3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
3SFZA 2F2EA 4LLGF 3OV8A 1T38A 4RB0A 2VONA 2QQBA 5CJ9A 1WIHA 4BAYA 4ENKA 4KB2A 1FZPB 4HLYA 4AVPA 2LNBA 4CICA 1H0MA 1QGPA 1RI7A 5H20A 2M87A 2V9VA 4ENNA 1XGMA 2FBKA 3LWFA 2DO7A 2L3DA 4RB3C 2PI0A 1IUYA 4ZYGA 1WQ2A 3L09A 3P9CA 2KJCA 3MZYA 4IRGA 3H3ZA 1WKMA 1BI3A 4G7HF 2K86A 4HV6A 4U7BA 2A3SA 4KNYA 4PDKA 3KP7A 2IT0A 4KYWA 3DF8A 2MH9A 3IC7A 4HV5A 4KC6A 4UV9A 4BQAA 2ZFWA 4G94A 2W85A 2YU3A 3NEUA 3KZYA 4ESJA 4BHBA 1O3TA 2ZNZA 4ENMA 4WWCA 1Z7UA 3F22A 4RGUA 1VTNC 1OYIA 1LVAA 1J0RA 3R4KA 4CXFA 3BWGA 2Z9OA 3HSRA 1IN6A 1LB2A 1LQ1A 3F8CA 1UB9A 4EM1A 1KU3A 3F3XA 4ENJA 4HYEA 1R36A 3F21A 3MCZA 4ESBA 4KUMA 1B4AA 1J2XA 3FOEA 3RTRA 1TW2A 4IRIA 3HRUA 4P55A 1G3WA 3GXOA 4M9SA 5BPIA 1SFEA 5FGMA 1QO0D 1FYMA 2XRNA 4R8HA 4HQEA 2Q8KA 5F1RA 1P2FA 3MAJA 1LJ9A 4XLNF 1QNTA 5K5QA 4HBLA 3GO5A 1T0FA 2P5MA 3E97A 3MEXA 4HW0A 4G7OF 2ETHA 1RUNA 1KYZA 5D4SA 2EFQA 1XCBA 1ZHFA 2IP2A 3EYIA 2L01A 1ISEA 1A04A 2XHKA 3GF2A 2H6BA 3DPLC 1J59A 1K78A 4M73A 4YIIA 4XBFA 3TQNA 1W7PD 3K69A 4WXCA 2FSWA 3I53A 4CZZA 4LG0A 1DDNA 5L3BA 1I27A 3U9GA 2VOOA 1RZ4A 1K78B 3FM5A 2KJBA 2XASA 2GXBA 5KVRA 5FFZA 1GVJA 4AIKA 2XIGA 1O57A 3ZMDA 1KU7A 2QENA 2DFIA 3GUDA 3V8KA 4I02A 3TOBA 3EYYA 1EH1A 4G7ZF 1XD7A 2P5VA 5HDGA 1WWXA 3EDPA 2VE8A 3TDUC 2L54A 1G3TA 1I5ZA 2VC0A 3HYIA 5KK1A 2QUFA 3M1EA 4LLLA 1E2XA 3G73A 1YYVA 5BQTA 3W6KB 3ZMVA 3P7NA 1AB4A 5HS9A 2VE9A 3NRVA 5CVJA 3HHHA 1P6RA 5DCMB 2Y0MA 2DQLA 2EFPA 2OZ6A 3QRFF 4RB2C 1SD7A 1YLFA 2IA2A 2D1VA 4RAYA 2QQAA 1TW3A 2EB7A 5E8GA 2BBYA 2COMA 4KT5C 2IPQX 3NQOA 4G0UA 3B02A 3MWMA 3FOFA 4Q5SF 2R7DA 2XKOA 3CAGA 5D6FA 2XAHA 5HOOA 3BZ6A 1X3UA 3R0JA 3DXJF 3CJNA 3HRMA 1P4AA 3DV8A 3MQ0A 4EM2A 2FXAA 1V4RA 1XGNA 3IRQA 1RNLA 2HEOA 3U2RA 1KQ0A 1UCRA 4U88A 2YX7A 3C1DA 3QAHA 1KU9A 1FBUA 1D8KA 1XSDA 1L0OC 1Z9CA 1OKRA 1R5GA 4LMYA 2A6HF 4UVCA 2FRHA 3LQRA 2GZWA 1MJ9A 3HUGA 4HOBA 2CGPA 4A12A 4HQMA 4JBAA 1XGSA 2M45A 4D0PA 2F5EA 3I5UA 3V7CA 3WGIA 2P5KA 5LRSA 3MFKA 1G6NA 3GFMA 3KEOA 3Q5FA 1ZG1A 4L9VA 3F8MA 5H6QA 4OIOF 2STTA 3F8FA 3GX4X 3KCCA 5L3CA 1XMAA 1R5HA 2HR3A 2JPCA 4ZYEA 4EQQA 3WE3A 5D4RA 3VFZA 3IRRA 4UHTA 5HLIA 3TO9A 2L4MA 5ED4A 5CVRA 4YFXF 2LF7A 4ZZDA 5FFXA 1YTYA 2NS0A 3CLOA 2XAGA 3PQJA 1XXAA 4MTDA 5BOXA 2CW0F 4Q4ZF 1S7AA 5E20A 4CGZA 4MEYF 2L02A 2BYVE 4WF2A 1ULYA 4HX7A 1W7PA 4I98B 3KP6A 2DLLA 2WWYA 3GLXA 1SMTA 5LGTA 1ZARA 4MQVA 1LDDA 4DQ2A 1W7PB 1BI1A 3WTYC 2XCQA 3TOAA 1ZRFA 4BYYA 1IF1A 3ABTA 2QLZA 1ONVA 1XDUA 4G8XA 3ZMUA 4RGRA 3LA7A 4G0WA 4FX4A 1G4DA 1J75A 2F5DA 2A5YB 3ZMTA 2F5CA 2W24A 4Q48A 2GIVA 1QPMA 4ZH4F 1CF7A 3LA2A 4UV8A 3GW2A 3BROA 2KWAA 4OIPF 2B0LA 3LQQA 2IVMA 3I4PA 3OPFA 2OA4A 1S3JA 2FNPA 5FLXZ 1BN5A 5HLGA 3V4GA 5JI6A 1GXQA 1PUEE 2ZCWA 1SD4A 2HOEA 3O2PE 3FMQA 2DI3A 3O6BB 3GFIA 1IRFA 3FM3A 2VC1A 3WG9A 3V8LA 2PEXA 1ON2A 4UXNA 2GQQA 2QQ9A 1U6GA 2BGCA 3ZQ7A 5HS8A 2ZFZA 2O3FA 1TQMA 5D8LB 5JVTA 1HSJA 4HX4A 2PFBA 1B1BA 1FPQA 1DD5A 1AWCA 2AXLA 3FXRA 1Z05A 4Q47A 3C3WA 5A2QK 3F8NA 1MKMA 1J9IA 4OMZA 2P6TA 1K79A 3VOEA 4GYIA 2RQPA 2C6YA 5LHIA 4O6JA 3CUQB 1BJTA 3PFIA 2QZ8A 4KIGA 2V79A 3VEPA 2NYXA 3L9FA 1R7JA 2X4HA 5ICEA 1G3SA 1O7FA 1HKQA 2VXZA 4EGYA 3HRSA 3ZMSA 2OD5A 2GAUA 1ZRCA 2KKOA 3CDHA 1RIOH 3HTUA 1R23A 2VT2A 3J80Z 4LLNA 3ZMZA 1EK8A 4A2UA 3SHFA 2P7CB 1TBXA 4ZYDA 1R22A 3FXQA 2YX4A 2EJRA 3GZ6A 1BM9A 2HWVA 4FT8A 1Z6TA 3DEUA 2DQRA 2M30A 3CUQC 4N0BA 3J7AO 4RS8A 4KIBA 3DKWA 3KP5A 2HQRA 1BBYA 1LDKB 2XCRB 4UNOA 1F1ZA 1EV7A 2KIFA 2RGRA 1EH6A 2HTJA 4OU0A 2RKHA 1BIAA 1LEBA 1V3FA 2BE5F 3GFLA 2HTSA 2Y48A 2O6GE 1S29A 2XVCA 4ASNA 3H3UA 2M1BA 4KMFA 2PMHA 4OIQF 2UXNA 3CO7C 1XB4A 4TV7A 2R3SA 5IT9K 1ZG3A 4M6YA 1DPUA 2CYYA 1ON1A 1BJAA 3BPXA 2FBIA 3HSEA 3Q9VA 3ECOA 3FHZA 4RGXA 3JSPA 3ZPLA 1OPCA 1R58A 2XV4S 4M9ZA 3VODA 3K1PA 5DUIA 2OZUA 2CG4A 4IVNA 2IA0A 1HXDA 5LHHA 5K1YA 4M6XA 2M8EA 2FOKA 5DEQA 3J81K 5F64A 3BPVA 1DUXC 1MZBA 3WTWC 1GHCA 5J8FA 4S05A 2ESNA 5F6FA 4G6QA 3CTAA 3N4MA 4I01A 2VBWA 4L0ZB 5HS7A 1BC8C 2CWEA 4QWQA 4LB6B 1D8JA 2V1DA 1FSEA 3I58A 3T8RA 2DAOA 1O7LA 3GZ5A 2E1NA 1BOAA 3K2ZA 3JTGA 2PJPA 3QP5A 3QP6A 1PP7U 1P4XA 1T2KA 3RYPA 2LKPA 4K2EA 1O3QA 4HA8A 2CFXA 4KDDA 2XCOA 1YS7A 2DU9A 3FWEA 1ZGJA 4EJVA 2K4BA 1U2WA 2RC4A 1TLHB 5LGNA 1FNNA 5FD6A 3ZN1A 2EV5A 2HDCA 3K1MA 3OEPA 2GWRA 3AAFA 5D5XB 5E1WA 1Z91A 2YR2A 4XRFA 3HRTA 1IXCA 1BC7C 1K6OA 1ZGAA 3IKTA 4YG2F 1W5SA 4GGGA 4PGHA 2D2WA 1L3LA 3FF5A 3KFWX 1SD6A 5EEHA 1U78A 4GYGA 2DPUA 3GEZA 4KAWX 3R60A 1YS6A 4A0ZA 1W5TA 1YO5C 1R1UA 3ML6A 4KN4X 5DCMA 4XSZF 2LSOA 2EFOA 1HBXG 4J3NA 2FEZA 3JAMK 4CDGA 2YPRA 1ZG5A 1ODDA 1ZH5A 3MMLB 2K7LA 2MLGA 4GFQA 5HDKA 4NB5A 3KETA 1HKTA 3L4KA 4I2OA 3FMRA 1GXPA 3QPTA 3SXYA 1JHFA 4O3MA 1FYLA 3DQVC 2X0LA 1R1VA 3FMSA 2E1CA 1JGSA 1FC3A 3LAPA 4M71A 1FY7A 5FB2A 1Q1HA 2Z3YA 2XAFA 5FD5A 1KQ8A 6PAXA 1XSXA 1XCVA 1XXCA 2XROA 2O8XA 4LJZF 4P9FA 3ZP5A 2ISZA 2VT3A 2K02A 2M5WA 2GA1A 3WTUC 4N9HA 2PHCB 3P9IA 1T98A 3KE2A 4HF0A 2EK5A 4OINF 3IWFA 5AONA 2V1UA 3IKVA 3TO7A 1KA8A 3M8FA 2ZXJA 3FZVA 1HW1A 1J7KA 2GXGA 2ZBKA 1XSVA 3ISPA 1C0WA 2RN7A 5E1XA 1FWZA 1IAWA 1DPRA 2J5OA 1K7AA 4PGGA 1S8NA 4EJOA 1MDMA 2DK5A 5DD4A 3TKYA 4EVIA 4EJTA 5D5VB 1XGOA 3IHUA 4ETSA 2JRTA 2MLKA 3F6VA 4ON0A 4OOIA 2O03A 1MDMB 4CHUA 2NNYA 3V7SA 1XN7A 1YW8A 2EV6A 3WTXC 2HS5A 2XAQA 1ZRDA 2MBFA 4U0YA 5E1ZB 3Q9SA 3HTSB 2ZKZA 3TDZC 1F5TA 1TTYA 4IHSA 4CO8A 4A5MA 5J6XA 1BI2A 1ZYRF 4PZJA 1UHMA 2JPBA 1FLIA 4PCQA 2FF4A 3KLOA 4MEXF 4JK1X 4FX0A 1YW7A 4S04A 3RPUA 4MHGA 5CVIA 3T1BA 5LBQA 3I59B 3JTHA 2KIUA 4EMSA 1O3RA 3DPTA 1TQIA 2F5FA 1FBQA 2QM3A 4HF2A 1YFHA 2PLYA 3QX3A 1Y0UA 2XKPA 2RV8A 1PDNC 2ACJA 2Y75A 4LFUA 5LGUA 4BHCA 4EGZA 2FMYA 4ESFA 1U8RA 4I0BA 4XLPF 2WC2A 2STWA 3RJPA 1DP7P 4KICA 1IN8A 1FX7A 2HQNA 3DFGA 1I6XA 1LNWA 2IRFG 3N97A 1F9NA 2VOPA 5JFRA 1TNSA 4CYDA 4EV0A 4MNUA 2P7VB 1XXBA 4YIFA 3O3KA 4Y15A 3EETA 1Z6RA 1ZN2A 1YG2A 3ERED 5DDGA 3KP3A 2NRAC 4JQFA 3ULQB 3GWZA 1IN5A 5BS6A 5E8IA 3QU3A 4A6EA 2CQKA 2IW5A 3M8EA 4L5JA 5ILUA 1QZYA 3ELKA 3F6OA 1IN7A 3PQKA 4FM9A 3CUQA 4AIJA 1R00A 4XSXF 2ISYA 2H09A 1ZVUA 1FBSA 4GXOA 2AS5F 1ZAOA 4MGRA 4F7ZA 2LDUA 3R0AA 5DYMA 3M9AA 3HHGA 1F4KA 1GE9A 3HOTA 1WRJA 1BIBA 3WE2A 2H27A 1U5TB 2PQ8A 2ZJ2A 4HLXA 3K0LA 3WGHA 1IZ1A 3JW4A 3SZTA 1EH8A 3U1DA 1QBJA 4L18B 2G9WA 3LFKA 1B9NA 1OMIA 2DPDA 3QU6A 3R61A 4YFKF 4ZZLA 3FX3A 2DW4A 1MGTA 4RGSA 1XMKA 4WXDA 2A61A 4P9UA 3KEQA 5FO5A 1D5VA 3WODF 2PMUA 3BJOA 3CO6C 2G7HA 1WQFA 5L3FA 3WTVC 1KGSA 4HDUA 3HSFA 4MQ9F 3BUEA 4LK1F 3RPQA 4AIHA 4RAZA 1KYWA 1Z1DA 1U5TC 3ZN0A 1SAXA 2Z5UA 1EH7A 1IXSB 5H6RA 2JTVA 1I1GA 3REOA 5ICGA 1FT9A 4IXAA 4N9IA 4WX9A 4NQWA 4MTEA 3OREA 1OYYA 4IRHA 3BJ6A 5LEKA 1FOKA 3D0SA 4KN7X 5AIQA 1B4BA 1SMYF 1SD5A 4I7HA 4B09A 2DK8A 1QZZA 3BY6A 1H9TA 3MZHA 4B8XA 4EJUA 4QLCU 3WTSC 1JE8A 1SFXA 2FNAA 3RYRA 2A68F 2K27A 3WU1B 2XAJA 2Z33A 5TRDA 3EUHA 1TQPA 2O61A 5D5WB 1YIOA 2RGVA 4Y13A 2GA2A 5A2QZ 1HW5A 5HLHA 2MH2A 5BMZA 5HDNA 4AD9A 5CYVA 3H92A 4L9JA 4DNCA 2HFHA 5D6EA 5L3GA 2V6CA 3E5QA 1ZLKA 5JHUA 2KIMA 2PN6A 2HZTA 5J8CA 2NNNA 1FYKA 1IN4A 2WV0A 3W6JB 3IL2A 2UZKA 1HW2A 3NUHA 1OYWA 4P5OA 1WQHA 1BGWA 2L4AA 3HIFA 2FBHA 4LG0B 2TDXA 1ZREA 1I1SA 1B6AA 4L5IA 3LSTA 2ZMEA 1P4WA 4YFNF 4UUVA 2PBIA 3RKYA 4G9YA 1SFUA 1B59A 3ECHA 5CLSA 2JSCA 4OIRF 5E18F 3L4JA 2ZMEB 2HKOA 4A0YA 4BHPA 2W25A 1O3SA 1PP8F 4KMUX 3DP7A 2FA5A 2D45A 1IS1A 3K9TA 3C7JA 4HF1A 2CO5A 2QVOA 1HSTA 3S2WA 3I54A 1OR7A 4IJAA 5L3EA 2EFWA 1XDSA 2K4JA 2ZO4A 2H6CA 2W84A 2VBXA 2ADUA 1U3EM 5IT9Z 4Y17A 5AIPA 3KP4A 4U0VA 3E6CC 2RDPA 2Q0OA 1T6SA 4LK0F 4M9XA 1IW7F 4I09A 1UFMA 3TGNA 4HDVA 1P92A 4UVAA 2EWNA 4R79A 3LA3A 3F23A 3RKWA 1MD0A 5L3DA 3L00A 3J81Z 5JVOA 3OOPA 2P8TA 4P96A 5FLXK 4IF4A 2UXXA 5K5RA 3BOQA 5DV5A 3TO6A 2VBYA 4NHJA 3I0TA 1T39A 5JR3A 4G0VA 4RB1A 1USSA 2QWWA 3KP2A 4GCVA 3KLNA 3VB2A 1JHHA 3HOSA 3P9KA 3CUOA 2P4WA 1STZA 2QYOA 3T5XA 4EJWA 4U0WA 3T8TA 2D1HA 4KDPA 3RKXA 2CSOA 3L2CA 2E7WA 2OQRA 4WK8F 3RDIA 3RIRA 2JZYA 2V1XA 3I71A 2XGXA 2YSRA 4KA4A 1HQCA 2G7UA 5HVQC 3R6SA 3WU0A 2DTRA 5BPDA 4OMYA 4WCGA 3QPHA 4IHTA 3GYHX 3ABUA 5LHGA 4HAMA 2IA1A 2FU4A 4GO1A 4A6DA 3SQNA 4E70A 5ICFA 5DCFA 4EM0B 1YQAA 3J80K 2LF8A 3WTTC 1CGPA 4LGWA 4L9TA 3M7GA 1QQIA 2R7FA 2RVCA 2OU2A 2MD5A 4L0YB 1J5YA 1E17A 3I59A 1D3YA 4BH9A 3I64A 3SZPA 1H9GA 1NHAA 5ICCA 4KB4A 2DT5A 3E3VA 2NAZA 2DBBA 5E17F 5D8KB 2HKXA 1S7OA 1WSUA 2FMLA 3BJAA 3T0YA 1MJBA 2EFNA 3D5LA 4L9NA 2A69F 2PG4A 2J5PA 3JAMZ 5IT3A 2EV0A 3E6BA 2WTEA 1USTA 5D5UB 3LPXA 4DDQA 4M74A 3F72A 4ZYHA 5ILVA 4LD5A 1RUOA 1JXSA 2Z99A 1LEAA 2Q2EA 3WGGA 5DUKA 2OQGA 5EEGA 2E7XA 2OAZA 2Y3PA 4A5NA 4KFCA 1TNTA 2RNJA 1S6LA 2O0YA 4R1HA 3BP8A 3WTZA 3LAJA 4LB5A 1KU2A 1UHWA 4BNCA 5CVVA 4HX8A 3BDDA 3FXUA 1FSHA 2VN2A 3F8BA 2MC3A 5LLQA 5LRRA 2HGCA 5CVUA 4AWXB 4A0XA 4UVBA 4WXHA 3E5XA 1R1TA 1BI0A 4BXUA 3KZZA 1CF7B 1IRGA 5TJJA 3B73A 1LDJA 1YW9A 1KQ9A 2MA3A 3VA7A 1MJAA 4U7DA 2UWMA 2P6SA 1WI9A 2KRFA 2XUBA 2HYFA 4HZFA 4G6DA 3QOPA 2VBZA 5DD8A 3E6MA 2H94A 2FQ3A 3E5UA 4Z2YA 2QBYA 1AOYA 2P5LC 1B9MA 4M72A 3GFJA 5ILSA 3ROUA 1REPC 2BV6A 2ESHA 4I0AA 4IPAA 3RI4A 2VODA 2ZNYA 1U5TA 2QBYB 2W57A 3K1NA 1G3YA 5LEJA 4KIFA 3E6DA 5K5OA 3COAC 1HKSA 2IJLA 2OBPA 2HYGD 3JSOA 5ERIA 2EA2A 4FHTA 4O5VA 2JT1A 3GVAA 2A6EF 2ELHA 2EA4A 3V8JA 2FE3A 3G3ZA 3L7WA 1W4MA 1WQGA 2BEOA 3V7RA 1IXRC 1FP2A 1ZLJA 4H0EA 3EQLF 2A07F 3C18A 1FP1D 3IWZA
chains in the Genus database with same CATH superfamily
2R7QA 2XPVA 3SFZA 4A3CC 2OV7A 2F2EA 2OF7A 4LLGF 3OV8A 4JYKA 1T38A 5B5EC 4RB0A 3HOZC 4DYRA 1XTAA 1YRNB 1E0EA 2ZSHB 2VONA 2QQBA 5IP6A 3MKYB 2NS7A 3BQZA 5CJ9A 1QA6A 2CMPA 4BAYA 4ENKA 1WIHA 2CUEA 1FZPB 4KB2A 4HLYA 4AVPA 2LNBA 3GCMA 4GFBA 3IH4A 4C2TA 4CICA 1RR7A 1MH3A 1V5EA 1H0MA 1QGPA 2EIKH 1X31C 4MFEA 1RI7A 1UV7A 4CCMA 5H20A 2QCOA 2E5ZA 5FKLA 3A01A 3AG1H 1BJZA 2M87A 2V9VA 1TWAA 3CC7I 1MIJA 4ENNA 1XGMA 2IXSA 2FBKA 2O7OA 3LWFA 2DO7A 2L3DA 2DA5A 4PJNA 4RB3C 1D1CA 2PI0A 5KHDA 5IYCJ 1IUYA 4ZYGA 1D0XA 3AD7C 1WQ2A 3L09A 2DJNA 3P9CA 2PMZN 2L9SA 2KJCA 3OIOA 3MZYA 4I76A 1YNJA 4FE7A 2YUSA 2Q1ZB 4IRGA 3H3ZA 2MD0A 1WKMA 2V1NA 3MN2A 3KYDB 1BI3A 1PJRA 4G7HF 2K86A 2BY2A 3LSMA 4HV6A 4U7BA 1E3PA 2A3SA 1RC9A 2R5YA 2X6OA 4B43A 2MC4A 4KNYA 3RZOJ 3HDDA 4PDKA 4ZJZA 3KP7A 3M3YJ 2IT0A 1JTXA 4KYWA 2CV1A 2IGKA 3U1KA 2GLOA 3DF8A 3EQLA 2MH9A 3IC7A 2Z16A 4HV5A 4KC6A 2YU9C 4CCNA 4A3GJ 4HG2A 3IH2A 4UV9A 3MKZA 4BEHA 4BQAA 4ANJA 1WFXA 4LLGA 2R5YB 2I10A 1G51A 2ZFWA 3G4SI 4G94A 2W85A 1MSEC 2YU3A 4E4HA 3OYIA 3NEUA 3KZYA 4ESJA 1OCTC 4BHBA 2CRGA 2M7AA 1O3TA 4PJ0C 2ZNZA 4ENMA 2OCCH 1MNEA 3HOYK 4A3EK 4WWCA 1Z7UA 3F22A 2DOFA 2JA6K 4RGUA 1ETXA 1VTNC 1OYIA 4JP0A 3HL2A 1LVAA 3CESA 3AD9C 1J0RA 3R4KA 5CQGA 1D5YA 3L2VA 1ACIA 1MW7A 1LE8A 4ZTJA 3HKZD 3S1RJ 4ITVA 4CXFA 2XC7A 1EKEA 1A6QA 4BY1J 3BWGA 2Z9OA 3HSRA 1IN6A 2JA5J 2EZIA 1LB2A 1LQ1A 3F8CA 4WJ3M 1UB9A 4XLCA 4M1XA 4EM1A 1KU3A 4JX5A 1XZQA 1V54H 3F3XA 4ZDPA 4ENJA 2DA3A 1QZEA 4HYEA 1R36A 3F21A 3MCZA 4ESBA 4KUMA 1B4AA 1MMSA 5KAIC 4G7HA 1J2XA 3GTQK 3FOEA 3RTRA 1R4NB 1TW2A 4J19A 4IRIA 3HRUA 1JTYA 4P55A 1WVRA 2IS4A 1G3WA 3GXOA 4M9SA 5BPIA 3FBNB 1SFEA 5F1JA 5FGMA 5J1RA 4JOMA 1QO0D 2CW8A 2DA4A 2K9QA 2K9MA 1R6RA 1Y1VK 3CCRI 4BXXJ 1FYMA 2XRNA 4R8HA 4HQEA 1WJDA 2Q8KA 3W2WA 5F1RA 4KASA 1P2FA 4AUXA 3MAJA 2EPFA 1LJ9A 4XLNF 1QNTA 1GUUA 3BG6A 5K5QA 1IJWC 2M0MA 2VJ5A 5FKMA 1SMYA 1HF0A 4HBLA 3GO5A 5C44K 4XIDA 1T0FA 2P5MA 3K70C 4QIWD 3H3VL 3E97A 3MEXA 4HW0A 3CCQI 2EQRA 1JJ6C 2CJJA 2ETHA 4G7OF 1RUNA 1W0UA 3VYRB 3JRHA 3CMEI 1ZQ1C 3GTQA 1KYZA 5EYRA 3T01A 2CQNA 5D4SA 2EFQA 1XCBA 2MW8A 3S16J 3H9QA 3VDXA 2OCEA 1O25A 2VLAA 2OC6A 1SFOJ 1ZHFA 2IP2A 3EYIA 2L01A 1ISEA 1A04A 2XHKA 3GF2A 2H6BA 3Q3QA 3DPLC 1J59A 4NC6A 1I3AA 3JRFA 5HODA 1K78A 1A31A 1Y1VA 1PUFA 4D5CA 2ZJRF 4M73A 4YIIA 4XBFA 2VQLA 3HOXJ 3TQNA 5HNFA 4DBRA 1W7PD 2M4GA 3K69A 4WXCA 1I6VA 2FSWA 3I53A 4C3JK 1N78A 3ZRGA 3HJEA 4CZZA 2O8KA 3RPUD 4MO7A 4LG0A 2NVQK 1DDNA 4X6AK 5L3BA 1I27A 3U9GA 4X1EA 2L7MP 2VOOA 2NVXA 1RZ4A 2DODA 3IH3A 1K78B 5E68A 1PUFB 1H88C 4A3MK 3FM5A 2A68A 5J40A 2KJBA 2XASA 4ZDLA 2GXBA 2IGMA 1MBKA 3DWLE 4ZYAA 2JK3A 4A3BK 3QPSA 5KVRA 3I4MJ 2O9LA 5FFZA 1GVJA 1HA8A 4A3EC 1EFWA 5FKKA 2XIGA 4KJZA 4AIKA 1O57A 1HI9A 2JA6C 1Y1WA 3S14J 3ZMDA 1KU7A 4LOWA 2QENA 1PVEA 2DFIA 3GUDA 3V8KA 4I02A 3TOBA 1N77A 3UR3C 1TWAJ 3EYYA 1EH1A 1KONA 4GTLA 3S0XA 4G7ZF 1XD7A 4AYBN 2P5VA 5HDGA 1WWXA 3EDPA 1Y0NA 2VE8A 1F36A 4XORA 3EUKL 3TDUC 2L54A 1G3TA 1I5ZA 4G7OA 2E2IJ 1FOYA 1Z21A 2VC0A 3HYIA 1T0FC 1O4XA 5KK1A 2QUFA 3M1EA 1BW5A 4LLLA 3S1NK 1E2XA 1FMVA 4BLAA 4FCYA 3G73A 3GTQC 4JX6A 1YYVA 9ANTA 1OCOH 2JQ7A 3FKJA 1B8IB 2IS2A 5IYDK 5BQTA 3S17J 3W6KB 3ZMVA 3P7NA 3WHCA 1AB4A 2L7ZA 3P5JA 1TWCJ 5IPAA 5HS9A 2VE9A 3NRVA 5CVJA 3JCUC 4YRVA 2VUMK 1Y1VC 3HHHA 3IV5A 1P6RA 3VYUB 1I3QK 5DCMB 2Y0MA 2VJJA 4BU2A 3HPHA 4AC0A 2DQLA 2EFPA 3BP3A 2OZ6A 2OUMA 3UKGA 3QRFF 4BS9A 3T02A 5C44C 2KIQA 4B4CA 2VPLA 3TW6A 4RB2C 1TT0A 5C4JJ 3IUOA 3SDBA 3ZXSA 1SD7A 1YLFA 2IA2A 2D1VA 2QSGX 3HKZL 1VQKI 3HZJA 4RAYA 2EZHA 2WBMA 3S1QK 2XGEA 2QQAA 1D1AA 2W48A 4PAAA 4RMFA 3DU5A 2HDWA 2JA2A 1TW3A 2ID3A 2EB7A 5E8GA 2BVLA 1NK2P 2M7BA 1H8AC 3A8IA 4G7ZA 2BBYA 2COMA 3FISA 1IO2A 4KT5C 4EEFG 2IPQX 3NQOA 4G0UA 4C3JC 3B02A 3HBLA 3MWMA 3FOFA 4Q5SF 3CMAI 5IOTA 3PSIA 2NOGA 1KZHA 2NVQC 2R7DA 4PJMA 3OMYA 2XKOA 2E2JJ 3CAGA 1RR8C 4A3MC 3PO3K 4PSXA 5D6FA 2CV2A 2VXDA 3PIOF 2XAHA 3G71I 5HOOA 3BZ6A 1X3UA 2RH6A 3R0JA 2JWTA 4J00A 3DXJF 3CJNA 1WH5A 1AKHA 2ECBA 3HRMA 1P4AA 2G0EA 1HC8A 4A3BC 3DV8A 3MQ0A 2YS9A 4EM2A 4F3QA 1TWGK 3MKWB 2FXAA 4QIWL 1V4RA 1XGNA 3K6GA 3IRQA 1RNLA 3DBRB 2E60A 3HC7A 4E7JA 2HEOA 1PJ6A 3U2RA 1YCLA 3JRDA 1E3OC 1KQ0A 1UCRA 4U88A 1AKHB 2YX7A 3C1DA 2K3PA 3QAHA 2VJIA 4XRSG 1KU9A 3ABLH 1FBUA 1D8KA 1JQWA 1VGXA 1VQ6I 3TEDA 1XSDA 3BR5A 1L0OC 1Z9CA 3OYFA 1OKRA 1R5GA 4C2MK 4PUSA 1P9QC 1W1WE 3AG2H 5IP9K 2D6FC 1OCZH 4LMYA 3S1NC 5GADJ 2A6HF 1TWGA 4E7LA 4KM9A 2HOTA 4UVCA 2FRHA 3LQRA 2L9VA 2JMWA 4CCLA 2LKXA 2R7UA 5IYDC 1QRYA 2EH3A 3L1PA 2GZWA 2N8GA 1MJ9A 3HUGA 4HOBA 2CGPA 4A12A 4HQMA 4JBAA 5E3NA 1XGSA 2VUMC 1I3QC 2M45A 4D0PA 4IOCF 2F5EA 3I5UA 1YJWI 2NVXJ 3V7CA 2P5KA 4NDLA 5LRSA 3WGIA 1G6NA 3GFMA 3KEOA 3MFKA 2OTJI 1HCRA 4E6KG 3Q5FA 1WSVA 3LSIA 1OCCH 1TT5B 2XSDC 3DXJA 1ZG1A 2MABA 1VQ8I 4L9VA 3F8MA 1IRXA 4CA0A 1TWHJ 3DTIA 4QPQA 4BJTA 2JN6A 2XF6A 2QF7A 3GTGJ 5H6QA 2Z1DA 1Y1WJ 2JVGA 4OIOF 3S1QC 2STTA 2LR8A 3F8FA 3GX4X 1SAUA 3KCCA 5L3CA 1XMAA 1R5HA 3QYFA 2HR3A 1WOOA 2JPCA 4ZYEA 4A93K 3S15K 5M5WJ 5M5XK 4LIVA 2HI3A 2JVHA 3EPZA 3WE3A 4EQQA 3VFZA 5D4RA 3IRRA 4UHTA 5HLIA 3TO9A 4A3FJ 2L4MA 5ED4A 1TL8A 4JX4A 5CVRA 3M1CA 4YFXF 2LF7A 4ZZDA 5FFXA 2EBBA 4BJ6C 1YTYA 4D1QA 4ILDA 2NS0A 4NC7A 3VWBA 3CLOA 2XAGA 3PQJA 2Y0SN 4XICA 1XXAA 4U87A 4MTDA 1YNNA 3RKQA 3PO3C 1VQLI 2VJ4A 1X3WB 3G1OA 3PO2J 5BOXA 4XLAA 2CW0F 3H5AA 2A6HA 4Q4ZF 1S7AA 5E20A 4CGZA 4MEYF 5C4XJ 2L02A 3ZQGA 2F5VA 2BYVE 5CKTA 4WF2A 5GPAA 5J1UA 1TWGC 3GTJK 1ULYA 3PUBA 4HX7A 1W7PA 4I98B 2HPMA 3KP6A 2JA7K 2DLLA 2RAEA 1VQNI 2WAQD 2LY2A 2WWYA 1T95A 3GLXA 1SMTA 5LGTA 2V9PA 1ZARA 2UUZA 4MQVA 1ZR2A 2R7SA 2M34A 1LDDA 4DQ2A 4BBRJ 1MNMC 1W7PB 1BI1A 3WTYC 2XCQA 1MBEA 3OR2C 2KRHA 3KPHA 3TOAA 4BYYA 1VI0A 1IF1A 1ZRFA 1SFKA 3MVPA 3ABTA 4C2MC 1HDDC 2BY3A 2QLZA 1ONVA 1XDUA 1QVTA 4G8XA 3H9GA 5IP9C 3A8JA 2KDOA 3ZMUA 4RGRA 3LA7A 4OIOA 4G0WA 3S2HJ 5JLWA 3GTJA 1WJFA 3BG3A 1K83J 1LFBA 3GMEA 4FX4A 1G4DA 5D4DA 1J75A 2F5DA 3GTPJ 1MNDA 2A5YB 3ZMTA 1Y8RB 2ZJPF 2F5CA 2AQFA 3I55I 2W24A 4Q48A 2GIVA 1J6XA 4ZC3A 4YFXA 4RMNA 2JA8K 1QPMA 5F0HA 4ZH4F 1CF7A 3LA2A 4UV8A 5K7HA 3GW2A 3BR2A 3BROA 2KWAA 4OIPF 1FOWA 2B0LA 1KQ4A 3LQQA 3SFIA 2IVMA 4FQGA 3I4PA 2ME6A 2LYCA 3OPFA 2CW0A 4YEJA 3PM1A 2OA4A 3S2DJ 1QU3A 1S3JA 4LR2A 1INNA 4I6ZA 2FNPA 2IS1A 4MEYA 3BTJA 5FLXZ 1VQ9I 1RU0A 1WCMK 1BN5A 5HLGA 3V4GA 2DMQA 3BZKA 5JI6A 1GXQA 1PUEE 2ZCWA 1SD4A 2HOEA 1WOSA 3O2PE 1LFUP 3FMQA 3RSNA 2DI3A 3FBIB 2ZXWH 4IEJA 4XK4A 3G1MA 3HPGA 3O6BB 3FHNA 4A93C 3S15C 3GFIA 3IAS2 1IRFA 2R93K 2XAUA 3FM3A 2VC1A 4BE1A 3WG9A 1O24A 1TWFK 3V8LA 4FZBA 2PEXA 1ON2A 5B1AH 1UAAA 4UXNA 2GQQA 2QQ9A 2EZLA 1U6GA 2M2EA 2BGCA 1JI8A 4NNJA 4C3IK 3ZQ7A 5HS8A 1DGWY 2ZFZA 1I6HK 4KMAA 2O3FA 1TQMA 2W82A 4BLBA 1Y39A 5D8LB 2A5WA 5JVTA 4FASD 2HXOA 1HSJA 4HX4A 3JRGA 1SVOA 2H1LA 2DYRH 2PFBA 1B1BA 1FPQA 1DD5A 2GM4A 3GTJC 3CQZK 3EUAA 1AWCA 3OYMA 2AXLA 3FXRA 1Z05A 4Q47A 1VJEA 2R93A 1OFCX 1SVMA 3BR3A 3C3WA 4KM8A 5A2QK 2JA7C 3F8NA 3NWSA 1MKMA 2HVSA 3OS1A 3OL3A 4ZH4A 2PX9A 2BW3A 1A6IA 3ZQIA 1ETOA 3A03A 4OIPA 1J9IA 2R7VA 3RQ4A 4OMZA 2P6TA 2VQHA 1K79A 4E7IA 2FQOA 3VOEA 1WI3A 2EIJH 4GYIA 2X48A 2RQPA 2C6YA 5FLMJ 3TP3A 5EGOA 5LHIA 3I4NK 1LKXA 4O6JA 3CUQB 2VKHA 3HOVJ 3GTOK 1BJTA 1BR1A 3PFIA 5HL8A 4II3A 2QZ8A 4KIGA 2V79A 3VEPA 5L46A 5CQEA 2CW7A 1SC7A 5EDNA 2NYXA 2DN0A 1FIAA 4L5EA 2X6XA 5J1YA 3L9FA 4FETA 2DMPA 1R7JA 3AL0B 2X4HA 4II2A 4DZPA 5ICEA 1G3SA 1O7FA 4D7MA 3N0BA 1MMNA 1XZPB 1HKQA 1YX3A 1X1BA 3LL7A 2VXZA 2LMDA 4EGYA 2JA8C 3HRSA 5KNLA 3ZMSA 3H0GJ 2OD5A 3ASNH 2GAUA 4S0HB 1ZRCA 3WU2C 2KKOA 3CDHA 1RIOH 4M6VA 3HTUA 1R23A 2VT2A 5J3LA 2VASA 3J80Z 1VZ0A 2VKDA 2GSOA 3GTOA 4LLNA 2WAQL 1AU7A 2X1EA 3ZMZA 1EK8A 4A2UA 1WCMC 3SHFA 2P7CB 1TBXA 2GSUA 4ZYDA 1R22A 3FXQA 2YX4A 1UMQA 2EJRA 2ZSIB 2CUZA 2NVYJ 3GZ6A 5JVGF 5IYBK 4RAFA 4GDFA 1O2BA 4KN4A 4PFPA 3CJRB 5J47A 1BM9A 2HWVA 2R93C 4FT8A 4LG3A 3CCUI 1TWFC 5FRMA 1Z6TA 3DEUA 4NC8A 4XNFA 1FMWA 3S3NA 4BBSK 3K7AK 3FXMA 5B3SH 2GBYA 2DQRA 2M30A 2TRTA 3CUQC 1K6YA 1O2FB 4N0BA 1WORA 3A0BC 4OAZA 2WV1A 3J7AO 4RS8A 3FIWA 4KIBA 3DKWA 4AM3A 3TFHA 3KP5A 4C3IC 2HQRA 1I6HC 1BBYA 1LDKB 1J6VA 2ECCA 2XCRB 3AL0C 4UNOA 2K85A 1F1ZA 1EV7A 2EINH 2H8WA 2KIFA 2LD5A 2RGRA 4I99C 1CQTA 4OAYA 1EH6A 2HTJA 4OU0A 2RKHA 1BIAA 1LEBA 5FJ8J 2A6EA 1V3FA 1GV2A 4QSHA 5IORA 3SDGA 2BE5F 3CQZC 2WB1N 4UB6C 3GFLA 2FUG2 2HTSA 2Y48A 3I3LA 3KEYA 4XQFA 1W36D 1S29A 2XVCA 2O6GE 4ASNA 3NWTA 3H3UA 1R4MB 2M1BA 3A8KA 1T56A 2BHYA 4KMFA 2PMHA 5M3MJ 3DTEA 4OIQF 2FJ1A 2UXNA 4Y7NK 3HOUK 3CO7C 1XB4A 4TV7A 1FEXA 2R3SA 5IT9K 1ZG3A 4M6YA 4A3KJ 1DPUA 2CYYA 4UY8I 1ON1A 3L2UA 1BJAA 3BPXA 2M3AA 1ZELA 2FBIA 5EZHA 3HSEA 3Q9VA 3ECOA 5EZGA 3FHZA 4RGXA 1K61A 3I4NC 3JSPA 3ZPLA 4M3FA 2B63J 1OPCA 1XPPA 3GTOC 1R58A 2XV4S 4M9ZA 5C3EJ 4P1WA 3VODA 3K1PA 3N0CA 1ZTRA 1O2AA 3FXLA 5DUIA 2E2HK 2OZUA 2CG4A 4IVNA 3J7ZI 1GLNA 2IA0A 1HXDA 5LHHA 5K1YA 4M6XA 4KATA 2M8EA 2W7NA 2TCTA 1JKPC 2FOKA 2PJRA 5DEQA 1IE0A 3J81K 5F64A 3QWLA 3BPVA 1DUXC 4IX7A 1MZBA 3QODA 3WTWC 2KLOA 1GHCA 2DFEA 5J8FA 4S05A 3BLYA 3MMYB 1P7JA 3PNYA 4A3CJ 2ESNA 2KRCA 5F6FA 2HDDA 5EF6A 1I50K 3L2QA 3HOZJ 3A2KA 2PJRB 5GAEJ 4G6QA 3CTAA 3N4MA 1BW6A 4I01A 5E79C 4HNVA 2VBWA 4HSRA 2ZC2A 4L0ZB 3BT9A 3OYAA 5HS7A 1R71A 2E2HA 3G1LA 1BC8C 2CWEA 1Z7LA 4QWQA 2PMZD 2BE5A 2M0CA 2LY9A 4A3JK 4LB6B 5K7ZA 1D8JA 1APLC 2JH3A 2V1DA 1FSEA 3BR1A 3I58A 4RM2A 2X1CA 2X6WA 2QA4I 3GTKK 3T8RA 2DAOA 1MBHA 5IYBC 1O7LA 4B3AA 2JA6A 3FXOA 3GZ5A 3CCJI 4HPQA 3WHBA 2E1NA 1JUPA 1JJ8C 1FTZA 1BOAA 4W97A 3K2ZA 1T08B 3RCOA 3S1MK 4HEA2 4BBSC 3K7AC 1EQRA 1I50A 3JTGA 2PJPA 1UZCA 3QP5A 3QP6A 1TC3C 1JT6A 4BQQA 3DEWA 1PP7U 1P4XA 1T2KA 3NARA 4ZDOA 3RYPA 1RRJA 4XN0A 5IOSA 3FXKA 4XRMA 3AG4H 1Y8QB 2LKPA 4K2EA 1R5ID 4HA8A 1O3QA 2CFXA 1HQMA 4KDDA 2F4OB 3LSHA 3SEQA 4LIUA 2XCOA 1YS7A 2DU9A 3FWEA 4CYCA 3HB9A 1ZGJA 2KQRA 1YOVB 4EJVA 1TZLA 2DA2A 4DW6A 5DM6F 2K4BA 2GSNA 1U2WA 5GAGJ 2RC4A 4BKXA 5IOYA 1TLHB 2E19A 5LGNA 3LMMA 2YU9J 2NOJB 2R7ZJ 1FNNA 4Y7NC 5FD6A 2LP0A 4CZCA 3HOUC 3ZN1A 3AFHA 4CYCB 1IG7A 2EV5A 2HDCA 3K1MA 2R5ZB 1P7IA 4GT9A 2CH0A 1U8BA 1BL0A 2KFDA 1MBFA 3OEPA 4P9SA 4B48A 2GWRA 1HOMA 3KX2A 3PSFA 3AAFA 2X6YA 3VYTB 5D5XB 5E1WA 1Z91A 2E2HC 5JLXA 4G6TB 1LUJB 2YR2A 4XRFA 3HRTA 3HOYC 1IXCA 1BC7C 1K6OA 1ZGAA 3OYCA 3VSKA 3VSLA 3IKTA 4YG2F 1W5SA 4GGGA 2D5VA 4PGHA 2ZB9A 2D2WA 1VFCA 1L3LA 3FF5A 4XLNA 3KFWX 1SD6A 3M4OK 1M1EB 5EEHA 1U78A 1I50C 4GYGA 2DPUA 3GEZA 4XR6A 4KAWX 1B8IA 5GPCA 3EUHC 3R60A 1OCRH 4RDUA 1YS6A 4A0ZA 4IHWA 1W5TA 2RREA 2XSJC 4FE4A 2DA1A 1YO5C 1R1UA 2WAFA 4PJJA 3ML6A 4KN4X 2DMUA 5DCMA 2FD5A 4XSZF 2LSOA 2AXTC 4A3JC 2EFOA 3KYLA 3GTLK 2H8RA 1HBXG 4EATA 4J3NA 5GAHJ 2FEZA 3GTKC 1AHDP 3H5NA 2LG4A 2MSYA 3JAMK 3OYDA 4CDGA 2YPRA 1ZG5A 1ODDA 2R92K 3W6VA 1JKOC 3H9JA 3ONQA 3ZCOA 1TP4A 3A02A 5K7FA 3QYEA 2DA6A 1ZH5A 3MMLB 3S1MC 2CS3A 4LQYA 4PABA 1WJEA 3RZDK 2K7LA 2MLGA 2R7XA 3TBIA 4GFQA 2X1DA 5HDKA 5IY5H 4NB5A 2Y2ZA 1GT0C 2XDVA 2LFBA 3KETA 2M8GX 1N25A 1HKTA 3HOWK 3L4KA 4I2OA 3FMRA 1LFPA 1GXPA 3QPTA 1S9HA 1XMXA 3SXYA 1JHFA 4O3MA 3C2GA 1T8IA 2L5QA 1FYLA 4IOAF 3DQVC 1IDZA 2X0LA 1R1VA 3FMSA 2E1CA 3ZQCA 2HXIA 2IBDA 4YG2A 2R92A 2B9SA 5IP7K 1JGSA 2VUMA 1FC3A 4QTRA 1I3QA 4IHXA 2WADA 3LAPA 2PMZL 4M71A 1FY7A 1FTTA 5FB2A 1Q1HA 2Z3YA 4BY7K 2XAFA 5FD5A 1KQ8A 2JJ7A 6PAXA 3TP0A 1XSXA 2IGNA 5TJ3A 4AYBD 1XCVA 4DJAA 1XXCA 4X6AC 3GTMK 4BXFA 4V2GA 5F27A 2XROA 2O8XA 2AHQA 4LJZF 4P9FA 3ZP5A 2ZMEC 4A3EJ 3D1NI 2ISZA 2VT3A 1GDTA 2K02A 4XSZA 2XPUA 2M5WA 2KDZA 2JA6J 5E3MA 2GA1A 3WTUC 2JRMA 4N9HA 1ZXOA 3S8PA 4F91B 1SVLA 1IRZA 2PHCB 4A3DK 3P9IA 1T98A 3KE2A 5FKNA 2DA7A 2OPTA 4HF0A 2EK5A 1POGA 4OINF 4C3HK 3IWFA 5AONA 2V1UA 2LKSA 3I56I 1R9TK 3IKVA 3FKIK 3TO7A 1KA8A 3K4BA 3M8FA 5EG0A 4Y52K 4DGWB 2ZXJA 3FZVA 3M4OC 3GTMA 2WY8Q 1HW1A 3K2AA 2LRDA 2HVRA 1J7KA 2GXGA 4W1UA 2ZBKA 1XSVA 1JOEA 3ISPA 1C0WA 2RN7A 5E1XA 3H0DA 3GTQJ 1FWZA 1IAWA 1DPRA 1U9NA 2J5OA 2Y30A 4B44A 5EG0B 2RQQA 1K7AA 4HRIA 1IQ0A 4WJ4A 2LVSA 3M8JA 4PGGA 1DU0A 5FLVA 1S8NA 3M07A 4EJOA 3GTLC 2K9NA 4A3LK 1Y1VJ 5M5YK 4DBQA 1MDMA 2DK5A 5DD4A 3GSIA 3TKYA 3ESWB 4EVIA 3HKZA 2R92C 1R9TA 3J7AY 1ZK8A 3G6EI 2CV0A 4EJTA 5D5VB 2BVMA 4XN3A 3BCBA 1B72A 5C44J 2QSHX 1XGOA 3IHUA 3Q3SA 4Q5SA 1BOBA 3RZDC 3OIPA 4ETSA 2JRTA 3TFIA 2KISA 2MLKA 3F6VA 4ON0A 1ZGWA 4OOIA 2O03A 1MDMB 4LJZA 3L2RA 3FDYA 3DLAA 4CHUA 1Z67A 3HOWC 2NNYA 2IGOA 2CFAA 1B72B 2DXIA 3V7SA 1XN7A 1YW8A 4CH7A 3O8GA 1X2NA 2EV6A 5H2FC 3WTXC 2HS5A 1W36C 4XL9A 2XAQA 3CMMA 1ZRDA 2KP6A 2V4JC 2MBFA 4OINA 4U0YA 1ETKA 1JT0A 4C3JJ 2CFAB 5E1ZB 5IP7C 2NVTK 3Q9SA 1HDPA 3LSPA 3DCFA 3HTSB 2V7FA 3TFJA 2O5JA 1UJ8A 2ZKZA 3TDZC 2NVQJ 4X6AJ 5M3FK 2DT7B 1F5TA 1TTYA 4BY7C 4IHSA 4A3MJ 4CO8A 4A5MA 4A3IK 5E3LA 5J6XA 1BI2A 1ZYRF 4UUSB 4PZJA 3GTMC 1UHMA 2JPBA 1FLIA 4E7HA 4A3BJ 5EGEA 4PCQA 2FF4A 3KLOA 3DKXA 3K4LA 1VF9A 2ID6A 4MEXF 4JK1X 1BA5A 1IV6A 4FX0A 4A3DC 4UB8C 1VQOI 1YW7A 4S04A 3RPUA 4C3HC 4MHGA 4LOCA 5CVIA 3T1BA 1R9TC 3FKIC 4PSWA 5LBQA 3OYBA 3I59B 4Y52C 4OWRB 1VQ5I 1FOXA 2DYSH 3JTHA 2DMTA 2KIUA 4EMSA 2LOOA 1O3RA 5IYCK 3S1NJ 4RA2A 1VRQC 3N05A 3DPTA 2F6CA 1NTCA 3GZNB 4F52A 4C45A 3AG3H 1TQIA 2F5FA 2ELJA 1FBQA 3MD2A 5IYDJ 2QM3A 3HG9A 4HF2A 2CU7A 4UUTA 4AYBL 5FKOA 1IDYA 1YFHA 1D1BA 3ASOH 3D5SC 4A3LC 3K4MA 2PA8D 1J09A 2VUMJ 2PLYA 1I3QJ 1ETWA 1Y0UA 3SEZA 2VKEA 3QX3A 4BACA 4DOZA 2XKPA 2RV8A 1PDNC 3RZOK 2JA7A 2HZDA 5CPRB 3M3YK 2LY1A 2HQAA 2V26A 2ACJA 2ZXIA 2Y75A 4LFUA 5LGUA 2CQ7A 4XCHA 3IAM2 4BQOA 4BHCA 3BG9A 1ZR4A 4EGZA 3LFUA 2FMYA 4ESFA 1U8RA 4A3GK 2PPBA 4I0BA 4AVZA 4XLPF 2CUFA 2BZTA 2WC2A 4HNTA 2STWA 2LH9A 4M3DA 4XLFA 3RJPA 1DP7P 2Y0SD 4Q4ZA 4KMHA 3S3MA 3S1QJ 4KICA 3TMOA 4DYQA 1IN8A 4GTFA 1FX7A 2HQNA 1E3HA 3HXAA 3DFGA 1I6XA 2O5IA 1LNWA 1VQ7I 2IRFG 3N97A 2EIMH 4AIDA 3OYLA 1F9NA 2VOPA 3Q0WA 5JFRA 3OSGA 4F93B 1TNSA 1WJCA 3HM5A 4CYDA 4EV0A 3JREA 2NVTC 3DBLB 1ETQA 4KMDA 4MNUA 3G4CA 1QPIA 1RETA 2P7VB 3CJTB 1XXBA 3S1RK 4YIFA 3PO3J 3O3KA 3QOEA 4Y15A 4BY1K 3EETA 4A3IC 1Z6RA 5F0FA 2JA5K 1ZN2A 1ZBSA 1YG2A 1MBGA 4NBQA 1IBAA 3ERED 5DDGA 3OYKA 1EF4A 3KP3A 1BDFA 2NRAC 4JQFA 3ULQB 3GWZA 1IN5A 1TWGJ 3LSKA 1WCMA 3PFYA 5BS6A 2P0WA 2EZKA 5E8IA 3QU3A 3K4CA 2XPWA 4XMYA 2ELKA 4Z6YA 4A6EA 2CQKA 2IW5A 3M8EA 3GEIA 4L5JA 2DCEA 5ILUA 1QZYA 3ELKA 5GTHC 2W1OA 3F6OA 3AH5A 1TWFA 1IN7A 4BXXK 3PQKA 3CDLA 1YJ9I 4AYBA 4FM9A 3OYGA 3CUQA 4AIJA 3Q0UA 1R00A 1YJNI 4XSXF 3OS2A 2ISYA 4BDZA 1O26A 2H09A 1ZVUA 4C2MJ 1IC8A 4X0GA 3E0JB 5IP9J 5IYCC 1DCHA 1FBSA 4GTAA 2W4SA 1DCPA 1R49A 2V9KA 4GXOA 4BGDA 3U21A 2HU9A 2AS5F 4XM3A 1XZPA 2DDBA 3S16K 2E1OA 1ZAOA 3BP8C 3C2BA 4MGRA 1SFOK 4F7ZA 2LDUA 2VKVA 3R0AA 3CQZA 5DYMA 3M9AA 3C2HA 3HHGA 3J7YJ 1F4KA 1GE9A 4AU7A 3HOTA 1WRJA 1BIBA 3WE2A 3F0CA 3RZOC 4N4NB 2K40A 1YI2I 1ORKA 3HOXK 3M3YC 3CJQB 4BE2A 2H27A 3OR1C 1U5TB 2PQ8A 2Y9YA 4XOPA 2ZJ2A 4HLXA 2X9DA 4HNUA 3V42A 2F4MB 3K0LA 3WGHA 1IZ1A 1Z77A 3JW4A 4A3GC 4RAGA 3SZTA 4ABZA 1UELB 1EH8A 2Y31A 4P5AA 3U1DA 1QBJA 4L18B 2G9WA 3LFKA 1B9NA 1OMIA 2DPDA 3QU6A 1ENHA 3R61A 4YFKF 2GIZA 1SFOA 3K4NA 5BNGA 4ZZLA 1H89C 3FX3A 2KZGA 2DW4A 3BR0A 1MGTA 3I4MK 1YX5A 4RGSA 4A93J 3S15J 1XMKA 4BQNA 5M5XJ 4WXDA 2A61A 4P9UA 3ERMA 3S14K 1X58A 3KEQA 5FO5A 1A35A 1YE9A 4BDYA 1D5VA 1UG0A 1TWAK 1PYVA 2MFZA 3WODF 5JHFA 2E35A 2PMUA 3BJOA 2V6UA 3S1RC 1USOA 4C30A 3CO6C 3KZIC 2Y9ZA 2G7HA 2UV1A 1G8XA 2PA8L 3DEEA 1A36A 4BY1C 1WQFA 2JA5C 3OWTA 5L3FA 2E2IK 1Z0XA 4KMUA 2DMNA 3WTVC 1KGSA 4HDUA 3HSFA 4MQ9F 3BUEA 4LK1F 3RPQA 3GTJJ 3K10A 4AIHA 4BKWA 1IV8A 4RAZA 1KYWA 1IUFA 1WHUA 1Z1DA 1U5TC 2E5NA 3CCVI 4GTCA 3HKZN 2JA7J 5F0CA 1GV5A 2JUGA 4FISA 3S17K 3WG7H 3ZN0A 1TWCK 2Y0SL 1SAXA 2NXNB 3E1SA 4Y4RA 3OIQA 3CCEI 4BXXC 2M4KA 2Z5UA 3CDIA 4RBOA 2LC2A 1EH7A 1IXSB 2E2IA 1Z3XA 5H6RA 1D0YA 2R7WA 3A01B 2ZXHA 2DOAA 2JTVA 1X1CA 1I1GA 5KCMA 5C4JK 3REOA 5TGTA 1WZ2A 3H1CA 4YFKA 5ICGA 1FT9A 3CC2I 3GLLA 2LLKA 3BG7A 4IXAA 4N9IA 2VPRA 3S16C 2R7OA 1V55H 4WX9A 1SFOC 3UNGC 2Z2SB 4NQWA 1DP3A 1TWCA 4XKVA 2WAQA 4MTEA 3OREA 1OYYA 1XG1A 4IRHA 1MMGA 3BJ6A 2JA8J 3WODA 4O2DA 5LEKA 3HOXC 5DM7F 2VIXA 4QIWN 1FOKA 3D0SA 4KN7X 5AIQA 2HVQA 1B4BA 3S32A 1SMYF 3A4CA 1SD5A 4NQWB 4I7HA 4XOTA 4B09A 4B3XA 3OY9A 2E2JK 2FOWA 4IKFA 1IL2A 1WCMJ 3KIOA 2EBIA 2DK8A 2IAIA 3CMYA 4MQ9A 1U9OA 4LK1A 4BEHB 4QJVA 1W0TA 2HOAA 4FTHA 1YX2A 5HNHA 1G2HA 2V6SA 3I4MC 1QZZA 5EJCA 3BY6A 1H9TA 4M3GA 3F9KA 3MZHA 4J01A 2IEKA 2R93J 3W2AA 4B8XA 2R7TA 4EJUA 4QLCU 4GZYA 3S14C 3JRCA 1TWFJ 3WTSC 5GP9A 3ZGKA 3OSFA 4RLQA 1JE8A 1SFXA 2FNAA 4QJVB 5DS9A 2WB1D 1O29A 1TWAC 4OIQA 3AKZA 2ZUFA 4C2UA 1NK3P 3HGYA 2NVUB 4C3IJ 3RYRA 1X19A 1I6HJ 2A68F 2K27A 1LE8B 2OTLI 3DPUA 2Y0SA 1F7UA 1S5LC 2XAJA 3WU1B 2Z33A 5TRDA 1VH2A 1V5GA 4E7KA 2FQTA 3EUHA 3QYBA 2E2IC 1TQPA 3QPLA 4F92B 4XKWA 4XLEA 2O61A 5D5WB 2QQ8A 4Y33A 1YIOA 2RGVA 4Y13A 2K9LA 3CQZJ 2GA2A 4BE0A 5LD2C 5A2QZ 1YITI 3SZYA 1X4OA 1HW5A 2KMUA 2W00A 1XZQB 5TMCA 4XKBA 2F48A 3GTKA 1RKWA 5HLHA 2MH2A 5CHPA 5BMZA 3S17C 4RLFA 1JKRC 2R5ZA 1NG6A 1OJLA 1TWCC 2RNGA 4P5BA 1JVIA 2E1MB 3GEEA 3BC8A 3PUFA 2L9NA 5HDNA 2DT6A 4AD9A 2QKLB 5CYVA 3H92A 4GTEA 4L9JA 2NVXK 2A6TA 3I4NJ 1Y56A 3X2QH 4DNCA 2HFHA 5D6EA 5F08A 5L3GA 3GTOJ 3K4JA 2V6CA 3OS0A 2XGDA 5C4XK 5C4JC 3T00A 1JKQC 4ZTFA 4GTDA 3L2WA 1J98A 3E5QA 1ZLKA 5JHUA 2KIMA 4XONA 1TWHK 1S7EA 2PN6A 3VYSB 2HZTA 3GTGK 5J8CA 2NNNA 1Y1WK 1FYKA 1WJBA 5EGHA 1IN4A 3ZQHA 1X1AA 5M5WK 2WV0A 3W6JB 3IL2A 2UZKA 1HW2A 3NUHA 1F93A 2GAGC 4JK1A 4A3FK 1OYWA 1V5VA 1XX5A 4D7NA 4P5OA 5IOQA 1WQHA 1BGWA 4C9YA 2L4AA 2VQGA 3JSTA 4XLHA 3HIFA 3OL4A 1XPXA 2FBHA 2E2JC 4LG0B 2TDXA 3CD6I 3JRBA 1ZREA 1I1SA 3PO2K 1WJAA 1B6AA 4L5IA 3LSTA 2ZMEA 1TWHA 3H36A 3GTGA 3B6CA 2R7RA 1NG7A 1P4WA 1Z3YA 4YFNF 4UUVA 5IYBJ 2E1MC 2PBIA 3RKYA 3LSGA 4G9YA 1S72I 1SFUA 3H3VK 1B59A 3ECHA 4B47A 3CCLI 1AA7A 1MH4A 5CLSA 2JSCA 2VL8A 4OIRF 2V6EA 3AQPA 4M3BA 1XS9A 5E18F 1VQPI 2DFFA 4BBSJ 2KL4A 3L4JA 2ZMEB 3K7AJ 3IPJA 2LREA 5GTIC 2HKOA 1PJ5A 4QPOA 4A0YA 4BHPA 5KAFC 2W25A 1O3SA 3PNTA 1EI6A 1PP8F 5DTDA 4KMUX 1WH7A 3TW7A 3DP7A 4BBRK 2FA5A 2D45A 1IS1A 1X1DA 3G4AA 3G2BA 3C7JA 3K9TA 3QQAA 4HF1A 2CUJA 5TMFA 1L0WA 2CO5A 2QVOA 1IGNA 2XRLA 3H5RA 1MMAA 1LVKA 1ERDA 1HSTA 5F04A 3S2WA 3AD8C 3I54A 3S2HK 3LOCA 1OR7A 2L0KA 4IJAA 5L3EA 3CF5F 1K83K 2EFWA 1WOPA 2E71A 3GTLA 3GTPK 4LITA 3OYEA 1XDSA 2K4JA 2ZO4A 3PJRA 1SEUA 2H6CA 2W84A 1VNDA 2VBXA 1RESA 2ADUA 2QEXI 1U3EM 5IT9Z 2LTPA 4Y17A 3KP4A 5AIPA 5FROA 4Y7NJ 4U0VA 3E6CC 2RDPA 2Q0OA 3HOUJ 1OCPA 2CQQA 1T6SA 4WILA 4LK0F 4M9XA 3MZ8A 1IW7F 1QVUA 4I09A 2NVXC 1UFMA 3TGNA 4HDVA 1P92A 4UVAA 2EWNA 4R79A 2WB1L 3LA3A 2W7VA 1FIPA 3S2DK 3D5RC 3F23A 2E2HJ 3RKWA 3GDZA 2P81A 1MD0A 4YFNA 1WPKA 5L3DA 1USMA 3L00A 3J81Z 4E7ZA 1JGGA 3HOYJ 1TWHC 1K83A 3GTGC 3GTPA 5JVOA 3OOPA 2P8TA 4P96A 5FLXK 1WSRA 4IF4A 2UXXA 1Y1WC 5K5RA 2BOLA 4OIRA 3BOQA 3DTKA 1DGRM 1O28A 1X4PA 2DFHA 3CLQA 5DV5A 5J4VA 3BR6A 4G12A 1Y6IA 4BJ5C 3AQOA 3TO6A 2VBYA 4NHJA 4A3FC 1XC5A 1W5CC 3I0TA 1I50J 1DU6A 2GOMA 1X2MA 1T39A 5JR3A 1C0AA 3HXLA 4G0VA 4RB1A 1UG2A 1LPQA 1ETYA 1QHGA 1GVDA 1USSA 2QWWA 3KP2A 4IHVA 3BZCA 3DLLF 2FQ4A 4GCVA 4PFOA 3PO2C 3KLNA 3VB2A 1JHHA 4CUGA 3N3YA 4A3JJ 1JUMA 3LNQA 3HOSA 3P9KA 3CUOA 3OYJA 2KPMA 2P4WA 3K4KA 1YIJI 4NUBA 1STZA 2QYOA 3GTKJ 5C4XC 3T5XA 4EJWA 4AH6A 4U0WA 3T8TA 2XB0X 4IQJA 3HEFA 1OR7C 2D1HA 2MG4A 4KDPA 1PJ7A 3RKXA 1K4SA 4D9JA 4HSTA 2VB6A 2CSOA 3ZQFA 3S1MJ 3L2CA 1U0JA 4LK0A 2E7WA 2OQRA 5JFEA 2X51A 2X85A 1MBJA 4WK8F 1IW7A 3FKIA 3RDIA 3RIRA 3TTGA 4IHYA 2JZYA 2KT0A 3JR9A 3BTCA 4IL6C 2V1XA 2HNHA 4BBRC 1BR2A 3I71A 2XGXA 3CF2A 5FLMK 2YSRA 3H35A 4B1RA 4KA4A 5FRNA 3A0HC 1VQ4I 1HQCA 2G7UA 2L7KA 3HOVK 2PMZA 5TISC 3CP8A 3R6SA 5HVQC 2BHZA 2QKMB 4XKCA 2WAQN 3WU0A 3S2HC 3JRIA 1N75A 1NH3A 4NOIA 2DTRA 4KISA 1K83C 2ZUEA 2BXZA 5BPDA 2WB1A 3GTPC 2FX0A 2Y69H 4OMYA 1VQMI 4WCGA 2ZJQF 4UUSA 3QPHA 3OOUA 1OLTA 4IHTA 2A05A 1X3ZB 4V2FA 4DZJA 3ABUA 3GYHX 5LHGA 1HLVA 3GIRA 2DDAA 1A5JA 3HUGB 3CCSI 4DYCA 4HAMA 3H0GK 1WJ5A 2IA1A 2CQXA 3JRAA 2NS8A 2FU4A 4MIMA 4GO1A 3TL4X 4A6DA 2L2OA 2BY1A 3SQNA 5ICFA 1RKTA 5DCFA 4E70A 4EM0B 1G59A 3S2DC 1YQAA 3IP4B 3J80K 2LF8A 1ETVA 4F55A 3WTTC 1CGPA 4LGWA 2BXYA 3M7GA 4L9TA 1UHSA 1QQIA 3BTLA 4PK4A 2R7FA 2RVCA 2EILH 2OU2A 2VI6A 5J4YA 1WGXA 2MD5A 4L0YB 3W2VA 2NVYK 1J5YA 1E17A 3I59A 1SANA 3KYCB 1D3YA 1V5FA 3GEHA 4BH9A 1DCOA 3I64A 5B1BH 3SZPA 1H9GA 1NHAA 3M4OJ 5ICCA 4KB4A 2ME0A 3H0GA 2DT5A 3E3VA 2K3FA 2NAZA 2DBBA 5E17F 2ICWG 5D8KB 2HKXA 3K70D 1S7OA 1WSUA 3BJAA 2FMLA 4RM3A 1MSFC 3T0YA 2DOEA 2HYJA 3RQIA 1X1PA 1MJBA 2EFNA 3CCMI 3D5LA 4L9NA 3CP2A 2A69F 2PG4A 3FK6A 3GTLJ 2J5PA 2XF7A 3JAMZ 4Y3OA 2L7FP 2KZVA 5IT3A 2NVYA 2B7EA 5FJ8K 2EV0A 3E6BA 2WTEA 1USTA 5D5UB 3LPXA 3SYTA 4DDQA 1EJ9A 4A69C 4M74A 2R92J 4KT6A 3F72A 4PJLA 4ZYHA 5ILVA 4LD5A 5EEAA 4IQ4A 3I9V2 1RUOA 1JXSA 2Z99A 1ZQ3P 3RZDJ 1T33A 4V19K 4YELA 1LEAA 2H1KA 4M3EA 2Q2EA 3WGGA 5M3MK 5DUKA 3A1YA 4H4KC 2OQGA 2JUCA 3FXJA 1ZKGA 4CCKA 1O27A 5EEGA 3HOWJ 1ZYRA 4A3KK 2XF5A 2E7XA 2HPIA 2O5RA 4KN7A 2IS6A 2OAZA 5FLMC 1BR4A 2Y3PA 1QHHD 4A5NA 1F7VA 4MFDA 1JUSA 4KFCA 2KHMA 1TNTA 2B63K 3HOVC 2Q2EB 5C3EK 2RNJA 4D5FA 1S6LA 2O0YA 2XB5A 3BP8A 4R1HA 3WTZA 3LAJA 4LB5A 1KU2A 2VQCA 1UHWA 3DKYA 3LSRA 4BNCA 5CVVA 4HX8A 3BDDA 3FXUA 1FSHA 2VN2A 4MEXA 5IP7J 4KARA 3DBHB 3O8HA 4CSWA 2WY7Q 3F8BA 5IOZA 4BUPA 2MC3A 5LLQA 4BY7J 5LRRA 2HGCA 2E36A 5CVUA 4AWXB 5LFAA 4A0XA 4UVBA 2COBA 3MKLA 4WXHA 4BL0B 2R0QC 3E5XA 1R1TA 2GOXB 1BI0A 2LBFA 1Q1VA 3GTMJ 1BS2A 3LSJA 4BXUA 3H0GC 4A3CK 2R4GA 3BQYA 3DU6A 3ZR8X 1ITYA 3KZZA 3HOZK 3ABKH 3S93A 1CF7B 2B63A 2HQ5A 3BCAA 1IRGA 2A69A 5TJJA 3B73A 3ABMH 4GRIA 1LDJA 3OYNA 3BG5A 3OYHA 1YW9A 2I5UA 2K9SA 2LBFB 1KQ9A 2MA3A 1RPWA 3VA7A 1MJAA 1MMDA 4E7SA 4U7DA 2ZFUA 1YHQI 4A3DJ 2UWMA 2P6SA 3ADAC 1VLOA 2R7ZC 2QGUA 1WI9A 2XGCA 2NVYC 3Q0VA 1J6WA 4C3HJ 2GAHC 2KRFA 1OQYA 2XUBA 1R9TJ 4GTBA 2HYFA 3FKIJ 3HGGA 4HZFA 4IZZA 4Y52J 2QSFX 4G6DA 2AQEA 3QOPA 3CC4I 2VBZA 3PNVA 3E6MA 2H94A 2FQ3A 5DD8A 3E5UA 3S3OA 3FK7A 4Z2YA 2V6TA 4IO9F 2JA5A 2QBYA 1AOYA 4XLPA 2L9RA 1B9MA 2P5LC 4M72A 3ZQQA 4KITB 3GFJA 5ILSA 3ROUA 1K4TA 4MLOA 2E34A 3E7LA 1REPC 2BV6A 2ESHA 4I0AA 2MYSA 4IPAA 3RI4A 2OJED 3SZGA 4A3LJ 2BY0A 2VODA 2ZNYA 3PIPF 4YIRX 1U5TA 5M5YJ 2GXAA 2QBYB 2W57A 3NAUA 4CCOA 5B66C 1EA3A 4CCJA 3K1NA 3W3CA 1OISA 1G3YA 3CCYA 2HOSA 5LEJA 1D0ZA 2I8DA 2CFOA 2M9HA 5HLTA 2YU9K 4KIFA 2R7ZK 3E6DA 2LK2A 5K5OA 3COAC 1HKSA 5E3OA 2IJLA 2OBPA 2WA0A 2K5CA 2HYGD 3BTIA 3JSOA 4A3KC 2BW3B 1F43A 4XRSA 5ERIA 2EA2A 2MGQA 4FHTA 2DJIA 2DTZA 4O5VA 4N4OB 2JT1A 3GVAA 3PL8A 2B63C 1FJLA 1I39A 2A6EF 2ELHA 2F4IA 5EGOB 5C3EC 2EA4A 2AO9A 3V8JA 2FE3A 4DIQA 3SZZA 1DQUA 2WAEA 3B6AA 3CZ6A 2JSPA 3G3ZA 3L7WA 1W4MA 2NVTJ 3H3VD 1WQGA 2BEOA 3V7RA 1IXRC 1FP2A 5M3FJ 1YRNA 2YU9A 1ZLJA 3ZOBA 4H0EA 3SJMA 2R7ZA 3EQLF 3ZQLA 3GBGA 2A07F 3C18A 3VPRA 4A3IJ 1FP1D 4XSXA 3IWZA
chains in the Genus database with same CATH topology
3SFZA 2F2EA 4LLGF 3OV8A 1T38A 4RB0A 2VONA 2QQBA 5CJ9A 1WIHA 4BAYA 4ENKA 4KB2A 1FZPB 4HLYA 4AVPA 2LNBA 4CICA 1H0MA 1QGPA 1RI7A 5H20A 2M87A 2V9VA 1TWAA 4ENNA 1XGMA 2FBKA 3LWFA 2DO7A 2L3DA 4RB3C 2PI0A 1IUYA 4ZYGA 1WQ2A 3L09A 3P9CA 2KJCA 3MZYA 4IRGA 3H3ZA 1WKMA 1BI3A 4G7HF 2K86A 4HV6A 4U7BA 2A3SA 4KNYA 4PDKA 3KP7A 2IT0A 4KYWA 3DF8A 2MH9A 3IC7A 4HV5A 4KC6A 4UV9A 4BQAA 2ZFWA 4G94A 2W85A 2YU3A 3NEUA 3KZYA 4ESJA 4BHBA 1O3TA 2ZNZA 4ENMA 4WWCA 1Z7UA 3F22A 4RGUA 1VTNC 1OYIA 1LVAA 1J0RA 3R4KA 4CXFA 3BWGA 2Z9OA 3HSRA 1IN6A 1LB2A 1LQ1A 3F8CA 1UB9A 4M1XA 4EM1A 1KU3A 3F3XA 4ENJA 4HYEA 1R36A 3F21A 3MCZA 4ESBA 4KUMA 1B4AA 1J2XA 3FOEA 3RTRA 1TW2A 4IRIA 3HRUA 4P55A 1G3WA 3GXOA 4M9SA 5BPIA 1SFEA 5FGMA 1QO0D 1FYMA 2XRNA 4R8HA 4HQEA 2Q8KA 5F1RA 4KASA 1P2FA 3MAJA 1LJ9A 4XLNF 1QNTA 5K5QA 4HBLA 3GO5A 1T0FA 2P5MA 3E97A 3MEXA 4HW0A 4G7OF 2ETHA 1RUNA 3GTQA 1KYZA 5D4SA 2EFQA 1XCBA 1O25A 1ZHFA 2IP2A 3EYIA 2L01A 1ISEA 1A04A 2XHKA 3GF2A 2H6BA 3Q3QA 3DPLC 1J59A 1Y1VA 1K78A 4M73A 4YIIA 4XBFA 3TQNA 1W7PD 3K69A 4WXCA 2FSWA 3I53A 4CZZA 4LG0A 1DDNA 5L3BA 1I27A 3U9GA 2VOOA 2NVXA 1RZ4A 1K78B 3FM5A 2KJBA 2XASA 2GXBA 5KVRA 5FFZA 1GVJA 4AIKA 2XIGA 1O57A 1Y1WA 3ZMDA 1KU7A 2QENA 2DFIA 3GUDA 3V8KA 4I02A 3TOBA 3EYYA 1EH1A 4GTLA 3S0XA 4G7ZF 1XD7A 2P5VA 5HDGA 1WWXA 3EDPA 2VE8A 3TDUC 2L54A 1G3TA 1I5ZA 2VC0A 3HYIA 5KK1A 2QUFA 3M1EA 4LLLA 1E2XA 4BLAA 3G73A 1YYVA 5BQTA 3W6KB 3ZMVA 3P7NA 1AB4A 5HS9A 2VE9A 3NRVA 5CVJA 3HHHA 1P6RA 5DCMB 2Y0MA 2DQLA 2EFPA 2OZ6A 3QRFF 4RB2C 1SD7A 1YLFA 2IA2A 2D1VA 4RAYA 2QQAA 1TW3A 2EB7A 5E8GA 2BBYA 2COMA 4KT5C 2IPQX 3NQOA 4G0UA 4C3JC 3B02A 3MWMA 3FOFA 4Q5SF 5IOTA 2R7DA 2XKOA 3CAGA 5D6FA 2XAHA 5HOOA 3BZ6A 1X3UA 2RH6A 3R0JA 3DXJF 3CJNA 3HRMA 1P4AA 3DV8A 3MQ0A 4EM2A 2FXAA 1V4RA 1XGNA 3IRQA 1RNLA 2HEOA 3U2RA 1KQ0A 1UCRA 4U88A 2YX7A 3C1DA 3QAHA 1KU9A 1FBUA 1D8KA 1XSDA 1L0OC 1Z9CA 1OKRA 1R5GA 4LMYA 2A6HF 1TWGA 4KM9A 4UVCA 2FRHA 3LQRA 2GZWA 1MJ9A 3HUGA 4HOBA 2CGPA 4A12A 4HQMA 4JBAA 1XGSA 2M45A 4D0PA 2F5EA 3I5UA 3V7CA 3WGIA 2P5KA 5LRSA 3MFKA 1G6NA 3GFMA 3KEOA 3Q5FA 1ZG1A 4L9VA 3F8MA 5H6QA 4OIOF 2STTA 3F8FA 3GX4X 3KCCA 5L3CA 1XMAA 1R5HA 2HR3A 2JPCA 4ZYEA 4EQQA 3WE3A 5D4RA 3VFZA 3IRRA 4UHTA 5HLIA 3TO9A 2L4MA 5ED4A 5CVRA 4YFXF 2LF7A 4ZZDA 5FFXA 1YTYA 4ILDA 2NS0A 3CLOA 2XAGA 3PQJA 1XXAA 4MTDA 5BOXA 2CW0F 4Q4ZF 1S7AA 5E20A 4CGZA 4MEYF 2L02A 2BYVE 4WF2A 1ULYA 4HX7A 1W7PA 4I98B 3KP6A 2DLLA 2WWYA 3GLXA 1SMTA 5LGTA 1ZARA 4MQVA 1LDDA 4DQ2A 1W7PB 1BI1A 3WTYC 2XCQA 3TOAA 1ZRFA 4BYYA 1IF1A 3ABTA 4C2MC 2QLZA 1ONVA 1XDUA 4G8XA 3ZMUA 4RGRA 3LA7A 4G0WA 3GTJA 4FX4A 1G4DA 1J75A 2F5DA 2A5YB 3ZMTA 2F5CA 2W24A 4Q48A 2GIVA 1QPMA 4ZH4F 1CF7A 3LA2A 4UV8A 3GW2A 3BROA 2KWAA 4OIPF 2B0LA 1KQ4A 3LQQA 2IVMA 3I4PA 3OPFA 2OA4A 1S3JA 4LR2A 2FNPA 5FLXZ 1BN5A 5HLGA 3V4GA 5JI6A 1GXQA 1PUEE 2ZCWA 1SD4A 2HOEA 3O2PE 3FMQA 2DI3A 3O6BB 3GFIA 1IRFA 3FM3A 2VC1A 3WG9A 1O24A 4FZBA 3V8LA 2PEXA 1ON2A 4UXNA 2GQQA 2QQ9A 1U6GA 2BGCA 3ZQ7A 5HS8A 2ZFZA 4KMAA 2O3FA 1TQMA 4BLBA 5D8LB 5JVTA 1HSJA 4HX4A 2PFBA 1B1BA 1FPQA 1DD5A 1AWCA 2AXLA 3FXRA 1Z05A 4Q47A 2R93A 3C3WA 4KM8A 5A2QK 3F8NA 1MKMA 1J9IA 4OMZA 2P6TA 1K79A 3VOEA 4GYIA 2RQPA 2C6YA 5LHIA 4O6JA 3CUQB 1BJTA 3PFIA 2QZ8A 4KIGA 2V79A 3VEPA 2NYXA 3L9FA 1R7JA 2X4HA 5ICEA 1G3SA 1O7FA 3N0BA 1HKQA 2VXZA 4EGYA 3HRSA 3ZMSA 2OD5A 2GAUA 1ZRCA 2KKOA 3CDHA 1RIOH 3HTUA 1R23A 2VT2A 3J80Z 2GSOA 3GTOA 4LLNA 3ZMZA 1EK8A 4A2UA 3SHFA 2P7CB 1TBXA 2GSUA 4ZYDA 1R22A 3FXQA 2YX4A 2EJRA 3GZ6A 1O2BA 1BM9A 2HWVA 4FT8A 1Z6TA 3DEUA 2DQRA 2M30A 3CUQC 4N0BA 3J7AO 4RS8A 4KIBA 3DKWA 3KP5A 4C3IC 2HQRA 1BBYA 1LDKB 2XCRB 4UNOA 1F1ZA 1EV7A 2KIFA 2RGRA 1EH6A 2HTJA 4OU0A 2RKHA 1BIAA 1LEBA 1V3FA 5IORA 2BE5F 3GFLA 2HTSA 2Y48A 2O6GE 1S29A 2XVCA 4ASNA 3H3UA 2M1BA 4KMFA 2PMHA 4OIQF 2UXNA 3CO7C 1XB4A 4TV7A 2R3SA 5IT9K 1ZG3A 4M6YA 1DPUA 2CYYA 1ON1A 1BJAA 3BPXA 2FBIA 3HSEA 3Q9VA 3ECOA 3FHZA 4RGXA 3JSPA 3ZPLA 1OPCA 1R58A 2XV4S 4M9ZA 3VODA 3K1PA 3N0CA 1O2AA 5DUIA 2OZUA 2CG4A 4IVNA 2IA0A 1HXDA 5LHHA 5K1YA 4M6XA 4KATA 2M8EA 2FOKA 5DEQA 3J81K 5F64A 3BPVA 1DUXC 1MZBA 3WTWC 1GHCA 5J8FA 4S05A 2ESNA 5F6FA 4G6QA 3CTAA 3N4MA 4I01A 2VBWA 4L0ZB 5HS7A 2E2HA 1BC8C 2CWEA 4QWQA 4LB6B 1D8JA 2JH3A 2V1DA 1FSEA 3I58A 2JA6A 3T8RA 2DAOA 1O7LA 3GZ5A 2E1NA 1BOAA 3K2ZA 1I50A 3JTGA 2PJPA 3QP5A 3QP6A 1PP7U 1P4XA 1T2KA 3RYPA 5IOSA 2LKPA 4K2EA 1O3QA 4HA8A 2CFXA 4KDDA 2XCOA 1YS7A 2DU9A 3FWEA 1ZGJA 4EJVA 2K4BA 2GSNA 1U2WA 2RC4A 1TLHB 5LGNA 1FNNA 5FD6A 3ZN1A 2EV5A 2HDCA 3K1MA 4GT9A 3OEPA 2GWRA 3AAFA 5D5XB 5E1WA 1Z91A 2YR2A 4XRFA 3HRTA 1IXCA 1BC7C 1K6OA 1ZGAA 3IKTA 4YG2F 1W5SA 4GGGA 4PGHA 2D2WA 1L3LA 3FF5A 3KFWX 1SD6A 5EEHA 1U78A 4GYGA 2DPUA 3GEZA 4KAWX 3R60A 1YS6A 4A0ZA 1W5TA 1YO5C 1R1UA 3ML6A 4KN4X 5DCMA 4XSZF 2LSOA 2EFOA 1HBXG 4J3NA 2FEZA 3JAMK 4CDGA 2YPRA 1ZG5A 1ODDA 1ZH5A 3MMLB 4LQYA 2K7LA 2MLGA 4GFQA 5HDKA 4NB5A 3KETA 1HKTA 3L4KA 4I2OA 3FMRA 1GXPA 3QPTA 3SXYA 1JHFA 4O3MA 1FYLA 3DQVC 2X0LA 1R1VA 3FMSA 2E1CA 2R92A 1JGSA 2VUMA 1FC3A 1I3QA 3LAPA 4M71A 1FY7A 5FB2A 1Q1HA 2Z3YA 2XAFA 5FD5A 1KQ8A 6PAXA 5TJ3A 1XSXA 1XCVA 1XXCA 2XROA 2O8XA 4LJZF 4P9FA 3ZP5A 2ISZA 2VT3A 2K02A 2M5WA 2GA1A 3WTUC 4N9HA 1ZXOA 2PHCB 3P9IA 1T98A 3KE2A 4HF0A 2EK5A 4OINF 3IWFA 5AONA 2V1UA 3IKVA 3TO7A 1KA8A 3M8FA 2ZXJA 3FZVA 3GTMA 1HW1A 1J7KA 2GXGA 2ZBKA 1XSVA 3ISPA 1C0WA 2RN7A 5E1XA 1FWZA 1IAWA 1DPRA 2J5OA 1K7AA 4PGGA 1S8NA 4EJOA 1MDMA 2DK5A 5DD4A 3TKYA 4EVIA 1R9TA 4EJTA 5D5VB 1XGOA 3IHUA 4ETSA 2JRTA 2MLKA 3F6VA 4ON0A 4OOIA 2O03A 1MDMB 4CHUA 2NNYA 2CFAA 3V7SA 1XN7A 1YW8A 2EV6A 3WTXC 2HS5A 2XAQA 1ZRDA 2MBFA 4U0YA 2CFAB 5E1ZB 3Q9SA 3HTSB 2ZKZA 3TDZC 1F5TA 1TTYA 4IHSA 4CO8A 4A5MA 5J6XA 1BI2A 1ZYRF 4PZJA 1UHMA 2JPBA 1FLIA 5EGEA 4PCQA 2FF4A 3KLOA 4MEXF 4JK1X 4FX0A 1YW7A 4S04A 3RPUA 4C3HC 4MHGA 5CVIA 3T1BA 5LBQA 3I59B 3JTHA 2KIUA 4EMSA 1O3RA 3DPTA 1TQIA 2F5FA 1FBQA 2QM3A 4HF2A 1YFHA 2PLYA 3QX3A 1Y0UA 2XKPA 2RV8A 1PDNC 2JA7A 2ACJA 2Y75A 4LFUA 5LGUA 4BHCA 4EGZA 2FMYA 4ESFA 1U8RA 4I0BA 4XLPF 2WC2A 2STWA 3RJPA 1DP7P 4KMHA 4KICA 1IN8A 4GTFA 1FX7A 2HQNA 3DFGA 1I6XA 1LNWA 2IRFG 3N97A 1F9NA 2VOPA 5JFRA 1TNSA 4CYDA 4EV0A 4KMDA 4MNUA 3G4CA 2P7VB 1XXBA 4YIFA 3O3KA 4Y15A 3EETA 1Z6RA 1ZN2A 1ZBSA 1YG2A 3ERED 5DDGA 3KP3A 2NRAC 4JQFA 3ULQB 3GWZA 1IN5A 1WCMA 5BS6A 5E8IA 3QU3A 4A6EA 2CQKA 2IW5A 3M8EA 4L5JA 5ILUA 1QZYA 3ELKA 3F6OA 3AH5A 1TWFA 1IN7A 3PQKA 4FM9A 3CUQA 4AIJA 1R00A 4XSXF 2ISYA 1O26A 2H09A 1ZVUA 1FBSA 4GTAA 4GXOA 2AS5F 1ZAOA 4MGRA 4F7ZA 2LDUA 3R0AA 3CQZA 5DYMA 3M9AA 3HHGA 1F4KA 1GE9A 3HOTA 1WRJA 1BIBA 3WE2A 2H27A 1U5TB 2PQ8A 2ZJ2A 4HLXA 3K0LA 3WGHA 1IZ1A 3JW4A 3SZTA 1EH8A 4P5AA 3U1DA 1QBJA 4L18B 2G9WA 3LFKA 1B9NA 1OMIA 2DPDA 3QU6A 3R61A 4YFKF 1SFOA 4ZZLA 3FX3A 2DW4A 1MGTA 4RGSA 1XMKA 4WXDA 2A61A 4P9UA 3KEQA 5FO5A 1D5VA 3WODF 2PMUA 3BJOA 3CO6C 2G7HA 1WQFA 5L3FA 3WTVC 1KGSA 4HDUA 3HSFA 4MQ9F 3BUEA 4LK1F 3RPQA 4AIHA 4BKWA 4RAZA 1KYWA 1Z1DA 1U5TC 4GTCA 3ZN0A 1SAXA 2Z5UA 1EH7A 1IXSB 2E2IA 5H6RA 2JTVA 1I1GA 3REOA 5ICGA 1FT9A 4IXAA 4N9IA 4WX9A 4NQWA 1TWCA 4MTEA 3OREA 1OYYA 4IRHA 3BJ6A 5LEKA 1FOKA 3D0SA 4KN7X 5AIQA 1B4BA 1SMYF 1SD5A 4I7HA 4B09A 2DK8A 1QZZA 3BY6A 1H9TA 3MZHA 4B8XA 4EJUA 4QLCU 3WTSC 1JE8A 1SFXA 2FNAA 1O29A 3RYRA 2A68F 2K27A 3WU1B 2XAJA 2Z33A 5TRDA 3EUHA 1TQPA 2O61A 5D5WB 1YIOA 2RGVA 4Y13A 2GA2A 5A2QZ 1HW5A 3GTKA 5HLHA 2MH2A 5CHPA 5BMZA 4P5BA 5HDNA 4AD9A 5CYVA 3H92A 4GTEA 4L9JA 4DNCA 2HFHA 5D6EA 5L3GA 2V6CA 4GTDA 3E5QA 1ZLKA 5JHUA 2KIMA 2PN6A 2HZTA 5J8CA 2NNNA 1FYKA 5EGHA 1IN4A 2WV0A 3W6JB 3IL2A 2UZKA 1HW2A 3NUHA 1OYWA 4P5OA 5IOQA 1WQHA 1BGWA 2L4AA 3HIFA 2FBHA 4LG0B 2TDXA 1ZREA 1I1SA 1B6AA 4L5IA 3LSTA 2ZMEA 1TWHA 3GTGA 1P4WA 4YFNF 4UUVA 2PBIA 3RKYA 4G9YA 1SFUA 1B59A 3ECHA 5CLSA 2JSCA 4OIRF 3AQPA 5E18F 3L4JA 2ZMEB 2HKOA 4A0YA 4BHPA 2W25A 1O3SA 1PP8F 4KMUX 3DP7A 2FA5A 2D45A 1IS1A 3G4AA 3K9TA 3C7JA 4HF1A 2CO5A 2QVOA 1HSTA 3S2WA 3I54A 1OR7A 4IJAA 5L3EA 3GTLA 2EFWA 1XDSA 2K4JA 2ZO4A 2H6CA 2W84A 2VBXA 2ADUA 1U3EM 5IT9Z 4Y17A 5AIPA 3KP4A 4U0VA 3E6CC 2RDPA 2Q0OA 1T6SA 4LK0F 4M9XA 1IW7F 4I09A 1UFMA 3TGNA 4HDVA 1P92A 4UVAA 2EWNA 4R79A 3LA3A 3F23A 3RKWA 1MD0A 5L3DA 3L00A 3J81Z 1K83A 3GTPA 5JVOA 3OOPA 2P8TA 4P96A 5FLXK 4IF4A 2UXXA 5K5RA 3BOQA 1O28A 5DV5A 3AQOA 3TO6A 2VBYA 4NHJA 3I0TA 1T39A 5JR3A 4G0VA 4RB1A 1USSA 2QWWA 3KP2A 4GCVA 3KLNA 3VB2A 1JHHA 3N3YA 3HOSA <