3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
molecule keywords Arginine repressor
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
3OREA 4G0WA 1R1TA 3HSFA 2FBHA 4E70A 2K4BA 1XDSA 2XRNA 2PHCB 3VB2A 1P2FA 2B0LA 3DPTA 4EJUA 4UVAA 2DAOA 4Y17A 4XSXF 1L0OC 3K9TA 2P7VB 2BGCA 1B9NA 4RB3C 2BEOA 4G94A 5FB2A 2EV6A 2G7HA 3GVAA 1WWXA 2XHKA 1XMAA 3E6CC 4HZFA 3MQ0A 3I58A 2YPRA 1R58A 1ONVA 3F6VA 4QWQA 3CUQA 5L3CA 3P9CA 2E7XA 2HZTA 2IT0A 1IUYA 4HQMA 5ED4A 2RN7A 1TQIA 1YIOA 3ERED 3ISPA 4KMFA 3HHHA 5CVRA 5J8CA 2Z5UA 2DBBA 4BYYA 1EV7A 4EGYA 2CG4A 2KJBA 2UWMA 5TJJA 2HFHA 3KLNA 5HDKA 4WXCA 3SQNA 5LGNA 4FHTA 1WQFA 1BBYA 3F8BA 5DCFA 3B73A 2XCOA 1OPCA 1QPMA 2HEOA 3GFLA 4HLYA 2NRAC 1YQAA 4GCVA 3IWZA 2P5VA 3WE2A 3HIFA 1RIOH 1FX7A 3BOQA 2XAQA 4G6DA 2ZKZA 2H27A 4MEYF 2KWAA 1OR7A 4M6YA 5A2QZ 5CJ9A 3FXQA 3WTSC 2ZCWA 3BUEA 4OMYA 1ZG3A 2QQBA 2VONA 3QU6A 2FSWA 1ZG1A 2CW0F 5ILUA 4N9IA 2IP2A 1LDJA 1P4WA 4HLXA 1XXAA 4CXFA 1O7LA 2MLGA 2R7FA 1W7PA 2D45A 1FBQA 4HW0A 1F9NA 1WIHA 3OV8A 2NYXA 1KGSA 3U1DA 2EFWA 1IRFA 1E2XA 2JPCA 5BOXA 5E17F 4KN7X 1MJ9A 3KP7A 4FX4A 2RDPA 1OYWA 1ZRCA 3IL2A 4EJTA 5LBQA 3GX4X 3ZMTA 2Q8KA 2L4MA 3KP3A 5K5OA 2ISYA 5J8FA 3V7SA 3WE3A 1ZREA 2VBYA 3GWZA 2K7LA 4BHBA 3GZ6A 3BZ6A 1PP7U 1IN6A 2JZYA 2CO5A 3BJ6A 2WV0A 3MZYA 1FSHA 3RJPA 4UXNA 4MNUA 2EB7A 3K69A 3C7JA 3L09A 5D5UB 3NEUA 1ZN2A 2ESHA 1L3LA 1S29A 2W25A 4MQVA 1S7AA 5HOOA 1FOKA 2D1VA 3HOTA 4O5VA 2Z33A 4LJZF 4YFKF 4IPAA 1OKRA 3K2ZA 5D6EA 2DO7A 4KB4A 4WXDA 2ADUA 1HSJA 3J80Z 3J80K 4U0YA 1S8NA 4R79A 1Z6RA 1BIAA 2VOPA 1J9IA 3MFKA 2V1XA 2FEZA 2QBYA 4U7BA 3ABTA 4MTEA 5DV5A 2Q2EA 1FP1D 3ULQB 3I71A 4LG0B 1IN8A 4NQWA 3ELKA 3J81Z 4ZYGA 2EV5A 4KYWA 1LB2A 2J5OA 5JI6A 4ENKA 1ON1A 1EH8A 5CYVA 3FX3A 2BV6A 5DCMB 2VBXA 1IXRC 1MJAA 1U78A 4LMYA 4LB5A 3DQVC 4KA4A 4RGSA 3F3XA 2RVCA 3VA7A 1XDUA 5E20A 3DV8A 1MGTA 2MC3A 2ZO4A 4EM0B 3HRUA 2O8XA 2L3DA 1EH1A 3ZMUA 1QNTA 3CJNA 4ZZLA 1I5ZA 2W85A 1SD4A 2O61A 3WTYC 2JSCA 3ZMVA 4A5NA 3I5UA 3DFGA 2L4AA 3CO6C 5KK1A 4N0BA 1AOYA 3CLOA 2LF8A 1TNTA 3KEQA 1GXPA 3M8FA 2H09A 1LJ9A 1I27A 3I59B 4EMSA 1I6XA 1B4BA 2UXNA 1PUEE 1AB4A 4MEXF 5ICGA 4CYDA 2PMHA 4UHTA 4P96A 1QZYA 4ZYDA 1FYMA 2EWNA 4GXOA 1W5TA 2RNJA 1XMKA 3GYHX 4Q5SF 2LSOA 1HW2A 3RTRA 4P9UA 3RKXA 4PGGA 1XCVA 3IC7A 3BP8A 2FXAA 4RGUA 3WG9A 3JSPA 1IW7F 3VFZA 4WX9A 3TO6A 1XN7A 1BI1A 2X4HA 5FFZA 5IT9Z 3P9IA 2PFBA 4EV0A 1TTYA 1YS7A 3I59A 2ZBKA 2P6SA 4LLLA 1ZRDA 3RYRA 3HYIA 5LHGA 4I02A 2XUBA 1I1SA 2JTVA 2VN2A 1SMYF 3C3WA 4KN4X 1HKQA 1T0FA 4CICA 1F1ZA 3B02A 4ZZDA 4KT5C 1R5GA 2QENA 3F8MA 1RUOA 1G6NA 3R4KA 4G6QA 3E3VA 2FMYA 3W6JB 2EFOA 2HS5A 2IA2A 2PJPA 2QLZA 5L3BA 3Q9SA 2C6YA 1TNSA 4ENMA 1VTNC 4DNCA 2L54A 3LAPA 4RB2C 1HQCA 4I98B 2DQLA 5K5RA 4L0YB 1R00A 2CFXA 3NRVA 3FHZA 2UZKA 3CTAA 4OIOF 1S3JA 1ZVUA 1CGPA 4NB5A 5E1XA 2JPBA 4ENNA 1YW9A 4A2UA 2DTRA 3ZP5A 4AIKA 4Q48A 4P5OA 2O03A 1JXSA 3RYPA 3WTTC 2FNAA 2HKOA 3P9KA 3GXOA 4I0BA 3K1PA 1SAXA 2GIVA 4R1HA 2XAJA 1LDKB 1Z9CA 1X3UA 1R36A 5DYMA 3EYYA 4CDGA 2CSOA 5K1YA 3RPUA 4EVIA 2FQ3A 1GHCA 2A69F 1BC7C 2E1NA 2KRFA 2QBYB 1BJAA 5D4SA 6PAXA 1B6AA 1ZRFA 3GUDA 4HDVA 4BHPA 1BN5A 1FBUA 1SMTA 2XROA 4WF2A 3KP5A 3HSEA 4M73A 2A61A 2KJCA 2KIUA 1T38A 3O3KA 1WRJA 3LWFA 2IA1A 5FO5A 1R22A 1KU3A 2J5PA 1KQ8A 4EGZA 5HVQC 4IXAA 3HHGA 2NAZA 1O57A 4G7OF 1CF7B 3OEPA 1WQGA 5L3GA 4KIBA 3CUQC 4KAWX 1G4DA 2FA5A 1J0RA 1O3QA 1IZ1A 2V1UA 3E6DA 3WU0A 3V7CA 4XSZF 3BY6A 3WTZA 4L9NA 1K78A 1UHMA 3ZPLA 1WQHA 4G9YA 2Y75A 3HTSB 3KZYA 1QQIA 1P6RA 2PMUA 2A3SA 4I01A 3IRQA 1ISEA 1U5TB 1TBXA 1KQ0A 2GZWA 5D4RA 1UHWA 3I64A 3E97A 5HLIA 3KETA 2HWVA 3IKTA 4I09A 3FXRA 1ZHFA 3LPXA 3IHUA 2KKOA 1Z6TA 1PDNC 2PN6A 4L18B 4HF2A 1J2XA 4HA8A 1IRGA 2P5KA 3OPFA 1HW1A 1RUNA 4ESJA 3KLOA 3F72A 4HBLA 2HQRA 2STTA 1TW2A 5H6QA 2OZ6A 3IKVA 1MJBA 1BI2A 3KP2A 1J7KA 4GGGA 4WWCA 3KEOA 5AIPA 1BM9A 2XAFA 3KP6A 3WTWC 2HYFA 5J6XA 2IRFG 1R5HA 1YS6A 4OU0A 4BXUA 3DPLC 2HQNA 2R3SA 3LA3A 4GFQA 2D1HA 1XSXA 3HOSA 2HTSA 4Q4ZF 4KDDA 3RKWA 1RZ4A 4ENJA 4O3MA 2XCRB 3RPQA 4I0AA 2F5DA 2RGVA 3GEZA 4IJAA 1V3FA 3DXJF 3HRTA 2LF7A 4I2OA 5BPDA 3DKWA 5AONA 4Z2YA 3M1EA 4L9VA 4L0ZB 3FM5A 2WC2A 3I0TA 2KIMA 3R0JA 1OYYA 2WWYA 2OU2A 4U88A 3TDZC 2XAHA 2GA2A 1IS1A 3DP7A 2M45A 2M30A 4A0ZA 5HLGA 2FRHA 3F6OA 3EUHA 5D5XB 2YX4A 4KC6A 2VT2A 2GAUA 4GO1A 1G3YA 1UCRA 4KFCA 2XAGA 3TO9A 3V8LA 2YX7A 3T5XA 1H9TA 3H3ZA 4MGRA 1GXQA 1F4KA 3V8JA 1A04A 1SFXA 3JTHA 1JE8A 1GVJA 4KIGA 3F8FA 1HW5A 2V79A 3LQRA 4BNCA 4H0EA 1T98A 1IAWA 1IXSB 1XSDA 5ICFA 4Q47A 2UXXA 2CWEA 3QRFF 3W6KB 2BYVE 1BIBA 4O6JA 1FWZA 1FT9A 4GYIA 4B09A 1LVAA 3CAGA 1Z05A 5H20A 3DF8A 2H6CA 4M6XA 1R1UA 3GZ5A 1STZA 1ZGJA 4A6DA 1CF7A 3K0LA 4S04A 2RQPA 5F6FA 2TDXA 3F21A 2FNPA 4D0PA 1QZZA 2EV0A 3S2WA 3IRRA 3C1DA 4EJWA 1B4AA 1ZARA 1LEBA 3WU1B 2MBFA 2IJLA 5CLSA 2XIGA 3CUOA 3FZVA 4KIFA 4OIRF 4OIPF 3KE2A 2D2WA 2LKPA 1W7PB 2RC4A 2PI0A 3WTXC 3J7AO 5LRSA 1O7FA 4LD5A 2MH2A 1ON2A 2BBYA 4HV5A 4RGRA 1U2WA 4XRFA 4LB6B 2GXGA 3CDHA 1U5TA 2Q0OA 4U0WA 3REOA 5FD5A 5JVOA 4IRIA 5D8LB 2GXBA 1XCBA 1O3RA 4Y13A 1H9GA 1KQ9A 3FMSA 3ZMSA 1WQ2A 1HSTA 4LFUA 4LK1F 4CGZA 2HYGD 2L02A 4LLGF 1IF1A 2EFNA 3E5XA 3TQNA 5HS7A 2OZUA 4WXHA 3JTGA 2XKOA 1PP8F 2ZXJA 3G3ZA 3TDUC 3O2PE 3T8TA 2XVCA 4ASNA 3ML6A 1REPC 5LLQA 4KICA 3E5QA 4RAZA 5ILVA 5H6RA 1J75A 4GYGA 4U7DA 2VOOA 3F23A 3R61A 2V9VA 4FX0A 3FOEA 4A6EA 3WGGA 1SD5A 1ZGAA 2HOEA 3BPXA 4JBAA 2ESNA 2A6HF 2V1DA 2O6GE 2FU4A 5FFXA 2STWA 3SHFA 3L4JA 4CHUA 1XSVA 1HKSA 1BOAA 1FNNA 2OA4A 1SD6A 1FC3A 5JHUA 2JRTA 2OQGA 4WK8F 4TV7A 5BPIA 5DD4A 5HS9A 2ELHA 2VBWA 1R1VA 4DQ2A 1U3EM 1YW7A 1FZPB 2FOKA 4ZYHA 4BQAA 2F5FA 2G7UA 3QP5A 1FPQA 3J81K 1GE9A 3QX3A 3LA2A 3KP4A 2Z99A 2PG4A 2GQQA 4IRHA 1Z91A 1YTYA 3T1BA 3PFIA 4M72A 5CVIA 3MMLB 1JGSA 1W7PD 1QO0D 4L5JA 5EEGA 2HTJA 1U8RA 3BDDA 2ZFZA 1OYIA 4YIIA 1K78B 4ZYEA 2F5CA 3K1NA 3F22A 4HYEA 4WCGA 2W57A 2PEXA 1XGSA 3QU3A 3I4PA 1FSEA 3KCCA 4CZZA 3ZMZA 2Y0MA 2A07F 1XXBA 5D5WB 3L2CA 3RKYA 4HOBA 3FXUA 5F1RA 5ILSA 1LDDA 1WI9A 2X0LA 4IVNA 1R7JA 1JHFA 4PGHA 3TOBA 2MH9A 3GFIA 3VODA 2OBPA 4EM2A 2QVOA 1T2KA 3PQKA 1O3SA 3WGHA 4JQFA 1SD7A 3E6BA 1D8KA 2QZ8A 3SZPA 2K27A 2CGPA 3COAC 2QM3A 4MTDA 2MA3A 5LGTA 5E8GA 4HX7A 1IN5A 2VBZA 2EK5A 2G9WA 1USSA 4IF4A 5DUKA 1EH6A 5LEJA 3IWFA 4JK1X 4MQ9F 1XGOA 1ZG5A 2PBIA 2RGRA 2H94A 4IHSA 1R23A 3AAFA 5CVJA 1KYZA 4N9HA 3N4MA 1D3YA 5LHIA 1S6LA 3M8EA 2FF4A 1LNWA 2AXLA 2A5YB 2MLKA 3RI4A 4AVPA 3ZN1A 5JVTA 1ODDA 1IN4A 2HKXA 1BGWA 4ON0A 2K02A 4UVBA 4I7HA 5CVUA 1ZAOA 1D8JA 2AS5F 2XKPA 3MAJA 4CO8A 1TQPA 1J59A 2M87A 4XLPF 1BI3A 4P55A 4OOIA 2XASA 1XGMA 3M7GA 2EFPA 1FBSA 4EM1A 5HS8A 3TKYA 3LQQA 1S7OA 1I1GA 3R6SA 4FT8A 1ZYRF 1DDNA 2P4WA 2Z9OA 2QUFA 4M71A 1BI0A 2A68F 3MCZA 4BH9A 3PQJA 3QOPA 2ZFWA 1BC8C 4OIQF 5HLHA 4LK0F 3TGNA 3GLXA 3BWGA 4RB0A 2XV4S 2LDUA 3WGIA 2L01A 1TLHB 4XLNF 3FM3A 3FMRA 4HAMA 3HRMA 4L5IA 1LEAA 2Y48A 4EJVA 5D5VB 4HX8A 4YG2F 3TO7A 5CVVA 3H92A 3HTUA 4LLNA 4Y15A 4R8HA 4KDPA 1USTA 2W24A 5BQTA 4G8XA 4DDQA 4EQQA 1NHAA 4KUMA 2COMA 1MKMA 3F8CA 2NS0A 4PCQA 1YFHA 1FY7A 2YU3A 1FP2A 2OQRA 1U6GA 4P9FA 1Z1DA 3EDPA 4FM9A 5LGUA 2F2EA 5FLXZ 3JSOA 2M5WA 4ZH4F 3TOAA 1BJTA 1SFUA 1E17A 2XCQA 3L9FA 2DPDA 3KFWX 3GW2A 4G0UA 1Q1HA 2FBKA 2YR2A 1F5TA 2ZMEA 3SZTA 2ISZA 2QWWA 3DEUA 2EJRA 3V7RA 4ETSA 3VOEA 3GFJA 5E1WA 3ZMDA 4L9JA 3EETA 1KU2A 4A5MA 4YFNF 3I54A 5HDGA 4BHCA 2E1CA 2W84A 3H3UA 1D5VA 2IVMA 5TRDA 3O6BB 4HDUA 2XGXA 1K79A 1G3TA 4G7ZF 1FYKA 1EK8A 2CQKA 5FD6A 4KB2A 4LG0A 1MDMA 4PDKA 5L3FA 2VC0A 4AIHA 5ICEA 5E8IA 4UV8A 3L4KA 4RAYA 2LNBA 1G3SA 4UNOA 2F5EA 1V4RA 3FWEA 3BPVA 2P6TA 2VE8A 2RV8A 1XGNA 3EYIA 2JT1A 2R7DA 5K5QA 2DU9A 2GWRA 5JR3A 1EH7A 4RB1A 5D6FA 2QYOA 3JW4A 4M9ZA 3M9AA 1JHHA 3KZZA 2IPQX 3ECOA 4B8XA 1DPUA 2M8EA 3N97A 1SFEA 2K4JA 1K7AA 4AIJA 2P7CB 2M1BA 3L7WA 2HGCA 3LAJA 3GF2A 3FOFA 3BJAA 1DUXC 5LEKA 1XXCA 1RNLA 4OINF 1Z7UA 2QQAA 1KU9A 1Y0UA 2O3FA 2ZNZA 3EQLF 1P92A 2IW5A 1ZH5A 1IN7A 3D0SA 4YFXF 2HDCA 1FYLA 3WTVC 3E6MA 3T0YA 1XB4A 2FBIA 3T8RA 4ESBA 5IT9K 2P5MA 2DW4A 2CYYA 1DP7P 5A2QK 3BJOA 1OMIA 1YYVA 1KYWA 5IT3A 2DQRA 5KVRA 4L9TA 1AWCA 2EA4A 1T6SA 1YO5C 3SXYA 1UB9A 4M9XA 3HRSA 3F8NA 1J5YA 3CUQB 3ZN0A 2P5LC 4S05A 4ESFA 2KIFA 1QBJA 5F64A 2NNNA 2IA0A 4A12A 3V4GA 5LRRA 5DUIA 2P8TA 4UUVA 2DI3A 1HXDA 5LHHA 4M74A 4F7ZA 3VEPA 2VC1A 4MHGA 4EJOA 1U5TC 4UVCA 1H0MA 1FLIA 4HX4A 4KMUX 2QQ9A 4A0YA 5L3DA 1DD5A 1B59A 1ZLJA 3WODF 4NHJA 3WTUC 4UV9A 1YG2A 2ACJA 2OAZA 2E7WA 3MEXA 3QP6A 1C0WA 5EEHA 1XD7A 1DPRA 2PQ8A 2BE5F 5HDNA 1ULYA 5E18F 3Q9VA 2NNYA 1KA8A 1G3WA 2FMLA 5JFRA 4QLCU 2FE3A 4M9SA 4J3NA 2H6BA 5FGMA 2EFQA 3ECHA 1T39A 5AIQA 1K6OA 3QPHA 2YSRA 3ROUA 3R60A 3BROA 1YW8A 1LQ1A 3G73A 2RKHA 3U2RA 3LSTA 3D5LA 4KNYA 1WKMA 1KU7A 2A6EF 3SFZA 1P4AA 2K86A 3RIRA 2HR3A 5FLXK 4HQEA 1MZBA 1W4MA 3QPTA 1RI7A 2VXZA 4G7HF 5ICCA 4G0VA 2DLLA 1MDMB 4OMZA 2Z3YA 3R0AA 1TW3A 5E1ZB 2ZMEB 2ETHA 1B1BA 3V8KA 5D8KB 5DEQA 1W5SA 1MD0A 3P7NA 2VODA 4LGWA 4RS8A 4IHTA 5DD8A 4HF1A 1WSUA 3LA7A 3C18A 5ERIA 2WTEA 1P4XA 3ABUA 4K2EA 1ZLKA 3ZQ7A 2DK5A 2ZNYA 4HF0A 2PLYA 5BS6A 3FF5A 4AWXB 2GA1A 4PZJA 2EA2A 2V6CA 2DT5A 3Q5FA 2MD5A 3E5UA 1HBXG 3NQOA 3CO7C 4RGXA 2OD5A 4A0XA 1B9MA 3GFMA 3L00A 3LFKA 3K1MA 4BAYA 2ZJ2A 2DK8A 2VE9A 1TQMA 4U0VA 3U9GA 3GO5A 2Y3PA 1UFMA 4XBFA 3MZHA 3MWMA 1YLFA 3OOPA 2DFIA 3I53A 2O0YA 3FMQA 3HSRA 5DCMA 5L3EA 1HKTA 1O3TA 1QGPA 4AD9A 3RDIA 4YIFA 2DPUA 4HV6A 3JAMK 3HUGA 3NUHA 3JAMZ 5BMZA 3QAHA 1IXCA 4IRGA 2VT3A 5DDGA
chains in the Genus database with same CATH superfamily
3G4AA 3OREA 4G0WA 1R1TA 3HSFA 2FBHA 4E70A 5IOSA 3S2HK 2JA5A 1R6RA 2K4BA 1XDSA 1Y0NA 2XRNA 3JRGA 1FTTA 2PHCB 3VB2A 1P2FA 2B0LA 1YNJA 2DA4A 3DPTA 1ETOA 4EJUA 4IL6C 3NARA 4UVAA 1BOBA 1WCMK 3ADAC 2DAOA 4NOIA 4Y17A 4KMAA 2NOGA 3QWLA 1IBAA 2X1DA 2ECBA 1MNMC 4XSXF 1ENHA 1L0OC 3K9TA 1YITI 1BDFA 4XLEA 1Z21A 2P7VB 2HPIA 1N78A 3T01A 2BGCA 1B9NA 2L7KA 4CYCA 3Q0VA 4N4NB 4RB3C 2BVLA 2BEOA 4G94A 1SFOK 4O2DA 5C3EC 5C44C 2K9MA 5FB2A 2EV6A 1EJ9A 4OIPA 2G7HA 4MO7A 1B8IB 3GVAA 1WWXA 1TT5B 2XHKA 1XMAA 3E6CC 1R71A 2CRGA 2A6HA 4HZFA 3S16J 2WB1A 4KJZA 3MQ0A 1W0TA 1IV6A 3U1KA 4LITA 4QIWN 3I58A 3A8IA 2YPRA 4DGWB 2R7XA 1R58A 1ONVA 3F6VA 3GTQJ 4QWQA 3BP8C 3CUQA 2MC4A 5L3CA 3P9CA 2E7XA 2HZTA 1X4PA 2BW3A 3EQLA 3KX2A 4C30A 2IT0A 3HGYA 1IUYA 4HQMA 5ED4A 2RN7A 3H0GJ 3HPGA 3O8GA 1MBHA 1TQIA 1YIOA 3ERED 3ISPA 2MG4A 1NG7A 3S2DK 4KMFA 2EBIA 3W2VA 1TL8A 3HHHA 1TWGA 5CVRA 3GTJA 2VQHA 1RKWA 3UNGC 3RSNA 4AUXA 5J8CA 2Z5UA 2DBBA 4BYYA 1EV7A 4LLGA 1ETWA 3PUBA 2E2IC 1JKQC 5M5YJ 2E2HC 3S0XA 1OLTA 3VYUB 4EGYA 2CG4A 3HOVJ 3PO2C 2XB0X 2KJBA 2UWMA 3PIOF 1TWCA 3BP3A 3A8KA 3ESWB 5TJJA 2HFHA 3KLNA 5HDKA 3CCSI 2LTPA 4WXCA 3SQNA 4MFDA 5LGNA 5FJ8K 4FHTA 3DPUA 3VYTB 1WQFA 1AA7A 4A3EK 4DBRA 1BBYA 2DFHA 3AL0B 2XGDA 3F8BA 5DCFA 3B73A 2XCOA 1OPCA 1QPMA 4V2FA 2JA8C 3BQZA 2HEOA 3BCBA 5M5XK 4ZDLA 3I4NC 3GFLA 4HLYA 3I56I 2JUCA 2ECCA 4CCOA 2NRAC 2XSDC 1WOPA 1YQAA 4GCVA 4UY8I 2HI3A 3IWZA 5FLVA 3GTGC 1G51A 1S9HA 4B3XA 1V55H 4BDZA 2P5VA 3WE2A 3HIFA 3FK6A 1RIOH 1FX7A 1WJ5A 2DMNA 3BOQA 1P7JA 4BGDA 4A3MC 5FLMJ 2XAQA 4A3GJ 2E34A 2AHQA 2H8WA 2ZKZA 4G6DA 5FLMC 4A3GC 2H27A 2R5YB 2HOSA 3RZDC 4MEYF 4AYBN 1TWFK 1OR7A 4M6YA 2KWAA 5A2QZ 2NVXK 5CJ9A 3FXQA 3WTSC 1VQOI 1NK3P 2ZCWA 2R7ZK 3BUEA 4OMYA 1GDTA 2VXDA 2Q2EB 2PA8D 4PJMA 2JA7J 2A5WA 2V6EA 1ZG3A 3HPHA 2QQBA 2VONA 3QU6A 2LY9A 2FSWA 1ZG1A 2CW0F 5ILUA 4JK1A 4N9IA 2PMZA 4WJ4A 2IP2A 2Z2SB 2CU7A 1LDJA 2JUGA 1P4WA 2VB6A 2AXTC 3TFJA 4XLCA 5HLTA 4RMNA 4HLXA 4A3EJ 1XXAA 4CXFA 1O7LA 2MLGA 1VQ5I 2R7FA 1G59A 3JCUC 1FMVA 4BBRC 1W7PA 2D45A 5GAGJ 3CCJI 1FBQA 2E19A 4HW0A 3TBIA 1PJ6A 1F9NA 1FOYA 4BL0B 1WIHA 3OV8A 2NYXA 2PMZD 3SZZA 1KGSA 1D0ZA 3CP2A 3U1DA 2EFWA 1IRFA 2F4OB 1E2XA 3S2DJ 2JPCA 4M3GA 1O2BA 2PJRA 5BOXA 2E2HJ 2K85A 3OL3A 5EGOA 2BW3B 3L2VA 2EZKA 4HNVA 5E17F 3HOYC 4KN7X 1MJ9A 3AFHA 2YU9K 3KP7A 4FX4A 1Z3XA 2VQGA 2RDPA 1K83K 1OYWA 1ZRCA 2NVYJ 3IL2A 4EJTA 3G4SI 2DOEA 2LKSA 5LBQA 3GX4X 3B6CA 2VASA 1ACIA 2JA7K 3HOYK 2HQAA 2VIXA 5DTDA 3ZMTA 5C3EK 1O25A 3HOZJ 3GSIA 4BXXC 2CQNA 2Q8KA 2L4MA 3DU6A 2GM4A 4IQJA 3KP3A 2R7ZA 2E2HA 2R7ZJ 5K5OA 2ISYA 1RETA 5C4JK 1F7UA 5J8FA 3GTPJ 2GSUA 3V7SA 3WE3A 3HOWC 3GTLJ 2R7TA 1PJRA 1ZREA 2VBYA 2A05A 3GWZA 2K7LA 2HVRA 1X4OA 5IY5H 1AKHB 3S1NJ 1LE8B 2AQEA 3F0CA 2AQFA 4BHBA 3DKYA 3E1SA 3GZ6A 3BZ6A 1PP7U 4B43A 3W2AA 4C3IK 3HOWJ 4YFXA 3L2RA 1IN6A 5IP9C 1QHGA 1X58A 1FIAA 2JZYA 2CO5A 3BJ6A 4Y7NJ 2WV0A 3MZYA 3GTMC 1FSHA 1FIPA 2BY3A 3RJPA 4UXNA 4MNUA 2EB7A 3K69A 3NAUA 3C7JA 4C2MC 3L09A 1QZEA 3K4BA 5D5UB 2RAEA 2H1LA 3NEUA 4NBQA 3ZQCA 1ZN2A 2ESHA 2R5YA 1L3LA 4Y52K 1S29A 2W25A 3FXJA 3LSRA 4MQVA 1S7AA 5HOOA 1F7VA 1FOKA 2D1VA 3HOTA 4L5EA 2JWTA 4O5VA 2DOFA 5JLXA 2Z33A 4I6ZA 4GTFA 4RA2A 2F4MB 3HOYJ 4LK0A 4E7HA 1LKXA 1LPQA 1ZELA 4JP0A 4FE4A 4LJZF 4YFKF 4IPAA 5GPAA 1OKRA 3K2ZA 5D6EA 2WADA 2VJJA 2DO7A 3GTGA 4KB4A 4WXDA 4XLPA 3K4NA 2ADUA 1HSJA 3IP4B 3J80Z 1MNEA 2JA6K 3GTOK 3J80K 4U0YA 1Z7LA 1S8NA 5GADJ 4XKCA 4R79A 1OCTC 4BDYA 1Z6RA 1BIAA 2M7BA 3M3YC 2VOPA 1J9IA 5M3FK 3MFKA 4BY1J 2V1XA 2FEZA 1APLC 2QBYA 1TWAJ 4BBSC 3CCYA 2M2EA 5IYCC 1X3WB 4U7BA 3GTPC 3GTOC 3ABTA 4MTEA 2YUSA 2IXSA 4CH7A 5DV5A 2Q2EA 1FP1D 4II2A 1D1BA 3ULQB 4QTRA 3I71A 1Z77A 2DMTA 4LG0B 1KQ4A 1IN8A 4NQWA 5EGHA 3I3LA 3ELKA 3J81Z 4ZYGA 2EV5A 4KYWA 1LB2A 2FQTA 2J5OA 5JI6A 3BG9A 4ENKA 1ON1A 4CYCB 1EH8A 3S16C 1SEUA 4GTLA 2K9QA 3A0HC 2DA2A 5CYVA 1IC8A 1LFBA 4M3EA 3A02A 3C2GA 1WFXA 3FX3A 2ZUEA 2BV6A 3GZNB 5DCMB 2VBXA 4DBQA 4XICA 1IXRC 2BY0A 4A3JK 1MJAA 3FXLA 1U78A 4XLAA 1FOXA 4LMYA 4LB5A 2ELKA 3B6AA 3N05A 3DQVC 2HDWA 3OIOA 4KA4A 4RGSA 1R9TK 3F3XA 3K4LA 2BHYA 5HODA 2W1OA 2CQ7A 1YOVB 2RVCA 3QOEA 4A3JC 2IGMA 3VA7A 2X6WA 1XDUA 4LIVA 5E20A 4CA0A 4D7MA 3TMOA 3DV8A 1MGTA 2MC3A 3HEFA 2ZO4A 4JYKA 4EM0B 3HRUA 5F0CA 2O8XA 2R5ZB 3I4MC 2L3DA 1MH4A 1EH1A 3ZMUA 4BKXA 1QNTA 3CJNA 3M1CA 3WHCA 4ZZLA 1I5ZA 4FCYA 5KAIC 4EATA 3S17J 3VYSB 2K3PA 4PUSA 2W85A 1SD4A 3AG2H 2O5IA 1I3AA 2O61A 3OS0A 3WTYC 2JSCA 1V5FA 2V9PA 2DT6A 5B1AH 1H88C 3J7ZI 1IQ0A 1J98A 4BY7K 3ZMVA 4MQ9A 4A5NA 1O24A 3I5UA 1BR4A 5IOZA 4HSTA 3MKZA 3DFGA 5FKLA 2L4AA 3OL4A 1MNDA 2OUMA 5KHDA 1HDPA 3CO6C 5KK1A 4N0BA 1AOYA 3CLOA 2X6YA 4XN0A 2LF8A 2M3AA 1R9TC 3O8HA 1DCOA 1TNTA 5IYDC 1A6IA 3Q3QA 2DXIA 3KEQA 1FTZA 3AKZA 3M8FA 1GXPA 2H09A 2NS8A 1LJ9A 1YHQI 4BU2A 1I27A 4QSHA 3I59B 4EMSA 1VQ6I 1O29A 4P5AA 3OYKA 3GTLC 5IP9J 1I6XA 1B4BA 2UXNA 3HOUC 1JUPA 1PUEE 3S1MC 5IYBK 1AB4A 4MEXF 2R92K 5M5YK 1OCRH 4DW6A 2VPLA 1X1CA 2R4GA 3D5SC 5ICGA 2ME6A 4CYDA 3GTQK 2PMHA 4XK4A 4UHTA 3LSPA 3SZYA 2E2JC 4P96A 4XCHA 1QZYA 4ZYDA 1FYMA 2M4GA 2XRLA 2EWNA 1I50C 2R7OA 4GXOA 2EILH 2BE5A 1W5TA 5E68A 2RNJA 1XMKA 4LIUA 3GYHX 1OCZH 4Q5SF 3K4MA 2E2HK 2LSOA 1XC5A 1U8BA 1HW2A 3RTRA 2GOMA 4P9UA 3RKXA 4PGGA 1VF9A 4PJNA 3PL8A 2W7VA 4KMHA 1XCVA 2B63J 2WB1N 1VQ7I 1YX5A 3BP8A 2F4IA 3IC7A 2FXAA 4M3BA 4RGUA 3WG9A 4CSWA 3JSPA 3HOVC 1IW7F 1PVEA 2X51A 3VFZA 4E7SA 4WX9A 3TO6A 1XN7A 2RH6A 1MH3A 1BI1A 2X4HA 5FFZA 5IT9Z 3P9IA 2PFBA 5K7HA 1LE8A 4EV0A 2LLKA 1IV8A 3SEZA 1TTYA 1YS7A 3I59A 2OC6A 2ZBKA 2P6SA 4LLLA 4JX4A 4X1EA 1ZRDA 3RYRA 1VQPI 5IP6A 2OCEA 4C3HC 4OIRA 3HYIA 2OPTA 3S1RJ 4H4KC 5LHGA 1P9QC 4YEJA 4I02A 2XUBA 3M4OJ 1I1SA 3IPJA 2JTVA 2VN2A 3ASOH 4KN7A 1V5GA 1SMYF 3C3WA 4KN4X 1VQ9I 1HKQA 4BY7J 5C44J 1T0FA 4CICA 1F1ZA 1I3QJ 2VJ5A 3B02A 1YCLA 4ZZDA 1TWFJ 4KT5C 1R5GA 2QENA 4ILDA 3F8MA 1RUOA 2ICWG 4C9YA 1G6NA 3PM1A 3R4KA 4G6QA 3AQOA 5F08A 2VUMC 3E3VA 3S1NC 2FMYA 3W6JB 2EFOA 3HG9A 4BJTA 2R93K 1Y1VJ 1A36A 2HS5A 1X3ZB 3DKXA 2IA2A 2PJPA 2QLZA 3TP0A 5L3BA 2KIQA 4QJVA 2OTLI 3Q9SA 3RZOJ 2C6YA 2QCOA 1TNSA 4ENMA 2UUZA 2E2IA 5EGOB 1VTNC 4DNCA 2L54A 3LAPA 2VKEA 2YU9J 3HGGA 4RB2C 1X2MA 1HQCA 3HOXK 4I98B 2DQLA 3OS2A 5K5RA 5HL8A 2WA0A 5GTIC 4A3IK 4L0YB 1R00A 2CV2A 2CFXA 2DN0A 3SFIA 2BY2A 3NRVA 3FHZA 1PUFA 2E5NA 2UZKA 3CTAA 4OIOF 1S3JA 1ZVUA 4BJ6C 1CGPA 4NB5A 5E1XA 2JPBA 1X2NA 2RREA 1YW9A 1WJDA 2DTRA 4A2UA 4ENNA 3OWTA 3S1QK 3ZP5A 4XLHA 4AIKA 4Q48A 5DS9A 4P5OA 2O03A 2W48A 1JXSA 1TWHK 3GLLA 3RYPA 1UG0A 2VUMK 3S3MA 1LVKA 2ZJPF 4BY1C 3I4MJ 3WTTC 2FNAA 2HKOA 3P9KA 3GXOA 3AD9C 4I0BA 3K1PA 1SAXA 2GIVA 4R1HA 1WPKA 2XAJA 1LDKB 4BACA 1Z9CA 4G7ZA 1X3UA 1R36A 5DYMA 3EYYA 4CDGA 4CCLA 2CSOA 5K1YA 5EJCA 1BS2A 3RPUA 4EVIA 2FQ3A 1GHCA 4C3JK 5EGEA 3CC7I 2H8RA 1S7EA 4DOZA 4ZC3A 1GV2A 2ZXIA 3S1RC 4J19A 3TP3A 3OYLA 4AYBL 1UZCA 1D0YA 2A69F 1BC7C 1A5JA 3CD6I 2ME0A 2E1NA 1RR7A 1BW6A 2KRFA 2O7OA 2QBYB 1ZQ1C 1BJAA 4A3DJ 5D4SA 4XOPA 4AU7A 6PAXA 2X9DA 1T08B 1NG6A 1B6AA 1ZRFA 3K7AK 1UJ8A 3GUDA 4HDVA 3K4KA 3CF5F 3ZRGA 4BHPA 1Y56A 1D1CA 1BN5A 1FBUA 1SMTA 2XROA 3IV5A 2HXOA 2ZSHB 4WF2A 9ANTA 4MIMA 3KP5A 3HSEA 4XKWA 2M34A 4M73A 3BQYA 2NVTK 2A61A 2KJCA 4A3BJ 2DFEA 1JKRC 1SFOC 1I50J 4XSZA 2KIUA 2XF6A 1T38A 4KMDA 1JVIA 3O3KA 1WRJA 3LWFA 4KMUA 3CF2A 4DYRA 2NVXA 2IA1A 3JRFA 3DCFA 5FO5A 1R22A 1I3QA 1KU3A 2J5PA 1KQ8A 1O2FB 4PK4A 4RM2A 4EGZA 5HVQC 4IXAA 1ETQA 3G71I 1Y39A 1GUUA 3KIOA 4P5BA 2VUMA 2JK3A 2ZJQF 5E3NA 3HHGA 3FKIC 2NAZA 1O57A 4I76A 4G7OF 1BR2A 1CF7B 1J6XA 1X1BA 2E36A 1MBFA 1Y1WJ 3OEPA 1WQGA 2JA6C 4FZBA 5L3GA 1UV7A 4KIBA 3CUQC 2E2JJ 2E2IJ 1WOSA 4KAWX 3SEQA 2FA5A 1G4DA 2WB1D 3S15C 1J0RA 1O3QA 1IZ1A 1GT0C 2V1UA 4A3KJ 1VQ4I 4Z6YA 3E6DA 3WU0A 3V7CA 3CCMI 3I4NJ 5IOYA 1EKEA 4XSZF 1B72A 3KYLA 3BY6A 4W1UA 4LQYA 3WTZA 2WAFA 1TWCJ 4L9NA 1K78A 2V7FA 5FKMA 3F9KA 5LD2C 1UHMA 1OCOH 2Y69H 3ZPLA 2LY1A 2LC2A 1WQHA 2KP6A 1X1PA 3PNVA 4G9YA 4PJLA 3S16K 3I4MK 2Y75A 1R49A 3HTSB 3JRHA 2GLOA 2DYSH 4C3HJ 2VJ4A 3JSTA 1MBEA 3KZYA 1YJ9I 1XX5A 1QQIA 2CQQA 4HEA2 1P6RA 1JGGA 2CQXA 3HM5A 1N75A 1AU7A 2PMUA 2A3SA 4S0HB 4I01A 3PO3J 3IRQA 1ISEA 1U5TB 2LR8A 5EDNA 1TBXA 1F43A 3OYIA 2CFAA 1KQ0A 1JI8A 2GZWA 5D4RA 1ZYRA 2WAQD 2I10A 1UHWA 1YI2I 3I64A 2B9SA 3E97A 5CKTA 5HLIA 5FRMA 5L46A 1WI3A 3KETA 2HWVA 3IKTA 2K9SA 4I09A 1USMA 3FXRA 1ZHFA 3LPXA 3IHUA 1ZGWA 2YU9C 2KKOA 1Z6TA 1PDNC 5IOQA 5F04A 2LVSA 2PN6A 2W82A 4L18B 3H9JA 4HF2A 1J2XA 3FXKA 4HA8A 4A3BC 1IRGA 2P5KA 3BR3A 3OPFA 1HW1A 1RUNA 4ESJA 3KLOA 4M6VA 3FBNB 3EUHC 4BXXK 3DLAA 4G7HA 3F72A 2EPFA 4Y4RA 4Q4ZA 3VWBA 4HBLA 2CFOA 2HQRA 3BR2A 2STTA 1TW2A 4A3CK 2OTJI 2JVGA 3ASNH 5H6QA 1IL2A 1IDYA 1MBGA 4D9JA 2OZ6A 1ZXOA 3IKVA 1MJBA 2LMDA 4E7KA 1BI2A 4GTBA 2EIKH 1PJ5A 2VKHA 3KP2A 1J7KA 4GGGA 4WWCA 3KEOA 4XORA 2E5ZA 5AIPA 1BM9A 2XAFA 3KP6A 3WTWC 2HOTA 4IOAF 1V5VA 1E0EA 3CCVI 4Y33A 4RDUA 2HYFA 1V54H 5J6XA 2IRFG 3CCQI 1R5HA 1YS6A 4OU0A 4BXUA 3DPLC 2HQNA 2R3SA 3LA3A 4GFQA 2D1HA 1ETKA 1XSXA 1R5ID 3HOSA 2HTSA 4X0GA 4Q4ZF 2V4JC 4X6AK 3C2BA 2Y0SL 4KDDA 4D1QA 3RKWA 1RZ4A 2N8GA 3IH2A 3HUGB 5FRNA 3K7AC 4ENJA 4O3MA 2XCRB 3LSKA 3RPQA 5KNLA 4I0AA 2F5DA 2RGVA 3GEZA 1YNNA 1VQKI 3MD2A 2R7WA 4HG2A 3K70C 2XF5A 3HKZD 4IJAA 1V3FA 3DXJF 2ID6A 5M3FJ 3HRTA 1TC3C 2JA5C 3M07A 2LF7A 3SDBA 5BPDA 4I2OA 3DKWA 1B8IA 5CQGA 1IRXA 4Y7NC 3H0GA 4GZYA 5AONA 4Z2YA 2KT0A 3M1EA 4L9VA 4L0ZB 3FM5A 4AH6A 3WG7H 3LNQA 2WC2A 3S1MJ 3I0TA 4CCKA 1HI9A 1TWAK 1TWFA 2KIMA 4A3CJ 2AO9A 3AG4H 3K2AA 4HPQA 3R0JA 2NVYK 2ZJRF 3A0BC 1OYYA 3BR1A 3RCOA 2WWYA 5FROA 1WSRA 2OU2A 4U88A 3TDZC 2XAHA 1N25A 4FISA 2Y30A 3FIWA 1X1DA 3W6VA 2DDBA 4NUBA 2X6XA 4IHWA 4A3FC 3HKZN 3EUAA 5F1JA 1D0XA 3BZKA 2GA2A 4X6AJ 1WJEA 2L9RA 3FXMA 2I5UA 4RAGA 2R7SA 1IS1A 4G7OA 1HOMA 1R9TJ 5HNHA 1YX2A 2Y0SA 2EIJH 1LFUP 3D1NI 3DP7A 4A3IC 2P0WA 1NK2P 1YRNB 2M45A 2Q1ZB 2M30A 3M4OC 4C45A 4A0ZA 4D5CA 5HLGA 2O8KA 2FRHA 3F6OA 3EUHA 4AC0A 3K7AJ 2YX4A 5D5XB 4KC6A 3HXAA 2VT2A 3M3YJ 3GTJK 4B1RA 1NH3A 1FOWA 2GAUA 3BR6A 4GO1A 1YIJI 3K70D 4B3AA 1A35A 4FTHA 3HKZL 1IDZA 3BTJA 4M3FA 2ZC2A 1G3YA 1UCRA 2BXZA 4HSRA 2L7FP 5EEAA 4HRIA 4KFCA 1YRNA 4II3A 4LR2A 5GP9A 2XAGA 1TP4A 2O5RA 1OQYA 3TO9A 3GTMJ 5EYRA 3V8LA 2YX7A 3OIQA 3T5XA 4BE1A 4A3LC 2IS2A 1H9TA 1MMAA 1OJLA 2KDZA 3H3ZA 4MGRA 2IGNA 1GXQA 1HCRA 1F4KA 1I6HJ 3V8JA 4AM3A 4UUTA 3GTPK 2L7ZA 1A04A 5C4JJ 1SFXA 2BXYA 3JTHA 4XL9A 4BLBA 1JE8A 1GVJA 4KIGA 5TGTA 5B5EC 3F8FA 2M0CA 1HW5A 4U87A 1IRZA 2DFFA 2V79A 2F5VA 2PMZL 3KEYA 3TFHA 3LQRA 1MSEC 4MEXA 4BNCA 2R92A 3RQIA 4H0EA 1T98A 4V2GA 1IAWA 1IXSB 1XSDA 2JRMA 3RZDK 5ICFA 1Q1VA 4FE7A 4IO9F 4N4OB 1XZQA 3ABLH 4Q47A 2UXXA 5M5XJ 2CWEA 3QODA 2R0QC 3QRFF 4KISA 3PSIA 3JRCA 3W6KB 2BYVE 2KPMA 4LJZA 1BIBA 4O6JA 4QIWD 1FWZA 1T95A 3PO3K 3H5AA 5E3LA 1GVDA 1TWHJ 1FT9A 1H8AC 1A31A 4GYIA 1EQRA 3ONQA 5CHPA 4B09A 3OSGA 1LVAA 2E60A 3CAGA 2A6EA 3HJEA 4AYBA 1Z05A 5B1BH 2KFDA 5H20A 3HOVK 2HVSA 3DF8A 2V1NA 3RQ4A 1C0AA 2H6CA 2QSHX 1W0UA 1MMGA 4M6XA 2V9KA 2K9LA 2HDDA 2EH3A 1R1UA 3GZ5A 2DYRH 1XG1A 1STZA 1ZGJA 3A1YA 1KZHA 4OWRB 4A6DA 4GDFA 1CF7A 3BG3A 3K0LA 2RQPA 5F6FA 2TDXA 4S04A 1WZ2A 4GRIA 3F21A 3OY9A 2FNPA 4XKBA 4GTAA 4D0PA 1QZZA 5K7ZA 1W36D 1HDDC 2EV0A 1XZQB 2A68A 1Y1VA 3I4NK 3H9GA 3C1DA 3MN2A 1B4AA 3S2WA 4EJWA 3IRRA 3JR9A 4IHXA 4A3DK 2EINH 1ZARA 1Y1WA 3W2WA 3CQZK 1LEBA 4MFEA 3WU1B 2MBFA 2IJLA 5CLSA 1UHSA 4GTCA 2XIGA 3CUOA 3A4CA 5EZGA 1I6HK 3FZVA 4KIFA 3PSFA 3HXLA 4OIRF 4OIPF 3KE2A 3AG3H 2D2WA 2LKPA 3L2UA 2W00A 5D4DA 2ZB9A 1W7PB 2RC4A 4IQ4A 2PI0A 1K61A 3G6EI 2NVQK 4Y3OA 3WTXC 1S5LC 3L2WA 3OS1A 3J7AO 5LRSA 1O7FA 3QPSA 4LD5A 1DGWY 1ON2A 2MH2A 3OYDA 2OF7A 2BBYA 4HV5A 4RGRA 1U2WA 2ZXWH 4XRFA 3W3CA 4LB6B 4KN4A 2XPWA 2O5JA 2JA7C 1MIJA 5IYDK 2GXGA 3CDHA 2FUG2 1I6VA 1WCMA 1U5TA 3S14C 2Q0OA 4U0WA 3REOA 3G1LA 2CMPA 3OIPA 3OR2C 5FD5A 5JVOA 1GLNA 4IRIA 4KM9A 5D8LB 2GXBA 1XCBA 4YIRX 4DZJA 4KASA 1O3RA 1T56A 3GCMA 4Y13A 1YX3A 1H9GA 1KQ9A 3HL2A 3FMSA 2CJJA 3ZMSA 1WQ2A 4RLFA 1HSTA 3CDIA 4LFUA 4LK1F 5JVGF 4WJ3M 3LSIA 2DMUA 4CGZA 2V6SA 2HYGD 5J1YA 3KYCB 2IBDA 1MBKA 2L02A 1SFOA 1WCMJ 2DTZA 4LLGF 2E1MB 3CDLA 4J01A 1JT0A 1IF1A 3BTIA 2EFNA 2XPVA 3E5XA 5GPCA 4F93B 3CMMA 1BW5A 1R4NB 3ZR8X 5E3OA 3TQNA 1R9TA 5HS7A 3LSGA 3H0GK 2KISA 2OZUA 4WXHA 1ZTRA 3JTGA 3HOZK 2XKOA 5J47A 1PP8F 4B44A 2BVMA 4XKVA 4D5FA 1F36A 2DMQA 2ZXJA 3DBHB 3G3ZA 2IGOA 3TDUC 1ZBSA 4BY1K 4UB6C 4M1XA 3SDGA 4DZPA 3OYJA 2ID3A 3O2PE 3T8TA 2XVCA 4ASNA 3ML6A 1REPC 5LLQA 1O2AA 4KICA 3PO2K 3E5QA 4RAZA 2IS4A 2HYJA 5ILVA 5H6RA 5M5WK 1J75A 1DCPA 4GYGA 1TWCC 3HZJA 4BKWA 1P7IA 1EI6A 4U7DA 2QKMB 4XOTA 3K10A 2VOOA 5EG0B 4ZTJA 2VUMJ 3F23A 2CW8A 3R61A 3CCUI 5JFEA 2V9VA 4FX0A 3FOEA 3BLYA 1I50A 2CUJA 4A6EA 2KZVA 4XRMA 3A03A 3S1QJ 1I3QC 1J09A 2QSFX 2X6OA 5J4VA 3S1QC 3I9V2 3GTMK 3WGGA 4GTDA 1SD5A 1ZGAA 2HOEA 3BPXA 3OYAA 4Y52J 3DLLF 2R92C 4JBAA 3AD8C 1TWGC 2WV1A 2ESNA 3FHNA 3T00A 1SFKA 2A6HF 5FKKA 2V1DA 1XPPA 2O6GE 1WJCA 2FU4A 2Y31A 5FFXA 2STWA 2JA6A 3SHFA 2K9NA 3IH4A 3L4JA 4CHUA 1XSVA 1FJLA 1HKSA 2X1CA 2B7EA 3ABKH 3H1CA 4Y7NK 2IAIA 3KYDB 1BOAA 1FNNA 2OA4A 1SD6A 2NVTC 1FC3A 5JHUA 3G1MA 2JRTA 2VI6A 3RZDJ 2OQGA 3S17K 2L0KA 4WK8F 4TV7A 1OR7C 1RC9A 4C2MK 1UAAA 5BPIA 3BG7A 1ETVA 2PPBA 2R7QA 3DTEA 3GTKA 2B63K 1IUFA 2CUFA 5DD4A 3GEIA 5HS9A 2ELHA 5TMCA 1JQWA 4BQQA 1Z3YA 4IHYA 4GTEA 2VBWA 1R1VA 1A6QA 2LKXA 4NQWB 4DQ2A 4NC6A 1U3EM 1YW7A 1I3QK 4CCMA 5IYCK 1N77A 1FZPB 1O4XA 2FOKA 4QJVB 4ZYHA 4PFPA 4BQAA 4A3FK 1YE9A 2XGEA 2F5FA 2VQLA 4BQOA 4C3JC 2G7UA 3QP5A 1F93A 4AYBD 1FPQA 3AL0C 4CCNA 3J81K 1XPXA 1TWAC 4CZCA 1GE9A 3QX3A 3LA2A 3KP4A 2Z99A 2XF7A 2JA8J 2PG4A 1SMYA 2GQQA 4A3MK 2LYCA 2NVYC 4IRHA 1J6VA 1Z91A 1T8IA 1H89C 1YTYA 1WJFA 3T1BA 2TCTA 3PFIA 2A6TA 3N3YA 3HB9A 3PJRA 4M72A 5CVIA 3MMLB 3S2DC 1JGSA 1W7PD 1QO0D 3FISA 4L5JA 3OYNA 5EEGA 2HTJA 2H1KA 1U8RA 2LREA 1U9NA 2K5CA 3BDDA 4BEHA 2ZFZA 3S1NK 4IKFA 3H0DA 1INNA 1OYIA 2OCCH 4YIIA 4E7ZA 1K78B 3AH5A 3CCEI 2COBA 2EIMH 4LOWA 4ZYEA 2F5CA 4A3LK 5TMFA 3OYEA 3A2KA 3K1NA 1JKOC 3ABMH 3F22A 1ZR2A 4HYEA 4WCGA 1JKPC 4V19K 2PMZN 1XMXA 3DTKA 2W57A 2PEXA 1XGSA 3QU3A 3I4PA 1FSEA 1LFPA 1UMQA 3KCCA 4BXFA 1J6WA 3OYCA 2B63A 4CZZA 2Y9ZA 3ZMZA 2JA8K 4HNTA 2Y0MA 3CQZA 2A07F 1XXBA 2M9HA 4HNUA 2JA7A 2IGKA 5D5WB 3L2CA 3RKYA 3BZCA 4HOBA 2XPUA 3K4CA 3S1MK 3FXUA 5F1RA 5ILSA 1LDDA 1WI9A 1Y1WC 2NVXJ 2VKDA 2UV1A 5IP9K 1X31C 2VJIA 4XN3A 2E2IK 2X0LA 3GTQC 5B66C 4F52A 5FKNA 5TISC 1PJ7A 3Q3SA 4IVNA 2WAEA 4PSXA 4F3QA 3N0CA 4YFKA 3ZQIA 1R7JA 4WILA 2E1MC 2GSOA 3LOCA 4XR6A 1JHFA 4A3CC 4PGHA 3TOBA 3J7AY 4DYQA 4OINA 3GMEA 2MH9A 3GFIA 3VODA 1WVRA 2OBPA 3IH3A 2DA7A 5M3MJ 4EM2A 2QVOA 2XDVA 3PQKA 1T2KA 3X2QH 1O3SA 3WGHA 4JQFA 1SVLA 3K6GA 1SD7A 3WHBA 1QVUA 2PA8L 4I99C 1VRQC 3T02A 3E6BA 2L7MP 1D8KA 4PAAA 3IAM2 1PUFB 2QZ8A 3SZPA 2K27A 2CGPA 3COAC 2QM3A 4MTDA 2GXAA 2MA3A 5LGTA 4A3BK 5E8GA 4PABA 3OR1C 4HX7A 5IYDJ 2FOWA 1IN5A 2MABA 2VBZA 2EK5A 1CQTA 2G9WA 1USSA 2L2OA 4IF4A 5DUKA 1EH6A 2BOLA 4PFOA 1Y8QB 5LEJA 1TWFC 3IWFA 1RU0A 4JK1X 4MQ9F 1XGOA 3TTGA 1YJWI 3GTLK 3QYFA 1ZG5A 2PBIA 4PJJA 2RGRA 3J7YJ 1W5CC 1K83J 3JRIA 1W36C 3GTKJ 3GTGK 2H94A 3CZ6A 4IHSA 1R23A 3AAFA 3GTOA 5CVJA 1ZR4A 1KYZA 3H35A 4ZTFA 4N9HA 3IUOA 2JA5K 4XRSG 3N4MA 3S3NA 3D5RC 1MW7A 1D3YA 1VQMI 1VFCA 5LHIA 1U9OA 5JLWA 4A3EC 1NTCA 1S6LA 3E7LA 3M8EA 2FF4A 1LNWA 3M8JA 2AXLA 2A5YB 2MLKA 3TEDA 3BTCA 1AKHA 1VLOA 2ZUFA 3RI4A 4AVPA 3ZCOA 3ZN1A 1D1AA 2R7UA 5JVTA 1ODDA 3GTJJ 4EEFG 1IN4A 3M3YK 2HKXA 1BGWA 4KM8A 3LSMA 4ON0A 4BBSK 4XMYA 2K02A 4UVBA 4RM3A 4I7HA 5CVUA 1ZAOA 1D8JA 2AS5F 2PX9A 2XAUA 3MKYB 2Y2ZA 2XKPA 3MAJA 4CO8A 1VQLI 1TQPA 1J59A 3MKWB 2M87A 3HKZA 4NC8A 4OIQA 4XLPF 2P81A 3PNYA 1BI3A 3MVPA 2M7AA 4P55A 2R7RA 1BL0A 4OOIA 2XASA 1XGMA 3M7GA 2EFPA 5DM7F 4CUGA 5J1UA 1WH5A 4KITB 1FBSA 4EM1A 5HS8A 4ZJZA 3GTGJ 3GTKK 1DP3A 2QGUA 3TKYA 2FQ4A 5IP7J 1Y8RB 3LQQA 1QA6A 1L0WA 3DEWA 3QYEA 1S7OA 1I1GA 3R6SA 1TWCK 4FT8A 2GBYA 2NOJB 3U21A 4IZZA 1AHDP 1ZYRF 1DDNA 2P4WA 4YG2A 1USOA 4RMFA 2Z9OA 1TWHA 2QUFA 2JSPA 1HQMA 4M71A 1QHHD 3H5RA 3IAS2 1BI0A 4XIDA 1K6YA 2A68F 2MW8A 3MCZA 4BH9A 1X19A 3PQJA 3S93A 3QOPA 5DM6F 1DGRM 5CQEA 3BG5A 2IS1A 2ZFWA 1BC8C 4OIQF 4RAFA 4C3IC 5HLHA 5C4XC 4LK0F 2LY2A 3BR5A 3FKJA 3TGNA 2EZLA 3GLXA 4E7LA 2WAQA 3BWGA 1BA5A 4RB0A 2XB5A 2XV4S 2LDUA 2V26A 3WGIA 1ERDA 2L01A 4BBRJ 1TLHB 4XLNF 3FM3A 1V5EA 1TWHC 3FMRA 3HBLA 4IOCF 4HAMA 2JMWA 2Z1DA 1O26A 3HRMA 4L5IA 2NVUB 1VQ8I 2ZFUA 2QQ8A 1LEAA 2Y48A 4EJVA 5D5VB 2CV1A 4HX8A 1WCMC 1JJ8C 4YG2F 3TO7A 3QQAA 1RRJA 1IW7A 3FKIJ 3JREA 5CVVA 3LSHA 3H92A 3HTUA 1MBJA 3CC4I 3S2HJ 4LLNA 4Y15A 2CUEA 2QEXI 3PFYA 2HOAA 4R8HA 4KDPA 1USTA 2W24A 5BQTA 3FXOA 4DJAA 3CMAI 3A01B 2K3FA 1SC7A 3GTJC 2IS6A 4G8XA 3S2HC 3MZ8A 4DDQA 4EQQA 4OAYA 4QIWL 1DCHA 1NHAA 4KUMA 2NXNB 5K7FA 5F0FA 3PO2J 2COMA 3ZQFA 1MKMA 3CCLI 1ITYA 3F8CA 2NS0A 2KRHA 4PCQA 3TW6A 2KMUA 3OYBA 1YFHA 1WGXA 1FY7A 1VNDA 1ZK8A 2YU3A 1FP2A 3TW7A 3WU2C 2OQRA 1U6GA 4UB8C 4P9FA 4B47A 4B48A 1SFOJ 1Z1DA 3EDPA 2QKLB 4FM9A 1TWGJ 3GDZA 4BXXJ 2BZTA 3PO3C 4XNFA 3DXJA 3DU5A 4XLFA 1O28A 2YU9A 5LGUA 2F2EA 5FLXZ 1K83A 4FQGA 3JSOA 2K40A 2M5WA 4ZH4F 2BHZA 3TOAA 3VSLA 5C44K 5BNGA 1BJTA 1SFUA 1E17A 3ERMA 4C2UA 2XCQA 2EBBA 3L9FA 2DPDA 3KFWX 3GW2A 1JJ6C 4G0UA 2FBKA 1Q1HA 2TRTA 2YR2A 1F5TA 1DQUA 2ZMEA 3SZTA 4C3IJ 5F27A 4DIQA 2ISZA 4KARA 2QWWA 1JUSA 2HZDA 3DEUA 2EJRA 3V7RA 4ETSA 1LUJB 3VOEA 3GFJA 1K4SA 1Y6IA 2WB1L 5E1WA 2ELJA 4NNJA 3GTMA 5EZHA 3ZMDA 3VDXA 2M4KA 3CMYA 3RPUD 4L9JA 3EETA 4ABZA 1KU2A 4A5MA 1MMSA 4YFNF 3I54A 5HDGA 2NVQJ 4BHCA 2GAGC 2E1CA 3HDDA 1EA3A 1R4MB 3LSJA 2NVQC 2W84A 4PJ0C 3H3UA 4JX6A 4LK1A 1D5VA 5H2FC 2IVMA 5TRDA 5E3MA 3O6BB 3S3OA 4HDUA 1O27A 2XGXA 2MGQA 1G3TA 3TL4X 4G7ZF 1K79A 3CQZJ 5CPRB 4AIDA 4FETA 1FYKA 2DDAA 2F6CA 1EK8A 2M8GX 2CQKA 2D5VA 3ZQQA 2WBMA 1XS9A 3H3VL 5FD6A 4KB2A 3RZOC 4LG0A 1MDMA 4PDKA 2GAHC 5FJ8J 3CJQB 4NC7A 3QPLA 5L3FA 2VC0A 3DBLB 4BJ5C 4AIHA 5ICEA 5E8IA 4UV8A 2E35A 1QVTA 2A69A 2E71A 2I8DA 1WSVA 4YELA 4BBSJ 1TWAA 4G12A 2QA4I 1RR8C 2R92J 3L4KA 4A93K 3EPZA 5IPAA 4RAYA 3WODA 1QU3A 2LNBA 1G3SA 5C4XK 1FMWA 3GBGA 2NVYA 4UNOA 2F5EA 3UR3C 1V4RA 5EF6A 1SANA 5C4XJ 3FWEA 4XM3A 3CC2I 3BPVA 3ZQGA 2P6TA 1TWGK 2VE8A 1I50K 3GIRA 3I55I 4XSXA 2RV8A 1XGNA 3EYIA 2JT1A 2R7DA 2WAQL 2FD5A 3BT9A 1ZQ3P 2JN6A 4RBOA 5JHFA 5KCMA 5K5QA 2HQ5A 1S72I 2DU9A 2GWRA 3H0GC 5JR3A 1EH7A 4RB1A 2DJIA 5D6FA 4OIOA 3OOUA 3S32A 2E2JK 2EZIA 2QYOA 1JOEA 5FLMK 3JW4A 4A3GK 3A8JA 4P9SA 4M9ZA 3M9AA 1JHHA 3KZZA 2B63C 4A69C 2XSJC 3BG6A 2IPQX 3ECOA 4C3JJ 4B8XA 4C2MJ 1DPUA 4GT9A 3S15J 2M8EA 4QPOA 3N97A 4IHVA 2HXIA 1SFEA 5IYBJ 4BUPA 1WORA 3FK7A 1OFCX 4X6AC 1ETYA 2KLOA 2K4JA 1EF4A 3CMEI 3S1RK 4XONA 5J1RA 4RLQA 2E1OA 1BJZA 4BE2A 1K7AA 2KZGA 5J4YA 3GTQA 4AIJA 2P7CB 2M1BA 3L7WA 2HGCA 1YJNI 3TFIA 1G2HA 4YRVA 3LAJA 3HOXC 4P1WA 2L5QA 3GF2A 3FOFA 3BJAA 1DUXC 4IEJA 2LP0A 1PYVA 3AG1H 5LEKA 1XXCA 1VZ0A 1RNLA 3AD7C 3HOZC 4OINF 1Z7UA 2QQAA 1I6HC 2ZNZA 1KU9A 1Y0UA 2CH0A 2O3FA 3EQLF 1RESA 1G8XA 1DU0A 3H3VD 1P92A 2IW5A 1U0JA 5B3SH 1ZH5A 4BE0A 2FQOA 3AQPA 3VPRA 1IN7A 2DA6A 2ZMEC 3D0SA 3CESA 4YFXF 4E7JA 1GV5A 1MMNA 2HDCA 2Y0SD 4PSWA 4ZYAA 1FYLA 2LK2A 3WTVC 2W7NA 4XRSA 3E6MA 3T0YA 1XB4A 2FBIA 3JRAA 3T8RA 4ESBA 5IT9K 5GAHJ 1OCCH 1WH7A 4J00A 1DU6A 3KPHA 2P5MA 2DW4A 2CYYA 1DP7P 3PIPF 1MSFC 5EG0A 5A2QK 3BJOA 5KAFC 2HU9A 2R93C 1OMIA 2JA6J 1YYVA 3GEEA 2R93J 2L9VA 1I39A 1KYWA 1RPWA 3FBIB 1ORKA 5F0HA 2DQRA 5KVRA 5IT3A 3P5JA 3N0BA 3LMMA 4L9TA 2WAQN 2EA4A 2HPMA 1T6SA 1AWCA 2JJ7A 1YO5C 1T33A 3SXYA 1UB9A 1QPIA 5IOTA 3EUKL 4M9XA 3HRSA 1Y1WK 3F8NA 3H36A 3JRBA 1KONA 1J5YA 2HNHA 2GOXB 2LH9A 1HC8A 3CP8A 2DMPA 3SJMA 4UUSA 4F55A 2KRCA 3CUQB 2LFBA 3ZN0A 2GSNA 3MMYB 2P5LC 2R93A 4S05A 3S17C 2QF7A 2W4SA 1IJWC 4ESFA 3HC7A 2KIFA 3S8PA 1QBJA 4YFNA 5HNFA 3HOXJ 2GIZA 5F64A 2DCEA 2XGCA 5J3LA 4A3IJ 4MEYA 2NNNA 2X85A 3V42A 1B72B 3C2HA 3QYBA 2IA0A 4LG3A 2CV0A 5GAEJ 3KZIC 2DOAA 4A12A 3V4GA 3ZQLA 5LRRA 5M3MK 5C4JC 5DUIA 1HA8A 1E3OC 2KQRA 1TT0A 2P8TA 4UUVA 2L9NA 3GTOJ 1XZPA 1WHUA 4BS9A 3ZQHA 2DI3A 5IYCJ 1OCPA 1HXDA 1WJBA 3H5NA 3DTIA 5LHHA 4M74A 4F7ZA 3VEPA 2MFZA 2VC1A 2ZSIB 4MHGA 1U5TC 4UVCA 4AVZA 4EJOA 1H0MA 3S14J 4HX4A 3BR0A 1SVOA 4KMUX 4NDLA 1SVMA 1FLIA 2QQ9A 1T0FC 4QPQA 4A0YA 4ZDPA 3VYRB 5L3DA 2NS7A 1DD5A 1B59A 1ZLJA 3G1OA 4FASD 2JA2A 3FDYA 3NWSA 3WODF 3WTUC 1IG7A 3PNTA 3BTLA 4NHJA 4KT6A 4A3DC 3M4OK 4UV9A 1YG2A 2ACJA 4C2TA 2OAZA 2E7WA 3CLQA 2QSGX 4W97A 1VH2A 1VGXA 3MEXA 2LOOA 3QP6A 4BQNA 1C0WA 3GTLA 5EEHA 4F91B 1XD7A 1DPRA 3SZGA 2D6FC 1SAUA 1D5YA 2PQ8A 2BE5F 2M0MA 3JRDA 5HDNA 1ULYA 5E18F 3FKIK 1QRYA 2BY1A 2Y9YA 4A3JJ 3GTKC 3Q9VA 1IGNA 2NNYA 1KA8A 1G3WA 2FMLA 2HVQA 4JOMA 4QLCU 2FE3A 5JFRA 2R5ZA 1MMDA 4DYCA 4ZDOA 2CUZA 5GTHC 3Q0UA 4M9SA 1WOOA 4A93J 1M1EB 4J3NA 2H6BA 1JTYA 5FGMA 2DA5A 2EFQA 4XLNA 3ECHA 2LRDA 1T39A 5AIQA 1POGA 2ZXHA 1K6OA 4MLOA 3QPHA 2G0EA 2V6TA 3CQZC 5TJ3A 2YSRA 3ROUA 2KDOA 4BBRK 3R60A 4JX5A 2NVXC 3MKLA 4D7NA 3BROA 1E3PA 1YW8A 3DWLE 3Q0WA 3DBRB 2IEKA 4E4HA 1LQ1A 3G73A 5M5WJ 2RKHA 3U2RA 5IYBC 3LSTA 2FJ1A 4M3DA 1OISA 3D5LA 4KNYA 5C3EJ 3OSFA 4ITVA 2EQRA 1WJAA 2EZHA 3RZOK 1WKMA 1KU7A 3A01A 3PUFA 5FKOA 2A6EF 1ZKGA 3SFZA 3E0JB 2X48A 3HOUJ 2DA3A 4UUSB 2LD5A 1P4AA 2K86A 3RIRA 2HR3A 5FLXK 4HQEA 2R7ZC 1MZBA 1W4MA 3QPTA 1RI7A 1RKTA 2VXZA 4G7HF 5ICCA 5IORA 4G0VA 2DLLA 1MDMB 4OMZA 1JTXA 2O9LA 4GFBA 2Z3YA 3R0AA 2PJRB 4BY7C 1TW3A 3H9QA 2ZMEB 5E1ZB 2ETHA 2LG4A 1B1BA 3HOWK 3FKIA 1BR1A 3V8KA 3SYTA 3S15K 5D8KB 3OYGA 5DEQA 2Y0SN 3OMYA 1W5SA 2F48A 3OYFA 2R7VA 2VLAA 2MYSA 1MD0A 1K83C 3P7NA 4A93C 2MD0A 4BLAA 1HLVA 4LGWA 2VODA 4RS8A 4IHTA 5DD8A 1XTAA 4KATA 4HF1A 1WSUA 3UKGA 3LA7A 1Z0XA 1JT6A 3C18A 5ERIA 4BEHB 4C3HK 2WY7Q 2X1EA 2WTEA 4F92B 2CS3A 3HOUK 1P4XA 1UG2A 3ABUA 3BC8A 4K2EA 4A3FJ 1ZLKA 1VQNI 3ZQ7A 3LFUA 1JUMA 2DK5A 2ZNYA 4HF0A 2Z16A 3L1PA 1HF0A 2VQCA 3GTPA 4E6KG 2V6UA 3OYHA 4IX7A 5IP7K 2PLYA 5BS6A 3FF5A 4OAZA 3ZGKA 4AWXB 2GA1A 4PZJA 2EA2A 2V6CA 2DT5A 4E7IA 3VSKA 2MD5A 3E5UA 2RNGA 2VPRA 3OYMA 3Q5FA 1HBXG 3CJTB 2DJNA 2DT7B 3NQOA 1XZPB 4A3KC 4LOCA 5IP7C 1EFWA 2JVHA 3CO7C 2DA1A 2WY8Q 3CJRB 2FX0A 3G4CA 2LBFB 4B4CA 4RGXA 1UELB 2VL8A 2OD5A 2JQ7A 4A0XA 1B9MA 2LBFA 3GFMA 3ZOBA 2XC7A 5LFAA 2JH3A 3L00A 3LFKA 4A3LJ 3K1MA 4BAYA 2KHMA 2ZJ2A 4Y52C 3GEHA 1VI0A 2CW0A 2DK8A 2VE9A 1TQMA 2CW7A 4U0VA 2MSYA 4Q5SA 3U9GA 5J40A 3GO5A 1TZLA 1K4TA 5E79C 1Y1VC 2Y3PA 3H3VK 2NVTJ 4A3MJ 1UFMA 2CFAB 4XBFA 2VKVA 3MZHA 3MWMA 3RKQA 1YLFA 3OOPA 2DFIA 2RQQA 4ANJA 3G2BA 4XQFA 3I53A 1ETXA 2O0YA 3FMQA 3HSRA 1X1AA 3NWTA 5DCMA 2JA5J 5L3EA 3LL7A 1Y1VK 1IO2A 1HKTA 1O3TA 1QGPA 4AD9A 1FEXA 2OJED 2YS9A 1VJEA 2DODA 3RDIA 3K4JA 4YIFA 2DPUA 4ZH4A 4A3KK 3L2QA 1IE0A 2KL4A 4HV6A 3JAMK 3CCRI 3HUGA 3NUHA 3JAMZ 5BMZA 1W1WE 1E3HA 3BCAA 4G6TB 3S14K 3QAHA 2L9SA 1IXCA 2OV7A 4IRGA 3ZXSA 3DEEA 2VT3A 1Z67A 4CCJA 5DDGA
chains in the Genus database with same CATH topology
3G4AA 3OREA 4G0WA 1R1TA 3HSFA 2FBHA 4E70A 5IOSA 2JA5A 2K4BA 1XDSA 2XRNA 2PHCB 3VB2A 1P2FA 2B0LA 3DPTA 4EJUA 4UVAA 2DAOA 4Y17A 4KMAA 4XSXF 1L0OC 3K9TA 2P7VB 2BGCA 1B9NA 4RB3C 2BEOA 4G94A 5FB2A 2EV6A 2G7HA 3GVAA 1WWXA 2XHKA 1XMAA 3E6CC 4HZFA 3MQ0A 3I58A 2YPRA 1R58A 1ONVA 3F6VA 4QWQA 3CUQA 5L3CA 3P9CA 2E7XA 2HZTA 2IT0A 1IUYA 4HQMA 5ED4A 2RN7A 1TQIA 1YIOA 3ERED 3ISPA 4KMFA 3HHHA 1TWGA 5CVRA 3GTJA 5J8CA 2Z5UA 2DBBA 4BYYA 1EV7A 3S0XA 4EGYA 2CG4A 2KJBA 2UWMA 1TWCA 5TJJA 2HFHA 3KLNA 5HDKA 4WXCA 3SQNA 5LGNA 4FHTA 1WQFA 1BBYA 3F8BA 5DCFA 3B73A 2XCOA 1OPCA 1QPMA 2HEOA 3GFLA 4HLYA 2NRAC 1YQAA 4GCVA 3IWZA 2P5VA 3WE2A 3HIFA 1RIOH 1FX7A 3BOQA 2XAQA 4G6DA 2ZKZA 2H27A 4MEYF 2KWAA 1OR7A 4M6YA 5A2QZ 5CJ9A 3FXQA 3WTSC 2ZCWA 3BUEA 4OMYA 1ZG3A 2QQBA 2VONA 3QU6A 2FSWA 1ZG1A 2CW0F 5ILUA 4N9IA 2IP2A 1LDJA 1P4WA 4HLXA 1XXAA 4CXFA 1O7LA 2MLGA 2R7FA 1W7PA 2D45A 1FBQA 4HW0A 1F9NA 1WIHA 3OV8A 2NYXA 1KGSA 3U1DA 2EFWA 1IRFA 1E2XA 2JPCA 5BOXA 5E17F 4KN7X 1MJ9A 3KP7A 4FX4A 2RDPA 1OYWA 1ZRCA 3IL2A 4EJTA 5LBQA 3GX4X 3ZMTA 1O25A 2Q8KA 2L4MA 3KP3A 2R7ZA 2E2HA 5K5OA 2ISYA 5J8FA 2GSUA 3V7SA 3WE3A 1ZREA 2VBYA 3GWZA 2K7LA 4BHBA 3GZ6A 3BZ6A 1PP7U 1IN6A 2JZYA 2CO5A 3BJ6A 2WV0A 3MZYA 1FSHA 3RJPA 4UXNA 4MNUA 2EB7A 3K69A 3C7JA 4C2MC 3L09A 5D5UB 3NEUA 1ZN2A 2ESHA 1L3LA 1S29A 2W25A 4MQVA 1S7AA 5HOOA 1FOKA 2D1VA 3HOTA 4O5VA 4GTFA 2Z33A 4LJZF 4YFKF 4IPAA 1OKRA 3K2ZA 5D6EA 2DO7A 3GTGA 4KB4A 4WXDA 2ADUA 1HSJA 3J80Z 3J80K 4U0YA 1S8NA 4R79A 1Z6RA 1BIAA 2VOPA 1J9IA 3MFKA 2V1XA 2FEZA 2QBYA 4U7BA 3ABTA 4MTEA 5DV5A 2Q2EA 1FP1D 3ULQB 3I71A 1KQ4A 4LG0B 1IN8A 4NQWA 5EGHA 3ELKA 3J81Z 4ZYGA 2EV5A 4KYWA 1LB2A 2J5OA 5JI6A 4ENKA 1ON1A 1EH8A 4GTLA 5CYVA 3FX3A 2BV6A 5DCMB 2VBXA 1IXRC 1MJAA 1U78A 4LMYA 4LB5A 3DQVC 4KA4A 4RGSA 3F3XA 2RVCA 3VA7A 1XDUA 5E20A 3DV8A 1MGTA 2MC3A 2ZO4A 4EM0B 3HRUA 2O8XA 2L3DA 1EH1A 3ZMUA 1QNTA 3CJNA 4ZZLA 1I5ZA 2W85A 1SD4A 2O61A 3WTYC 2JSCA 3ZMVA 4A5NA 1O24A 3I5UA 3DFGA 2L4AA 3CO6C 5KK1A 4N0BA 1AOYA 3CLOA 2LF8A 1TNTA 3Q3QA 3KEQA 1GXPA 3M8FA 2H09A 1LJ9A 1I27A 3I59B 4EMSA 4P5AA 1O29A 1I6XA 1B4BA 2UXNA 1PUEE 1AB4A 4MEXF 5ICGA 4CYDA 2PMHA 4UHTA 4P96A 1QZYA 4ZYDA 1FYMA 2EWNA 4GXOA 1W5TA 2RNJA 1XMKA 3GYHX 4Q5SF 2LSOA 1HW2A 3RTRA 4P9UA 3RKXA 4PGGA 4KMHA 1XCVA 3IC7A 3BP8A 2FXAA 4RGUA 3WG9A 3JSPA 1IW7F 3VFZA 4WX9A 3TO6A 1XN7A 2RH6A 1BI1A 2X4HA 5FFZA 5IT9Z 3P9IA 2PFBA 4EV0A 1TTYA 1YS7A 3I59A 2ZBKA 2P6SA 4LLLA 1ZRDA 3RYRA 4C3HC 3HYIA 5LHGA 4I02A 2XUBA 1I1SA 2JTVA 2VN2A 1SMYF 3C3WA 4KN4X 1HKQA 1T0FA 4CICA 1F1ZA 3B02A 4ZZDA 4KT5C 1R5GA 2QENA 4ILDA 3F8MA 1RUOA 1G6NA 3R4KA 4G6QA 3AQOA 3E3VA 2FMYA 3W6JB 2EFOA 2HS5A 2IA2A 2PJPA 2QLZA 5L3BA 3Q9SA 2C6YA 1TNSA 4ENMA 2E2IA 1VTNC 4DNCA 2L54A 3LAPA 4RB2C 1HQCA 4I98B 2DQLA 5K5RA 4L0YB 1R00A 2CFXA 3NRVA 3FHZA 2UZKA 3CTAA 4OIOF 1S3JA 1ZVUA 1CGPA 4NB5A 5E1XA 2JPBA 4ENNA 1YW9A 4A2UA 2DTRA 3ZP5A 4AIKA 4Q48A 4P5OA 2O03A 1JXSA 3RYPA 3WTTC 2FNAA 2HKOA 3P9KA 3GXOA 4I0BA 3K1PA 1SAXA 2GIVA 4R1HA 2XAJA 1LDKB 1Z9CA 1X3UA 1R36A 5DYMA 3EYYA 4CDGA 2CSOA 5K1YA 3RPUA 4EVIA 2FQ3A 1GHCA 5EGEA 2A69F 1BC7C 2E1NA 2KRFA 2QBYB 1BJAA 5D4SA 6PAXA 1B6AA 1ZRFA 3GUDA 4HDVA 4BHPA 1BN5A 1FBUA 1SMTA 2XROA 4WF2A 3KP5A 3HSEA 4M73A 2A61A 2KJCA 2KIUA 1T38A 4KMDA 3O3KA 1WRJA 3LWFA 2NVXA 2IA1A 5FO5A 1R22A 1I3QA 1KU3A 2J5PA 1KQ8A 4EGZA 5HVQC 4IXAA 4P5BA 2VUMA 3HHGA 2NAZA 1O57A 4G7OF 1CF7B 3OEPA 1WQGA 4FZBA 5L3GA 4KIBA 3CUQC 4KAWX 1G4DA 2FA5A 1J0RA 1O3QA 1IZ1A 2V1UA 3E6DA 3WU0A 3V7CA 4XSZF 3BY6A 4LQYA 3WTZA 4L9NA 1K78A 1UHMA 3ZPLA 1WQHA 4G9YA 2Y75A 3HTSB 3KZYA 1QQIA 1P6RA 2PMUA 2A3SA 4I01A 3IRQA 1ISEA 1U5TB 1TBXA 2CFAA 1KQ0A 2GZWA 5D4RA 1UHWA 3I64A 3E97A 5HLIA 3KETA 2HWVA 3IKTA 4I09A 3FXRA 1ZHFA 3LPXA 3IHUA 2KKOA 1Z6TA 1PDNC 5IOQA 2PN6A 4L18B 4HF2A 1J2XA 4HA8A 1IRGA 2P5KA 3OPFA 1HW1A 1RUNA 4ESJA 3KLOA 3F72A 4HBLA 2HQRA 2STTA 1TW2A 5H6QA 2OZ6A 1ZXOA 3IKVA 1MJBA 1BI2A 4GTBA 3KP2A 1J7KA 4GGGA 4WWCA 3KEOA 5AIPA 1BM9A 2XAFA 3KP6A 3WTWC 2HYFA 5J6XA 2IRFG 1R5HA 1YS6A 4OU0A 4BXUA 3DPLC 2HQNA 2R3SA 3LA3A 4GFQA 2D1HA 1XSXA 3HOSA 2HTSA 4Q4ZF 4KDDA 3RKWA 1RZ4A 4ENJA 4O3MA 2XCRB 3RPQA 4I0AA 2F5DA 2RGVA 3GEZA 4IJAA 1V3FA 3DXJF 3HRTA 2LF7A 4I2OA 5BPDA 3DKWA 3H0GA 5AONA 4Z2YA 3M1EA 4L9VA 4L0ZB 3FM5A 2WC2A 3I0TA 1TWFA 2KIMA 3R0JA 1OYYA 2WWYA 2OU2A 4U88A 3TDZC 2XAHA 2GA2A 1IS1A 3DP7A 2M45A 2M30A 4A0ZA 5HLGA 2FRHA 3F6OA 3EUHA 5D5XB 2YX4A 4KC6A 2VT2A 2GAUA 4GO1A 1G3YA 1UCRA 4KFCA 4LR2A 2XAGA 3TO9A 3V8LA 2YX7A 3T5XA 1H9TA 3H3ZA 4MGRA 1GXQA 1F4KA 3V8JA 1A04A 1SFXA 3JTHA 4BLBA 1JE8A 1GVJA 4KIGA 3F8FA 1HW5A 2V79A 3LQRA 4BNCA 2R92A 4H0EA 1T98A 1IAWA 1IXSB 1XSDA 5ICFA 4Q47A 2UXXA 2CWEA 3QRFF 3W6KB 2BYVE 1BIBA 4O6JA 1FWZA 1FT9A 4GYIA 5CHPA 4B09A 1LVAA 3CAGA 1Z05A 5H20A 3DF8A 2H6CA 4M6XA 1R1UA 3GZ5A 1STZA 1ZGJA 4A6DA 1CF7A 3K0LA 4S04A 2RQPA 5F6FA 2TDXA 3F21A 4GTAA 2FNPA 4D0PA 1QZZA 1Y1VA 2EV0A 3S2WA 3IRRA 3C1DA 4EJWA 1B4AA 1ZARA 1Y1WA 1LEBA 3WU1B 2MBFA 2IJLA 5CLSA 4GTCA 2XIGA 3CUOA 3FZVA 4KIFA 4OIRF 4OIPF 3KE2A 2D2WA 2LKPA 1W7PB 2RC4A 2PI0A 3WTXC 3J7AO 5LRSA 1O7FA 4LD5A 2MH2A 1ON2A 2BBYA 4HV5A 4RGRA 1U2WA 4XRFA 4LB6B 2GXGA 3CDHA 1WCMA 1U5TA 2Q0OA 4U0WA 3REOA 5FD5A 5JVOA 4IRIA 4KM9A 5D8LB 2GXBA 1XCBA 4KASA 1O3RA 4Y13A 1H9GA 1KQ9A 3FMSA 3ZMSA 1WQ2A 1HSTA 4LFUA 4LK1F 4CGZA 2HYGD 2L02A 1SFOA 4LLGF 1IF1A 2EFNA 3E5XA 3TQNA 1R9TA 5HS7A 2OZUA 4WXHA 3JTGA 2XKOA 1PP8F 2ZXJA 3G3ZA 3TDUC 1ZBSA 4M1XA 3O2PE 3T8TA 2XVCA 4ASNA 3ML6A 1REPC 5LLQA 1O2AA 4KICA 3E5QA 4RAZA 5ILVA 5H6RA 1J75A 4GYGA 4BKWA 4U7DA 2VOOA 3F23A 3R61A 5JFEA 2V9VA 4FX0A 3FOEA 1I50A 4A6EA 3WGGA 4GTDA 1SD5A 1ZGAA 2HOEA 3BPXA 4JBAA 2ESNA 2A6HF 2V1DA 2O6GE 2FU4A 5FFXA 2STWA 2JA6A 3SHFA 3L4JA 4CHUA 1XSVA 1HKSA 1BOAA 1FNNA 2OA4A 1SD6A 1FC3A 5JHUA 2JRTA 2OQGA 4WK8F 4TV7A 5BPIA 3GTKA 5DD4A 5HS9A 2ELHA 4GTEA 2VBWA 1R1VA 4DQ2A 1U3EM 1YW7A 1FZPB 2FOKA 4ZYHA 4BQAA 2F5FA 4C3JC 2G7UA 3QP5A 1FPQA 3J81K 1GE9A 3QX3A 3LA2A 3KP4A 2Z99A 2PG4A 2GQQA 4IRHA 1Z91A 1YTYA 3T1BA 3PFIA 3N3YA 4M72A 5CVIA 3MMLB 1JGSA 1W7PD 1QO0D 4L5JA 5EEGA 2HTJA 1U8RA 3BDDA 2ZFZA 1OYIA 4YIIA 1K78B 3AH5A 4ZYEA 2F5CA 3K1NA 3F22A 4HYEA 4WCGA 2W57A 2PEXA 1XGSA 3QU3A 3I4PA 1FSEA 3KCCA 2B63A 4CZZA 3ZMZA 2Y0MA 3CQZA 2A07F 1XXBA 2JA7A 5D5WB 3L2CA 3RKYA 4HOBA 3FXUA 5F1RA 5ILSA 1LDDA 1WI9A 2X0LA 4IVNA 3N0CA 1R7JA 2GSOA 1JHFA 4PGHA 3TOBA 2MH9A 3GFIA 3VODA 2OBPA 4EM2A 2QVOA 1T2KA 3PQKA 1O3SA 3WGHA 4JQFA 1SD7A 3E6BA 1D8KA 2QZ8A 3SZPA 2K27A 2CGPA 3COAC 2QM3A 4MTDA 1O2BA 2MA3A 5LGTA 5E8GA 4HX7A 1IN5A 2VBZA 2EK5A 2G9WA 1USSA 4IF4A 5DUKA 1EH6A 5LEJA 3IWFA 4JK1X 4MQ9F 1XGOA 1ZG5A 2PBIA 2RGRA 2H94A 4IHSA 1R23A 3AAFA 3GTOA 5CVJA 1KYZA 4N9HA 3N4MA 1D3YA 5LHIA 1S6LA 3M8EA 2FF4A 1LNWA 2AXLA 2A5YB 2MLKA 3RI4A 4AVPA 3ZN1A 5JVTA 1ODDA 1IN4A 2HKXA 1BGWA 4KM8A 4ON0A 2K02A 4UVBA 4I7HA 5CVUA 1ZAOA 1D8JA 2AS5F 2XKPA 3MAJA 4CO8A 1TQPA 1J59A 2M87A 4XLPF 1BI3A 4P55A 4OOIA 2XASA 1XGMA 3M7GA 2EFPA 1FBSA 4EM1A 5HS8A 3TKYA 3LQQA 1S7OA 1I1GA 3R6SA 4FT8A 1ZYRF 1DDNA 2P4WA 2Z9OA 1TWHA 2QUFA 4M71A 1BI0A 2A68F 3MCZA 4BH9A 3PQJA 3QOPA 4C3IC 2ZFWA 1BC8C 4OIQF 5HLHA 4LK0F 3TGNA 3GLXA 3BWGA 4RB0A 2XV4S 2LDUA 3WGIA 2L01A 1TLHB 4XLNF 3FM3A 3FMRA 4HAMA 1O26A 3HRMA 4L5IA 1LEAA 2Y48A 4EJVA 5D5VB 4HX8A 4YG2F 3TO7A 5CVVA 3H92A 3HTUA 4LLNA 4Y15A 4R8HA 4KDPA 1USTA 2W24A 5BQTA 4G8XA 4DDQA 4EQQA 1NHAA 4KUMA 2COMA 1MKMA 3F8CA 2NS0A 4PCQA 1YFHA 1FY7A 2YU3A 1FP2A 2OQRA 1U6GA 4P9FA 1Z1DA 3EDPA 4FM9A 1O28A 2YU9A 5LGUA 2F2EA 5FLXZ 1K83A 3JSOA 2M5WA 4ZH4F 3TOAA 1BJTA 1SFUA 1E17A 2XCQA 3L9FA 2DPDA 3KFWX 3GW2A 4G0UA 1Q1HA 2FBKA 2YR2A 1F5TA 2ZMEA 3SZTA 4KARA 2ISZA 2QWWA 3DEUA 2EJRA 3V7RA 4ETSA 3VOEA 3GFJA 5E1WA 3GTMA 3ZMDA 4L9JA 3EETA 1KU2A 4A5MA 4YFNF 3I54A 5HDGA 4BHCA 2E1CA 2W84A 3H3UA 1D5VA 2IVMA 5TRDA 3O6BB 4HDUA 1O27A 2XGXA 1K79A 1G3TA 4G7ZF 1FYKA 1EK8A 2CQKA 5FD6A 4KB2A 4LG0A 1MDMA 4PDKA 5L3FA 2VC0A 4AIHA 5ICEA 5E8IA 4UV8A 1TWAA 3L4KA 4RAYA 2LNBA 1G3SA 2NVYA 4UNOA 2F5EA 1V4RA 3FWEA 3BPVA 2P6TA 2VE8A 2RV8A 1XGNA 3EYIA 2JT1A 2R7DA 5K5QA 2DU9A 2GWRA 5JR3A 1EH7A 4RB1A 5D6FA 2QYOA 3JW4A 4M9ZA 3M9AA 1JHHA 3KZZA 2IPQX 3ECOA 4B8XA 1DPUA 4GT9A 2M8EA 3N97A 1SFEA 2K4JA 1K7AA 3GTQA 4AIJA 2P7CB 2M1BA 3L7WA 2HGCA 3LAJA 3GF2A 3FOFA 3BJAA 1DUXC 5LEKA 1XXCA 1RNLA 4OINF 1Z7UA 2QQAA 1KU9A 1Y0UA 2O3FA 2ZNZA 3EQLF 1P92A 2IW5A 3AQPA 1ZH5A 1IN7A 3D0SA 4YFXF