1J7KA 3DV8A 4A6DA 4X0GA 4OIPF 4OINA 1IN8A 4XN0A 4BDYA 3GTPC 3BR6A 3MKYB 3FXMA 4CH7A 2ESNA 2DN0A 1WQFA 1H8AC 1X1AA 3JW4A 1K4TA 5CPRB 2JA6C 1SMTA 1I3QA 2Q1ZB 1E3HA 2XRLA 1R9TA 1O3RA 5IT9Z 3CCQI 1INNA 5FJ8J 1T98A 2LY1A 3GFIA 1TWCK 3Q3QA 3A2KA 1TL8A 4P5BA 3FWEA 1S7AA 2XB0X 3GO5A 3NEUA 3UKGA 2E2JK 3FXUA 2WAQD 1YW7A 2K5CA 3HRMA 1YJWI 5D4DA 2V6CA 1I27A 2PJRA 2KZVA 3BR0A 5H6RA 1KU2A 2L7FP 5LHHA 2E2HK 2FA5A 1XB4A 4UV8A 2EZLA 3IKTA 2E2JJ 2M5WA 3K10A 2PMUA 3CF5F 4A3JJ 1KQ8A 4II2A 1XC5A 4ITVA 3BP8A 1MBKA 5TJJA 3WTTC 3OYMA 2BYVE 1VQMI 2PFBA 1V5VA 1SMYF 3DLLF 4IKFA 4D7NA 4KN7X 2KLOA 3VODA 3AD9C 3ZMDA 2B63C 4ZC3A 3IWFA 5HLIA 2QGUA 4I01A 3FBIB 4KMFA 2B63K 1BI0A 3RZOK 1V55H 3PNTA 4O3MA 1AU7A 2PJPA 3L2WA 1Z6TA 2ECBA 4GGGA 4KYWA 1IV6A 1NG7A 3GTKJ 1WJAA 1H88C 4HZFA 1AHDP 1DGWY 4BXXJ 5ICCA 3BZKA 4CICA 3GTMJ 1YFHA 1JT6A 2EV0A 1Y8RB 1XGNA 2K40A 5IYCJ 1V5EA 2X0LA 3KZZA 1YQAA 5DCMB 2V1XA 3RKYA 3ZQIA 4G0VA 4KB2A 3SZGA 3FZVA 1YX3A 3H3VD 4IHYA 3F8NA 2R7WA 4C3JC 2XC7A 2PA8D 2Y3PA 1ZYRA 4ENNA 5KVRA 2VOPA 2NVYA 3BCAA 3BTIA 4DBQA 2EBBA 2HOAA 3HGGA 2K3FA 3KEQA 2JA7A 4RGSA 4G7HA 4ETSA 3CDIA 2LR8A 2NS0A 2AHQA 5FKOA 2XGEA 4ZYDA 4RB3C 2K7LA 1R5GA 1V4RA 1QPMA 3M8FA 3S17K 2Z9OA 1FX7A 1F5TA 3F8CA 2WY8Q 2FOKA 3ZXSA 2IBDA 4KIBA 1R9TC 3N05A 3TP3A 1EI6A 3RI4A 2XRNA 1H89C 1JT0A 3N0BA 2FQTA 1LDKB 2JSCA 3ZMTA 2JPBA 1X1CA 2DI3A 3LSIA 2NVYJ 1B4BA 2LP0A 3E3VA 3OR2C 2V6TA 3S2WA 2LLKA 4RAZA 2PMZN 2Y31A 1ODDA 1Z3YA 3GBGA 1D1AA 3IKVA 4XONA 4G7ZA 1VQ4I 1KONA 4A3FC 3DKXA 5CVJA 5D6EA 2R7ZC 4A3FK 3FXQA 3S2DK 2AQEA 2E2HJ 2K3PA 4KFCA 1SANA 2KDZA 2H1KA 3I4MJ 3S2HJ 1F36A 1MH3A 5HDKA 2V4JC 2CW7A 1TWFJ 1UG0A 4Q5SA 3RYPA 3SDBA 3TFIA 2MLGA 3GTLA 3OYLA 2WB1D 2Q2EB 3AD8C 5B66C 1G51A 1J0RA 1T95A 2Q8KA 4RAYA 4A3IC 2YU9C 1EJ9A 1MBGA 3JAMZ 3FBNB 3LAPA 1NK2P 4HDVA 1XGOA 1WSRA 1CF7B 1FNNA 4A3MK 3WGGA 5JFRA 2GSNA 2E2HA 3FKJA 1IXSB 2F48A 3AG2H 4O5VA 3G2BA 3IH2A 2V6EA 1IUFA 4A3LJ 2E19A 1I50A 5M3MK 5J6XA 5FFXA 1YX2A 1WI9A 1TWFA 3G3ZA 3Q5FA 2NVQK 1XN7A 3ABKH 2VBYA 1K83J 5L3FA 1TWAA 3DU6A 2LTPA 2LNBA 1MW7A 4U7DA 1O4XA 4QIWD 2R5YA 3E6CC 2MC4A 2DT5A 2DJIA 2KRFA 4ZDOA 1ACIA 5K5QA 4KDPA 5JLWA 2ZJ2A 2CWEA 1OYIA 1Z91A 3K6GA 3GTJA 4DYCA 4DNCA 2Y0SD 4M9XA 4XORA 3LMMA 1S5LC 4GTBA 2MABA 4KN7A 4E7KA 3ASNH 2JA5K 2ESHA 4J19A 1TWHC 2OCCH 1MJ9A 1SAUA 5TRDA 4YIIA 4IHSA 3FXLA 2GBYA 2HDDA 1O3SA 3OEPA 4RMNA 1ZLJA 2MW8A 3GTJK 4WK8F 3TQNA 5FGMA 3BROA 3R6SA 1HLVA 5EEGA 3L7WA 4ESJA 2VQGA 1X3UA 4QWQA 2NVYC 4G6DA 2GSOA 1SFOK 2BY2A 2LSOA 1G3SA 5KAFC 2JA6A 1IJWC 5F08A 5BMZA 5IORA 4AM3A 3GZ6A 2JSPA 1PP7U 1NH3A 4G7HF 1TWFK 4JK1X 1ETXA 3EUKL 3D0SA 4KMHA 3P7NA 1A6IA 2XKOA 1TWHA 4A3KC 1R5HA 2GA1A 2A68F 3TFJA 1Q1VA 4E4HA 5LEJA 1FC3A 1B59A 2L4AA 2E7WA 4IL6C 1XSVA 4CZCA 4I6ZA 2GAHC 3PQKA 1E3OC 5IT3A 1W1WE 1YCLA 2E2IC 3K7AJ 1I1GA 4BNCA 2IEKA 2HVQA 3W2WA 1IRZA 2JPCA 1E3PA 4G7ZF 3FK6A 4GYIA 3ZQ7A 1WJDA 2L4MA 5J8CA 2EH3A 4MTDA 3BLYA 4MTEA 4HX4A 5LBQA 3DPLC 1PUFB 4HLYA 3PFIA 2PX9A 3G4CA 1SVMA 1PUFA 2RGVA 5D5XB 4KMUX 5DUIA 6PAXA 2RQPA 2DTZA 2EK5A 3HSFA 5M5XK 5FD6A 2YUSA 1Z9CA 3IH3A 2LRDA 4KJZA 2JUGA 5HDGA 3V8KA 2I8DA 5AONA 5EG0B 1O3TA 4LITA 1O2BA 4C2UA 3ECOA 3OYBA 2M30A 5ED4A 4IHTA 3J80K 1YIJI 3CJNA 3E97A 2GXAA 2IGOA 2R7FA 4I76A 1T0FA 2GXGA 1YO5C 2EJRA 3E0JB 4KC6A 2GM4A 5ILSA 1W0UA 4M9SA 2DA1A 2E2JC 1K83C 3IH4A 1ETWA 2LF7A 2FOWA 2ICWG 3FKIJ 3WTUC 1Z1DA 2QKMB 2Y0SA 1HA8A 2GOXB 4L18B 4XLNF 4KMDA 1R23A 2W57A 3O8HA 3HOVJ 4TV7A 2EFNA 2H8WA 5FKNA 3GTPK 3VSLA 1W36D 2IP2A 4ZZLA 2DPDA 3A02A 1HC8A 1TWGC 4CYCA 3HC7A 5EJCA 3TEDA 1B72B 4A3CK 4KISA 3IUOA 2CRGA 3HYIA 1LE8A 3I4MC 3S2HC 5IOZA 4B47A 3RTRA 3UR3C 3GTPJ 5IYBK 2HQNA 4PJMA 1ETOA 4X6AJ 3HXAA 3R61A 1FPQA 2MFZA 3L4JA 3W3CA 3F72A 2EPFA 4G6TB 5EDNA 4LK1A 2HQ5A 3QOPA 5E18F 3H0GK 2LKSA 3H5AA 2EFPA 2FEZA 1YG2A 1D0ZA 4PCQA 3HOYJ 4FQGA 3CO6C 1MMNA 1YJ9I 4KM8A 3JSOA 1S7EA 4IQ4A 2TCTA 2R5ZA 1XGSA 2ELHA 3JRAA 3L2QA 2VBWA 2VC1A 2CG4A 2DOAA 3OR1C 2HNHA 5BPDA 2XF5A 3GVAA 1DP3A 1OYYA 1I50J 1YS7A 4V2FA 4WF2A 1X19A 4L9TA 5F1RA 2X9DA 2FU4A 5CVUA 2Q2EA 5IP6A 5F6FA 5E79C 4XN3A 3OYHA 2K86A 2DA3A 3BR3A 4XMYA 1FTZA 2LBFA 4ENMA 4AYBD 1JQWA 3MMLB 3AFHA 1TZLA 1ZVUA 1RPWA 2EV5A 2MD5A 2EBIA 3Q0VA 3JRFA 1UB9A 2B63A 1YS6A 5DM6F 5FLVA 1V5FA 2X1DA 4EJTA 3HKZN 4KT6A 4P5OA 2GIVA 4EJOA 5CJ9A 5L3EA 1S3JA 3PJRA 3G4SI 2AO9A 2GAUA 1QVTA 4DOZA 2O61A 1S6LA 4P1WA 3SEQA 1PVEA 3GTOA 2EILH 1DQUA 2M4KA 5E17F 2X1CA 1J6XA 2XDVA 3S1RJ 3RZDK 2O3FA 2CW0A 3LPXA 3J7YJ 3WTYC 2NS7A 1MMDA 1N75A 5JHFA 2LKPA 1HXDA 2QSFX 1ZTRA 5IOYA 4NDLA 2LREA 3FF5A 5E3NA 3NWSA 1D5YA 3FX3A 5K7HA 3CCMI 1O29A 4BY7K 1IAWA 2IGMA 4XKBA 4LIVA 2AXLA 4MFDA 3HKZD 3GTOK 2HWVA 4HF0A 1SFKA 3L09A 3NARA 4A3JC 2XVCA 4RBOA 4XR6A 3SHFA 3K4JA 1GXPA 2BW3A 5EYRA 3VYRB 5FLMJ 5KHDA 4GTAA 2WV1A 2XIGA 4M3BA 5M5XJ 2P5MA 5LLQA 1MNDA 3B73A 4CCJA 2F4IA 2D5VA 2VQCA 1OCTC 4LD5A 2HU9A 1K61A 3QAHA 5GTIC 1RIOH 5FO5A 4GTEA 1W5SA 1R6RA 2O0YA 3AG3H 2Y0MA 3KLNA 2M34A 1WWXA 4C3IC 2F5FA 3PO2K 4A3DC 4C3IK 1ZQ3P 3PO2C 3E6BA 5J8FA 1G3TA 1P2FA 3TOBA 2LY2A 4HSRA 4EJWA 2ZNYA 4PJLA 4YFNF 1S72I 1JJ6C 2Y2ZA 4XNFA 1U8RA 2HPMA 2BV6A 5BPIA 2WAQN 1MMAA 3CMMA 3BG5A 3I54A 4LMYA 1K78B 3F22A 1F4KA 3GTLC 3DKWA 5KCMA 1V3FA 3EETA 1U5TA 3O3KA 3BQZA 1ETYA 2IA0A 2JVGA 1B8IB 2MBFA 4C30A 1WQGA 1RKTA 5EEHA 4RS8A 2RKHA 1WPKA 4AUXA 1U3EM 3RZDJ 3S3NA 3HEFA 4LB5A 3K4KA 1Z77A 3QPTA 4M3DA 2DJNA 3HBLA 3K2AA 4HOBA 4AYBA 4F3QA 3FISA 3OYNA 3BOQA 3M8EA 3I55I 3VYSB 5C3EC 4R1HA 4QTRA 4RM3A 2E2IA 1OCCH 4FASD 1XDSA 1USMA 3HRTA 2GA2A 4KN4X 3OY9A 3HOXC 2UZKA 4B09A 1VF9A 3HOXK 3S16J 3GEIA 1ULYA 2XHKA 3CF2A 1JXSA 2ME0A 3BZCA 4KITB 1K83A 1USOA 1HDPA 3JTGA 3H9GA 4XRMA 1YI2I 4KM9A 3H9JA 3L1PA 1LFUP 2F6CA 2QA4I 2OTLI 2QUFA 1JJ8C 1O27A 4G6QA 1F93A 1ETKA 4J3NA 1HCRA 4AH6A 2E2IK 4PGHA 4C3HK 3ERED 5K1YA 3WU0A 1WQ2A 4CA0A 5IYBJ 3GIRA 2NVUB 1X4PA 1WOPA 3FOEA 1WCMJ 2ZKZA 5DCFA 3MZHA 2H27A 3CCEI 2KIMA 2V6UA 1V5GA 3Q9SA 3AL0C 3EUHC 1QZZA 2DT7B 2KWAA 4C3HJ 3GTKC 3MN2A 3T02A 3PO3K 3VSKA 2K85A 3E6MA 2K9LA 4KMAA 1Z6RA 3NWTA 3WTWC 4BACA 2CFXA 1VLOA 3OIPA 2ZMEA 4M9ZA 2LKXA 4LIUA 1WOOA 1IRFA 2BEOA 3BDDA 4IHXA 3DKYA 2AQFA 2P7VB 1HSJA 4G94A 1T56A 1SEUA 4DYQA 3EPZA 5C4JJ 3K9TA 1SD7A 4UY8I 5IP7J 2NOGA 1Y1VA 1BJZA 2WV0A 2R7VA 1XCVA 4MEXA 3BTCA 2L7ZA 2PG4A 4CUGA 2XCOA 5B1AH 4L9NA 3BP3A 1JUPA 5C3EJ 4UUVA 4KIFA 2V1DA 3O2PE 4IRIA 3A03A 3HUGB 4R79A 1EFWA 1OLTA 4BDZA 1KQ4A 4F91B 2FQOA 3LQQA 1X2MA 2OJED 1FJLA 4GFBA 2VBXA 2JA5A 2EIKH 1R71A 1YX5A 2V7FA 2XPWA 3JCUC 3KEOA 3LSGA 2V6SA 4ZYHA 3GDZA 3GTMK 4P55A 1IW7F 3K4LA 4I02A 3BJ6A 4Q5SF 3NRVA 5J1RA 4C2MJ 3G1LA 4AU7A 3CLOA 4BJ6C 4HG2A 4XCHA 4YIRX 4NC6A 1MNEA 2YX7A 2ZFWA 2KJBA 4LG3A 1LNWA 3D1NI 2QEXI 3PO2J 2L2OA 3JTHA 2D1VA 4PK4A 5C4XK 4Y7NK 2ISYA 3S0XA 2MGQA 1WORA 1X1BA 4EEFG 2CJJA 2NS8A 5TGTA 3ZRGA 4XRSA 3C1DA 4UV9A 2P5VA 2IGNA 1YNJA 4GYGA 3KP3A 4OU0A 1X1PA 2LDUA 2DFIA 2IJLA 1FLIA 1FMVA 4N9HA 4DBRA 4XLAA 1XDUA 4MGRA 2VL8A 4OMYA 2V1UA 5JFEA 4XM3A 3RSNA 2OF7A 3ZPLA 4A2UA 5HODA 2FNPA 2XF7A 4HX7A 2FQ3A 1ZREA 1NK3P 2NVTK 2ZXWH 1VNDA 2NVTC 4HAMA 2PMZA 2R7ZK 3QYBA 4D9JA 1HI9A 3BTJA 3DPTA 1Z7UA 4HLXA 3HJEA 4BHBA 3QYFA 5HNFA 2DXIA 1HW1A 3HPHA 4XLFA 5LHGA 2R7UA 2IT0A 2EA4A 2F4MB 1X4OA 3GEHA 4KN4A 4MQVA 2JA7C 2XAFA 3W2AA 1WCMA 3OYGA 3B6CA 3HPGA 2F2EA 2XKPA 3F8MA 2GQQA 3W6VA 4BGDA 4FTHA 2VUMJ 3PSIA 3S17J 3KCCA 2DBBA 3KIOA 2XV4S 3F0CA 4XLCA 4BE0A 4WWCA 1G6NA 1VQOI 2QBYB 3GTLK 3PSFA 4ENJA 4E7JA 4C3JK 3GFJA 3OYJA 4D0PA 1TWCJ 4EM0B 2M8EA 2FBIA 2EIMH 3K70C 1K79A 1BI3A 5IP9K 3H35A 4GTDA 4BEHA 2PMZD 4BBRC 2KFDA 3P9KA 3RCOA 1XMAA 1ZG3A 4FT8A 4RAFA 5BQTA 2RH6A 3K7AC 3TDZC 2E1OA 5IYCK 3VA7A 4NBQA 3TKYA 3SZYA 3S17C 3KYCB 3KP6A 4NC7A 1HKSA 2W84A 4Q48A 5L3GA 5GPAA 3WTZA 2VB6A 1W0TA 4GTFA 4IOCF 2B7EA 4M72A 5H2FC 4GZYA 4MIMA 2RNGA 5E1ZB 3S1NC 2ZFUA 3BR1A 1S29A 5F0HA 4KATA 4WILA 1UJ8A 4WJ4A 2A6HA 5GAHJ 4BE1A 3CUQA 1QNTA 1WH7A 2A6EF 4BY1J 3L4KA 4AVPA 3G71I 4E70A 4QSHA 1RZ4A 3OL3A 3M3YJ 2CW8A 3HOYC 1TC3C 2OTJI 4XLPF 3OYIA 4WXDA 4CCLA 2UUZA 2O9LA 3C3WA 4UB6C 2NVYK 1ZK8A 3JSPA 5E3LA 1N78A 3K4BA 2HKOA 1WHUA 2LH9A 3I71A 1O3QA 2KISA 2QBYA 1I3QC 1I6XA 2R93C 1FSEA 2R93K 1QVUA 1HOMA 3KP7A 3PO3C 3I5UA 4FM9A 3LOCA 4W97A 1ZHFA 3MD2A 5FB2A 3PNVA 5J4VA 4B1RA 3ZP5A 3I56I 5M3FJ 3GEEA 3VWBA 2P4WA 3S1MK 3TMOA 1XX5A 3ZOBA 2X6XA 3NQOA 2R7QA 3DBRB 4WX9A 1G3YA 1KGSA 4D5CA 2CV0A 1RUOA 2QSGX 3AD7C 3ZMVA 4P9FA 4F92B 3FHZA 3RQIA 3FXOA 3BUEA 2W7NA 4C3JJ 4JP0A 2WWYA 3PIOF 1X2NA 2E34A 2XB5A 4RDUA 2EZHA 3DWLE 4A12A 4LG0A 5TISC 1T39A 2X1EA 5IPAA 4LK0A 2K02A 4GO1A 1IF1A 3DTIA 5EGOA 1VQNI 4XLPA 2VBZA 1POGA 3GUDA 2QQ8A 1ZGWA 3GFMA 2M4GA 4BY1C 4Y15A 4RA2A 1YRNA 3I4NC 2BXZA 3I4NK 4NHJA 3I4PA 1UHWA 1FEXA 1OMIA 2BHYA 3I3LA 5L46A 1AB4A 3VOEA 1EA3A 1P4WA 1JKRC 2GAGC 1VQLI 4L0ZB 1KU7A 5BNGA 3HHHA 1IQ0A 4Z2YA 3CD6I 2HYJA 1F1ZA 2Y0SL 3LL7A 4X1EA 2HOTA 1EQRA 3H5RA 4G0UA 2XGCA 2VJJA 3WODF 4O6JA 1A36A 3LSRA 1UCRA 3HOVC 2XUBA 3F6VA 2D2WA 4Y13A 1SFOA 1TWCC 5B1BH 3ONQA 4XSXF 4YFKA 3FKIC 1ZRCA 2BE5A 1MBHA 4A69C 1SD4A 4JYKA 3HOUC 4OIRA 4BLBA 5J1YA 3ZQFA 5KAIC 4Y7NC 3ZMZA 1RC9A 3AL0B 1TWGA 4PGGA 5E20A 2WC2A 3GTMA 3JAMK 1O2FB 1T6SA 5DCMA 2A5WA 2DDBA 3K4CA 5AIPA 1LEBA 4B44A 1OCOH 3Q0UA 3S14C 3A8IA 3VDXA 2CSOA 4HEA2 2BE5F 4XLEA 2JA7J 4RM2A 3DXJF 2J5PA 2YPRA 5CQGA 4ZYEA 3EQLA 3M4OC 2WA0A 3OYAA 4K2EA 4A3IJ 4BS9A 5LFAA 5M3FK 2MG4A 3F6OA 4G12A 2CO5A 2GSUA 3OPFA 4P9UA 4AIKA 2FSWA 2ID6A 2LY9A 2JUCA 2RAEA 3WHCA 4NOIA 3RZOC 5C4JC 3U9GA 4M1XA 1I6HC 1X1DA 4UXNA 3S1QJ 2X4HA 5JLXA 3HB9A 4UNOA 1XGMA 3E5UA 2PLYA 4CGZA 4WJ3M 1ISEA 2L02A 4UVAA 2FF4A 1FTTA 3COAC 3WE3A 2PBIA 1T8IA 1FSHA 4E7SA 3LNQA 1WH5A 3U1DA 2CUZA 2Y48A 3E5XA 1TQPA 5HS8A 3L2UA 2VUMK 4LOWA 1LUJB 1SFEA 3V7SA 3CC2I 1BOAA 2DK5A 4YRVA 4H4KC 4UHTA 3VB2A 3BPXA 4A3MJ 2A69F 3TFHA 5TMFA 3AQPA 3O8GA 1MDMB 3JRDA 3GLXA 4EJVA 4V2GA 4CCNA 2PEXA 1WJBA 4BHCA 3FM5A 2A69A 5IP9C 1W4MA 4L5IA 1WIHA 1V54H 1P92A 1TQMA 2B0LA 4BBRK 5F04A 1KZHA 1WSVA 5GAGJ 3ASOH 2RQQA 2TRTA 1WJ5A 3BR5A 3OIQA 4A3DJ 3FK7A 2XAGA 1UHMA 2CU7A 1DU0A 3KLOA 3FDYA 1RRJA 2E36A 3GTGA 1HBXG 3E1SA 3CJRB 2XROA 2DK8A 1XZQA 1TLHB 1HQCA 4LK1F 4A0ZA 3FXJA 1X3WB 3SYTA 3L2VA 3RZDC 3L9FA 2BHZA 3I4MK 3MAJA 3S2HK 4A5MA 1UMQA 2QQAA 5IYBC 4BXXK 3RKXA 4BXXC 3QQAA 3KETA 1B9NA 3M8JA 3S3OA 2GIZA 5C4XC 1IN7A 1R1TA 3BT9A 1EV7A 2CUFA 3PUFA 2VLAA 2W4SA 4U0VA 4CXFA 2L7KA 4G0WA 2L0KA 1F9NA 2JA7K 1RNLA 4E6KG 3JRCA 1A5JA 3WODA 3KFWX 2OQRA 2XAHA 3S1QK 2ACJA 1JTYA 2M0MA 3M7GA 1ZG5A 5EGEA 4N4OB 2HOSA 3T01A 4A3GJ 2JA8K 3S3MA 1XZPA 2DMUA 2K4BA 1Z05A 2OU2A 2VJ5A 3TO9A 2MC3A 1MGTA 5GP9A 4AYBN 2WADA 4YEJA 2P5LC 1AWCA 3GTGC 1PP8F 4I7HA 1E17A 3RPQA 1Y1WK 3ABUA 5EEAA 2VI6A 1Y1WC 4NQWB 5L3DA 3DCFA 2ZNZA 2QF7A 3VEPA 2LG4A 5DD4A 1Z7LA 4BXUA 4EM2A 1SC7A 4RGXA 4M6YA 3E6DA 2G9WA 1E2XA 4XLHA 5J47A 3JRGA 2A5YB 3KZIC 4NUBA 3JREA 1Y1WJ 5LEKA 2HEOA 3BG6A 4HPQA 2W85A 2M7AA 4MFEA 2DQLA 2KPMA 4UUSA 1U5TB 5CLSA 5DUKA 1IRGA 1B4AA 1OQYA 2QENA 5M5WK 3OYKA 2ELKA 3H9QA 4NQWA 2BW3B 3WTVC 2P8TA 5D5WB 1IN4A 4BQOA 4FX4A 5IYDC 2NVTJ 3PUBA 3GTOJ 4A3FJ 3BZ6A 1JGGA 1RR7A 3OREA 4G9YA 3LSHA 4IF4A 4UUSB 3H3VK 1TW2A 2L01A 2XAJA 4QLCU 3AH5A 1IL2A 1W7PD 2DA5A 2M8GX 3REOA 2ZXIA 4I09A 4X6AK 3K1MA 1VRQC 1WCMC 3HOZK 3S15K 2R92A 5HLTA 3GMEA 4QPQA 3V4GA 1WGXA 3CMAI 3CC4I 3CQZJ 3KYLA 4IXAA 4GCVA 1BBYA 2VASA 4NC8A 1WZ2A 2Y0SN 1AA7A 4HNVA 4PJJA 1JVIA 1UV7A 2KP6A 3CCSI 4XICA 5F64A 3SZTA 2QSHX 1I3QK 4F55A 1W5CC 3GTQA 1I6VA 3QU6A 2DA4A 3LA2A 4PJNA 5M3MJ 4EM1A 3GTQC 2DODA 1ZARA 3J81K 5DV5A 3G1OA 3S1MC 4E7LA 3LSJA 2UXNA 4B48A 1QQIA 4XLNA 2LD5A 2LBFB 2ZUFA 4EQQA 2XAUA 5C4XJ 1AKHB 4QJVB 4PJ0C 4PFPA 2QZ8A 3V7CA 2VPLA 3OYCA 2K9SA 1VH2A 1XPPA 3K1NA 2P7CB 4I0AA 1HKQA 4XSZA 3SEZA 1EK8A 5KNLA 1MBFA 1D3YA 1T08B 3QP5A 1FYLA 4AIJA 1R9TK 4DZJA 3ZN1A 4AYBL 2XAQA 1D0YA 1MDMA 3FMQA 4A3GC 2M2EA 5D4RA 3NUHA 4KA4A 2D45A 4LLGA 2P6SA 5IYDJ 5LHIA 4BY1K 3GFLA 3ZQHA 1FOWA 2WTEA 2G7HA 1HDDC 5D8KB 2JTVA 1WVRA 4HNUA 3CUOA 2EB7A 1CGPA 5IP7C 2KDOA 2P0WA 5D6FA 3OS2A 1Y8QB 1T33A 3H0GA 2XPVA 2QQBA 3EYYA 2R7SA 3S16C 2FXAA 3E5QA 3DFGA 3S16K 3R4KA 2COMA 3LQRA 3JSTA 2NNNA 1SFOJ 1JKQC 1BR4A 1D1BA 2ETHA 2EIJH 3B6AA 2IXSA 1LEAA 4XKVA 1Y1WA 3FKIK 1BOBA 3DEUA 1EH1A 3GZ5A 3OWTA 1LDDA 5CHPA 4FCYA 4DDQA 1WOSA 3BP8C 2F5CA 4YFXF 1Z67A 4MQ9A 4U0YA 3BJOA 3H0GJ 1VGXA 3GYHX 2JRMA 3MKLA 4V19K 5JVTA 1LJ9A 1DCHA 3P5JA 3QRFF 1BC8C 1QU3A 4OIOA 3QX3A 1TNSA 3CDHA 1IS1A 1K78A 2DMQA 1FZPB 1GV5A 1OCZH 9ANTA 1QZYA 1J59A 3DEWA 2O03A 4GT9A 3SXYA 2A68A 3M4OK 4P5AA 1EH8A 1SVLA 5FKLA 4FE4A 1O2AA 3NAUA 3GTKA 1XD7A 5E1WA 4F52A 3SJMA 3ZQGA 3E7LA 1JKPC 1O26A 1IDYA 2HGCA 1HQMA 4C3IJ 2JJ7A 5C4JK 2KRHA 4ZJZA 1ERDA 2K9QA 2X6YA 2Y9YA 1ZKGA 2Y75A 3HGYA 5EZHA 3SDGA 5GADJ 5HVQC 1WJEA 2IA1A 1RETA 2JWTA 2KKOA 2QM3A 4JK1A 1M1EB 4H0EA 3ABLH 2EFQA 3I0TA 2V26A 4Y52J 1O24A 4A3LK 1Y0NA 1JE8A 4JBAA 3RKQA 2PPBA 3SZZA 4ANJA 2VODA 3FXRA 3W2VA 4ZTFA 3HOWC 4L0YB 1OISA 2OD5A 2O5IA 4XKCA 3A4CA 1YRNB 2PHCB 5EGHA 5DDGA 3BPVA 1XPXA 1SD5A 4MQ9F 4G7OA 3IAS2 2ID3A 1VQ8I 4A93K 1TP4A 2IS2A 4A93C 1IGNA 2OZUA 3T8TA 1DPRA 2HXOA 3ZGKA 1SAXA 2HVRA 2HDWA 3M07A 3SQNA 1ON2A 1XSXA 3DP7A 5HS7A 1OKRA 4DZPA 1P4XA 1PJRA 1TWAC 4MEYA 3TBIA 4LGWA 3S32A 4A3KJ 2R7XA 1KU9A 2G0EA 2BOLA 3U1KA 1R00A 2E60A 1ITYA 4OIOF 4OIQF 1MBJA 5FKKA 4EV0A 3FM3A 2YS9A 3F3XA 4M6XA 2RGRA 3KPHA 3PM1A 1QGPA 2E1MC 2QCOA 3LSMA 4QPOA 2OV7A 3CLQA 3S1RC 3R0AA 2QQ9A 3B02A 4A3KK 3S1RK 3RJPA 4LR2A 3KZYA 1S9HA 3HRSA 2YU9A 2R7OA 1GLNA 1GXQA 2CQXA 2DA7A 4BXFA 3H5NA 1BJAA 2CQKA 5EZGA 2OPTA 5CVIA 3GTGJ 4BY7J 1KYZA 2VC0A 2IS1A 4Q4ZA 3KEYA 1WCMK 3IWZA 1MBEA 4A3EK 1R58A 3HOUJ 1BI2A 4B4CA 3JR9A 5D8LB 3A0HC 4M74A 2M1BA 4WXHA 5HS9A 4BYYA 2HYGD 1ZBSA 3CQZK 2QWWA 1ON1A 2NVXK 4ESFA 3PQJA 1UFMA 4M71A 3CMEI 3K2ZA 3S93A 4C2MK 4WXCA 4ZH4F 3GCMA 1FIPA 2KZGA 1XCBA 1ENHA 1OFCX 3GEZA 3GF2A 2JA8C 3I53A 5CKTA 4OINF 4OIPA 1MH4A 3IHUA 1WSUA 2LOOA 3ISPA 1C0WA 3AAFA 4P9SA 1OCRH 4DIQA 3A0BC 3CP2A 5HLHA 1B9MA 1TT0A 5LD2C 1FOYA 4BBRJ 4ASNA 2Z5UA 2HKXA 3DTKA 4AVZA 2V9VA 4CCOA 4Y7NJ 3AKZA 5LRRA 3QWLA 2DYSH 4E7IA 2Y9ZA 2EV6A 2CW0F 1U78A 4N0BA 1USTA 2F4OB 2DMTA 1MSFC 1OCPA 3H0DA 1R4NB 2XGDA 1JTXA 5DD8A 3CUQB 1TNTA 1ZRFA 2XPUA 2IVMA 5ICFA 4IX7A 1QHGA 4Y52C 2A6TA 2BBYA 1UG2A 2JRTA 5L3CA 4CHUA 1Z3XA 4HA8A 5A2QK 2STTA 3X2QH 3OS0A 4M73A 1FOKA 4L5EA 4XQFA 4A3IK 2FQ4A 3DTEA 3LFUA 4HX8A 3KP2A 3N97A 5IYDK 4A3MC 1ORKA 2YSRA 3HM5A 2DFFA 1K4SA 2XSJC 3T1BA 1AOYA 3JRIA 2R5YB 4IRGA 5J40A 2DPUA 1ZGAA 3CO7C 1L0OC 2R92J 2WAFA 2E35A 3FOFA 2HTSA 2WAEA 2HQRA 4BJTA 2CV2A 4QJVA 4IPAA 3KYDB 1FMWA 1RR8C 5HNHA 3ERMA 2BVLA 2DO7A 3BCBA 1UAAA 5IYCC 2A6HF 2R92K 1RUNA 4JX6A 4IHWA 3H0GC 3EDPA 1GV2A 4HF2A 5C3EK 2FE3A 3I58A 4R8HA 3S1NJ 4RAGA 3ESWB 3T8RA 4QIWN 3WG7H 4XIDA 1OYWA 1WQHA 2IS4A 2XGXA 4EGZA 5K5OA 3BQYA 4LLNA 3G1MA 2UV1A 3RDIA 4HBLA 5FRNA 1TBXA 5EGOB 1BDFA 3D5SC 1Y1VJ 3HG9A 1MJBA 2L5QA 2V79A 3GSIA 2ZMEC 4ILDA 4AC0A 1T38A 3HKZA 1Y56A 3R0JA 3QOEA 4PUSA 2R7TA 1G2HA 4PSWA 3HOZC 3S15C 1FBSA 1OJLA 4A3BC 3S14J 2NVXJ 4DJAA 1R1VA 1MMSA 1ZG1A 1U2WA 4XK4A 1DP7P 3EQLF 4A0YA 3GW2A 2W1OA 1QHHD 3M3YC 2WB1N 3AQOA 2EZKA 2GZWA 3OYFA 4I2OA 2QKLB 2X48A 4XL9A 1UZCA 2O6GE 3QPLA 4S04A 4AWXB 5IT9K 2EQRA 1H9GA 3GTKK 3V8JA 3PNYA 3CC7I 3LA7A 4A3LC 4KUMA 5DM7F 4W1UA 5D5VB 4UUTA 2ZJQF 3WTSC 1O7LA 1U8BA 1YW9A 4E7HA 5GAEJ 3QODA 1MJAA 4O2DA 4D7MA 2QYOA 1KYWA 2L9VA 1WI3A 3LSTA 4IEJA 3VFZA 4OIQA 4P96A 4DGWB 2HTJA 3DU5A 5J4YA 5FRMA 3PFYA 2VOOA 2PQ8A 1XZPB 2RREA 4BY7C 1R7JA 3HOXJ 1I6HK 2JT1A 4AD9A 2XASA 4MNUA 2FD5A 1BL0A 3H3ZA 2CMPA 2MD0A 4A3GK 3D5LA 4BL0B 4A3JK 2KIFA 2HQAA 3KP4A 3T0YA 2I10A 2JVHA 2RNJA 1YW8A 1ZR2A 2XSDC 2F5EA 3J81Z 2O5JA 3BC8A 1ZQ1C 2L9SA 2MA3A 5CYVA 2VJIA 2VUMC 5ILUA 1ZH5A 1DD5A 1J5YA 3HRUA 3TO6A 2BVMA 2VQLA 1TTYA 1J6VA 3K4NA 4FZBA 5KK1A 4CCKA 1W7PB 1DCOA 4XRFA 1TWAJ 1JHHA 4PABA 2E1NA 2VKEA 3L00A 1BW6A 5FD5A 4C9YA 4HSTA 3UNGC 3BY6A 1WKMA 2QLZA 2W48A 5M5YJ 3PO3J 3MEXA 1D1CA 3ABTA 2ZXHA 2V9PA 1FBUA 3BG3A 3KP5A 3SFZA 2NOJB 4GXOA 2R7ZJ 1H9TA 2R93J 2DU9A 4EVIA 2M0CA 1XZQB 1JGSA 4XKWA 1MNMC 3G73A 4DQ2A 3DPUA 1OPCA 5B3SH 1EKEA 2VE8A 2RC4A 1MSEC 3FMRA 2K9NA 4S05A 2OUMA 1FWZA 2NXNB 3A8JA 2VUMA 3DXJA 3F8FA 3M1CA 4ON0A 3SFIA 1HSTA 3DBLB 3OYEA 1BIAA 2AXTC 5IOSA 3BG9A 2HR3A 1BC7C 3S14K 2LC2A 5GTHC 4ESBA 1BGWA 2H09A 1IDZA 1YE9A 2YU3A 4BJ5C 4A3CC 2KQRA 4PSXA 3J7ZI 2Z33A 4ZDPA 4Z6YA 2IGKA 5CQEA 4L9JA 1VQPI 1W7PA 3MKZA 2KHMA 1DCPA 3CZ6A 2ECCA 2MH2A 1FBQA 4EATA 4KASA 2B9SA 4UVCA 2DOFA 4HYEA 4BU2A 4XOTA 3T5XA 1IZ1A 4NB5A 4ZTJA 3Q9VA 3U2RA 1ZR4A 2JA5C 2BGCA 1ZLKA 1BS2A 4HV6A 4OAZA 3GZNB 2OBPA 2Z2SB 2V1NA 1H0MA 1R1UA 3LA3A 1LVAA 2JA6K 1HF0A 3TW6A 5LGNA 5L3BA 2NYXA 1TW3A 3C2BA 2IRFG 4C3HC 4OAYA 4BE2A 2N8GA 4CCMA 1R9TJ 5HLGA 1G8XA 1S7OA 1GUUA 5IOQA 4A5NA 2UWMA 2RDPA 1TWAK 1PJ6A 5C44C 1ONVA 2F5DA 1VJEA 3HKZL 4D5FA 3K4MA 3ADAC 1P4AA 5M5YK 1IV8A 2EFOA 1D8JA 5EF6A 1TWFC 2ZJRF 1YITI 1A35A 2IS6A 3P9IA 3HIFA 2W82A 3RQ4A 1ETVA 2JH3A 4C2MC 2G7UA 2XCRB 3CCVI 2Q0OA 2FX0A 3BJAA 4A93J 4RGRA 3C18A 2DAOA 2DDAA 2DA2A 3EUHA 3HTUA 2R7DA 3GTJJ 1ZXOA 3LSKA 1PJ5A 2X6WA 4U87A 3IPJA 1YIOA 3HOWJ 2Y69H 3ZN0A 2MH9A 2D6FC 4M3FA 3GWZA 4BBSJ 4BEHB 1RKWA 1J09A 2IAIA 4M6VA 3I59A 3S2DJ 3CQZC 3IRQA 3WGHA 3CUQC 4M3EA 3H3VL 2IPQX 4MEXF 3U21A 5HOOA 2DTRA 2VJ4A 2PA8L 4ZYAA 3IAM2 4BQAA 3S1MJ 3S1QC 4B3AA 2EA2A 3FMSA 4M3GA 4PAAA 2UXXA 2M3AA 5FLMC 1DDNA 3GTGK 3CTAA 5FJ8K 1ZELA 4MHGA 1DGRM 5IP9J 3FXKA 5LGTA 3ABMH 3C2HA 3AG4H 1Y39A 5JR3A 3I9V2 1AKHA 2BY1A 1RI7A 2RVCA 2ME6A 2L54A 4YG2F 1REPC 3I59B 4QIWL 2X85A 2R0QC 1J6WA 3RKWA 2ZXJA 1BW5A 4Y52K 1K83K 2JZYA 1N77A 2CFOA 4YG2A 4A3DK 4Q4ZF 1U5TC 1NG6A 2FUG2 2P81A 2H8RA 3T00A 4XRSG 3IRRA 1FP1D 1I3AA 3W6JB 2ZFZA 2HZTA 4HF1A 1W5TA 1P9QC 1VQ5I 2OQGA 1EF4A 2WBMA 1RU0A 1D8KA 3OOUA 3DLAA 2CS3A 2ZBKA 4LQYA 3N0CA 2VKVA 1BN5A 2JA5J 2CV1A 5FFZA 1P7IA 3OV8A 4X6AC 3OMYA 1UHSA 2W25A 4HNTA 5B5EC 5TMCA 1Y0UA 1R49A 2X6OA 4G8XA 2TDXA 1HW5A 1Q1HA 4BHPA 5BS6A 4LB6B 2K27A 1XS9A 1B8IA 4F7ZA 1FP2A 1QPIA 4GRIA 1ZRDA 4Y4RA 2PMHA 3ZQCA 3F8BA 2FMLA 4B8XA 5FROA 5A2QZ 4HDUA 4PZJA 3GLLA 2LF8A 3WGIA 1OR7C 3EYIA 4RLFA 5K5RA 5D4SA 1JUMA 1J98A 2CFAB 1G4DA 4LFUA 2A07F 4XSZF 2JA6J 3OSFA 2VE9A 4MEYF 3TOAA 1MMGA 2STWA 1Z0XA 1L3LA 1U9OA 5CVRA 3KX2A 2H1LA 4FHTA 4KAWX 2EWNA 4E7ZA 1A6QA 5ICEA 3WE2A 2O8XA 2O5RA 4I0BA 1QZEA 1SD6A 2KT0A 5IOTA 1F7VA 1IBAA 1ETQA 3K7AK 2O7OA 4CYDA 1NHAA 1IN6A 2BY0A 2WY7Q 5FKMA 2YX4A 1ZGJA 1DPUA 3I4NJ 1X3ZB 4A0XA 5GPCA 1TWGJ 4BQNA 4JX4A 3ML6A 3OYDA 4GTCA 2OC6A 2LVSA 3QU3A 3MKWB 1W36C 2O8KA 2VPRA 5E3MA 3QP6A 4UVBA 3G4AA 3CQZA 2HS5A 2W00A 3GTJC 1B1BA 3J7AY 4HRIA 1WRJA 4HV5A 2M7BA 1GE9A 2ZSIB 1J2XA 2FNAA 3MZYA 4KICA 2FRHA 1XTAA 3TO7A 3V8LA 2X51A 1USSA 1BR1A 4AIDA 1TWCA 5C44K 1QBJA 3PL8A 2ZUEA 1FY7A 4EMSA 3VYTB 4MLOA 2DYRH 2CGPA 2KIUA 3J7AO 4YFNA 1U6GA 2MYSA 3V7RA 1I50C 2FJ1A 1PYVA 2COBA 1I50K 3H36A 4BKWA 3H1CA 1LFPA 1F7UA 2AS5F 1GDTA 1BA5A 1A31A 3HHGA 3LAJA 4XOPA 3CCUI 3HL2A 5E3OA 3K69A 2MSYA 1YHQI 3H92A 4IRHA 1LKXA 3WHBA 4RLQA 4HQMA 1C0AA 1N25A 1DUXC 2NVQC 2HYFA 2DFHA 1FT9A 3WG9A 4J00A 1I6HJ 1G59A 4JQFA 1KQ0A 4A3EC 2RN7A 4PFOA 1ZN2A 3M1EA 1J75A 1IO2A 2VIXA 4JX5A 4CDGA 1Y1VC 3MWMA 4BBSK 2KMUA 2JA8J 1TT5B 1Y6IA 3GTPA 5J1UA 3S2DC 4CO8A 3TP0A 2DLLA 4ZDLA 2FMYA 4MO7A 4BH9A 1L0WA 1XMKA 2R5ZB 3OOPA 1LVKA 5CVVA 2K4JA 2QVOA 3I64A 4ENKA 2DT6A 5M5WJ 4HW0A 3GX4X 2ZJPF 1HW2A 1KU3A 3RPUD 1VQKI 3VPRA 1HKTA 3IP4B 3L2CA 1YYVA 2R4GA 1WFXA 1K6YA 4LJZA 1D5VA 2VQHA 2R93A 2CH0A 1T0FC 3A01B 1Z21A 1BIBA 1JKOC 2JQ7A 2PMZL 3HOVK 2EINH 2XF6A 2M45A 3GXOA 5E1XA 1LFBA 1VQ9I 4B43A 3ZMSA 2D1HA 1MIJA 2JN6A 4A3BJ 3MCZA 2ADUA 2L3DA 4LOCA 4YELA 1T2KA 3RZOJ 5H6QA 3JRBA 1MD0A 2CUJA 4IJAA 1X58A 2H6CA 2JMWA 3A8KA 1LDJA 2HZDA 2E1MB 4I99C 2Y30A 1O7FA 4EJUA 3K0LA 3M4OJ 2LMDA 2OA4A 1TQIA 3EUAA 3BG7A 3OL4A 1PDNC 2WAQL 2M9HA 4DW6A 1OR7A 3G6EI 5J3LA 2GXBA 2CUEA 2DOEA 2VT3A 1O28A 3IL2A 5DS9A 2DCEA 1O57A 3MMYB 4UB8C 2E7XA 3K1PA 3MFKA 3N3YA 5EG0A 1GT0C 1GVJA 2NAZA 1XMXA 5F27A 3LSPA 1YTYA 3DEEA 2NVQJ 2E2IJ 1E0EA 1R4MB 2R92C 3HDDA 1J9IA 4KT5C 4C45A 1IN5A 4Y17A 3HOTA 5ICGA 2A05A 1CF7A 2HI3A 2NVXC 3R60A 2Z1DA 3CJQB 2Z99A 4EGYA 4DYRA 2V9KA 3S1NK 4HQEA 1JI8A 3GTQK 5FLMK 4D1QA 1SVOA 1JUSA 5FLXK 2R7RA 1JOEA 1WJCA 2CYYA 2A61A 2H6BA 2E5NA 4LG0B 2H94A 3ZCOA 3WU2C 5BOXA 4LLGF 1IC8A 2WB1A 3CCRI 1IRXA 3HOYK 2DMNA 1WJFA 3LFKA 4F93B 3IV5A 1VZ0A 3CP8A 3H3UA 5D5UB 4I98B 3HTSB 5E68A 2DFEA 2Z16A 3HSEA 3CESA 2R7ZA 2A3SA 3WTXC 1LQ1A 1I5ZA 4KARA 4Q47A 1S8NA 3KE2A 3OSGA 1EH7A 4RB0A 3FHNA 3CCJI 2OZ6A 3RIRA 3ZQLA 2W24A 1F43A 3GTMC 1YOVB 1TWGK 2JK3A 3CDLA 3RPUA 3FIWA 4LLLA 3HOZJ 2DA6A 3S15J 5IP7K 3ZR8X 2GWRA 2JA2A 1UELB 1VFCA 1B6AA 4FISA 1VQ7I 1QA6A 4Y33A 1VI0A 5TJ3A 4ABZA 4PDKA 1ZAOA 3BWGA 2VXDA 4CSWA 1XXBA 2HPIA 1O25A 1LPQA 1I3QJ 4OWRB 4WCGA 1RESA 3OS1A 2GLOA 2VKDA 1YNNA 1XSDA 1MZBA 4KDDA 3PIPF 2ISZA 2EFWA 2E2HC 3M9AA 4YIFA 1XXAA 3TL4X 4N9IA 1EH6A 3Q3SA 3O6BB 2K9MA 5LGUA 1LE8B 2L9NA 4LJZF 1XXCA 4BLAA 4KNYA 3LWFA 4CYCB 2R3SA 4GDFA 3TTGA 2LK2A 3N4MA 3BTLA 2L7MP 1APLC 2ZMEB 2GOMA 3DQVC 4ZH4A 3CMYA 1KA8A 2VKHA 3CJTB 4J01A 3TGNA 4KIGA 4BQQA 3ROUA 1IXRC 4OMZA 2NVXA 1PUEE 5JHUA 5JVGF 1P6RA 3IC7A 2WB1L 3TW7A 4A3BK 3SZPA 2RV8A 2ZCWA 1U0JA 2EZIA 2F5VA 2HOEA 2VXZA 3HSRA 4RGUA 2ZB9A 2DW4A 4BAYA 3F23A 4Y3OA 3JRHA 2NRAC 1IE0A 2XCQA 2C6YA 3AG1H 4S0HB 3M3YK 4L5JA 4A3EJ 3CAGA 3HOUK 1R36A 1VTNC 3F9KA 3RYRA 3GTQJ 1Y1VK 2OCEA 2W7VA 3J80Z 3QPSA 1VQ6I 5FLXZ 5K7FA 5E8IA 2M87A 4CZZA 5JVOA 3F21A 4OOIA 2YU9K 4YFXA 2CQNA 4FX0A 3OIOA 1BI1A 5DTDA 2PI0A 1FYKA 1PJ7A 5HL8A 3QPHA 1ZYRF 2J5OA 4IZZA 3Q0WA 1DU6A 2PJRB 4RB2C 1GVDA 4ZZDA 1IW7A 3HOWK 2BZTA 1YLFA 2LYCA 1QO0D 2YU9J 1K7AA 3WU1B 5F0FA 1R22A 5IY5H 1I1SA 1TWHJ 4L9VA 3D5RC 4BUPA 2LFBA 3A1YA 2A6EA 2P5KA 3MZ8A 2PN6A 1CQTA 4RB1A 3QYEA 2MLKA 1SMYA 4XBFA 5E8GA 1U9NA 4YFKF 2HVSA 4XSXA 4AIHA 4RMFA 2CQ7A 5DEQA 5ILVA 5AIQA 3GTOC 1K6OA 4KMUA 2HXIA 2IA2A 1G3WA 2BY3A 2VT2A 2ELJA 2DQRA 3HZJA 3HOSA 5F1JA 1JHFA 2E5ZA 5DYMA 4GTLA 3ZQQA 2OAZA 3ECHA 1IUYA 2Z3YA 1SFXA 1XG1A 2CQQA 4IO9F 4OIRF 2VN2A 4B3XA 4C2TA 5LRSA 2KRCA 3C2GA 1BR2A 2L9RA 3HXLA 2FBHA
chains in the Genus database with same CATH topology
5JI6A 5HDNA 2E1CA 1BM9A 4LK0F 4A6EA 3FKIA 2KJCA 5H20A 2YR2A 1STZA 1IXCA 3MQ0A 1LB2A 2HFHA 5ERIA 2ZO4A 4IVNA 1KQ9A 4ZYGA 1A04A 2P6TA 3C7JA 3P9CA 2IW5A 3ELKA 3ULQB 3HUGA 1FYMA 1SFUA 4U7BA 4G7OF 4U88A 1BJTA 4GFQA 3TDUC 1MKMA 3ZMUA 2HDCA 3W6KB 4U0WA 2FBKA 2VONA 4KB4A 2NNYA 3DF8A 1GHCA 1J7KA 3DV8A 4A6DA 4OIPF 1IN8A 2ESNA 1WQFA 3JW4A 1SMTA 1I3QA 1R9TA 1O3RA 5IT9Z 3Q3QA 1T98A 3GFIA 4P5BA 3FWEA 1S7AA 3GO5A 3NEUA 3FXUA 1YW7A 3HRMA 2V6CA 1I27A 5H6RA 1KU2A 5LHHA 2FA5A 1XB4A 4UV8A 3IKTA 2M5WA 2PMUA 1KQ8A 5TJJA 3BP8A 3WTTC 2BYVE 2PFBA 1SMYF 4KN7X 3VODA 3ZMDA 3IWFA 5HLIA 4I01A 4KMFA 1BI0A 4O3MA 2PJPA 1Z6TA 4GGGA 4KYWA 4HZFA 5ICCA 4CICA 1YFHA 2EV0A 1XGNA 2X0LA 3KZZA 1YQAA 5DCMB 2V1XA 3RKYA 4G0VA 4KB2A 3FZVA 3F8NA 4C3JC 2Y3PA 4ENNA 5KVRA 2VOPA 2NVYA 3KEQA 2JA7A 4RGSA 4ETSA 2NS0A 4ZYDA 4RB3C 2K7LA 1R5GA 1V4RA 1QPMA 3M8FA 2Z9OA 1FX7A 1F5TA 3F8CA 2FOKA 4KIBA 3RI4A 2XRNA 3N0BA 1LDKB 2JSCA 3ZMTA 2JPBA 2DI3A 1B4BA 3E3VA 3S2WA 4RAZA 1ODDA 3IKVA 5CVJA 5D6EA 3FXQA 4KFCA 5HDKA 3RYPA 2MLGA 3GTLA 1J0RA 2Q8KA 4RAYA 3JAMZ 3LAPA 4HDVA 1XGOA 1CF7B 1FNNA 3WGGA 5JFRA 2GSNA 2E2HA 1IXSB 4O5VA 1I50A 5J6XA 5FFXA 1TWFA 1WI9A 3G3ZA 3Q5FA 1XN7A 2VBYA 5L3FA 1TWAA 2LNBA 4U7DA 3E6CC 2DT5A 2KRFA 5K5QA 4KDPA 2ZJ2A 2CWEA 1OYIA 1Z91A 3GTJA 4DNCA 4M9XA 4GTBA 2ESHA 1MJ9A 5TRDA 4YIIA 4IHSA 1O3SA 3OEPA 1ZLJA 4WK8F 3TQNA 5FGMA 3BROA 3R6SA 5EEGA 3L7WA 4ESJA 1X3UA 4QWQA 4G6DA 2GSOA 2LSOA 1G3SA 2JA6A 5BMZA 5IORA 3GZ6A 1PP7U 4G7HF 4JK1X 3D0SA 4KMHA 3P7NA 2XKOA 1TWHA 1R5HA 2GA1A 2A68F 5LEJA 1FC3A 1B59A 2L4AA 2E7WA 1XSVA 3PQKA 5IT3A 1I1GA 4BNCA 2JPCA 4G7ZF 4GYIA 3ZQ7A 2L4MA 5J8CA 4MTDA 4MTEA 4HX4A 5LBQA 3DPLC 4HLYA 3PFIA 3G4CA 2RGVA 5D5XB 4KMUX 5DUIA 6PAXA 2RQPA 2EK5A 3HSFA 5FD6A 1Z9CA 5HDGA 3V8KA 5AONA 1O3TA 1O2BA 3ECOA 2M30A 5ED4A 4IHTA 3J80K 3CJNA 3E97A 2R7FA 1T0FA 2GXGA 1YO5C 2EJRA 4KC6A 5ILSA 4M9SA 2LF7A 3WTUC 1Z1DA 4L18B 4XLNF 4KMDA 1R23A 2W57A 4TV7A 2EFNA 2IP2A 4ZZLA 2DPDA 3HYIA 3RTRA 2HQNA 3R61A 1FPQA 3L4JA 3F72A 3QOPA 5E18F 2EFPA 2FEZA 1YG2A 4PCQA 3CO6C 4KM8A 3JSOA 1XGSA 2ELHA 2VBWA 2VC1A 2CG4A 5BPDA 3GVAA 1OYYA 1YS7A 4WF2A 4L9TA 5F1RA 2FU4A 5CVUA 2Q2EA 5F6FA 2K86A 4ENMA 3MMLB 1ZVUA 2EV5A 2MD5A 1UB9A 2B63A 1YS6A 4EJTA 4P5OA 2GIVA 4EJOA 5CJ9A 5L3EA 1S3JA 2GAUA 2O61A 1S6LA 3GTOA 5E17F 2O3FA 3LPXA 3WTYC 2LKPA 1HXDA 3FF5A 3FX3A 1O29A 1IAWA 2AXLA 2HWVA 4HF0A 3L09A 2XVCA 3SHFA 1GXPA 4GTAA 2XIGA 2P5MA 5LLQA 3B73A 4LD5A 3QAHA 1RIOH 5FO5A 4GTEA 1W5SA 2O0YA 2Y0MA 3KLNA 1WWXA 4C3IC 2F5FA 3E6BA 5J8FA 1G3TA 1P2FA 3TOBA 4EJWA 2ZNYA 4YFNF 1U8RA 2BV6A 5BPIA 3I54A 4LMYA 1F4KA 1K78B 3F22A 3DKWA 1V3FA 3EETA 1U5TA 3O3KA 2IA0A 2MBFA 1WQGA 5EEHA 4RS8A 2RKHA 1U3EM 4LB5A 3QPTA 4HOBA 3BOQA 3M8EA 4R1HA 2E2IA 1XDSA 3HRTA 2GA2A 4KN4X 2UZKA 4B09A 1ULYA 2XHKA 1JXSA 1K83A 4KM9A 3JTGA 2QUFA 1O27A 4G6QA 4J3NA 4PGHA 3ERED 5K1YA 3WU0A 1WQ2A 3FOEA 2ZKZA 5DCFA 3MZHA 2H27A 2KIMA 3Q9SA 1QZZA 2KWAA 3E6MA 4KMAA 1Z6RA 3WTWC 2CFXA 2ZMEA 4M9ZA 1IRFA 2BEOA 3BDDA 2P7VB 1HSJA 4G94A 3K9TA 1SD7A 1Y1VA 2WV0A 1XCVA 2PG4A 2XCOA 4L9NA 4UUVA 4KIFA 2V1DA 3O2PE 4IRIA 4R79A 1KQ4A 3LQQA 2JA5A 2VBXA 3KEOA 4ZYHA 4P55A 1IW7F 4I02A 3BJ6A 4Q5SF 3NRVA 3CLOA 2YX7A 2ZFWA 2KJBA 1LNWA 3JTHA 2D1VA 2ISYA 3S0XA 3C1DA 4UV9A 2P5VA 4GYGA 3KP3A 4OU0A 2LDUA 2DFIA 2IJLA 1FLIA 4N9HA 1XDUA 4MGRA 4OMYA 2V1UA 5JFEA 3ZPLA 4A2UA 2FNPA 4HX7A 2FQ3A 1ZREA 4HAMA 3DPTA 1Z7UA 4HLXA 4BHBA 1HW1A 5LHGA 2IT0A 2EA4A 4MQVA 2XAFA 1WCMA 2F2EA 2XKPA 3F8MA 2GQQA 3KCCA 2DBBA 2XV4S 4WWCA 1G6NA 2QBYB 4ENJA 3GFJA 4D0PA 4EM0B 2M8EA 2FBIA 1K79A 1BI3A 4GTDA 3P9KA 1XMAA 1ZG3A 4FT8A 5BQTA 2RH6A 3VA7A 3TDZC 3TKYA 3KP6A 1HKSA 2W84A 4Q48A 5L3GA 3WTZA 4GTFA 4M72A 5E1ZB 4KATA 1S29A 3CUQA 1QNTA 2A6EF 3L4KA 4AVPA 4E70A 1RZ4A 4XLPF 4WXDA 3C3WA 3JSPA 2HKOA 3I71A 1O3QA 2QBYA 1I6XA 1FSEA 3KP7A 3I5UA 4FM9A 5FB2A 1ZHFA 3ZP5A 2P4WA 3NQOA 4WX9A 1G3YA 1KGSA 1RUOA 3ZMVA 4P9FA 3FHZA 3BUEA 2WWYA 4A12A 4LG0A 1T39A 2K02A 4GO1A 1IF1A 2VBZA 3GUDA 3GFMA 4Y15A 4NHJA 3I4PA 1UHWA 1OMIA 1AB4A 3VOEA 1P4WA 4L0ZB 1KU7A 3HHHA 4Z2YA 1F1ZA 4G0UA 3WODF 4O6JA 1UCRA 2XUBA 3F6VA 2D2WA 4Y13A 1SFOA 4XSXF 1ZRCA 1SD4A 4BLBA 3ZMZA 1TWGA 4PGGA 5E20A 2WC2A 3GTMA 3JAMK 1T6SA 5DCMA 5AIPA 1LEBA 2CSOA 2BE5F 3DXJF 2J5PA 2YPRA 4ZYEA 4K2EA 3F6OA 2CO5A 2GSUA 3OPFA 4P9UA 4AIKA 2FSWA 3U9GA 4M1XA 4UXNA 2X4HA 4UNOA 2PLYA 1XGMA 3E5UA 4CGZA 1ISEA 2L02A 4UVAA 2FF4A 3COAC 3WE3A 2PBIA 1FSHA 3U1DA 2Y48A 3E5XA 1TQPA 5HS8A 1SFEA 3V7SA 1BOAA 2DK5A 4UHTA 3VB2A 3BPXA 2A69F 3AQPA 1MDMB 3GLXA 4EJVA 2PEXA 4BHCA 3FM5A 1W4MA 4L5IA 1WIHA 1P92A 1TQMA 2B0LA 2XAGA 1UHMA 3KLOA 3GTGA 1HBXG 2XROA 2DK8A 1TLHB 1HQCA 4LK1F 4A0ZA 3L9FA 3MAJA 4A5MA 2QQAA 3RKXA 3KETA 1B9NA 1IN7A 1R1TA 1EV7A 4U0VA 4CXFA 4G0WA 1F9NA 1RNLA 3KFWX 2OQRA 2XAHA 2ACJA 1ZG5A 5EGEA 3M7GA 2CFAA 2K4BA 1Z05A 2OU2A 3TO9A 2MC3A 1MGTA 1AWCA 2P5LC 1PP8F 4I7HA 1E17A 3RPQA 3ABUA 5L3DA 2ZNZA 3VEPA 5DD4A 4EM2A 4BXUA 4RGXA 4M6YA 3E6DA 2G9WA 1E2XA 2A5YB 5LEKA 2HEOA 2W85A 2DQLA 1U5TB 5CLSA 5DUKA 1IRGA 1B4AA 2QENA 4NQWA 3WTVC 2P8TA 5D5WB 1IN4A 4FX4A 3BZ6A 3OREA 4G9YA 4IF4A 1TW2A 2L01A 2XAJA 4QLCU 3AH5A 1W7PD 3REOA 4I09A 3K1MA 2R92A 3V4GA 4IXAA 4GCVA 1BBYA 5F64A 3SZTA 3GTQA 3QU6A 3LA2A 4EM1A 1ZARA 3J81K 5DV5A 2UXNA 1QQIA 4EQQA 2QZ8A 3V7CA 3K1NA 2P7CB 4I0AA 1HKQA 1EK8A 1D3YA 3QP5A 1FYLA 4AIJA 3ZN1A 2XAQA 1MDMA 3FMQA 5D4RA 3NUHA 4KA4A 2D45A 2P6SA 5LHIA 3GFLA 2WTEA 2G7HA 5D8KB 2JTVA 3CUOA 2EB7A 1CGPA 5D6FA 3H0GA 2QQBA 3EYYA 2FXAA 3E5QA 3DFGA 3R4KA 2COMA 3LQRA 2NNNA 2ETHA 1LEAA 1Y1WA 3DEUA 1EH1A 3GZ5A 1LDDA 5CHPA 4DDQA 2F5CA 4YFXF 4U0YA 3BJOA 3GYHX 5JVTA 1LJ9A 3QRFF 1BC8C 3QX3A 1TNSA 3CDHA 1IS1A 1K78A 1FZPB 1QZYA 1J59A 2O03A 4GT9A 3SXYA 4P5AA 1EH8A 1O2AA 3GTKA 1XD7A 5E1WA 1O26A 2HGCA 5HVQC 2Y75A 2IA1A 2QM3A 2KKOA 4H0EA 2EFQA 3I0TA 1O24A 1JE8A 4JBAA 2VODA 3FXRA 4L0YB 2OD5A 2PHCB 5EGHA 5DDGA 3BPVA 1SD5A 4MQ9F 2OZUA 3T8TA 1DPRA 1SAXA 3SQNA 1ON2A 1XSXA 3DP7A 5HS7A 1OKRA 1P4XA 4LGWA 1KU9A 1R00A 4OIOF 4OIQF 4EV0A 3FM3A 3F3XA 4M6XA 2RGRA 1QGPA 3R0AA 2QQ9A 3B02A 3RJPA 4LR2A 3KZYA 3HRSA 2YU9A 1GXQA 1BJAA 2CQKA 5CVIA 1KYZA 2VC0A 3IWZA 1R58A 1BI2A 5D8LB 4M74A 2M1BA 4WXHA 5HS9A 4BYYA 2HYGD 1ZBSA 2QWWA 1ON1A 4ESFA 3PQJA 1UFMA 4M71A 3K2ZA 4WXCA 4ZH4F 1XCBA 3GEZA 3GF2A 3I53A 4OINF 1WSUA 3IHUA 3ISPA 1C0WA 3AAFA 5HLHA 1B9MA 4ASNA 2Z5UA 2HKXA 2V9VA 5LRRA 2EV6A 2CW0F 1U78A 4N0BA 1USTA 5DD8A 3CUQB 1TNTA 1ZRFA 2IVMA 5ICFA 2BBYA 2JRTA 5L3CA 4CHUA 4HA8A 5A2QK 2STTA 4M73A 1FOKA 4HX8A 3KP2A 3N97A 2YSRA 1AOYA 3T1BA 4IRGA 2DPUA 1ZGAA 3CO7C 1L0OC 3FOFA 2HTSA 2HQRA 4IPAA 2DO7A 2A6HF 1RUNA 3EDPA 4HF2A 2FE3A 3I58A 4R8HA 3T8RA 1WQHA 1OYWA 2XGXA 4EGZA 5K5OA 4LLNA 3RDIA 4HBLA 1TBXA 2V79A 1MJBA 4ILDA 1T38A 3R0JA 1FBSA 1R1VA 1ZG1A 1U2WA 1DP7P 3EQLF 4A0YA 3GW2A 3AQOA 2GZWA 4I2OA 2O6GE 4S04A 4AWXB 5IT9K 1H9GA 3V8JA 3LA7A 4KUMA 5D5VB 3WTSC 1O7LA 1YW9A 1MJAA 2QYOA 1KYWA 3LSTA 3VFZA 4P96A 2HTJA 2VOOA 2PQ8A 1R7JA 2JT1A 4AD9A 2XASA 4MNUA 3H3ZA 3D5LA 2KIFA 3T0YA 3KP4A 2RNJA 1YW8A 2F5EA 3J81Z 2MA3A 5CYVA 5ILUA 1ZH5A 1DD5A 1J5YA 3HRUA 3TO6A 1TTYA 4FZBA 5KK1A 1W7PB 4XRFA 1JHHA 2E1NA 5FD5A 3L00A 1WKMA 2QLZA 3BY6A 3MEXA 3KP5A 3ABTA 1FBUA 3SFZA 4GXOA 1H9TA 2DU9A 4EVIA 1JGSA 3G73A 4DQ2A 1OPCA 2VE8A 2RC4A 3FMRA 4S05A 2VUMA 1FWZA 3F8FA 4ON0A 1HSTA 5IOSA 1BIAA 1BC7C 2HR3A 1BGWA 4ESBA 2H09A 2YU3A 2Z33A 4L9JA 1W7PA 2MH2A 1FBQA 4KASA 4UVCA 4HYEA 3T5XA 1IZ1A 4NB5A 3Q9VA 3U2RA 2BGCA 1ZLKA 4HV6A 2OBPA 1H0MA 1R1UA 3LA3A 1LVAA 5LGNA 5L3BA 2NYXA 1TW3A 2IRFG 4C3HC 5HLGA 1S7OA 5IOQA 4A5NA 2UWMA 2RDPA 1ONVA 2F5DA 1P4AA 2EFOA 1D8JA 3P9IA 3HIFA 2JH3A 4C2MC 2G7UA 2XCRB 2Q0OA 3BJAA 4RGRA 3C18A 2DAOA 3HTUA 1ZXOA 3EUHA 2R7DA 1YIOA 3ZN0A 2MH9A 3GWZA 3I59A 3IRQA 3WGHA 3CUQC 2IPQX 4MEXF 5HOOA 2DTRA 4BQAA 2EA2A 3FMSA 2UXXA 1DDNA 3CTAA 4MHGA 5LGTA 5JR3A 2RVCA 1RI7A 2L54A 4YG2F 1REPC 3I59B 3RKWA 2ZXJA 2JZYA 4Q4ZF 1U5TC 3IRRA 1FP1D 3W6JB 2ZFZA 2HZTA 4HF1A 1W5TA 2OQGA 1D8KA 2ZBKA 4LQYA 3N0CA 1BN5A 5FFZA 3OV8A 2W25A 1Y0UA 4G8XA 2TDXA 1HW5A 1Q1HA 4BHPA 5BS6A 4LB6B 2K27A 4F7ZA 1FP2A 1ZRDA 2PMHA 3F8BA 2FMLA 4B8XA 5A2QZ 4HDUA 4PZJA 2LF8A 3WGIA 3EYIA 5K5RA 5D4SA 2CFAB 1G4DA 4LFUA 2A07F 4XSZF 2VE9A 4MEYF 3TOAA 2STWA 1L3LA 5CVRA 4FHTA 4KAWX 2EWNA 5ICEA 3WE2A 2O8XA 4I0BA 1SD6A 5IOTA 4CYDA 1NHAA 1IN6A 2YX4A 1ZGJA 1DPUA 4A0XA 3ML6A 4GTCA 3QU3A 3QP6A 4UVBA 3G4AA 3CQZA 2HS5A