3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
b'AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
2XKOA 3LQRA 4Q47A 5L3BA 3I64A 2W25A 2GXGA 1KYWA 1TW3A 3QU3A 3WGIA 2QQBA 2ZXJA 1HXDA 1FOKA 1FT9A 1BBYA 2B0LA 4ESJA 1SD6A 3R0AA 2F5CA 3QAHA 4K2EA 5LRRA 5EEHA 2M8EA 4Y13A 3MQ0A 4EJOA 3WTUC 2IA2A 3I5UA 2FEZA 3JSOA 1XGMA 3ECHA 1WIHA 2GIVA 5JVOA 4OOIA 2RDPA 2PFBA 4ZYGA 3BDDA 4JK1X 4L9NA 3DFGA 3ERED 4YIIA 1BI3A 2HTJA 1V4RA 4KFCA 1FWZA 3MMLB 4M73A 3JTHA 3SXYA 5JI6A 1AWCA 2HS5A 2HWVA 4KMUX 3L00A 3TQNA 5D8KB 4RGRA 5AIPA 1HKSA 3HTUA 1QZYA 1DUXC 3HIFA 3J80Z 2TDXA 4BHBA 3EYYA 2X4HA 1Y0UA 3W6KB 1BI0A 2YU3A 3QX3A 4IRGA 2FE3A 2L02A 2FBHA 2A6EF 4BYYA 3U1DA 4EM0B 4HW0A 3DV8A 4LLNA 4Q4ZF 2D2WA 2Y75A 1Z91A 3WU0A 2Y48A 3K9TA 1P4WA 1F1ZA 4HV6A 4EMSA 4IJAA 2CO5A 2HKOA 4LJZF 3GX4X 1IXCA 1I1SA 4ENJA 1G6NA 3F21A 3TDZC 3DQVC 1W5TA 3QPHA 3PFIA 4P9UA 4JQFA 1TBXA 1O7LA 3ABUA 2VXZA 5LHGA 4GYGA 5IT9K 4N9HA 4FX0A 4YG2F 3K1NA 1YW8A 5EEGA 2DK5A 3KP2A 1T98A 3IHUA 3BROA 4IHTA 3EDPA 4NB5A 5IT3A 2P7CB 2QQ9A 2XIGA 1SMTA 2EFQA 2GWRA 4P5OA 2FBKA 4HF1A 3HOSA 2XRNA 4EJUA 2QWWA 4FX4A 4N9IA 5ERIA 4RAYA 2MLGA 5DEQA 2DBBA 2J5PA 5TJJA 2KJCA 2RGRA 2W24A 4EJWA 2GXBA 1CF7A 2V79A 1OR7A 4NHJA 3TKYA 3I4PA 2MD5A 2P5MA 1S6LA 3NQOA 1ZG1A 1JE8A 4UHTA 1U8RA 1UHMA 4KAWX 1X3UA 4ON0A 2E1NA 3WGHA 1YW9A 1S29A 2ZMEA 3U9GA 4KNYA 1FX7A 2LSOA 4RAZA 5JFRA 1FSHA 3GO5A 2ZCWA 4GXOA 3V4GA 1U5TA 5BPIA 3HSFA 4KICA 1ZG3A 2EB7A 1MJ9A 3F8BA 3D5LA 5HS9A 1MDMA 4ZZLA 1B6AA 1YQAA 5E17F 3TGNA 4A5MA 3I53A 4RB1A 3RKWA 5HVQC 1IF1A 5H20A 5H6RA 1W5SA 3PQJA 5FFZA 2QM3A 2XASA 3ZN0A 2L4AA 2X0LA 3HHHA 1XGOA 2EFOA 4A0XA 5FO5A 3HUGA 5HS8A 3E3VA 1XMAA 1TTYA 4BH9A 2BEOA 4IRHA 2Q8KA 3F6VA 3IKVA 3BY6A 2YX4A 1YTYA 3FMRA 4I0BA 1RUNA 1P4AA 5J8FA 1XGNA 2OU2A 3RDIA 5LGTA 4A6DA 1MGTA 2HYGD 1GXQA 1QQIA 4CXFA 5FB2A 4YFXF 2D1HA 4O6JA 2VE9A 5K5OA 2QQAA 3GWZA 2AS5F 2P5LC 2A61A 3IRQA 3T1BA 4YIFA 2LKPA 2DTRA 2ETHA 5TRDA 1XD7A 1W7PA 1LDJA 4WWCA 1T6SA 2GA2A 4G7HF 5FD6A 3ZP5A 4I2OA 5L3EA 1PUEE 2W85A 3KETA 1CGPA 2G9WA 2YSRA 2RGVA 3H92A 4RB2C 3H3ZA 1HKQA 1XSXA 4HLYA 2PBIA 3C1DA 3LA3A 2RN7A 5KVRA 3VFZA 3F8CA 1YS6A 5DCMA 2DAOA 1ZRDA 2K02A 2P6SA 4MQVA 3WTTC 1BOAA 4ZZDA 3EETA 4UUVA 5ILVA 2KRFA 4YFNF 1UHWA 1QGPA 1LVAA 5CVRA 1CF7B 5HDGA 2ACJA 5HLGA 1IN8A 2EV5A 1XN7A 2DFIA 2EJRA 4CZZA 3G3ZA 2VN2A 1QZZA 1BIBA 2ZMEB 3DPLC 3O2PE 2YPRA 1T2KA 4ZYEA 4LLLA 1I6XA 4Z2YA 1SD4A 3ZMZA 3IKTA 5L3CA 2F5EA 2YR2A 4E70A 1BJAA 3J81K 1JGSA 1L0OC 1U5TB 3OOPA 1ZRFA 1YLFA 4G7ZF 2UXNA 1ZVUA 3RJPA 5L3GA 4KN7X 1TQMA 3HRUA 2IRFG 2STTA 1D3YA 1YS7A 2AXLA 1BC7C 3KLNA 2PMUA 1MDMB 5D5UB 2O6GE 3LWFA 3F8MA 2MC3A 3FXRA 1PDNC 3FMSA 2UWMA 1YYVA 3KCCA 5LGNA 2NYXA 2LDUA 2IT0A 1LB2A 1ZAOA 5E1XA 1B9MA 3ML6A 4AIKA 1HW5A 3MCZA 3EQLF 2FA5A 2F5DA 2VONA 2PI0A 4G6QA 4EQQA 3ELKA 3FXQA 2O8XA 1XXBA 3LQQA 3K1PA 2EA2A 3GZ6A 5BOXA 4HOBA 3V8LA 1I5ZA 1FP1D 2DPUA 1R36A 1DD5A 2EFPA 4I02A 2FNAA 3E5QA 4HF0A 3EUHA 4BNCA 3DP7A 4U0YA 3E6CC 4PGGA 1WWXA 4HQMA 3C7JA 5KK1A 5LBQA 1R22A 1J75A 2G7HA 3KLOA 5LEJA 2IVMA 1W7PB 2J5OA 1XSVA 1ZYRF 1XB4A 1USTA 3RYRA 5CVVA 2ESNA 4HX7A 4HX8A 3KZYA 2ZNZA 3DEUA 2RVCA 5J8CA 1SAXA 3S2WA 5D4SA 1IXRC 3GZ5A 3BJAA 3CUOA 4GO1A 4KUMA 3HTSB 4LFUA 2PEXA 3I54A 1BIAA 3CO7C 4CICA 5A2QZ 2PG4A 5DCMB 1OKRA 1K79A 3RKYA 3J80K 1WQ2A 4H0EA 1O3SA 4L0YB 3F23A 2O03A 1YIOA 3OPFA 4I09A 5CJ9A 3T5XA 1TLHB 5DDGA 3KP3A 1YG2A 2XHKA 1OMIA 1E2XA 2XCRB 3VEPA 5CVJA 5E18F 3LAJA 2A5YB 1LJ9A 3QRFF 3KP5A 1U2WA 1SD7A 5L3FA 4BHCA 2QENA 5F6FA 5E8GA 4ETSA 4UVCA 2VBWA 2NS0A 4MGRA 2V6CA 2EFNA 4BQAA 3ECOA 2JZYA 4IXAA 1WQHA 2HOEA 4JBAA 1QBJA 4L0ZB 4I0AA 4KIGA 3FWEA 6PAXA 1J7KA 3W6JB 3LPXA 3ZPLA 2NNYA 4RS8A 4LMYA 2IP2A 3BPVA 4U0VA 3GFLA 3M9AA 2D1VA 4G6DA 4CHUA 2VODA 1OPCA 1ZREA 1USSA 4ENNA 4KC6A 3KP4A 1FYLA 2MBFA 5DYMA 3ULQB 3FXUA 3FM3A 2QZ8A 1XSDA 4M6XA 4A0YA 1BJTA 2OQRA 2K4BA 2Q0OA 2CW0F 3LA7A 1MD0A 2PHCB 1RUOA 4S05A 2H6BA 2EFWA 1L3LA 5D5WB 3COAC 1NHAA 2QVOA 2QLZA 4Q5SF 1H0MA 2WV0A 1HQCA 4RB3C 2VBZA 3V8KA 5FGMA 2RC4A 2NNNA 2HKXA 5D5VB 1P4XA 4UVBA 4U7BA 2XAHA 1TQIA 4XSXF 4HDVA 4OMZA 1UFMA 2MA3A 4R8HA 3NUHA 5FD5A 2RV8A 3IRRA 2IPQX 1F4KA 2ESHA 4HX4A 1F9NA 4OIOF 3DF8A 1B4BA 4MEYF 2K7LA 1QNTA 4CO8A 1O3QA 4IHSA 1XMKA 4GFQA 4PZJA 1KU9A 4A2UA 3LFKA 5ILUA 3CDHA 2Z9OA 3KP7A 1Z9CA 3R61A 1WSUA 3B73A 2FQ3A 4HBLA 3CAGA 3FHZA 1UCRA 2CWEA 3CUQA 3FMQA 5ED4A 2BBYA 4R79A 2O61A 2P8TA 5ICEA 4L5JA 3V7SA 4LK1F 1R1UA 2GA1A 2R7FA 3GFIA 4A5NA 5IT9Z 1T0FA 4QWQA 2Y3PA 3R6SA 1IS1A 4ENMA 3MFKA 1ZN2A 1EH8A 4U88A 4KDPA 4L9JA 3WTVC 4WK8F 2JTVA 1WRJA 3FM5A 4EV0A 3OV8A 4P9FA 1ON1A 1HBXG 4HAMA 3KEOA 4AIHA 4WX9A 1DPRA 5ICGA 3VOEA 1IN6A 3HRMA 2OBPA 1FBSA 3ABTA 1BN5A 2M30A 1TNTA 2ZFWA 4CDGA 3MZHA 3TOBA 2HEOA 2YX7A 3QP5A 2JRTA 4AD9A 1SFXA 5HDKA 4LLGF 1J5YA 2Z33A 2MLKA 2JPCA 1S8NA 4M9ZA 2ZNYA 4FT8A 5E1ZB 3RKXA 1RIOH 3DKWA 2JPBA 1D8JA 5ICCA 1TQPA 2OZ6A 3ISPA 2RNJA 1EH6A 1BM9A 1H9TA 3I59A 3FOFA 2H27A 5ICFA 3WTXC 2Y0MA 2XV4S 4LB6B 3F6OA 4AIJA 2FU4A 3QP6A 2KIFA 4Q48A 3RIRA 1D8KA 3O3KA 1K6OA 4WXHA 4GYIA 3HSRA 1KGSA 1J2XA 4I98B 4ENKA 3PQKA 4U7DA 3E5UA 2IJLA 2P6TA 2EA4A 5E8IA 3V8JA 1OYWA 3M8FA 2H09A 4B09A 1HW2A 1E17A 5JHUA 4MEXF 2MH2A 3GEZA 3TO9A 2PQ8A 3OEPA 1XCBA 2JT1A 2CGPA 3OREA 2XGXA 3BZ6A 4L9TA 3VB2A 4UVAA 2CQKA 3CTAA 3WE2A 1FNNA 2E7XA 4ASNA 4CYDA 2R7DA 5E20A 4AWXB 1FZPB 3Q5FA 2E7WA 2LNBA 1GVJA 3I58A 5D4RA 1O57A 3T0YA 4EM2A 2HQRA 3L9FA 4MTEA 5DUKA 2DLLA 1W7PD 5CVUA 1FY7A 2XKPA 2ZFZA 2DPDA 3CUQB 3JAMZ 1SD5A 2A6HF 4IRIA 4GCVA 2A69F 4YFKF 3CJNA 1S7AA 1STZA 1FYKA 4LB5A 3KP6A 1REPC 1YW7A 2DT5A 2GZWA 1J9IA 5BPDA 4F7ZA 2FSWA 5LEKA 1ZLKA 2K86A 3EYIA 3B02A 5AIQA 5FLXZ 4ZYDA 3JSPA 2IA0A 1B9NA 4D0PA 2ZKZA 3GFJA 5HDNA 3U2RA 2O3FA 2FMYA 2O0YA 4G0VA 5BS6A 2EV6A 3Q9VA 3KFWX 1U3EM 3FF5A 4OU0A 4DQ2A 3ZMSA 2KWAA 2XVCA 5HOOA 1LEBA 1FPQA 2P5KA 3WE3A 4S04A 1KU2A 3C18A 3MAJA 4IPAA 1IRGA 3REOA 1ONVA 1Z6RA 1ZGJA 5LRSA 2LF7A 3N97A 1I27A 4NQWA 1BI2A 1PP7U 2R3SA 1WQGA 3E5XA 4MNUA 3DPTA 3RTRA 4OMYA 3F3XA 1FYMA 1IN7A 2WC2A 4KN4X 2HDCA 1TNSA 4KA4A 2F5FA 4M74A 2OAZA 3KE2A 1OYYA 2MH9A 4WXDA 2ISZA 3BWGA 3I59B 1ZARA 3SZTA 2M87A 3WU1B 1IW7F 1Z1DA 3MWMA 4MTDA 4EVIA 2IA1A 3ZQ7A 3K69A 1K78A 4PDKA 3I71A 1I1GA 4I7HA 2QBYA 5F64A 2HR3A 1P6RA 2HQNA 1QPMA 4UXNA 5LGUA 2M45A 2FXAA 1R58A 5L3DA 4IF4A 3L09A 1ZRCA 2F2EA 1YO5C 5AONA 2HYFA 4EGYA 1U6GA 2VE8A 3E6BA 2KKOA 4HQEA 3RI4A 1G3WA 4EJTA 2DQRA 3CLOA 4HF2A 1IXSB 5D5XB 1YFHA 2DK8A 2DU9A 4TV7A 2EWNA 4Y15A 3TO7A 3ZMTA 4MHGA 3P7NA 4ESBA 1LQ1A 2L3DA 3SHFA 2GAUA 3LAPA 1MKMA 4O5VA 4BHPA 1HKTA 4A12A 2DI3A 4G8XA 5LHIA 2XAGA 1K7AA 3ZMDA 4J3NA 4HLXA 4G0UA 4OIQF 2Z3YA 3NEUA 4M71A 3TOAA 1R1VA 2NAZA 3GLXA 1BI1A 1JXSA 1WI9A 1KYZA 4R1HA 3BJOA 5K5QA 3CO6C 1FP2A 4U0WA 2XUBA 1J0RA 3KZZA 2PMHA 1IUYA 3WTZA 1ZGAA 2KJBA 2FF4A 4MQ9F 1GE9A 2VBYA 2ELHA 4UV9A 1SFUA 2XROA 3BJ6A 3MEXA 1B4AA 1XDSA 4KIBA 2DW4A 4G9YA 2OA4A 4KMFA 3F72A 2UZKA 1XGSA 2M1BA 3HOTA 5HLIA 1KU7A 3HSEA 1IRFA 5D6FA 1HW1A 1S7OA 1IN5A 5DCFA 2V1DA 3SZPA 5J6XA 5JVTA 4QLCU 5BQTA 4KB2A 2QUFA 4ZH4F 4ESFA 1EV7A 1FC3A 3QU6A 3E6DA 3FOEA 2K27A 1O3TA 4FHTA 3TDUC 1DPUA 1EK8A 1G4DA 1Z05A 3VODA 5DD8A 5D8LB 2WWYA 2E1CA 1VTNC 5DV5A 1ZHFA 4KYWA 3Q9SA 3ROUA 1Z6TA 4KDDA 5D6EA 3GYHX 4KIFA 3WODF 3M1EA 1FSEA 1GXPA 4XLNF 1KQ0A 4HV5A 1T39A 2ZJ2A 3GF2A 1XXAA 2HGCA 3WGGA 3G73A 3CUQC 3E6MA 3P9CA 4N0BA 4M9SA 3WTSC 4XLPF 3FZVA 1ULYA 1K78B 1Q1HA 3I0TA 5LHHA 3JW4A 2CFXA 2QBYB 2Z5UA 4L9VA 3QPTA 5CYVA 4OINF 1U5TC 2D45A 2COMA 4LG0A 5K5RA 1JHHA 3HYIA 1LNWA 1R5GA 4BXUA 1WQFA 2HTSA 1RI7A 4HZFA 3AAFA 4UNOA 2BGCA 5BMZA 1U78A 4A6EA 1R00A 4LK0F 4XRFA 1IZ1A 4LGWA 4Y17A 3DXJF 3ZMVA 2FBIA 4RB0A 1XDUA 4L18B 1B59A 3BP8A 3C3WA 2GQQA 4M9XA 3IC7A 3RPUA 1LDDA 2LF8A 1MJBA 2Q2EA 4AVPA 1O7FA 2RQPA 2XCOA 3BUEA 4B8XA 3V7RA 1KQ8A 4HYEA 3ZMUA 1FBQA 4DNCA 3IWFA 4HA8A 3KEQA 3GW2A 5DD4A 3QOPA 2NRAC 2XAQA 2OD5A 2VC1A 1R5HA 4EJVA 4UV8A 4P96A 4G94A 2L01A 5LLQA 1Z7UA 2UXXA 1KU3A 1LDKB 2L54A 2VT3A 3GXOA 1ZH5A 3L4JA 2V1UA 4BAYA 1ZG5A 3JTGA 5HS7A 4A0ZA 2BV6A 1HSJA 1S3JA 4PGHA 1F5TA 1XCVA 3LA2A 2PJPA 3HHGA 4FM9A 1AB4A 3HRTA 1JHFA 3L4KA 2FRHA 4PCQA 4HDUA 3P9KA 1P92A 3E97A 2ZBKA 2WTEA 3F8NA 3L7WA 1H9GA 2ZO4A 2XAFA 1MJAA 3P9IA 1OYIA 1R1TA 1R7JA 1ZLJA 3F8FA 2V9VA 3GVAA 4M6YA 4P55A 4GGGA 3JAMK 1G3SA 3WG9A 1O3RA 5HLHA 4RGXA 4XSZF 4RGUA 2A68F 4L5IA 1RNLA 2V1XA 4OIPF 3HRSA 1AOYA 1J59A 1ISEA 2KIUA 4WXCA 1P2FA 4WF2A 2L4MA 2OZUA 2DO7A 5DUIA 5ILSA 4LG0B 4G7OF 2RKHA 3BPXA 3V7CA 5FLXK 2M5WA 3LSTA 3D0SA 5CLSA 2IW5A 2ISYA 2K4JA 4O3MA 2KIMA 1G3YA 5E1WA 2XCQA 1LEAA 2VOOA 2CSOA 2OQGA 3IWZA 3M8EA 4M72A 2STWA 3ZN1A 5F1RA 1IAWA 2A3SA 1IN4A 3IL2A 5FFXA 1R23A 2BE5F 4G0WA 5K1YA 2P5VA 2FMLA 2W84A 3RYPA 2CYYA 3GUDA 3FX3A 1DDNA 1HSTA 3VA7A 1SMYF 5CVIA 2C6YA 1QO0D 1BGWA 3R0JA 2VC0A 1W4MA 2VBXA 2VOPA 2ADUA 1GHCA 2JSCA 2PLYA 2W57A 1T38A 1ON2A 1KQ9A 4EM1A 3K1MA 2DQLA 4CGZA 2Z99A 4I01A 3NRVA 2VT2A 4ZYHA 2H6CA 1EH1A 2EK5A 4DDQA 1DP7P 1EH7A 2QYOA 1B1BA 1C0WA 3K0LA 4KB4A 2A07F 1BC8C 3RPQA 2P7VB 3M7GA 3T8TA 1UB9A 5A2QK 1RZ4A 2FOKA 3WTYC 2HZTA 2CG4A 2H94A 3L2CA 1PP8F 1SFEA 3MZYA 3J81Z 3K2ZA 1MZBA 3R60A 1TW2A 1ODDA 4XBFA 3J7AO 4KT5C 3BOQA 3O6BB 4LD5A 1G3TA 1D5VA 2BYVE 5H6QA 3SQNA 3N4MA 3WTWC 4IVNA 2P4WA 1WKMA 2HFHA 3F22A 3SFZA 1KA8A 3TO6A 1A04A 3H3UA 3T8RA 1XXCA 3R4KA 1FLIA 5JR3A 3GFMA 2PN6A 1FBUA 4RGSA 2G7UA 4WCGA 4OIRF 4EGZA 2FNPA 2XAJA 2EV0A 1V3FA
chains in the Genus database with same CATH superfamily
4HPQA 3CCYA 2XKOA 3LQRA 4Q47A 1J6WA 2M0CA 1K4TA 1B8IA 3G1OA 5L3BA 3I64A 3OYCA 3S15K 1FTZA 2OCCH 2W25A 2JA7J 1YCLA 4KN4A 2M4KA 2GXGA 3OYDA 4GTBA 1KYWA 5BNGA 1BR2A 1TW3A 3QU3A 4DZPA 3WGIA 2QQBA 2ZXJA 1HXDA 2CW7A 1FOKA 3BTIA 5DM7F 1FT9A 1BBYA 1RKWA 2B0LA 4ESJA 1ZGWA 3M3YJ 2IXSA 3JRGA 2DA1A 1SD6A 4PJLA 3R0AA 9ANTA 2LFBA 2ZXIA 2F5CA 3QAHA 4K2EA 1HDPA 3SEZA 5IYBK 4AYBL 5FKMA 5LRRA 3CDIA 5EEHA 3X2QH 2M8EA 4Y13A 3MQ0A 4A93K 4EJOA 1FIPA 3HG9A 3WTUC 2E1MB 2MYSA 3JREA 1P9QC 2IA2A 2E1OA 2EZIA 1TWGJ 1VRQC 3HPGA 1ETOA 4QSHA 3I5UA 2FEZA 2F6CA 3S1NC 3JSOA 4BQOA 3L2RA 2XDVA 1N25A 1POGA 1XGMA 3ECHA 1DCHA 1WIHA 1WFXA 5L46A 2GIVA 5JVOA 3GTPK 4OOIA 1S9HA 2KISA 4BS9A 3S15J 2RDPA 2DJIA 2PFBA 2QA4I 5IP6A 2ME0A 2NVXA 2DMQA 3KZIC 4ZYGA 2JA8K 3BDDA 4JK1X 2L7MP 4L9NA 1WCMC 2QCOA 3DFGA 2JJ7A 3ERED 4YIIA 3G1LA 1BI3A 2HTJA 1V4RA 3PJRA 4KFCA 1FWZA 3SDGA 1ZK8A 1K83C 1AHDP 3MMLB 4M73A 2KMUA 3JTHA 3SXYA 4CH7A 5B3SH 5JI6A 4BLAA 1F36A 2BHYA 1WJAA 3LL7A 3S1QC 5IYBJ 1AWCA 3LSJA 4CCLA 2V1NA 2JA6K 2HS5A 2HWVA 4KMUX 5EJCA 1W0TA 3L00A 4A93J 2HQ5A 3TQNA 3KYDB 4IQ4A 4AYBN 5D8KB 4RGRA 2DCEA 4LIUA 5B1BH 4A3MK 1JJ8C 4XKVA 5AIPA 1DCOA 1HKSA 4ZDPA 2X1DA 3ZQFA 3HTUA 2VKDA 4C2UA 2VPRA 1QZYA 1DUXC 5LFAA 5FKLA 2DOAA 3HIFA 2HXIA 5E3LA 4B43A 4M6VA 3J80Z 3B6CA 2TDXA 3GTPJ 4BHBA 1UHSA 1Y1WK 3EYYA 4BLBA 2X4HA 2JA8J 1I3QK 3D5RC 4AM3A 2VUMC 1Y0UA 1F43A 4M3FA 3JRDA 1TWCK 1E3HA 3MKLA 3W6KB 1BI0A 1I50C 5E68A 2O5IA 3VDXA 4BJ5C 3JRBA 3H0GA 2YU3A 1BJZA 3QX3A 3ABMH 1MNDA 4IRGA 2M0MA 1SVLA 2FE3A 3K6GA 2L02A 4KMAA 2FBHA 4D5FA 2A6EF 4BYYA 3GTMA 1Q1VA 3ABKH 2KDZA 2JA6J 2GBYA 3U1DA 4EM0B 3GTKC 4HW0A 3DV8A 2E2IK 2HOTA 5EYRA 4LLNA 1MBFA 3OYBA 2IGKA 4Q4ZF 2D2WA 2Y75A 5C4JC 1Z91A 3WU0A 3OS0A 2Y48A 3K9TA 1VFCA 1P4WA 1U8BA 4EATA 3F0CA 4KARA 1ENHA 1F1ZA 4HV6A 4EMSA 1WJDA 4IJAA 2CO5A 2EZLA 4JX4A 1WHUA 4XICA 2HKOA 4LJZF 3K7AC 3VYTB 4DZJA 3PO2C 1R9TC 2LY9A 3GX4X 2ECCA 1Y1WJ 4XSZA 1IXCA 1I1SA 2R7QA 2HYJA 4XN3A 2A68A 5CKTA 4GTLA 3N3YA 1O24A 4I99C 4ENJA 3FKIA 4UUSA 1G6NA 3JCUC 1TWCJ 3F21A 3TDZC 3DQVC 2EINH 1W5TA 1W36D 1LFPA 4BJ6C 3PUFA 3QPHA 3PFIA 4P9UA 2MABA 4D9JA 4JQFA 1TBXA 3BZCA 5KCMA 1LUJB 1O7LA 3ABUA 3ZQCA 3C2HA 2LY2A 2ZFUA 1ETYA 1YRNA 3GTLA 2VXZA 1TWFC 1XZQB 4G7OA 5LHGA 1L0WA 4GYGA 5IT9K 2FUG2 1VQOI 4N9HA 4FX0A 1EF4A 4YG2F 4A3GC 3BP8C 2LK2A 3K1NA 1BL0A 1YW8A 2L5QA 5EEGA 2NVUB 2DK5A 3MZ8A 2JH3A 3KP2A 4ILDA 1TWHC 1R5ID 5IP9C 1TT0A 1XC5A 1T98A 3IHUA 4GTEA 3BROA 4IHTA 1I39A 2HOSA 4QIWL 3EDPA 3EUKL 1K83K 4NB5A 5IT3A 2P7CB 5K7ZA 1ZBSA 2QQ9A 2E5NA 3BG9A 2XIGA 1SMTA 2EFQA 2GWRA 2JA5A 4P5OA 2FBKA 3GTQK 4HF1A 1DU6A 3HOSA 2XRNA 3HGGA 2WAQD 1IV8A 4EJUA 2QWWA 4FX4A 4N9IA 5ERIA 4RAYA 2MLGA 5DEQA 2DBBA 1TC3C 4QPQA 3S93A 2BHZA 5JLWA 3GDZA 3BR5A 1B8IB 4YFKA 2J5PA 1P7IA 5TJJA 2GSNA 2KJCA 2RGRA 2W24A 1H89C 5IOTA 5IYCK 4EJWA 2GXBA 2O7OA 1CF7A 2V79A 2Z16A 4RLFA 1OR7A 4NHJA 3TKYA 1Y1VA 2MG4A 3AG2H 3I4PA 3Q0VA 2MD5A 4KJZA 2P5MA 2XSJC 1S6LA 1FMWA 4MFEA 1A35A 2YU9C 2VUMK 3HOWC 3NQOA 3HEFA 4KMDA 1ZG1A 1JE8A 4UHTA 1U8RA 1UHMA 4KAWX 1I50K 1X3UA 4ON0A 2E1NA 2XF7A 3WGHA 1EJ9A 1K83J 1S29A 1YW9A 2LBFA 3JRFA 1JQWA 2GXAA 4QIWN 2ZMEA 2EQRA 1BDFA 3CMYA 3GTOC 3S1QJ 4B3XA 3U9GA 4KNYA 3GTKK 1FX7A 2LSOA 2V7FA 4FTHA 4RAZA 5JFRA 2DA5A 1FSHA 3LSHA 3GO5A 5DS9A 2ZCWA 3AH5A 2KRCA 4F93B 2W00A 4GXOA 2HDWA 3V4GA 3S32A 1U5TA 5BPIA 3HSFA 3GTJC 4KICA 1ZG3A 2EB7A 1MJ9A 1IDYA 3OR1C 3HL2A 3OYJA 1RPWA 3F8BA 3D5LA 4XRSA 1SFOC 4BE2A 5HS9A 5F1JA 3CCRI 3SYTA 1JTYA 4BU2A 3CCUI 2F48A 4IEJA 4E7LA 5FJ8K 2OUMA 1MDMA 4ZZLA 2VUMJ 3TP0A 2QF7A 2L7FP 1GLNA 2JVHA 1B6AA 1GV2A 1YQAA 5E17F 2RNGA 4PFOA 1DCPA 2V9KA 3TGNA 1I50J 5IYDC 3CZ6A 4A5MA 2B63C 3I53A 4BJTA 4RB1A 2LR8A 5C44K 3DEWA 3RKWA 5HVQC 1Z3XA 1TP4A 1IF1A 5H20A 5H6RA 1W5SA 3PQJA 4NDLA 3HXAA 3ZQLA 5FFZA 1J6XA 3QODA 3BTLA 2QM3A 2Y69H 2XASA 3GTKJ 3ZN0A 3ZGKA 2JUCA 3RZDC 1ETKA 2L4AA 2XC7A 2V26A 1N78A 2QSFX 2X0LA 3BC8A 1D1CA 1XGOA 2EFOA 3HHHA 3RPUD 4A0XA 3H3VL 3CC4I 1FMVA 2KPMA 3RQIA 1TWHK 5FO5A 2JA2A 3SZZA 1KONA 4XCHA 3HUGA 5HS8A 3AL0B 3CQZK 2FQTA 3E3VA 1XMAA 1TTYA 1V5EA 3K7AJ 4BH9A 2BEOA 4IRHA 2EILH 1IW7A 1BOBA 2Q8KA 2DA2A 2WAFA 3HOYK 1QPIA 5FJ8J 3F6VA 4RA2A 2ZB9A 3BY6A 3IKVA 4AC0A 3A01A 2YX4A 1MIJA 1VGXA 1YTYA 4XL9A 3FMRA 4I0BA 2JWTA 1RUNA 1P4AA 3UR3C 2VLAA 2E2HK 5J8FA 3A03A 4Y7NC 5F04A 1XGNA 2OU2A 3RDIA 5LGTA 3TMOA 5IP7C 4A6DA 4F91B 1MGTA 2HYGD 2Z1DA 4BE0A 4WJ4A 4LOWA 3QWLA 4V19K 1GXQA 1WH7A 1XMXA 4Z6YA 1QQIA 1IQ0A 5CHPA 3MD2A 4CXFA 5FB2A 2YU9K 2XPUA 3GTGC 2XB0X 4YFXF 3LSKA 4KISA 2D1HA 4O6JA 1TWHJ 5IP9J 2VE9A 3A2KA 5K5OA 4UUSB 2QQAA 3GWZA 2AS5F 2P5LC 2A61A 3IRQA 3T1BA 1MSFC 4YIFA 2LKPA 2DTRA 2ETHA 5TRDA 2W82A 1XD7A 1W7PA 1IG7A 1I6HC 1LDJA 3HOYJ 4WWCA 1T6SA 1MBJA 4XLFA 5FKOA 2GA2A 2LC2A 4G7HF 4A3EC 5E79C 3L2UA 1UV7A 5FD6A 1YRNB 3ZP5A 1MW7A 3J7YJ 4I2OA 5L3EA 1PUEE 2E2HJ 2JUGA 2W85A 5TGTA 3BP3A 4E7HA 2TRTA 3KETA 1CGPA 4D7NA 2G9WA 2YSRA 2RGVA 3H92A 3BG6A 1Z7LA 5M5YJ 4RB2C 3H3ZA 4MLOA 4A3BK 3HBLA 2ID3A 5J47A 3OL3A 1HCRA 3DBLB 4RAGA 1HKQA 4QJVA 1XSXA 2CQ7A 2L9NA 2UUZA 4A3FC 1SFOK 2KRHA 2HVRA 2ECBA 4HLYA 2PBIA 4BBSC 3C1DA 3LA3A 2R93C 2YU9J 4XRSG 2FOWA 2RN7A 4PUSA 3IAM2 5KVRA 3VFZA 2HPIA 1ORKA 2MD0A 3F8CA 1YS6A 4DJAA 5IYDK 2R7RA 2B63K 5DCMA 3GMEA 2KZVA 2IS2A 2XRLA 1Y0NA 2DAOA 3S3OA 1ZRDA 2VJJA 2K02A 3S1MC 2P6SA 4MQVA 1I6VA 2VKEA 1JGGA 3WTTC 1BOAA 1T33A 1I3AA 4O2DA 2R92C 2CUEA 4ZZDA 2K9MA 3EETA 4UUVA 5ILVA 2KRFA 1YIJI 4YFNF 1UHWA 1QGPA 1LVAA 5CVRA 1G51A 3DEEA 4WJ3M 1CF7B 1OJLA 5HDGA 4A3CC 2ACJA 5HLGA 1PJ7A 4MQ9A 2H1LA 2MSYA 2ME6A 1IN8A 3PO3C 2V6TA 2EV5A 4BBRC 4A3BJ 2IGOA 1FIAA 1XN7A 3CJRB 3E0JB 2DFIA 2EJRA 1OQYA 4CZZA 4IOCF 4UB8C 1FOXA 2LRDA 3G3ZA 5IPAA 2LBFB 1SFOJ 2VN2A 1QZZA 1BIBA 2HXOA 1Y56A 2ZMEB 2EBBA 3DPLC 3O2PE 2YPRA 4B3AA 1T2KA 2F4IA 4ZYEA 4LLLA 1ETXA 1I6XA 4Z2YA 1SD4A 3ZMZA 1ETVA 2KFDA 3IKTA 2LY1A 5IYDJ 5L3CA 2B63J 4FQGA 2LREA 3PNYA 4UY8I 1OCRH 2F5EA 2KLOA 2W48A 2YR2A 4E70A 1BJAA 3QPSA 5IP7K 2CQNA 3J81K 1JGSA 1L0OC 2RQQA 3L2WA 1U5TB 3OOPA 3JRIA 1ZRFA 4XNFA 2R7ZK 4C9YA 1YLFA 4G7ZF 2NVYC 2UXNA 1ZVUA 3RJPA 5L3GA 4KN7X 1S7EA 1TQMA 2R0QC 5FLMC 2Y30A 3HRUA 3MVPA 3FXMA 4ZH4A 4PFPA 2IRFG 3V42A 2STTA 1FTTA 1D3YA 3K70D 1YS7A 3L1PA 3GTGK 4NBQA 5B5EC 2OF7A 2VL8A 2AXLA 2IS1A 1O2AA 1BC7C 3KLNA 2PMUA 1MDMB 5D5UB 3BR1A 2O6GE 3G4SI 4IHWA 3LWFA 3F8MA 5J3LA 1X1PA 2MC3A 3FXRA 1PDNC 3FMSA 2K3PA 2UWMA 1YYVA 1WVRA 4RLQA 3S2DC 3KCCA 5LGNA 1HOMA 2NYXA 3QYEA 5EGHA 4A3EK 4G12A 2ELJA 2BW3A 2E19A 2VASA 2LDUA 3HKZA 2IT0A 1LB2A 1ZAOA 5E1XA 2VQHA 5LD2C 1OISA 2DFFA 3H5NA 4Y7NJ 5FRMA 1B9MA 3LSPA 1NG7A 1X1AA 3ML6A 5IP7J 4UUTA 1UZCA 3K10A 5FLVA 1IO2A 1MH3A 2EPFA 3S3NA 4AIKA 1HW5A 3MCZA 2L2OA 2CQQA 4KM8A 1HDDC 4XLNA 3EQLF 2FA5A 2ICWG 3HUGB 2F5DA 2K85A 1TWGA 4BBSK 2VONA 2OTLI 2PI0A 4G6QA 2K9LA 4EQQA 3GTGJ 5E3NA 4KATA 3ELKA 3FXQA 3BR3A 4C45A 2O8XA 1XXBA 3FBNB 1WJBA 3LSGA 3LQQA 3A01B 3K1PA 2EA2A 1AKHA 2M8GX 2BY0A 1WJ5A 4MIMA 2L7KA 4YG2A 2PX9A 2NXNB 2WY8Q 1R49A 3GZ6A 5BOXA 4HOBA 3V8LA 3CC7I 1I5ZA 4A69C 1N75A 1I6HJ 2M7BA 1FP1D 4KM9A 2R92K 1T95A 3S2HK 2DPUA 4OINA 4A3EJ 1R36A 1PVEA 2DN0A 1DD5A 2EFPA 4I02A 5EG0A 2FNAA 3E5QA 4A3CK 1W1WE 4HF0A 3DCFA 1O26A 1GUUA 4F3QA 1VQ9I 3GEEA 3EUHA 3OS2A 2N8GA 3DP7A 2XF5A 4U0YA 3E6CC 4BNCA 2FQOA 2K9SA 1WWXA 4PGGA 1WPKA 4AYBD 5KAIC 4HQMA 3C7JA 5KK1A 3U21A 5LBQA 4BBRK 1R22A 4IHXA 1VQ6I 2CH0A 3AG4H 4ZJZA 1J75A 2ZJQF 2ZSHB 2DJNA 2M2EA 4P9SA 2G7HA 2XGEA 2QEXI 3KLOA 4BBSJ 5LEJA 2IVMA 2YUSA 1W7PB 3SDBA 3ERMA 1VQMI 1ACIA 3HOVC 2J5OA 1XSVA 3K4NA 4HRIA 5GTHC 3JRCA 4J01A 3GTPA 5TMFA 2O8KA 2E34A 3QYBA 1RC9A 1ZYRF 1XB4A 3CP8A 3FDYA 1USTA 3RYRA 5TJ3A 2VPLA 2NVXC 1D0XA 2R92J 5CVVA 3S2HJ 2CRGA 2NS8A 3HPHA 2ESNA 3DBRB 2EZHA 4HX7A 4HX8A 3DLLF 3KZYA 2ZNZA 3DEUA 2RVCA 5J8CA 1SAXA 4QJVB 3S2WA 5D4SA 5FLMK 5EF6A 4A3CJ 1JVIA 1IXRC 3GZ5A 4PJJA 3BJAA 3CUOA 1JUMA 4XKBA 4E7IA 4GO1A 4KUMA 3HTSB 5C3EC 4LFUA 2PEXA 3PO3J 2E35A 3I54A 4BBRJ 3OYNA 2JA6A 2CMPA 1BIAA 3CO7C 4CICA 5A2QZ 2KQRA 2PG4A 3Q3QA 4PJNA 1AA7A 5DCMB 3PM1A 1OKRA 5J1RA 1K79A 3RKYA 3J80K 4ZYAA 1WQ2A 1VQLI 1RKTA 4H0EA 1K4SA 1O3SA 4L0YB 3F23A 2O03A 1W36C 3A0HC 3AQOA 4M3GA 1G8XA 4ANJA 1YIOA 3HKZL 2CJJA 3OPFA 4I09A 1WOOA 1WJFA 5CJ9A 3T5XA 1TLHB 4II3A 5DDGA 4NUBA 3KP3A 1Y1WA 1YG2A 5M5XK 2XHKA 3A02A 2X6OA 2LD5A 1I3QA 1OMIA 1E2XA 2XCRB 3VEPA 2NVYJ 5CVJA 3AL0C 1MNEA 5E18F 2VQCA 3LAJA 2A5YB 5FLMJ 1LJ9A 3DKXA 3TW7A 3QRFF 3KP5A 2LG4A 3H0GC 1U2WA 3CP2A 2X6WA 1O25A 1SD7A 3PSFA 4BKXA 5L3FA 3GTMC 3DU6A 5CQGA 4BHCA 2QENA 3OIQA 5F6FA 4XRMA 2E2IA 2R7WA 5E8GA 4M3EA 4ETSA 4UVCA 2VBWA 1O28A 2NS0A 2ZC2A 4MGRA 5M3FK 2V6CA 2EFNA 1Z67A 2GIZA 4BQAA 3S1RC 3MN2A 3ECOA 3LMMA 2JZYA 4IXAA 1O29A 1NTCA 1WQHA 2HOEA 4JBAA 2H8WA 3VSLA 1QBJA 4L0ZB 2V6UA 4I0AA 4KIGA 3FWEA 6PAXA 1J7KA 3W6JB 3LPXA 3ZPLA 4BY1K 4RM2A 2Y2ZA 3PUBA 3QPLA 1WORA 2NNYA 4RS8A 4BDZA 2L9SA 4LMYA 2LVSA 4XK4A 2PMZA 5M5XJ 2IP2A 2VKHA 3BPVA 4N4NB 2CV0A 4NC7A 3FKIC 3GEHA 4U0VA 2K5CA 3GFLA 3M9AA 1KQ4A 2D1VA 4G6DA 4CHUA 3W6VA 2VODA 4X1EA 5EZGA 3LSRA 5J4VA 2BY3A 3BQYA 4JK1A 2VJ4A 4Y52C 1OPCA 1ZREA 1USSA 1JT0A 2BW3B 4ENNA 1OCTC 3OYIA 4KC6A 3KP4A 3I9V2 2R7VA 2CU7A 5M3FJ 3BR0A 1FYLA 3FBIB 2MBFA 5DYMA 3ULQB 1WOPA 3FXUA 3FM3A 3BR6A 2QZ8A 3RSNA 4JP0A 1XSDA 4M6XA 4A0YA 4KMUA 4DOZA 4GTAA 1BJTA 4QIWD 2OQRA 4BY1J 5KNLA 2K4BA 2OCEA 2W7NA 3A8KA 1K83A 3OL4A 2Q0OA 1XX5A 2CW0F 4BQQA 3LA7A 4CCOA 1MD0A 3H9QA 3I56I 2IS4A 1JUPA 3CCQI 5FKKA 3CF5F 2PHCB 2JA5C 3GTQA 3FXLA 1RUOA 2ELKA 4XOPA 3ZOBA 4S05A 2H6BA 2EFWA 4NC6A 5F27A 1L3LA 4OIPA 1AKHB 1UAAA 2M4GA 3O8GA 5D5WB 1A6IA 1NHAA 2LMDA 4LG3A 3COAC 2QVOA 2GAHC 2QLZA 1PUFA 4Q5SF 5F0CA 1XG1A 4V2GA 1H0MA 2WV0A 1HQCA 1MMNA 3C2BA 4RB3C 3HOVJ 2VBZA 3V8KA 4IL6C 5FGMA 3S1NK 2GM4A 2X6YA 2RC4A 2NNNA 2HKXA 5EG0B 1OR7C 1BR4A 1V5GA 2KDOA 5D5VB 2CQXA 1P4XA 4QPOA 4UVBA 3ZQGA 4U7BA 3ESWB 2XAHA 4ZDLA 3G6EI 1TQIA 2G0EA 4XSXF 3S0XA 4HDVA 2W7VA 4FZBA 4E7SA 4OMZA 1UFMA 2MA3A 4R8HA 3NUHA 2WADA 1WCMK 5FD5A 1Y8RB 1MBGA 2RV8A 2CS3A 4J19A 2ZMEC 3IRRA 3FXKA 3H9GA 4BXXC 4YFNA 3GTKA 3S1QK 2IPQX 1F4KA 4PK4A 2E2JC 4A3LC 2ESHA 4XLEA 4HX4A 1F9NA 3S1RK 4OIOF 3GZNB 3OYHA 2WB1A 3DF8A 3OSFA 4ZDOA 4B48A 1OLTA 1HLVA 4MEYF 1B4BA 3S1NJ 1PYVA 2K7LA 4I6ZA 1QNTA 4CO8A 4D1QA 2BE5A 1O3QA 4IHSA 4A3JC 1XMKA 4GFQA 4PZJA 1KU9A 4A2UA 3LFKA 1V5VA 5ILUA 2A5WA 3K4KA 3CDHA 1LFUP 1IGNA 1D0YA 1X4PA 2MGQA 3FK7A 2AXTC 2HDDA 2DOEA 2Z9OA 3KP7A 3JRHA 1Z9CA 1LPQA 3R61A 4CCNA 1WCMJ 3BTJA 1WSUA 3B73A 2FQ3A 4A3DC 4HBLA 3CAGA 1SMYA 3H0GJ 1WGXA 4IHVA 1QHGA 5HODA 3FHZA 4BY7C 1UCRA 2CWEA 2BXYA 3CUQA 2K3FA 3FMQA 3G1MA 2ZJRF 1OCPA 5ED4A 4S0HB 2BBYA 4R79A 1JKQC 5KHDA 2O61A 2P8TA 5ICEA 2QSHX 4L5JA 3V7SA 4H4KC 2E36A 3S1RJ 2BVMA 5HNFA 4LK1F 3H3VD 1X58A 1R1UA 2GA1A 1TWHA 2B7EA 2R7FA 5C4JK 3GFIA 4A5NA 1TT5B 3CQZA 5HLTA 4XR6A 5IT9Z 1PJRA 4BEHA 3M1CA 2X85A 1T0FA 1QHHD 4QWQA 3K7AK 4GZYA 2Y31A 3PO2K 1R9TK 2Y3PA 4C2MC 2XB5A 3R6SA 3BR2A 1IS1A 4ENMA 3RQ4A 1F93A 3MFKA 3BG5A 1ZN2A 5IOQA 3OIPA 5J4YA 2E2HA 1QRYA 4CCMA 5EEAA 1EH8A 3PFYA 2NVTC 4U88A 4KDPA 4L9JA 3WTVC 3OYEA 1X2NA 4WK8F 2JTVA 1WRJA 3FM5A 1A6QA 3AG1H 3TEDA 4EV0A 3PSIA 3I55I 3OV8A 1FJLA 4P9FA 1NH3A 1ON1A 1WJCA 1HBXG 5IY5H 1TWFK 3IH4A 5GAHJ 2YU9A 4HAMA 3T02A 3KEOA 4AIHA 4A3GK 2KL4A 3BT9A 3ZQIA 4WX9A 1DPRA 5ICGA 5C4JJ 3VOEA 5TMCA 5IP9K 3TP3A 1IN6A 4DGWB 3HRMA 2OBPA 2VJIA 1FBSA 3ABTA 1BN5A 1IC8A 4Y33A 2M30A 1PJ5A 1TNTA 2ZFWA 3PO2J 4CDGA 1R9TJ 4F92B 1D1BA 2X51A 3MZHA 1MMSA 1YE9A 2K40A 3FKJA 3TOBA 1BA5A 3HOZC 3L2QA 4X0GA 3ZCOA 3A0BC 2HEOA 2YX7A 3QP5A 2CFOA 2JRTA 4AD9A 5C4XC 1SFXA 4L5EA 3DTEA 3H35A 5HDKA 2V6EA 1IDZA 4LLGF 1J5YA 3G2BA 4FE4A 2Z33A 2RAEA 2MLKA 2JPCA 1S8NA 2DYSH 4M9ZA 5M5YK 2ZNYA 4FT8A 5E1ZB 3RKXA 4X6AC 2VQGA 1RIOH 1K6YA 4A3JK 1AU7A 4NNJA 2I8DA 3BLYA 4XONA 4HSRA 3DKWA 2JPBA 4OIRA 1TWFJ 3BCAA 2IEKA 5M3MK 2X1CA 1D8JA 4A3GJ 5ICCA 1TQPA 4XLAA 4F55A 2OZ6A 3ISPA 1MBHA 2RNJA 2JMWA 4G6TB 3K70C 1EH6A 1BM9A 2AHQA 3HOWK 1H9TA 1DGRM 3I59A 4JYKA 2B63A 3FOFA 2H27A 4A3DK 5GPAA 4BXFA 1ZYRA 5ICFA 3WTXC 2E1MC 2Y0MA 1PUFB 1FEXA 2XV4S 4BY7K 2NS7A 1LKXA 2MC4A 3VSKA 3AD9C 2DMTA 2WV1A 1APLC 1VLOA 3GTOK 4LB6B 2CUJA 3F6OA 3K4JA 4V2FA 3JRAA 2FU4A 4AIJA 3QP6A 4N4OB 2E2JJ 1TWAC 2KIFA 3E7LA 4Q48A 3RIRA 1D8KA 2R4GA 3O3KA 1K6OA 4WXHA 4GYIA 3HSRA 1KGSA 1J2XA 4I98B 3S8PA 2JQ7A 2D5VA 4ENKA 3OYFA 3CJTB 3PQKA 4U7DA 3E5UA 2IJLA 3GTJK 1X3ZB 2FJ1A 2P6TA 2V4JC 3H36A 4A3JJ 2EA4A 3CJQB 5E8IA 3V8JA 4PAAA 3H0DA 3IUOA 4FE7A 1OYWA 5M3MJ 3M8FA 2H09A 1X4OA 4B09A 1HW2A 1E17A 4C2MK 5JHUA 4MEXF 2MH2A 3GEZA 3TO9A 2PQ8A 3OEPA 1XCBA 2JT1A 3HJEA 2CGPA 3OREA 4XN0A 4D7MA 1RR8C 2XGXA 3BZ6A 4L9TA 3HOUC 3VB2A 3HOWJ 2Q1ZB 4UVAA 2CQKA 3CTAA 4A3DJ 3WG7H 3WE2A 1FNNA 2EIJH 2R5ZA 4BY7J 3A8IA 2E7XA 4ASNA 3J7AY 3GTOJ 3ZQHA 4CYDA 2R7DA 2R7ZA 5E20A 1Z77A 4AWXB 1FZPB 3OYMA 3Q5FA 2E7WA 2LNBA 1GVJA 1YJ9I 4C3JC 3I58A 4OWRB 1YNJA 3TW6A 2ZJPF 2D6FC 5JHFA 4LOCA 1O57A 3T0YA 3U1KA 3IP4B 4BL0B 4EM2A 1P7JA 5D4RA 1G59A 3RZDK 3GTGA 2BY1A 1X2MA 2HQRA 1G2HA 3L9FA 4MTEA 3ZR8X 3Q0WA 5DUKA 1UG0A 2DLLA 4DBRA 2R7XA 3CMAI 3GTJJ 5IORA 3HC7A 3AD8C 1W7PD 5CVUA 3BZKA 1FOYA 4U87A 1FY7A 3BG3A 4AUXA 2XKPA 4C2MJ 2ZFZA 2DPDA 3CUQB 2HI3A 3JAMZ 1SD5A 2A6HF 3W3CA 2VKVA 5FKNA 4HNTA 4IRIA 4ITVA 2YS9A 2LKXA 3M3YC 4UB6C 2NVTJ 4GCVA 2A69F 4YFKF 1ZELA 4Y7NK 3CJNA 2VB6A 1S7AA 1STZA 1FYKA 4LQYA 4LB5A 2ID6A 3KP6A 2Y9ZA 1REPC 4BEHB 1VZ0A 1YW7A 3SZGA 3RZDJ 2DT5A 2EBIA 1OCCH 4FETA 1QU3A 1ZQ1C 1MH4A 2I10A 2LKSA 2A6EA 4C3IC 2GZWA 1JKOC 2O9LA 1J9IA 1R6RA 4AVZA 5BPDA 4F7ZA 1CQTA 3VPRA 1HQMA 2E60A 3S15C 2FSWA 5LEKA 1SVOA 1ZLKA 4Q4ZA 2K86A 3EYIA 3HDDA 2GOMA 1RRJA 3M4OC 2JA7A 1YHQI 3K4CA 3B02A 1I6HK 5AIQA 4CA0A 5FLXZ 4ZYDA 3JSPA 3FIWA 1VQKI 1TWAK 4KASA 5HNHA 3HZJA 2M7AA 2IA0A 2QKMB 4IX7A 5D4DA 2TCTA 3W2WA 4LJZA 1B9NA 4WILA 3SJMA 3OOUA 2DFHA 4D0PA 2HZDA 2ZKZA 3GFJA 5HDNA 2L7ZA 3U2RA 3MKZA 2O3FA 4FISA 4GRIA 4AU7A 2FMYA 2O0YA 4G0VA 1QVTA 5BS6A 4B47A 4X6AJ 3DU5A 4KMHA 2LLKA 2EV6A 3Q9VA 3KFWX 1U3EM 3FF5A 4OU0A 2HVSA 4A3FK 3B6AA 4DQ2A 3ZMSA 4BACA 4HNUA 2KWAA 2R93K 5B66C 4XKCA 2XVCA 5HOOA 1LEBA 3I4MC 4E6KG 1FPQA 2P5KA 3WE3A 4S04A 1KU2A 3C18A 3MAJA 4IPAA 4KN7A 3DTKA 1IRGA 3GTPC 1W0UA 2MW8A 3REOA 1YX5A 1ONVA 4A3KC 4XSXA 3ABLH 1Z6RA 2MFZA 1ZGJA 5LRSA 2LF7A 2JA8C 3S1MK 4MFDA 3N97A 1I27A 4NQWA 1ETQA 3NARA 1BI2A 1PP7U 5EDNA 1TWAJ 2R3SA 3K2AA 4C3JK 5GPCA 2COBA 1WQGA 2ZUEA 2F4MB 2F5VA 1X1DA 3E5XA 4MNUA 3DPTA 3RTRA 4OMYA 2X1EA 3KEYA 1MMDA 2L9VA 3F3XA 1FYMA 2KIQA 1IN7A 3PO3K 2WC2A 4KN4X 1ZKGA 2HDCA 2JA6C 1TNSA 2LTPA 3S16C 3BG7A 4KA4A 2F5FA 4M74A 2OAZA 3KE2A 1OYYA 2MH9A 4WXDA 4C30A 2ISZA 3BWGA 3I59B 1ZARA 1XZPA 4A3MC 3PIPF 3SZTA 1XPXA 5EGEA 2M87A 3RCOA 4XORA 4A3FJ 3WU1B 1IW7F 1A31A 1Z1DA 2R93J 4HSTA 3HKZD 3MWMA 4MTDA 1QZEA 3HOUJ 3JSTA 4EVIA 1F7VA 1D1AA 1JI8A 2IA1A 3ZQ7A 3K69A 1K78A 3N0CA 4PDKA 2JSPA 4YEJA 3I71A 1I1GA 4I7HA 2QBYA 3AD7C 5F64A 2HR3A 4NOIA 1P6RA 2HQNA 4M3BA 4RMNA 4DIQA 1Y8QB 3S1MJ 3CC2I 1QPMA 4CCJA 1I3QC 4UXNA 5LGUA 4J00A 2M45A 2V9PA 2FXAA 1R58A 4IO9F 5L3DA 3AFHA 4C3JJ 2NVYK 5EGOA 4IF4A 2ZXWH 1RESA 3L09A 5IOYA 1V54H 3G4AA 2R7TA 2VI6A 4IQJA 5CQEA 1MMGA 1ZRCA 1SAUA 2F2EA 1WI3A 5CPRB 4OAZA 5F0FA 2R7UA 2E2IC 3FK6A 2FQ4A 1YO5C 3FISA 5AONA 1LE8A 2HYFA 4EEFG 3CCSI 1U6GA 2EH3A 4XLHA 4YIRX 3AKZA 2VE8A 2R5ZB 4EGYA 3GEIA 3E6BA 1IBAA 3CMMA 2KKOA 4HQEA 3RI4A 1G3WA 1V55H 4EJTA 2DQRA 1O2FB 3M4OK 3S2DK 3CLOA 3IH3A 4HF2A 2AQEA 1IXSB 4BGDA 5D5XB 1YFHA 1R71A 1F7UA 2DK8A 2DU9A 3PIOF 1WZ2A 3FHNA 3T01A 1O4XA 4TV7A 2EWNA 2PA8D 3S17C 4Y15A 3TO7A 4RDUA 4XOTA 4MHGA 3ZMTA 3P7NA 2LOOA 4ESBA 1J6VA 1T56A 1LQ1A 2L3DA 1YJWI 3SHFA 4GDFA 2GAUA 1MMAA 3LAPA 5E3OA 1TWCA 1MKMA 4O5VA 4BHPA 4E7JA 2QGUA 1X1BA 3QOEA 5J1UA 4BQNA 2WA0A 1HKTA 2I5UA 4A12A 1U9OA 1YOVB 4C3IJ 2DI3A 4G8XA 5LHIA 2XAGA 1K7AA 3I4MK 3ZMDA 1GV5A 1OCZH 2V6SA 4J3NA 3LSIA 4HLXA 4G0UA 5IOZA 4OIQF 2Z3YA 3NEUA 4M71A 4PABA 4A3KK 5FROA 3TOAA 1R1VA 2NAZA 3GLXA 1BI1A 1JXSA 3Q3SA 3SFIA 1WI9A 1KYZA 4R1HA 3BJOA 3CLQA 5K5QA 3S2DJ 2BVLA 3CO6C 3M4OJ 1FP2A 4RBOA 5GP9A 2QSGX 5KAFC 1IL2A 3M8JA 1IRZA 3ASNH 2UV1A 4U0WA 2XUBA 3S14C 1J0RA 3KZZA 4ABZA 4PJ0C 2PMHA 2Y0SA 2VQLA 3OR2C 1IUYA 3SEQA 3WTZA 1ZGAA 4AIDA 2KJBA 2FF4A 3HKZN 4MQ9F 3GTQC 1GE9A 2VBYA 1RETA 2ELHA 4UV9A 2PA8L 1SFUA 3S16K 2XROA 2OC6A 3BJ6A 1BR1A 1BS2A 3MEXA 5E3MA 2GOXB 1R4MB 4JOMA 5IOSA 3G71I 1B4AA 1M1EB 1XDSA 4LLGA 4KIBA 1JUSA 3OMYA 2DW4A 4G9YA 2OA4A 1JOEA 4KMFA 3F72A 1O2BA 2P81A 2UZKA 4HG2A 1XGSA 2M1BA 3HOTA 3I4MJ 5IYCC 5HLIA 3HOVK 1KU7A 3HSEA 1B72A 1EQRA 2W4SA 1E3OC 1IRFA 4A3KJ 1ZTRA 5D6FA 3OYGA 1H8AC 3GTLC 1HW1A 2LH9A 4ZTJA 1W5CC 4C3HC 1S7OA 3TL4X 1IN5A 4YFXA 3OY9A 2BY2A 2HQAA 5DCFA 2V1DA 4FASD 3SZPA 2NVXK 2DA3A 5J6XA 1WSRA 1WCMA 4PJMA 2GSUA 5JVTA 4QLCU 4JX5A 1SC7A 3J7ZI 5BQTA 4KB2A 2QUFA 3HGYA 4ZH4F 3LOCA 1EV7A 2DDAA 4ESFA 3RZOC 1JKPC 1FC3A 1R4NB 2JK3A 3DTIA 5C3EK 3QU6A 2VJ5A 3E6DA 3S16J 2DFEA 1Z0XA 2K27A 3FOEA 1YX2A 2GSOA 1O3TA 4G7HA 4P1WA 2HU9A 4FHTA 1SANA 3ZQQA 3N0BA 3TDUC 4A3MJ 1DPUA 1EK8A 2WAQA 5B1AH 2WBMA 1YITI 1YNNA 1G4DA 1Z05A 1WOSA 4E7KA 1ITYA 3VODA 4Y3OA 1VF9A 4P5AA 5DD8A 2Y0SD 5D8LB 4NQWB 2WWYA 2E1CA 1VTNC 3CCVI 5DV5A 2PMZD 1ZHFA 4KYWA 3S17K 3Q9SA 3ROUA 4KT6A 1Y1VC 1Z6TA 4MEXA 3WU2C 4W1UA 2E5ZA 4KDDA 1I3QJ 2IBDA 5D6EA 5H2FC 3GYHX 4KIFA 2A05A 3WODF 2NVXJ 2VUMA 3M1EA 1VQ5I 1FSEA 1O27A 5F08A 1ZR4A 1GXPA 4XLNF 2DA4A 3QYFA 1KQ0A 5GTIC 2OJED 1I50A 1XZPB 4HV5A 1T39A 5C44C 2ZJ2A 3GF2A 3ZRGA 1XXAA 3KYLA 2KZGA 2HGCA 4II2A 3WGGA 2O5JA 3G73A 4PSWA 1TL8A 3H0GK 5C3EJ 3CUQC 5HL8A 3E6MA 3P9CA 3A4CA 4IKFA 4N0BA 1IJWC 4M9SA 3WTSC 3GTMK 1UELB 3FZVA 4XLPF 2E2IJ 4GTCA 4LK1A 3KPHA 1ULYA 4CSWA 2PJRA 1K78B 3BCBA 5GAEJ 1Q1HA 2B9SA 2NOGA 3I0TA 3L2VA 5K7HA 5LHHA 1VNDA 3JW4A 2CFXA 2QBYB 4LR2A 2Z5UA 2CUZA 2HVQA 4L9VA 3QPTA 3M07A 5CYVA 2LYCA 4C2TA 4OINF 1U5TC 4GT9A 1FOWA 3S14K 1DU0A 3CQZC 2D45A 3DLAA 1OFCX 2Y0SL 3GSIA 1VQ8I 3BQZA 2COMA 4LG0A 5EGOB 1T0FC 5K5RA 3S17J 5J40A 1R9TA 1JHHA 4DYQA 4CCKA 2PMZL 3HOYC 2A6HA 1MBKA 3NAUA 3HYIA 2NOJB 2K9NA 1LNWA 1R5GA 2DXIA 4BXUA 3FKIK 4LIVA 3CD6I 1WQFA 4P5BA 1HF0A 2E2HC 2A69A 2HTSA 1RI7A 4HZFA 1LE8B 3AAFA 1NK3P 4XQFA 3RKQA 4UNOA 2BGCA 3OYLA 5BMZA 1U78A 4F52A 4XKWA 2CW8A 1R00A 4A6EA 4LK0F 4XRFA 1IZ1A 4LGWA 2M9HA 1GVDA 4Y17A 1U9NA 3GTMJ 1QA6A 3TFIA 3DXJF 4G7ZA 4Y52K 4QTRA 3ZMVA 2PPBA 2FBIA 3A1YA 3NWTA 1TWFA 3OYKA 4RB0A 3GTLK 4C3HK 2CFAA 1E0EA 1XDUA 4L18B 1B59A 3WHCA 3BP8A 2Z2SB 3C3WA 1WSVA 1EFWA 2GQQA 4FCYA 4M9XA 1H88C 3VYRB 3IC7A 5M5WK 3I4NC 3RPUA 1LDDA 3S14J 3H3VK 1LFBA 4D5CA 2H8RA 3H1CA 2LF8A 1MJBA 2Q2EA 3RZOK 2L9RA 2IAIA 4AVPA 1O7FA 2RQPA 2Y0SN 1USOA 3GTQJ 2XCOA 3BUEA 4XIDA 2JA5K 4B8XA 3V7RA 1KQ8A 3HOXC 3OS1A 4HYEA 2PMZN 3ZMUA 2OTJI 3FKIJ 2WAQL 2XGCA 1FBQA 2WB1D 3H9JA 1JTXA 4B44A 4DNCA 2OPTA 3IWFA 1K61A 1UG2A 4HA8A 4XM3A 4A3BC 2X9DA 3KEQA 3PNTA 4DBQA 2ZSIB 2AO9A 5IYCJ 1DQUA 3GW2A 5DD4A 1V5FA 3QOPA 4E7ZA 3OYAA 2NRAC 1U0JA 4Y52J 3EQLA 1QVUA 2XAQA 2OD5A 2DDBA 2VC1A 1R5HA 3GTLJ 2CV1A 1UMQA 4EJVA 4C3HJ 4UV8A 1Y1VK 4GTDA 1WH5A 1DGWY 4P96A 4G94A 4A3IC 2L01A 4HNVA 5LLQA 5M5WJ 1Z7UA 3H5RA 4MO7A 2UXXA 5EZHA 1KU3A 3K4MA 1LDKB 1ZQ3P 1Z3YA 3CESA 3RZOJ 2L54A 2XSDC 5J1YA 3GTOA 2VT3A 3GXOA 1ZH5A 2JA5J 3DKYA 2ZXHA 2JVGA 3L4JA 2V1UA 1BW5A 4BXXK 2KHMA 4BAYA 1B72B 3QQAA 4B4CA 1ZG5A 2E2JK 3A8JA 1T08B 5GAGJ 1SFKA 3JTGA 2HPMA 4A3LK 2O5RA 5HS7A 4A0ZA 4KITB 1VQ4I 2WAQN 2BV6A 3SZYA 2KP6A 2K9QA 1HSJA 3HXLA 2DYRH 2WB1L 5TISC 2Y9YA 2DMPA 1S3JA 1VQPI 3GTJA 4PGHA 3ADAC 1F5TA 1XCVA 3LA2A 2PJPA 3HHGA 2CUFA 4FM9A 4DW6A 2BXZA 1PJ6A 1Y1VJ 1AB4A 1SFOA 3GLLA 1HI9A 4PSXA 3TBIA 3HRTA 1JHFA 4BDYA 3P5JA 1DP3A 3N05A 3L4KA 1SVMA 1XTAA 5C44J 4W97A 2FRHA 3FXOA 4PCQA 4HDUA 4IOAF 3P9KA 1P92A 4JX6A 3E97A 1INNA 2ZBKA 1Y39A 2WTEA 3F8NA 2R7ZC 2H1KA 4BXXJ 3L7WA 1H9GA 2ZO4A 2RH6A 3VWBA 3KIOA 3KYCB 3ONQA 4A3LJ 4M1XA 2NVQC 2XAFA 1MJAA 3P9IA 3S3MA 1C0AA 1OYIA 1R1TA 1R7JA 1ZLJA 3F8FA 2V9VA 1S72I 3GVAA 5JLXA 4M6YA 4P55A 5JVGF 1VQ7I 2JRMA 4GGGA 3I4NK 1IRXA 3JAMK 1G3SA 1JT6A 3GIRA 1GDTA 3CQZJ 2WB1N 1OCOH 4CYCA 1TZLA 2IGNA 3WG9A 3PL8A 1KZHA 1O3RA 3DPUA 5HLHA 1A5JA 2R5YA 4RGXA 1MNMC 3HOXK 4XSZF 4RGUA 2A68F 4L5IA 1RNLA 2V1XA 4OIPF 3CF2A 3HRSA 2PJRB 2AQFA 4I76A 4GTFA 3TFHA 1AOYA 1VQNI 1J59A 3IPJA 3CCMI 1MBEA 1ISEA 2NVTK 2KIUA 4WXCA 1P2FA 4XLCA 2QQ8A 3W2VA 2DTZA 3FXJA 3MKWB 1N77A 4WF2A 2L4MA 3GBGA 4ZC3A 2OZUA 2DT6A 4NC8A 1ETWA 2XF6A 2XGDA 2DO7A 4B1RA 1J98A 5DUIA 1EA3A 5ILSA 4LG0B 4G7OF 2RKHA 2FD5A 1IV6A 5GADJ 1X19A 3BPXA 4A3IK 3V7CA 4HEA2 3LFUA 4OIQA 3I4NJ 5FLXK 2X6XA 3BTCA 2M5WA 3GCMA 1WJEA 3LSTA 2XPVA 3D0SA 2R7SA 2R7OA 5CLSA 4GFBA 2IW5A 2GLOA 3VYUB 2ISYA 3S2HC 3KX2A 2JA7C 2K4JA 4RM3A 4O3MA 3HOXJ 2KIMA 1TWAA 3D5SC 3AQPA 1G3YA 5E1WA 2XCQA 1YJNI 1LEAA 2VOOA 1UJ8A 2E71A 4BUPA 2CSOA 3HOZK 2OQGA 3I3LA 4IHYA 4YRVA 2CFAB 3IWZA 5C4XK 3M8EA 4M72A 2STWA 1E3PA 3ZN1A 2XAUA 5F1RA 1IAWA 2A3SA 3AG3H 4CZCA 3D1NI 2DA6A 3F9KA 1IN4A 3IL2A 5FFXA 1R23A 3LNQA 3LSMA 2BE5F 3MMYB 4X6AK 2EIMH 4G0WA 1RR7A 3NWSA 5K1YA 2Q2EB 2QKLB 4BE1A 2P5VA 1JKRC 1XS9A 2FMLA 1TWGC 2W84A 2R93A 3RYPA 1USMA 4A3IJ 2CYYA 3H5AA 5K7FA 3GUDA 3FX3A 1DDNA 1ZXOA 1HSTA 1D5YA 1Z21A 1X3WB 3VYSB 4E4HA 2EZKA 1VH2A 4AH6A 3TTGA 2DMUA 3CCEI 3VA7A 1SMYF 1SEUA 3E1SA 5CVIA 4IZZA 2X48A 2C6YA 4M3DA 1QO0D 1BGWA 2R92A 3R0JA 2VC0A 1W4MA 3CCLI 2VBXA 1VI0A 1EI6A 3ASOH 1X1CA 2DA7A 3HOZJ 2NVQK 2CW0A 2IS6A 2VOPA 2ADUA 1GHCA 1Y6IA 4CUGA 2FX0A 4ZTFA 2JSCA 2A6TA 5C4XJ 3ZXSA 2W57A 3JR9A 2PLYA 3EUHC 1T38A 1ON2A 1YI2I 1IUFA 5IYBC 1KQ9A 4EM1A 3HM5A 4AYBA 3K1MA 2DQLA 1T8IA 4CGZA 4A93C 4Q5SA 4DYRA 2Z99A 2BOLA 1ZR2A 5JFEA 2DT7B 4RMFA 4I01A 3UNGC 3NRVA 3IH2A 2VT2A 4ZYHA 1IE0A 2H6CA 3CMEI 5FRNA 1EH1A 1ERDA 2RREA 2P0WA 2EK5A 2M34A 3EUAA 3PNVA 4DDQA 3HOUK 1DP7P 1EH7A 1NG6A 2QYOA 3HB9A 2DODA 2LP0A 1B1BA 3C2GA 1C0WA 3WODA 3K0LA 4KB4A 2R7ZJ 2A07F 2HNHA 1BC8C 3RPQA 3Q0UA 1GT0C 2P7VB 3M7GA 1MSEC 2NVYA 1YX3A 2BZTA 3OIOA 3T8TA 1UB9A 3WHBA 2NVQJ 5A2QK 2F4OB 1RZ4A 2FOKA 3WTYC 2HZTA 2CG4A 4LITA 2H94A 3L2CA 4OAYA 1PP8F 2WAEA 3EPZA 1NK2P 1SFEA 3MZYA 3J81Z 3K2ZA 4XLPA 3MKYB 1MZBA 4YELA 2VIXA 5DTDA 3R60A 1TW2A 2OV7A 1ODDA 4XBFA 3J7AO 3TFJA 4KT5C 3BOQA 3O6BB 4LD5A 1G3TA 1D5VA 5F0HA 4OIOA 1A36A 1LVKA 2BYVE 2W1OA 3O8HA 2JN6A 5H6QA 1D0ZA 3SQNA 3N4MA 1HA8A 2JA7K 1X31C 3WTWC 2HOAA 4IVNA 3DWLE 4MEYA 3UKGA 1JJ6C 4BY1C 2P4WA 2WY7Q 1RU0A 1S5LC 4RAFA 4XMYA 1HC8A 1EKEA 1WKMA 1VJEA 2HFHA 3F22A 1XZQA 2GAGC 1BW6A 1KA8A 3SFZA 3TO6A 3OSGA 2DMNA 2KT0A 1A04A 5DM6F 3M3YK 3K4BA 2IGMA 3H3UA 3T8RA 2ZUFA 3IAS2 1Y1WC 2XPWA 2M3AA 4DYCA 1XPPA 1XXCA 3R4KA 3CCJI 4Y4RA 2EIKH 1FLIA 2VXDA 5JR3A 3K4LA 3G4CA 1TWCC 3GFMA 4CYCB 2CV2A 2PN6A 1J09A 2L0KA 1FBUA 4RGSA 3T00A 2G7UA 2DOFA 4OIRF 4WCGA 4EGZA 2FNPA 3W2AA 1TWGK 2XAJA 4LK0A 3DBHB 2R5YB 2EV0A 4BKWA 3DXJA 1V3FA 3IV5A 4C3IK 3OWTA 3CDLA
chains in the Genus database with same CATH topology
2XKOA 3LQRA 4Q47A 5L3BA 3I64A 2W25A 2GXGA 4GTBA 1KYWA 1TW3A 3QU3A 3WGIA 2QQBA 2ZXJA 1HXDA 1FOKA 1FT9A 1BBYA 2B0LA 4ESJA 1SD6A 3R0AA 2F5CA 3QAHA 4K2EA 5LRRA 5EEHA 2M8EA 4Y13A 3MQ0A 4EJOA 3WTUC 2IA2A 3I5UA 2FEZA 3JSOA 1XGMA 3ECHA 1WIHA 2GIVA 5JVOA 4OOIA 2RDPA 2PFBA 2NVXA 4ZYGA 3BDDA 4JK1X 4L9NA 3DFGA 3ERED 4YIIA 1BI3A 2HTJA 1V4RA 4KFCA 1FWZA 3MMLB 4M73A 3JTHA 3SXYA 5JI6A 4BLAA 1AWCA 2HS5A 2HWVA 4KMUX 3L00A 3TQNA 5D8KB 4RGRA 5AIPA 1HKSA 3HTUA 1QZYA 1DUXC 3HIFA 3J80Z 2TDXA 4BHBA 3EYYA 4BLBA 2X4HA 1Y0UA 3W6KB 1BI0A 3H0GA 2YU3A 3QX3A 4IRGA 2FE3A 4KMAA 2L02A 2FBHA 2A6EF 4BYYA 3GTMA 3U1DA 4EM0B 4HW0A 3DV8A 4LLNA 4Q4ZF 2D2WA 2Y75A 1Z91A 3WU0A 2Y48A 3K9TA 1P4WA 4KARA 1F1ZA 4HV6A 4EMSA 4IJAA 2CO5A 2HKOA 4LJZF 3GX4X 1IXCA 1I1SA 4GTLA 3N3YA 1O24A 4ENJA 3FKIA 1G6NA 3F21A 3TDZC 3DQVC 1W5TA 3QPHA 3PFIA 4P9UA 4JQFA 1TBXA 1O7LA 3ABUA 3GTLA 2VXZA 5LHGA 4GYGA 5IT9K 4N9HA 4FX0A 4YG2F 3K1NA 1YW8A 5EEGA 2DK5A 2JH3A 3KP2A 4ILDA 1T98A 3IHUA 4GTEA 3BROA 4IHTA 3EDPA 4NB5A 5IT3A 2P7CB 1ZBSA 2QQ9A 2XIGA 1SMTA 2EFQA 2GWRA 2JA5A 4P5OA 2FBKA 4HF1A 3HOSA 2XRNA 4EJUA 2QWWA 4FX4A 4N9IA 5ERIA 4RAYA 2MLGA 5DEQA 2DBBA 2J5PA 5TJJA 2GSNA 2KJCA 2RGRA 2W24A 5IOTA 4EJWA 2GXBA 1CF7A 2V79A 1OR7A 4NHJA 3TKYA 1Y1VA 3I4PA 2MD5A 2P5MA 1S6LA 3NQOA 4KMDA 1ZG1A 1JE8A 4UHTA 1U8RA 1UHMA 4KAWX 1X3UA 4ON0A 2E1NA 3WGHA 1YW9A 1S29A 2ZMEA 3U9GA 4KNYA 1FX7A 2LSOA 4RAZA 5JFRA 1FSHA 3GO5A 2ZCWA 3AH5A 4GXOA 3V4GA 1U5TA 5BPIA 3HSFA 4KICA 1ZG3A 2EB7A 1MJ9A 3F8BA 3D5LA 5HS9A 1MDMA 4ZZLA 1B6AA 1YQAA 5E17F 3TGNA 4A5MA 3I53A 4RB1A 3RKWA 5HVQC 1IF1A 5H20A 5H6RA 1W5SA 3PQJA 5FFZA 2QM3A 2XASA 3ZN0A 2L4AA 2X0LA 3HHHA 1XGOA 2EFOA 4A0XA 5FO5A 3HUGA 5HS8A 3E3VA 1XMAA 1TTYA 4BH9A 2BEOA 4IRHA 2Q8KA 3F6VA 3IKVA 3BY6A 2YX4A 1YTYA 3FMRA 4I0BA 1RUNA 1P4AA 5J8FA 1XGNA 2OU2A 3RDIA 5LGTA 4A6DA 1MGTA 2HYGD 1GXQA 1QQIA 5CHPA 4CXFA 5FB2A 4YFXF 2D1HA 4O6JA 2VE9A 5K5OA 2QQAA 3GWZA 2AS5F 2P5LC 2A61A 3IRQA 3T1BA 4YIFA 2LKPA 2DTRA 2ETHA 5TRDA 1XD7A 1W7PA 1LDJA 4WWCA 1T6SA 2GA2A 4G7HF 5FD6A 3ZP5A 4I2OA 5L3EA 1PUEE 2W85A 3KETA 1CGPA 2G9WA 2YSRA 2RGVA 3H92A 4RB2C 3H3ZA 1HKQA 1XSXA 4HLYA 2PBIA 3C1DA 3LA3A 2RN7A 5KVRA 3VFZA 3F8CA 1YS6A 5DCMA 2DAOA 1ZRDA 2K02A 2P6SA 4MQVA 3WTTC 1BOAA 4ZZDA 3EETA 4UUVA 5ILVA 2KRFA 4YFNF 1UHWA 1QGPA 1LVAA 5CVRA 1CF7B 5HDGA 2ACJA 5HLGA 1IN8A 2EV5A 1XN7A 2DFIA 2EJRA 4CZZA 3G3ZA 2VN2A 1QZZA 1BIBA 2ZMEB 3DPLC 3O2PE 2YPRA 1T2KA 4ZYEA 4LLLA 1I6XA 4Z2YA 1SD4A 3ZMZA 3IKTA 5L3CA 2F5EA 2YR2A 4E70A 1BJAA 3J81K 1JGSA 1L0OC 1U5TB 3OOPA 1ZRFA 1YLFA 4G7ZF 2UXNA 1ZVUA 3RJPA 5L3GA 4KN7X 1TQMA 3HRUA 2IRFG 2STTA 1D3YA 1YS7A 2AXLA 1O2AA 1BC7C 3KLNA 2PMUA 1MDMB 5D5UB 2O6GE 3LWFA 3F8MA 2MC3A 3FXRA 1PDNC 3FMSA 2UWMA 1YYVA 3KCCA 5LGNA 2NYXA 5EGHA 2LDUA 2IT0A 1LB2A 1ZAOA 5E1XA 1B9MA 3ML6A 4AIKA 1HW5A 3MCZA 4KM8A 3EQLF 2FA5A 2F5DA 1TWGA 2VONA 2PI0A 4G6QA 4EQQA 4KATA 3ELKA 3FXQA 2O8XA 1XXBA 3LQQA 3K1PA 2EA2A 3GZ6A 5BOXA 4HOBA 3V8LA 1I5ZA 1FP1D 4KM9A 2DPUA 1R36A 1DD5A 2EFPA 4I02A 2FNAA 3E5QA 4HF0A 1O26A 3EUHA 4BNCA 3DP7A 4U0YA 3E6CC 4PGGA 1WWXA 4HQMA 3C7JA 5KK1A 5LBQA 1R22A 1J75A 2G7HA 3KLOA 5LEJA 2IVMA 1W7PB 2J5OA 1XSVA 3GTPA 1ZYRF 1XB4A 1USTA 3RYRA 5TJ3A 5CVVA 2ESNA 4HX7A 4HX8A 3KZYA 2ZNZA 3DEUA 2RVCA 5J8CA 1SAXA 3S2WA 5D4SA 1IXRC 3GZ5A 3BJAA 3CUOA 4GO1A 4KUMA 3HTSB 4LFUA 2PEXA 3I54A 2JA6A 1BIAA 3CO7C 4CICA 5A2QZ 2PG4A 3Q3QA 5DCMB 1OKRA 1K79A 3RKYA 3J80K 1WQ2A 4H0EA 1O3SA 4L0YB 3F23A 2O03A 3AQOA 1YIOA 3OPFA 4I09A 5CJ9A 3T5XA 1TLHB 5DDGA 3KP3A 1Y1WA 1YG2A 2XHKA 1I3QA 1OMIA 1E2XA 2XCRB 3VEPA 5CVJA 5E18F 3LAJA 2A5YB 1LJ9A 3QRFF 3KP5A 1U2WA 1O25A 1SD7A 5L3FA 4BHCA 2QENA 5F6FA 2E2IA 5E8GA 4ETSA 4UVCA 2VBWA 1O28A 2NS0A 4MGRA 2V6CA 2EFNA 4BQAA 3ECOA 1O29A 2JZYA 4IXAA 1WQHA 2HOEA 4JBAA 1QBJA 4L0ZB 4I0AA 4KIGA 3FWEA 6PAXA 1J7KA 3W6JB 3LPXA 3ZPLA 2NNYA 4RS8A 4LMYA 2IP2A 3BPVA 4U0VA 3GFLA 3M9AA 1KQ4A 2D1VA 4G6DA 4CHUA 2VODA 1OPCA 1ZREA 1USSA 4ENNA 4KC6A 3KP4A 1FYLA 2MBFA 5DYMA 3ULQB 3FXUA 3FM3A 2QZ8A 1XSDA 4M6XA 4A0YA 4GTAA 1BJTA 2OQRA 2K4BA 1K83A 2Q0OA 2CW0F 3LA7A 1MD0A 2PHCB 3GTQA 1RUOA 4S05A 2H6BA 2EFWA 1L3LA 5D5WB 3COAC 1NHAA 2QVOA 2QLZA 4Q5SF 1H0MA 2WV0A 1HQCA 4RB3C 2VBZA 3V8KA 5FGMA 2RC4A 2NNNA 2HKXA 5D5VB 1P4XA 4UVBA 4U7BA 2XAHA 3S0XA 1TQIA 4XSXF 4HDVA 4FZBA 4OMZA 1UFMA 2MA3A 4R8HA 3NUHA 5FD5A 2RV8A 3IRRA 3GTKA 2IPQX 1F4KA 2ESHA 4HX4A 1F9NA 4OIOF 3DF8A 1B4BA 4MEYF 2K7LA 1QNTA 4CO8A 1O3QA 4IHSA 1XMKA 4GFQA 4PZJA 1KU9A 4A2UA 3LFKA 5ILUA 3CDHA 2Z9OA 3KP7A 1Z9CA 3R61A 1WSUA 3B73A 2FQ3A 4HBLA 3CAGA 3FHZA 1UCRA 2CWEA 3CUQA 3FMQA 5ED4A 2BBYA 4R79A 2O61A 2P8TA 5ICEA 4L5JA 3V7SA 4LK1F 1R1UA 2GA1A 1TWHA 2R7FA 3GFIA 4A5NA 3CQZA 5IT9Z 1T0FA 4QWQA 2Y3PA 4C2MC 3R6SA 1IS1A 4ENMA 3MFKA 5IOQA 1ZN2A 2E2HA 1EH8A 4U88A 4KDPA 4L9JA 3WTVC 4WK8F 2JTVA 1WRJA 3FM5A 4EV0A 3OV8A 4P9FA 1ON1A 1HBXG 2YU9A 4HAMA 3KEOA 4AIHA 4WX9A 1DPRA 5ICGA 3VOEA 1IN6A 3HRMA 2OBPA 1FBSA 3ABTA 1BN5A 2M30A 1TNTA 2ZFWA 4CDGA 3MZHA 3TOBA 2HEOA 2YX7A 3QP5A 2JRTA 4AD9A 1SFXA 5HDKA 4LLGF 1J5YA 2Z33A 2MLKA 2JPCA 1S8NA 4M9ZA 2ZNYA 4FT8A 5E1ZB 3RKXA 1RIOH 3DKWA 2JPBA 1D8JA 5ICCA 1TQPA 2OZ6A 3ISPA 2RNJA 1EH6A 1BM9A 1H9TA 3I59A 2B63A 3FOFA 2H27A 5ICFA 3WTXC 2Y0MA 2XV4S 4LB6B 3F6OA 4AIJA 2FU4A 3QP6A 2KIFA 4Q48A 3RIRA 1D8KA 3O3KA 1K6OA 4WXHA 4GYIA 3HSRA 1KGSA 1J2XA 4I98B 4ENKA 3PQKA 4U7DA 3E5UA 2IJLA 2P6TA 2EA4A 5E8IA 3V8JA 1OYWA 3M8FA 2H09A 4B09A 1HW2A 1E17A 5JHUA 4MEXF 2MH2A 3GEZA 3TO9A 2PQ8A 3OEPA 1XCBA 2JT1A 2CGPA 3OREA 2XGXA 3BZ6A 4L9TA 3VB2A 4UVAA 2CQKA 3CTAA 3WE2A 1FNNA 2E7XA 4ASNA 4CYDA 2R7DA 2R7ZA 5E20A 4AWXB 1FZPB 3Q5FA 2E7WA 2LNBA 1GVJA 4C3JC 3I58A 5D4RA 1O57A 3T0YA 3GTGA 4EM2A 2HQRA 3L9FA 4MTEA 5DUKA 2DLLA 5IORA 1W7PD 5CVUA 1FY7A 2XKPA 2ZFZA 2DPDA 3CUQB 3JAMZ 1SD5A 2A6HF 4IRIA 4GCVA 2A69F 4YFKF 3CJNA 1S7AA 1STZA 1FYKA 4LQYA 4LB5A 3KP6A 1REPC 1YW7A 2DT5A 4C3IC 2GZWA 1J9IA 5BPDA 4F7ZA 2FSWA 5LEKA 1ZLKA 2K86A 3EYIA 2JA7A 3B02A 5AIQA 5FLXZ 4ZYDA 3JSPA 4KASA 2IA0A 1B9NA 4D0PA 2ZKZA 3GFJA 5HDNA 3U2RA 2O3FA 2FMYA 2O0YA 4G0VA 5BS6A 4KMHA 2EV6A 3Q9VA 3KFWX 1U3EM 3FF5A 4OU0A 4DQ2A 3ZMSA 2KWAA 2XVCA 5HOOA 1LEBA 1FPQA 2P5KA 3WE3A 4S04A 1KU2A 3C18A 3MAJA 4IPAA 1IRGA 3REOA 1ONVA 1Z6RA 1ZGJA 5LRSA 2LF7A 3N97A 1I27A 4NQWA 1BI2A 1PP7U 2R3SA 1WQGA 3E5XA 4MNUA 3DPTA 3RTRA 4OMYA 3F3XA 1FYMA 1IN7A 2WC2A 4KN4X 2HDCA 1TNSA 4KA4A 2F5FA 4M74A 2OAZA 3KE2A 1OYYA 2MH9A 4WXDA 2ISZA 3BWGA 3I59B 1ZARA 3SZTA 5EGEA 2M87A 3WU1B 1IW7F 1Z1DA 3MWMA 4MTDA 4EVIA 2IA1A 3ZQ7A 3K69A 1K78A 3N0CA 4PDKA 3I71A 1I1GA 4I7HA 2QBYA 5F64A 2HR3A 1P6RA 2HQNA 1QPMA 4UXNA 5LGUA 2M45A 2FXAA 1R58A 5L3DA 4IF4A 3L09A 3G4AA 1ZRCA 2F2EA 1YO5C 5AONA 2HYFA 4EGYA 1U6GA 2VE8A 3E6BA 2KKOA 4HQEA 3RI4A 1G3WA 4EJTA 2DQRA 3CLOA 4HF2A 1IXSB 5D5XB 1YFHA 2DK8A 2DU9A 4TV7A 2EWNA 4Y15A 3TO7A 3ZMTA 4MHGA 3P7NA 4ESBA 1LQ1A 2L3DA 3SHFA 2GAUA 3LAPA 1TWCA 1MKMA 4O5VA 4BHPA 1HKTA 4A12A 2DI3A 4G8XA 5LHIA 2XAGA 1K7AA 3ZMDA 4J3NA 4HLXA 4G0UA 4OIQF 2Z3YA 3NEUA 4M71A 3TOAA 1R1VA 2NAZA 3GLXA 1BI1A 1JXSA 1WI9A 1KYZA 4R1HA 3BJOA 5K5QA 3CO6C 1FP2A 4U0WA 2XUBA 1J0RA 3KZZA 2PMHA 1IUYA 3WTZA 1ZGAA 2KJBA 2FF4A 4MQ9F 1GE9A 2VBYA 2ELHA 4UV9A 1SFUA 2XROA 3BJ6A 3MEXA 5IOSA 1B4AA 1XDSA 4KIBA 2DW4A 4G9YA 2OA4A 4KMFA 3F72A 1O2BA 2UZKA 1XGSA 2M1BA 3HOTA 5HLIA 1KU7A 3HSEA 1IRFA 5D6FA 1HW1A 4C3HC 1S7OA 1IN5A 5DCFA 2V1DA 3SZPA 5J6XA 1WCMA 2GSUA 5JVTA 4QLCU 5BQTA 4KB2A 2QUFA 4ZH4F 4ESFA 1EV7A 1FC3A 3QU6A 3E6DA 3FOEA 2K27A 2GSOA 1O3TA 4FHTA 3N0BA 3TDUC 1DPUA 1EK8A 1G4DA 1Z05A 3VODA 4P5AA 5DD8A 5D8LB 2WWYA 2E1CA 1VTNC 5DV5A 1ZHFA 4KYWA 3Q9SA 3ROUA 1Z6TA 4KDDA 5D6EA 3GYHX 4KIFA 3WODF 2VUMA 3M1EA 1FSEA 1O27A 1GXPA 4XLNF 1KQ0A 1I50A 4HV5A 1T39A 2ZJ2A 3GF2A 1XXAA 2HGCA 3WGGA 3G73A 3CUQC 3E6MA 3P9CA 4N0BA 4M9SA 3WTSC 4XLPF 3FZVA 4GTCA 1ULYA 1K78B 1Q1HA 3I0TA 5LHHA 3JW4A 2CFXA 2QBYB 4LR2A 2Z5UA 4L9VA 3QPTA 5CYVA 4OINF 1U5TC 4GT9A 2D45A 2COMA 4LG0A 5K5RA 1R9TA 1JHHA 3HYIA 1LNWA 1R5GA 4BXUA 1WQFA 4P5BA 2HTSA 1RI7A 4HZFA 3AAFA 4UNOA 2BGCA 5BMZA 1U78A 4A6EA 1R00A 4LK0F 4XRFA 1IZ1A 4LGWA 4Y17A 3DXJF 3ZMVA 2FBIA 1TWFA 4RB0A 2CFAA 1XDUA 4L18B 1B59A 3BP8A 3C3WA 2GQQA 4M9XA 3IC7A 3RPUA 1LDDA 2LF8A 1MJBA 2Q2EA 4AVPA 1O7FA 2RQPA 2XCOA 3BUEA 4B8XA 3V7RA 1KQ8A 4HYEA 3ZMUA 1FBQA 4DNCA 3IWFA 4HA8A 3KEQA 3GW2A 5DD4A 3QOPA 2NRAC 2XAQA 2OD5A 2VC1A 1R5HA 4EJVA 4GTDA 4UV8A