3LAJA

The structure of the intermediate complex of the arginine repressor from mycobacterium tuberculosis bound to its dna operator and l-arginine.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
156
structure length
149
Chain Sequence
b'AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
pubmed doi rcsb
molecule keywords Arginine repressor
source organism Mycobacterium tuberculosis
molecule tags Transcription regulator
total genus 43
structure length 149
sequence length 156
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3lajA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3lajA02
1W5TA 2PLYA 3C3WA 1ZG3A 3HRTA 2NRAC 3JAMZ 5TRDA 1B4BA 2EFNA 1IF1A 1F1ZA 1XGNA 3FXUA 4L9NA 4BHCA 2GXGA 2FMYA 2M5WA 3BZ6A 4ASNA 3PQJA 3GVAA 1DP7P 3WGHA 3ZMTA 1FOKA 3TOAA 2VBZA 2X0LA 5JI6A 4EMSA 4A6EA 1TNSA 3FMQA 4ETSA 2DPUA 1KYWA 4Q4ZF 3WE3A 1ZAOA 3H3UA 4RGSA 5CVIA 2Z5UA 1EH7A 1BIBA 2PG4A 4WWCA 3DPLC 3T8TA 3CJNA 5K5RA 2CQKA 4HF1A 1KYZA 4RB2C 1LQ1A 2W25A 3F8NA 5LGUA 5DUKA 1B6AA 5L3DA 2HR3A 3HSFA 4UXNA 1MZBA 1ONVA 4LFUA 3MMLB 2QZ8A 1PDNC 3E6CC 4U7DA 3KP4A 1KU2A 5H6QA 5H20A 3C7JA 1HXDA 1D3YA 4EV0A 3K2ZA 1H0MA 1FSEA 4JK1X 2M8EA 1LJ9A 3BPVA 5J8FA 1P4WA 4ZZLA 1XB4A 1Z05A 1UHMA 3IC7A 5CJ9A 4IHSA 4FHTA 4BH9A 1IW7F 1XDSA 2A07F 2STWA 1REPC 2RVCA 4HV5A 4WXCA 5AIPA 1O57A 1ZG5A 2GAUA 2E7XA 3K1MA 3VEPA 3F72A 5D8KB 4RAZA 2JTVA 1P6RA 5E1WA 1I1SA 4ENMA 2VOOA 3R4KA 3P9CA 1H9GA 1FBQA 3RKWA 4OMZA 2P6TA 3I64A 2VC0A 4QWQA 2CYYA 2YX7A 2D1VA 3RIRA 1SFUA 5A2QZ 2R7DA 4IF4A 2FXAA 3GZ6A 1K78A 1ZYRF 3FF5A 3V8LA 1J75A 1HW2A 1BC8C 3TDZC 2WWYA 1IRGA 4EGZA 3ML6A 3L09A 3D5LA 5BPIA 5ERIA 3MFKA 2W57A 3E97A 1O7LA 4HYEA 3KLOA 3WTXC 4GYIA 4IXAA 3HSEA 1HSJA 4YFNF 2P8TA 3KP2A 3TO6A 1IRFA 5FB2A 5IT9K 2KIMA 3F22A 4L5JA 4ZYGA 5HOOA 3DXJF 4Q5SF 1QBJA 4A2UA 1R7JA 3CLOA 5LEKA 2A6HF 2EFPA 1QZYA 1LVAA 1MGTA 3C18A 2CGPA 3RTRA 2W84A 1YLFA 1XCBA 1I1GA 4BAYA 2J5OA 4CHUA 2NNYA 2FBKA 3L9FA 2RGVA 4FT8A 1G3SA 3E5UA 1AB4A 1W7PA 1R23A 3GYHX 2DPDA 1XXAA 1FZPB 5ILVA 4YIFA 4KN4X 3FHZA 3M7GA 2QBYB 2GA2A 1ZLKA 1YYVA 3IWFA 1B59A 4EJVA 3IHUA 4N9IA 1EK8A 4F7ZA 5DDGA 3O6BB 2KIFA 2WTEA 1RI7A 4HV6A 2UZKA 2EV6A 4GCVA 3EDPA 3WU0A 4AIKA 2O03A 4XLPF 2CO5A 2EFOA 4Y15A 2KRFA 2JRTA 1YTYA 4AIJA 3BPXA 3DP7A 4YIIA 3GF2A 3E6MA 4EGYA 1JXSA 5ILSA 2HZTA 1RNLA 2FOKA 2OAZA 1EH6A 1R5GA 1OYWA 4KICA 1FBUA 2OU2A 3OOPA 3P9KA 4Q47A 4GYGA 1W5SA 3LA2A 3ZMZA 4I2OA 4J3NA 4UHTA 2P5KA 5E17F 4P96A 2KKOA 4HBLA 2LF7A 1ULYA 2E1CA 5JHUA 4LD5A 1KGSA 2L4MA 1ZARA 4KNYA 4U0VA 2A68F 4G6QA 2AXLA 3ZPLA 3FWEA 5K5OA 2HWVA 3F6VA 1BC7C 1XN7A 2DK8A 5E18F 2HYFA 2Z99A 1ZGAA 2GZWA 2UXNA 3BUEA 3MWMA 2OQRA 1U8RA 1YS7A 2JPBA 1GXQA 2COMA 3TO7A 1YW9A 3B02A 4OOIA 2ISZA 2HQRA 1UFMA 3T8RA 3IRQA 4HDUA 3SZPA 4JBAA 5L3BA 4EM0B 2ZFZA 3F8MA 3KLNA 2O61A 3GFMA 3RI4A 1WI9A 3HTSB 1J0RA 3O2PE 1S8NA 2OZ6A 4I0BA 3I0TA 4LLGF 2M45A 4XRFA 2J5PA 3DKWA 1QZZA 1FY7A 4D0PA 1IS1A 5EEHA 3PFIA 5D4RA 4PDKA 4P55A 2W85A 2D1HA 3J80K 3GFIA 1U2WA 2DTRA 4GGGA 3KP6A 4OIPF 3WGIA 1USSA 3MEXA 4JQFA 3BJAA 5E20A 2QBYA 2ZNZA 2MLKA 2VOPA 3E3VA 2MH2A 1O3QA 4RGRA 4NQWA 2RN7A 5HVQC 2DU9A 5E1XA 1OYIA 3L00A 1TTYA 3ABTA 1R36A 4O5VA 1FLIA 5FD6A 2V1DA 1R00A 3ECOA 3JSPA 4OIRF 1KU7A 1XMKA 1J9IA 3TDUC 1R1VA 2HTJA 2HGCA 1PP7U 3L7WA 4ON0A 4R79A 5HS8A 2PMHA 1HQCA 2O3FA 2MC3A 4HAMA 2FNAA 2P5VA 1EH8A 2BBYA 4ZYHA 2L3DA 1H9TA 2G7HA 2IA1A 1Z9CA 3H92A 4XSZF 3F21A 1T98A 4OINF 2IW5A 3HIFA 3U1DA 5D5VB 3CDHA 3RDIA 5BMZA 1S29A 5HLGA 3H3ZA 1PUEE 2EWNA 4PZJA 1TW2A 2ADUA 2MH9A 4KIFA 2XCQA 3K9TA 1R1UA 4UVCA 3N97A 1GVJA 3JTHA 5LHIA 3ABUA 4KAWX 1U5TB 4BHBA 2ZMEB 4P9FA 4LG0B 1RUOA 4BNCA 2PBIA 3RPQA 4O6JA 5CLSA 1FT9A 4M9SA 2IPQX 3CUOA 3LA3A 5BQTA 1T0FA 1G6NA 3GLXA 1MDMB 2XIGA 5D8LB 5ICEA 1SFXA 1I6XA 4UVAA 3BWGA 3SXYA 4UV8A 4AD9A 4ZYEA 4QLCU 1CF7B 4L0YB 3QOPA 2RC4A 4ESFA 1WIHA 2NYXA 2ZKZA 1RIOH 4YFXF 2VC1A 4HLYA 1K6OA 2RKHA 4O3MA 4KN7X 4XBFA 1ZRFA 1BGWA 5BOXA 1S7AA 3V8KA 5DUIA 5F64A 3IL2A 1BJAA 2F5CA 2EA4A 2KWAA 2BGCA 3LA7A 5LGNA 3MZHA 2RDPA 3DV8A 4A6DA 5KVRA 3V8JA 2HQNA 4LMYA 3V7CA 1TLHB 5DYMA 4DDQA 3O3KA 1AWCA 1SD5A 3FMRA 3ZMDA 2W24A 3E5XA 1B9MA 1ZHFA 2OZUA 2KJCA 3HOSA 2QM3A 1PP8F 3WE2A 2VN2A 2OD5A 1KU9A 3R0JA 3QX3A 2JT1A 4Y17A 1ON1A 4FX0A 4G7ZF 4L5IA 4ZZDA 4WXDA 5LRSA 3OEPA 1BBYA 4Q48A 4U0YA 2RNJA 5FO5A 3OREA 5E1ZB 1J7KA 1USTA 2BE5F 3M1EA 3TGNA 4A5MA 1Z1DA 1XSDA 1T38A 1YO5C 3TO9A 2EFWA 4EJUA 2LF8A 4K2EA 2CFXA 5CVJA 2H27A 4LB6B 2M1BA 2FNPA 4WK8F 3WG9A 4G7HF 3KP5A 5L3GA 3I71A 4S04A 2XCRB 1BI1A 3NUHA 2EFQA 6PAXA 5K1YA 3FOEA 2UWMA 4RGUA 4ENNA 4IPAA 1FSHA 5D5XB 1HKQA 4HLXA 1Z6RA 1ZLJA 3EYYA 4FX4A 2QENA 1MJBA 2VT3A 3WTTC 1KQ8A 3JW4A 2VT2A 1FX7A 3HHHA 2CWEA 3F8FA 1D8KA 3D0SA 2H09A 2ZMEA 2IVMA 3HSRA 1V4RA 1IN4A 1IUYA 2PI0A 4LG0A 4NHJA 5EEGA 4WX9A 3IKVA 4L9JA 2K4JA 3KFWX 4KB4A 2K4BA 4IRGA 3GW2A 3RYPA 1YW7A 1FYLA 5HS7A 1MDMA 1BOAA 3MQ0A 2G9WA 1IN7A 1BJTA 1G4DA 1CF7A 2F2EA 2OA4A 1STZA 1FYMA 2CG4A 2P7VB 2BEOA 4FM9A 3NQOA 5D5WB 5FGMA 4L9VA 2HYGD 2GA1A 2HEOA 2B0LA 5CVRA 1DPRA 2ZXJA 2XASA 3GX4X 1U78A 3R0AA 3FX3A 1XD7A 3SFZA 4OIQF 2IP2A 1IN6A 3JSOA 1C0WA 3E5QA 5DD8A 2TDXA 4Y13A 2ZNYA 5HDKA 5FLXK 3FOFA 4UUVA 4XLNF 1OMIA 1GHCA 1WSUA 2V79A 5E8IA 4A12A 2NAZA 2PMUA 4IJAA 4M6XA 4GXOA 2PHCB 4CGZA 5DEQA 2PEXA 4B09A 4EM2A 2QQAA 2ZJ2A 1FBSA 4MQVA 5HLIA 2FRHA 3MCZA 2RQPA 2A3SA 3WGGA 1R58A 5F6FA 1LDDA 3RKYA 2DFIA 2XCOA 2JPCA 4IRHA 5LGTA 1UHWA 1OPCA 2DBBA 3V7RA 2GXBA 2A5YB 2F5DA 2L54A 3ROUA 1BIAA 2FBHA 3U2RA 5IT9Z 4MNUA 2MLGA 4RGXA 3WTWC 2ACJA 2ZCWA 2RGRA 3FM5A 4KT5C 1VTNC 1Z6TA 1R22A 1X3UA 4GFQA 1HW5A 1F5TA 3R6SA 2PQ8A 4WCGA 1YS6A 2XAJA 3WTVC 3KZYA 4Z2YA 3K1NA 3VFZA 3LWFA 2DT5A 3F8CA 4I7HA 1QQIA 2C6YA 1SD6A 2XV4S 3W6JB 1W7PD 2WV0A 2NNNA 2EV0A 2AS5F 2EA2A 3VB2A 3J81K 3HOTA 2JZYA 1EH1A 3N4MA 3QU3A 3OPFA 4MHGA 2FA5A 2EB7A 5E8GA 3TQNA 1W4MA 4KIBA 2HDCA 2VODA 3HRSA 2F5FA 1FC3A 1JHFA 4HW0A 1YW8A 4HQMA 4KIGA 4R8HA 2Z33A 2KIUA 3RKXA 1S7OA 4KYWA 2DAOA 4NB5A 4YFKF 1DD5A 4WXHA 3U9GA 1K7AA 3JAMK 5JFRA 3I4PA 5CYVA 4G0UA 1AOYA 2JSCA 5L3EA 2QVOA 3HHGA 1MKMA 1T39A 2XAGA 3DF8A 1CGPA 3P9IA 2H94A 1TQPA 3ZMUA 4ESBA 1DPUA 2LDUA 1E17A 3C1DA 4KUMA 3ERED 2IJLA 1DDNA 3LPXA 3RPUA 1KA8A 1HSTA 3QRFF 1HKSA 1OR7A 1BN5A 5DD4A 1ZRDA 4RB1A 3E6DA 5LEJA 4A5NA 2QWWA 2UXXA 5ICCA 1FPQA 3TKYA 4A0ZA 3CUQC 3VA7A 1ON2A 5JR3A 1B1BA 3CO6C 3ELKA 4LLNA 2DQRA 4EVIA 1P4AA 2XRNA 5ICGA 4MEXF 4EJTA 1HBXG 2OQGA 2L01A 4I98B 2STTA 1LB2A 4PGGA 2IT0A 2LNBA 2V6CA 4ENKA 2FBIA 2ZBKA 3ISPA 1S6LA 1U5TC 3GZ5A 4KMUX 3CO7C 3E6BA 3SHFA 1IXSB 2MBFA 4IHTA 3CUQB 1ZREA 2A61A 2L4AA 1LDJA 4LJZF 3K1PA 2BV6A 1B4AA 1K78B 4L0ZB 1XCVA 4L9TA 2GWRA 1G3WA 2QYOA 2XHKA 4MQ9F 5DV5A 3WU1B 1SD7A 2D45A 2IA0A 2PJPA 5D5UB 1Z91A 4G9YA 5ILUA 4LB5A 4M9ZA 3KCCA 4HOBA 5DCFA 1WKMA 3T1BA 1ODDA 1KQ0A 2ESHA 4DNCA 1WRJA 2XKOA 3I54A 4UNOA 1SFEA 3R61A 3ZP5A 4UVBA 4RS8A 1JGSA 1J5YA 1ZG1A 2MA3A 4M71A 4I01A 1A04A 2ZFWA 2QUFA 1XGOA 4OU0A 3QU6A 5TJJA 4G94A 3J80Z 2FMLA 1TQIA 3OV8A 5A2QK 2IRFG 2VONA 1S3JA 4AWXB 4I0AA 5JVTA 2GIVA 4IRIA 1I27A 2R7FA 1D5VA 3DPTA 1V3FA 3COAC 2YPRA 5BS6A 1YIOA 3FXQA 3ZMSA 2HKOA 1W7PB 4E70A 3L2CA 1WQGA 1JHHA 1XXCA 4ZYDA 2DK5A 3FM3A 1LDKB 4HF2A 2VBXA 5HS9A 3M8FA 3ZMVA 1IN8A 1MJ9A 5DCMB 3BOQA 1UB9A 1IN5A 1FWZA 4UV9A 2CSOA 3WTZA 4PCQA 4HA8A 4RB3C 3HUGA 5FFZA 3BY6A 2P4WA 3KETA 1D8JA 2FQ3A 5CVUA 2CW0F 4BQAA 3NEUA 1TBXA 3QP5A 4U88A 2H6BA 3IWZA 2A69F 5ED4A 1FNNA 3I53A 2XAFA 3EYIA 4KA4A 1RZ4A 1YQAA 3BJ6A 3M8EA 2PFBA 1G3YA 3QPTA 2EV5A 3AAFA 2XAQA 3GFJA 4CICA 3MZYA 3IRRA 4EQQA 4RB0A 4I02A 1O7FA 5ICFA 2K86A 3T0YA 3B73A 3F23A 2L02A 1BI2A 3WTSC 4G7OF 1GE9A 1G3TA 1QPMA 1XGMA 3BP8A 3GWZA 3PQKA 2A6EF 2RV8A 4P5OA 5HDNA 2ETHA 2XUBA 2OBPA 4MEYF 3BROA 3IKTA 1O3TA 2V9VA 3CUQA 1EV7A 2KJBA 5H6RA 3J7AO 4ZH4F 4PGHA 1P92A 5J8CA 5LHHA 1WQFA 1IAWA 1U6GA 5D6EA 1L0OC 3QAHA 4M74A 3REOA 4OIOF 3I58A 4CO8A 1HW1A 1U5TA 1LEAA 3KP7A 1ZRCA 3HYIA 1MJAA 3BDDA 1Y0UA 3FZVA 3I59B 2P5MA 5J6XA 1F9NA 1ISEA 4I09A 1U3EM 3DQVC 3LAJA 2LSOA 2HOEA 4CXFA 2Q2EA 2EK5A 2YR2A 3FXRA 4G0VA 2MD5A 2XAHA 2ZO4A 2H6CA 1FP2A 1WWXA 1ZH5A 4N9HA 4ENJA 5LBQA 2FU4A 2LKPA 3LAPA 2QQ9A 1BI0A 4HX7A 1XSVA 4G0WA 4P9UA 1F4KA 2XKPA 5AIQA 3L4JA 2K02A 1BM9A 1RUNA 3L4KA 4BXUA 5JVOA 1FP1D 2VXZA 2YU3A 3GXOA 1BI3A 4HZFA 1SD4A 2M30A 1Z7UA 5BPDA 3KE2A 4L18B 3VOEA 4MGRA 1XGSA 2YX4A 3Q9SA 3FMSA 2O0YA 2PN6A 2XVCA 2Y75A 5DCMA 3WTUC 3ULQB 2K27A 4HDVA 1L3LA 1LNWA 2Z3YA 2QQBA 2E1NA 5HLHA 3EUHA 4GO1A 5LRRA 4DQ2A 3EETA 4AVPA 1T6SA 1ZN2A 4R1HA 2F5EA 2DLLA 4MTEA 2NS0A 1NHAA 1LEBA 3F6OA 5L3CA 1KU3A 2V1UA 3ECHA 1XMAA 1QGPA 2O8XA 4MTDA 4LK0F 1I5ZA 2ELHA 3HTUA 5LLQA 3NRVA 2HFHA 5HDGA 2G7UA 3GEZA 2ISYA 2VE9A 1O3RA 1FYKA 2DO7A 4G8XA 4EJWA 3CAGA 2FF4A 2VBYA 3DFGA 4HX8A 3Q5FA 4A0YA 1QNTA 1SMTA 2V1XA 4KMFA 5LHGA 3P7NA 3S2WA 4BHPA 4M72A 3ZQ7A 1J2XA 2FEZA 3WODF 1T2KA 1R1TA 4CDGA 1IZ1A 3T5XA 4EM1A 2P6SA 2EJRA 3K69A 2X4HA 1OKRA 2R3SA 2XGXA 1O3SA 1HKTA 4LGWA 5D6FA 3M9AA 4WF2A 3I5UA 3LFKA 3GO5A 2P5LC 1B9NA 3KZZA 5CVVA 1QO0D 4KDDA 1WQ2A 3G73A 3I59A 4G6DA 2Q8KA 5L3FA 4IVNA 3GUDA 1SAXA 3DEUA 3SZTA 2D2WA 5FFXA 3KEOA 4U0WA 4A0XA 1R5HA 1P2FA 4XSXF 4YG2F 3HRMA 5FLXZ 1XDUA 4CYDA 3LSTA 4ESJA 4KDPA 3V4GA 2E7WA 3QPHA 4B8XA 3Q9VA 2IA2A 3VODA 3QP6A 3LQQA 4M9XA 2VE8A 2ESNA 1IXCA 4EJOA 2Y3PA 1JE8A 5F1RA 3JTGA 2DQLA 5FD5A 1MD0A 2HS5A 3G3ZA 1ZVUA 3ZN0A 1WQHA 2BYVE 4M6YA 3RJPA 2K7LA 3TOBA 3GFLA 3KP3A 2WC2A 1Q1HA 1OYYA 2Y48A 2VBWA 3EQLF 2QLZA 4KFCA 5KK1A 2DI3A 1ZGJA 3WTYC 1YG2A 4KB2A 4CZZA 2Y0MA 3LQRA 1TW3A 2O6GE 1GXPA 3KEQA 2DW4A 4BYYA 1UCRA 3W6KB 2YSRA 3F8BA 4AIHA 1K79A 3K0LA 5AONA 2FSWA 2GQQA 1XXBA 4N0BA 4LK1F 4RAYA 4M73A 4LLLA 4HX4A 1IXRC 4HF0A 5K5QA 2HKXA 4HQEA 3BJOA 2Z9OA 1P4XA 1YFHA 5D4SA 3F3XA 3SQNA 4U7BA 4S05A 3ZN1A 1E2XA 1TNTA 3MAJA 3J81Z 2Q0OA 4OMYA 3HRUA 2FE3A 1KQ9A 3R60A 2XROA 4KC6A 1J59A 1SMYF 3V7SA 3RYRA 1DUXC 1XSXA 5IT3A 2HTSA 1TQMA 4H0EA 3CTAA 4TV7A 2P7CB 2M87A
chains in the Genus database with same CATH superfamily
3SZGA 4C2TA 3ADAC 1I50A 3L2VA 1U0JA 1A5JA 2HVRA 1W5TA 3BTIA 2PLYA 3I4NK 3C3WA 1ZG3A 3HRTA 2NRAC 2M7AA 2V6EA 1V5FA 3JAMZ 2VUMA 1WHUA 4XR6A 5TRDA 2KRHA 1B4BA 2JQ7A 1G59A 2EFNA 1IF1A 2V7FA 2EIJH 3FKIJ 2MW8A 4XLPA 3H3VD 5CKTA 1F1ZA 2L7FP 1ORKA 2DJNA 1XGNA 2Y69H 3FXUA 4L9NA 3CCLI 1IE0A 3S1RK 4BHCA 1Z3YA 5GAGJ 1HDPA 4KM8A 2GXGA 5FLVA 3W3CA 2FMYA 1VQ8I 2M5WA 3BZ6A 4ASNA 3PQJA 3D1NI 3GVAA 3L2RA 2JA5J 2CMPA 4KT6A 5IOQA 2IS2A 3MVPA 1DP7P 2P0WA 3NAUA 3WGHA 3ZMTA 1FOKA 1WOOA 3TOAA 2VBZA 2X0LA 4KARA 2M4GA 1SFKA 5JI6A 5C4JJ 4EMSA 4C3JC 1Z21A 4B4CA 4A6EA 1O29A 1NK2P 1TNSA 1ETXA 4JX6A 4YRVA 3FXOA 3FMQA 2Y30A 4ETSA 2BY3A 2NS7A 2LP0A 2DPUA 1KYWA 4Q4ZF 1FOWA 2CQNA 1TWCJ 3WE3A 1ZAOA 3RPUD 2R5YB 3H3UA 4P5AA 2CFAB 4RGSA 5CVIA 3S2HC 2Z5UA 1EH7A 3K10A 1BIBA 4CYCB 3S1NC 2PG4A 4WWCA 2YU9C 3TP0A 3DPLC 2CW7A 3GZNB 2Z16A 3CJNA 3T8TA 2R7XA 5DTDA 3K4KA 4WJ3M 5K5RA 2CQKA 1D0YA 5FRMA 3RZDJ 2ME6A 4HF1A 2E1OA 1KYZA 4RB2C 1LQ1A 4A3IK 2KISA 2W25A 3F8NA 5LGUA 5DUKA 1B6AA 5L3DA 2HR3A 5IPAA 3CQZC 3HSFA 4UXNA 2ELJA 1MZBA 2DMTA 4NDLA 3OS2A 1ONVA 4LFUA 2VQCA 5IYDJ 3GBGA 2JA8C 2I8DA 1PJ5A 1I6HC 3MMLB 2QZ8A 3H5RA 1PDNC 2MFZA 3S15K 2EZHA 3E6CC 5HODA 2VLAA 3DBHB 3CCMI 4U7DA 2GOXB 1VH2A 3KP4A 1PJRA 4BY1K 1KU2A 4PK4A 5H6QA 5H20A 2VPLA 3C7JA 1HXDA 1D3YA 2LLKA 4EV0A 3K2ZA 3VSKA 1H0MA 1FSEA 2JA7J 4JK1X 2M8EA 5GTIC 1LJ9A 5HLTA 2BVMA 1O4XA 4LG3A 1X19A 2TCTA 4PJMA 3BPVA 5FRNA 5J8FA 1P4WA 2YUSA 4ZZLA 1XB4A 1Z05A 1UHMA 3CLQA 3LSGA 4D5CA 3IC7A 5CJ9A 4RLQA 4IHSA 3OR1C 4XKWA 4F52A 4FHTA 4BH9A 2DA7A 3GDZA 1WJDA 4BEHA 4BE1A 3DPUA 3H5NA 3HB9A 1SVMA 2XSJC 1IW7F 1XDSA 1GLNA 2A07F 2STWA 1WH5A 1REPC 4PAAA 2RVCA 4HV5A 4WXCA 3H9GA 5AIPA 1NTCA 4P9SA 4HSTA 4IQJA 3TFJA 2E71A 1O57A 3BG7A 3IAS2 4B48A 1ZG5A 4A3BC 4HNVA 2GAUA 2E7XA 5B5EC 3K1MA 3VEPA 3F72A 3GEIA 1ZGWA 5D8KB 3RZOK 4RAZA 4BBSK 2JTVA 2VIXA 1P6RA 1FJLA 3QYBA 5E1WA 1I1SA 3GTMK 2ZFUA 4ENMA 3AD9C 2VOOA 2RAEA 3CP8A 3R4KA 2H8RA 2V6SA 3CZ6A 3P9CA 1H9GA 2B7EA 1FBQA 3RKWA 4OMZA 5EGOB 4D9JA 4LLGA 3DWLE 1XPXA 2P6TA 2IS1A 3I64A 3HOVJ 1MSEC 2LC2A 2VC0A 3ASOH 3GTLA 4QWQA 4X0GA 1WSRA 3TFHA 3HKZN 2V9KA 2CYYA 4LQYA 1BOBA 2NOGA 2B63J 2YX7A 3PUBA 2EILH 2D1VA 3RIRA 4YFKA 1SFUA 5A2QZ 2R7DA 4IF4A 2FXAA 4BJ5C 3GZ6A 1K78A 2HZDA 2E1MC 1ZYRF 2HDDA 5E68A 3FF5A 2HPIA 3V8LA 1J75A 3QQAA 3UR3C 2L7ZA 1HW2A 2IAIA 2L7MP 1BC8C 1VQ6I 3TDZC 2WWYA 1IRGA 4EGZA 3ML6A 3L09A 3D5LA 4U87A 2LKXA 3A02A 5BPIA 4I99C 3KYDB 5ERIA 3MFKA 5KHDA 2W57A 5JLXA 2R93A 3E97A 1Z7LA 3DBRB 4LIUA 5IP7J 2JUGA 2VPRA 1O7LA 4FZBA 1RU0A 2VJIA 2W00A 4HYEA 3KLOA 1EFWA 3OIQA 3WTXC 4GYIA 4IXAA 1QA6A 5J1UA 3HOWK 3HSEA 1JQWA 1MBEA 3HXLA 4C30A 2W7NA 4X1EA 5F27A 4GTDA 1HSJA 2NVXK 4YFNF 2P8TA 3I4NJ 5EZGA 4BU2A 3KP2A 3TO6A 4DBQA 1IRFA 1WJCA 5FB2A 5EDNA 4AYBA 3BR3A 5IT9K 1BW5A 1Y1WA 2KIMA 3F22A 1Y1VA 2DT7B 4OIRA 3BG5A 4KASA 4L5JA 4GDFA 3BTJA 5FKNA 4ZYGA 4GFBA 5HOOA 3DXJF 4Q5SF 3S1RJ 1QBJA 4A2UA 2HNHA 1R7JA 4A3DJ 4A3EK 3CLOA 2HQAA 1Y8QB 5LEKA 2A6HF 2EFPA 1QZYA 1MBFA 1LVAA 1MGTA 3C18A 2CGPA 3RTRA 4A3IC 2W84A 2IBDA 2VQGA 1WCMJ 1UV7A 3M4OJ 1YLFA 1TWGA 1XCBA 1YNNA 4RAGA 1I1GA 2KL4A 4F91B 2QKMB 4BAYA 2J5OA 4CHUA 1MH4A 2NNYA 4V2FA 2FBKA 3L9FA 2RGVA 2EPFA 4YEJA 3TW6A 4FT8A 3GTOJ 4UB6C 1YRNB 1G3SA 3E5UA 3X2QH 3S15C 1AB4A 4C2MK 4OINA 1TWCA 1W7PA 4E7LA 1R23A 2CFAA 3GYHX 2JA2A 2LD5A 4BY1C 4RMNA 2DPDA 1TWFJ 4FTHA 1RESA 3TW7A 4CYCA 3OYEA 1FZPB 2E19A 1XXAA 4XLAA 4CCMA 5ILVA 1X1AA 4YIFA 4KN4X 3CC7I 3QWLA 3FHZA 3M7GA 3H0GK 3K4NA 2QBYB 2GA2A 1ZLKA 1YYVA 3IWFA 1IC8A 1B59A 4EJVA 3OYDA 3CC2I 3IHUA 5IOZA 3MKZA 4N9IA 3HOZJ 1EK8A 4F7ZA 5DDGA 2ECBA 1DU6A 3O6BB 4A3CK 2GM4A 1W36C 3HXAA 2KIFA 3I3LA 2WTEA 1RI7A 4HV6A 2UZKA 1RR8C 2EV6A 2VKHA 4NC7A 2WADA 3I9V2 3VYUB 2UV1A 4GCVA 2K3PA 3EDPA 2KZVA 3WU0A 1VQ5I 4ILDA 4AIKA 2O03A 1S72I 2XDVA 4XLPF 4BLAA 2CO5A 2EINH 2XPVA 4IX7A 2LREA 3RZOC 2H1LA 2KZGA 4BBSC 2EFOA 4Y15A 2KRFA 2JRTA 3JCUC 3GTMC 2YU9A 4B44A 2DCEA 1YTYA 3QODA 4AIJA 3BPXA 1X1DA 3DP7A 4YIIA 2ZSHB 3GF2A 3E6MA 4EGYA 1MNEA 1JXSA 2DA4A 4IL6C 2HPMA 3K2AA 3A0BC 5ILSA 1UAAA 1K83J 3BQZA 3GTQK 2HZTA 1W0TA 1SVLA 3CCQI 1RNLA 4LIVA 2E2JJ 5F1JA 2FOKA 3K7AJ 2BZTA 3CQZA 2OAZA 1EH6A 1R5GA 2X85A 5EG0B 1OYWA 4KICA 2ZSIB 1FBUA 2OU2A 4XRMA 4XONA 1E3PA 2R7QA 3OOPA 3P9KA 4Q47A 1IRZA 5CHPA 3AG4H 4GYGA 1W5SA 2RNGA 3LA2A 3OYGA 1FOXA 4A93J 3JRAA 3ZMZA 4I2OA 4BQQA 4J3NA 3G1MA 4UHTA 3OYNA 2P5KA 5E17F 1ENHA 4P96A 2KKOA 5JFEA 2LH9A 3DU6A 4HBLA 3BR0A 2LF7A 1ULYA 3GTKJ 4YFXA 3OYMA 2E1CA 2HVSA 4CSWA 5JHUA 1E3HA 1RC9A 5EGOA 2ZB9A 1D1CA 4LD5A 1KGSA 2L4MA 2FQTA 3S2DK 2NVQK 1VFCA 5E3NA 1ZARA 2WY7Q 4CUGA 4ABZA 1FMWA 1MMDA 4KNYA 4U0VA 2A68F 2MYSA 3ABMH 4G6QA 4D1QA 2HOSA 1T0FC 4C3HK 2AXLA 3ZPLA 3HOWC 3FWEA 5K5OA 2HDWA 5F0FA 2NVXC 2AXTC 4E7JA 2HWVA 3C2BA 3F6VA 1BC7C 1XN7A 5K7HA 4A3MK 2DK8A 5E18F 2HYFA 2Z99A 3BG6A 4C3IJ 1ZGAA 3FKIK 2GZWA 1F36A 2UXNA 3BUEA 1JTXA 1U9NA 1O2BA 3MWMA 3C2HA 2OQRA 4PFPA 1U8RA 4BDYA 4A3EC 2JA5K 4GTBA 1YS7A 5F0HA 1W5CC 4IQ4A 2OCCH 2JPBA 1GXQA 2COMA 3DKYA 1SAUA 3TO7A 1VNDA 1YW9A 5C4JK 3B02A 2E60A 4OOIA 5GAHJ 3KX2A 2ISZA 1J6WA 1WORA 2F4IA 2HQRA 1UFMA 3TMOA 2R7RA 1LE8B 2JA6J 1YJWI 3T8RA 3IRQA 4HDUA 2A69A 3SZPA 2M8GX 4JBAA 1TWCK 3V42A 5L3BA 1NH3A 4C2MC 4EM0B 1Y39A 4G12A 4E6KG 5HNFA 2ZFZA 2WAQD 2F4MB 1QHHD 3F8MA 3GFMA 3KLNA 3JRGA 4XRSG 3RI4A 1VQKI 1WI9A 1J6XA 5GPAA 2AHQA 5CQEA 3M07A 3HTSB 1J0RA 3O2PE 1O2FB 3H0GC 3CCJI 1S8NA 2OZ6A 1UHSA 4I0BA 3H3VK 3RZDK 2ZXIA 2LMDA 3I0TA 4LLGF 1T33A 1W1WE 2M45A 4UUTA 4XRFA 2J5PA 3DKWA 1QZZA 1FY7A 2BY1A 3M8JA 1WCMA 4A3CC 4V2GA 3VYRB 3JRBA 4D0PA 1ETYA 3HDDA 2FUG2 1IS1A 1O2AA 2R7ZJ 1U9OA 3OSGA 5EEHA 5IYDK 1XZPB 3S1QC 3PFIA 2BE5A 5D4RA 4PDKA 4P55A 4NOIA 1L0WA 1OCTC 2W85A 2K9LA 2D1HA 1MIJA 3OSFA 3J80K 3NWTA 3GFIA 1FTZA 4CCLA 1U2WA 3ZRGA 2A6EA 4QIWD 2A05A 2DTRA 3CCVI 4GGGA 4V19K 3KP6A 3MD2A 3GTGJ 4G7HA 3DEWA 4OIPF 3WGIA 1USSA 5IOYA 1TWFA 1S7EA 1B8IB 1YE9A 3MEXA 2JA7K 3C2GA 4A3FK 3MZ8A 4JQFA 5F04A 3LNQA 3BJAA 2KLOA 3ASNH 1JT6A 5E20A 2QBYA 3S3NA 2ZNZA 2MLKA 1YX2A 2VOPA 2JN6A 3E3VA 1DGWY 3HUGB 4JX5A 2MH2A 1O3QA 3RQIA 2E2HK 3GTQC 4RGRA 3HPGA 4NQWA 3OS0A 4CCKA 4XL9A 2RN7A 2OUMA 2QKLB 4IOCF 5HVQC 2DU9A 1WSVA 1X4OA 1WGXA 2L2OA 5E1XA 1OYIA 3L00A 1TTYA 3ABTA 1R36A 4O5VA 3A4CA 1MNMC 5FD6A 2V1DA 1R00A 2LKSA 3ECOA 1VQPI 1FLIA 3JSPA 3G4AA 4KN4A 4OIRF 1KU7A 1XMKA 1V5GA 1J9IA 3TDUC 1R1VA 2HTJA 3ZQGA 4B43A 1Z3XA 1AKHB 2HGCA 4RA2A 5TJ3A 1PP7U 2AO9A 1SEUA 3L7WA 4ON0A 2OC6A 4R79A 5HS8A 2FOWA 2LY1A 4FISA 2PMHA 1HQCA 1RPWA 2O3FA 2MC3A 4HAMA 3HOVK 2YS9A 2NVQC 2DMNA 2FNAA 2P5VA 3GTQJ 1EH8A 2BBYA 3SEQA 4ZYHA 3S1MJ 3H36A 3LL7A 2L3DA 3F9KA 4XN0A 1JKOC 2B63K 3PJRA 4C3HC 1OCRH 4A69C 2PMZD 1H9TA 3ZQIA 2F5VA 4IHWA 2KQRA 2VB6A 1BR1A 2G7HA 2IA1A 2GAGC 2E2IK 2WB1A 1Z9CA 3H92A 3AQPA 2Y9ZA 4XSZF 3F21A 1T98A 4OINF 2IW5A 1KQ4A 3HIFA 1Z77A 5FKOA 3U1DA 5D5VB 2ZMEC 3CDHA 3FKIC 3S3MA 3RDIA 2DYSH 2OCEA 3HKZL 3N3YA 5BMZA 4IZZA 1O27A 3CDIA 4CCJA 3BR6A 1S29A 3BQYA 1MBJA 4BLBA 3GTMA 2Y9YA 5HLGA 3J7YJ 3GMEA 2R92K 1I3QJ 3OYJA 2ZXWH 2JA5C 3KPHA 3H3ZA 1PUEE 2EWNA 5IP7K 4B1RA 3FK7A 4PZJA 1TW2A 2ADUA 3S2DJ 2MH9A 4OAZA 1X58A 4KIFA 2XCQA 5D4DA 1RKWA 3HOUJ 4M3FA 4RMFA 2EZLA 3K9TA 4DZPA 3CCRI 1R1UA 5C4JC 2ICWG 1X2MA 3FXKA 4C3HJ 4UVCA 3N97A 1GVJA 1MBGA 1TL8A 4OIQA 3JTHA 3CF2A 5LHIA 2PJRB 3ABUA 2DA5A 1TWCC 4BGDA 1AU7A 2K5CA 5IYBK 4KAWX 2HXIA 1U5TB 3RQ4A 4A3MJ 4BE2A 1DP3A 2VKDA 4BHBA 4NC8A 2ZMEB 4AM3A 4JP0A 4P9FA 4Y52J 3LSKA 1IGNA 3A0HC 2OJED 4A3DK 4XLNA 4LG0B 4P1WA 1RUOA 3PM1A 4BNCA 2ID3A 2PBIA 4MIMA 4W97A 3RPQA 2R7OA 3JRFA 4BBRJ 3RZDC 1TT5B 4O6JA 4GTFA 2M4KA 3UKGA 4RAFA 5CLSA 1FT9A 5EYRA 2WA0A 1WCMK 3HC7A 4M9SA 3M4OK 2IPQX 1R9TK 3IUOA 2L9SA 3AG1H 2R7SA 3CUOA 1EI6A 2HYJA 3LA3A 5BQTA 3QPSA 2CV2A 3AQOA 5FKLA 5H2FC 2E35A 4B3XA 1T0FA 1G6NA 2CS3A 2HI3A 3GLXA 4M3DA 5DS9A 1MDMB 2DMUA 2XIGA 2Z1DA 1UJ8A 1VQ4I 3CC4I 5D8LB 5ICEA 1LE8A 5HL8A 1SFXA 1I6XA 4UVAA 2NVXA 1D0ZA 3BWGA 3SXYA 2BOLA 4UV8A 2K9NA 4AD9A 4ZYEA 3G4CA 1WOPA 2IEKA 3OL3A 5JVGF 4QLCU 5M3FJ 1CF7B 1TWFK 4L0YB 3QOPA 2RC4A 4HSRA 2JA7C 4ESFA 3D5SC 1WIHA 2NYXA 2ZKZA 1RIOH 4F3QA 4YFXF 4A3LJ 4X6AK 4N4NB 2VC1A 1T08B 2MSYA 4HLYA 1K6OA 2RKHA 4DYQA 4O3MA 4XQFA 2NXNB 4KN7X 4XBFA 1ZRFA 3HOZK 1QU3A 4Y7NJ 1BGWA 3BZCA 3K70D 2DYRH 2OTJI 2VJ5A 3M3YJ 5BOXA 1S7AA 2XPUA 3V8KA 5DUIA 3U1KA 2W48A 2I10A 5F64A 1USMA 3IL2A 1XZPA 3S93A 1D1BA 4BXFA 2GSOA 4JYKA 1BJAA 2F5CA 2EA4A 2W1OA 2GLOA 2KWAA 2F4OB 2BGCA 3LA7A 2L9VA 5LGNA 3MZHA 3OYHA 4ANJA 2RDPA 3DV8A 5C44J 2W82A 4A6DA 5KVRA 3V8JA 2HQNA 3ABKH 4LMYA 3V7CA 1GVDA 1TLHB 5B1BH 2LYCA 5DYMA 1NG6A 2LBFA 4DDQA 3OYFA 1YX5A 4FASD 4A3FJ 3WODA 3FXLA 3O3KA 3ZGKA 1AWCA 3H0GA 2DA2A 3K4CA 1SD5A 3FMRA 3ZMDA 2W24A 3E5XA 1K83K 3HOVC 1B9MA 3LSMA 1ZHFA 2E2HJ 3BLYA 3EUAA 4FETA 1JKPC 4PABA 2E2JK 4AVZA 2OZUA 2KJCA 1IJWC 3I4MJ 3HOSA 4A3GJ 3K7AK 2ZXHA 2QM3A 2B63C 1VF9A 1PP8F 1FMVA 3WE2A 2VN2A 5TMFA 3ESWB 2F48A 1Y0NA 2WBMA 2OD5A 1KU9A 2V1NA 3HKZD 1GV2A 3R0JA 4A93K 3WHCA 3QX3A 3HG9A 2JT1A 4RM3A 4Y17A 1ON1A 3PIPF 3BR1A 2ME0A 3MKWB 4FX0A 4G7ZF 4L5IA 4XLEA 4LITA 1VQOI 1VLOA 4M1XA 4ZZDA 3TEDA 3GTKK 4WXDA 2QQ8A 3ONQA 1K4TA 4XKBA 2R92C 2LR8A 5LRSA 3CCEI 3OEPA 1BBYA 4Q48A 5IP7C 2WB1N 1MW7A 4U0YA 1QHGA 1ZBSA 3HBLA 2RNJA 1S9HA 1X4PA 3GTQA 1K61A 3GTPJ 5FO5A 2E5NA 1RRJA 3OREA 5E1ZB 1J7KA 1USTA 2BE5F 3SDGA 3M1EA 3TGNA 4A5MA 1Z1DA 1XSDA 3BR2A 4RLFA 1YO5C 1K6YA 1T38A 3TO9A 4M3BA 3I4NC 1F7VA 2EFWA 4EJUA 2XRLA 2LF8A 4K2EA 5M3MJ 2E2IJ 2CFXA 3LSHA 2DMPA 5CVJA 1OISA 4LB6B 2H27A 2M1BA 2FNPA 1DCHA 4WK8F 1B72B 3JRDA 4PJJA 3T00A 3WG9A 4C3IK 3KP5A 5L3GA 4S04A 3I71A 4G7HF 2PA8D 3OS1A 3EPZA 2VQHA 2XCRB 3S1RC 2NVYJ 4A3DC 1EF4A 1BI1A 3NUHA 2EFQA 3NWSA 5K1YA 6PAXA 3FOEA 2UWMA 4A3KK 4RGUA 4ENNA 2R92J 4IPAA 1A6QA 2CUZA 1FSHA 5D5XB 3ABLH 1HKQA 3FDYA 1VRQC 1HCRA 4HLXA 1WCMC 1IRXA 1Z6RA 1ZLJA 3M4OC 3ZQCA 3EYYA 3KIOA 3DKXA 4FX4A 1VZ0A 4OAYA 2QENA 3Q0WA 1MJBA 1D0XA 2VI6A 2VT3A 3WTTC 1KQ8A 2JA6K 3QPLA 3GTOC 2PJRA 4XK4A 2KFDA 2M9HA 5TMCA 1INNA 2BHYA 3JW4A 2NS8A 2VT2A 1FX7A 2AQEA 2Y31A 3OYAA 3HHHA 5IYBJ 1V5VA 2CWEA 3F8FA 4ZYAA 3ZCOA 1D8KA 3D0SA 3BZKA 2H09A 3GLLA 3IV5A 1TWFC 3AD8C 4KATA 2DFEA 2ZMEA 2IVMA 3HSRA 1V4RA 1IN4A 3FKIA 2H1KA 5B66C 2PPBA 1IUYA 4XLHA 3CCUI 2PI0A 1TC3C 4LG0A 4X6AC 1LKXA 1WJAA 4NHJA 2IGNA 5EEGA 3ZXSA 4WX9A 2JA5A 3HOZC 1VJEA 1D5YA 3IKVA 2O9LA 2O5IA 1USOA 3HGGA 3M1CA 2K4JA 4L9JA 4ZTFA 4MEXA 3KFWX 1R9TJ 2ECCA 5DM6F 3GEHA 1ETKA 4KB4A 2K4BA 4IRGA 3GW2A 3RYPA 1YW7A 2DDBA 2M34A 3BR5A 5K7ZA 1FYLA 1IQ0A 1DCOA 3QYFA 5HS7A 4KMHA 2R7ZK 3HPHA 1MDMA 1BOAA 3FKJA 3MQ0A 4IHXA 4G6TB 4DIQA 3Q3SA 2G9WA 1ACIA 5IP9K 1IN7A 2KP6A 5K7FA 1BJTA 3PFYA 2MGQA 3KZIC 2FQOA 1G4DA 2R5YA 3TP3A 3GTGK 2BW3B 1SVOA 2F2EA 2OA4A 1CF7A 2ELKA 2JVGA 1XPPA 1STZA 1AA7A 1FYMA 3SZZA 2HQ5A 1QZEA 2CG4A 2IS6A 2WAQL 2P7VB 1V55H 2BEOA 4XLCA 2DA3A 4FM9A 4X6AJ 3NQOA 5D5WB 4BJTA 5FGMA 5FLMJ 1OCPA 3RKQA 1C0AA 4L9VA 2HYGD 2EZIA 2GA1A 2HEOA 4LJZA 1K83C 2B0LA 1DCPA 5CVRA 5C4XJ 1DPRA 2LFBA 2ZXJA 5IY5H 2E2JC 2XASA 1QRYA 3GX4X 1U78A 3R0AA 3K7AC 3IPJA 3DTIA 1V5EA 2DOAA 4MQ9A 3FX3A 3BG9A 1RR7A 4JOMA 1XD7A 3SFZA 3JR9A 3S16J 3AD7C 4OIQF 3ZQHA 4BY7J 2IP2A 2QGUA 2IXSA 1IN6A 3JSOA 1C0WA 4BACA 5E3OA 3E5QA 2MG4A 5DD8A 5M5WJ 4A93C 1PJ7A 2TDXA 4Y13A 2ZNYA 4F55A 5HDKA 4XM3A 2M3AA 5FLXK 5B1AH 3FOFA 4UUVA 3DTEA 4XLNF 4QIWL 4KN7A 4Y3OA 2JA7A 2MD0A 4MFEA 1R71A 3GTKC 3PL8A 1SFOJ 1OMIA 1GHCA 1WSUA 2V79A 4NBQA 5E8IA 5GAEJ 4A12A 2NAZA 2PMUA 2BY0A 2CW8A 3CP2A 4IJAA 1ETWA 3TBIA 3S1MK 3D5RC 4M6XA 2E2HA 3LSRA 3P5JA 4GXOA 4MLOA 2PHCB 1ZR2A 4CGZA 5DEQA 1ZTRA 3VPRA 2PEXA 4B09A 2Y2ZA 4BS9A 4EM2A 2Z2SB 2MABA 2QQAA 2ZJ2A 1FBSA 3CJRB 4MQVA 1J6VA 3HZJA 3JREA 4IHYA 3K4BA 5HLIA 2FRHA 3MCZA 4C3IC 4GRIA 2LTPA 2V6UA 2RQPA 1OCOH 2XAUA 1PUFB 1YX3A 2A3SA 1OQYA 5IYCJ 4PJ0C 3GEEA 3WGGA 4E7SA 5M5XJ 1R58A 5F6FA 3AKZA 2R0QC 1YJNI 1LDDA 3B6CA 1EA3A 1YJ9I 1LUJB 3RKYA 2DFIA 3FBIB 3WU2C 2JPCA 1I3QK 4BDZA 4IRHA 2XCOA 4E7HA 5LGTA 1UHWA 3PO3J 1ITYA 1OPCA 2CFOA 2DBBA 5EZHA 5GADJ 4E7ZA 3V7RA 2GXBA 2A5YB 2F5DA 4GTCA 3OYKA 2L54A 4QSHA 3ROUA 1BIAA 4B3AA 1HF0A 4C2UA 3HOUK 2FBHA 3U2RA 3OMYA 5IT9Z 4MNUA 4XORA 2MLGA 4RGXA 2GOMA 4D7MA 1TWAJ 1APLC 2B63A 3WTWC 5IP6A 2ACJA 4WJ4A 4P5BA 2JA6C 1XZQB 1VQ7I 5KNLA 2ZCWA 4M3EA 2PMZL 1F93A 3FM5A 2RGRA 2DA6A 2BVLA 2E2IA 3IP4B 3GTJJ 4KT5C 3CMMA 1VTNC 3G1OA 1Z6TA 1R22A 3LOCA 1X3UA 2DOFA 2A6TA 4AU7A 2L5QA 4CCNA 4Y52K 4GFQA 3CCSI 4H4KC 1HW5A 1F5TA 5J1RA 4Q5SA 1BR2A 1I50J 3R6SA 2PQ8A 4WCGA 1YS6A 3NARA 4BBRK 4C45A 4BJ6C 4A3KJ 2R92A 2XAJA 3WTVC 4KISA 3KZYA 1UG2A 3J7AY 2HU9A 2VUMJ 4Z2YA 3K1NA 3VFZA 3LWFA 2DT5A 3N05A 4AYBN 3JRCA 1OCCH 5IYDC 5E79C 3F8CA 3HOYK 4I7HA 2R7ZC 5EJCA 1QQIA 2C6YA 1SD6A 3K4MA 2CW0A 1YI2I 2XV4S 2Y0SA 3W6JB 5IP9C 1W7PD 2WV0A 2NNNA 3HOXK 2EV0A 2ZJQF 5KAFC 2AS5F 5J3LA 2EA2A 3VB2A 3J81K 2LK2A 3HOTA 1HLVA 1VQLI 2JZYA 5M3FK 1IV8A 4PUSA 1EH1A 3GTGC 1DU0A 3N4MA 2IS4A 3QU3A 2OTLI 2VKEA 3OPFA 3S17J 4MHGA 4A3LK 2FA5A 2EB7A 5E8GA 1LVKA 1GDTA 1JTYA 3TQNA 3K4JA 1W4MA 2GIZA 4KIBA 3A8IA 3PNVA 1TZLA 3HGYA 2HDCA 4XNFA 2VODA 3HRSA 3HL2A 2F5FA 4Y7NK 1FC3A 1JHFA 4HW0A 1YW8A 4HQMA 3WG7H 2CQ7A 3H1CA 3BTCA 4KIGA 4R8HA 3TFIA 1GV5A 1R9TA 3M3YK 2Z33A 2KIUA 3RKXA 1UZCA 1S7OA 4KYWA 4XN3A 2DAOA 4NB5A 4YFKF 1DD5A 1TWHJ 3LFUA 4WXHA 3U9GA 2Q1ZB 1K7AA 3JAMK 5JFRA 4G7OA 3I4PA 5IP9J 5CYVA 3GTOA 1YRNA 4LOWA 1E3OC 4G0UA 2DN0A 1S5LC 3HJEA 1AOYA 5C44K 3OYCA 5C3EJ 2JSCA 5L3EA 2I5UA 2BXZA 2QVOA 2A5WA 4MEYA 1QVUA 3HHGA 1MKMA 1T39A 5JLWA 2HOTA 2W4SA 2NOJB 2DT6A 2XAGA 3DF8A 3MKYB 3IH2A 3CJQB 1CGPA 3P9IA 2H94A 1TQPA 3ZMUA 3MN2A 2EH3A 2CV1A 4ESBA 1DPUA 3SYTA 2LDUA 4BL0B 1E17A 4ZH4A 3S1MC 3I4MK 3C1DA 1AHDP 4A3GK 2XGEA 2VL8A 2EBIA 4KUMA 3ERED 2IJLA 1DDNA 3LPXA 3RPUA 2IGKA 3DTKA 4BE0A 1KA8A 1N78A 1HSTA 3QRFF 1HKSA 1OR7A 4FE4A 1BN5A 2QSGX 3PNTA 5DD4A 4RB1A 3BCBA 3E6DA 1ZRDA 1WZ2A 2R7VA 3BP8C 5LEJA 5LD2C 4A5NA 2QWWA 2UXXA 5ICCA 4ZDPA 4OIOA 3VDXA 4IOAF 2R7WA 1FPQA 3TKYA 1EQRA 1WOSA 2VASA 4A0ZA 4KITB 3CUQC 5J4VA 2E36A 2LG4A 1VQNI 3G4SI 3VA7A 3DU5A 3PO2J 1ON2A 3U21A 5JR3A 1B1BA 4BEHB 4L5EA 3CO6C 2QCOA 1H89C 3ELKA 1I3QC 4N4OB 4LLNA 1IBAA 1G8XA 2DQRA 4EVIA 1P4AA 2XRNA 4RBOA 1JJ6C 3A8KA 5ICGA 1P7JA 4MEXF 4EJTA 3S2DC 2CUEA 3S32A 4D5FA 1HBXG 4GTLA 4KMDA 2OQGA 1FTTA 1K83A 3O8HA 3GTPK 1ETQA 3HOUC 4J01A 2L01A 4I98B 4DBRA 2STTA 1MH3A 1IL2A 5HNHA 1LB2A 5EG0A 5FKMA 4PGGA 2IT0A 2LNBA 3OYLA 2V6CA 4ENKA 2FBIA 4Y33A 1Z67A 2ZBKA 5M3MK 2AQFA 3VYSB 3ISPA 3AL0B 2NVTK 1S6LA 1U5TC 3GZ5A 4KMUX 1J09A 3CMEI 1HQMA 3CO7C 4A3MC 3E6BA 3SHFA 1IXSB 2DMQA 9ANTA 5L46A 3GTLJ 2MBFA 4Y52C 1QPIA 4IHTA 3CUQB 2RREA 4HPQA 3MKLA 3BCAA 2NVYK 1FEXA 2MC4A 1ZREA 2A61A 2ZUFA 3GTKA 4BBRC 2L4AA 1LDJA 5GPCA 4XICA 3W2AA 4LJZF 3K1PA 2R4GA 2BV6A 1B4AA 1K78B 3AG2H 4L0ZB 1XCVA 3FIWA 4L9TA 2GWRA 1X3WB 3HKZA 1G3WA 2QYOA 2XHKA 3PSIA 4MQ9F 5DV5A 3WU1B 1M1EB 3HOYC 1JUSA 2JWTA 2DODA 2F6CA 5M5YJ 1SD7A 2D45A 1BL0A 2IA0A 2PJPA 5FJ8J 5D5UB 1XZQA 1Z91A 5DM7F 4G9YA 3LMMA 5ILUA 2R93J 1PYVA 4LB5A 4M9ZA 3E1SA 3SEZA 3KCCA 4AC0A 4HOBA 3VSLA 5DCFA 1WKMA 3T1BA 1ODDA 4GTEA 1KQ0A 2QSHX 1OCZH 2BHZA 1WRJA 2ESHA 2V26A 2XKOA 4DNCA 2XGCA 2KRCA 4QJVB 5EGHA 1H8AC 3I54A 1RETA 2KDOA 2O5RA 5J47A 4UNOA 1SFEA 4O2DA 4A3LC 2PA8L 3R61A 3ZP5A 4UVBA 4RS8A 3S14J 1JGSA 1J5YA 4XOTA 4J19A 1ZG1A 2MA3A 4M71A 2Y0SN 1ZQ3P 1O25A 3A8JA 4I01A 1A04A 2ZFWA 4II3A 3S3OA 4Y7NC 2QUFA 1XGOA 2Q2EB 4OU0A 1Y1WJ 3QU6A 2JRMA 5TJJA 1IUFA 1I3AA 1YOVB 1Y1VJ 3DEEA 4G94A 2RH6A 1MBHA 3J80Z 3L2WA 3M3YC 2B9SA 3CF5F 2FMLA 3HOYJ 1TQIA 3H9QA 3OV8A 5A2QK 2V4JC 2IRFG 2VONA 1S3JA 2JA6A 1JGGA 3CDLA 4A3JJ 2FX0A 2WV1A 4AWXB 1F43A 1MBKA 3HOXJ 4I6ZA 4I0AA 4BXXJ 1LFPA 5JVTA 3OY9A 2BXYA 2CJJA 4XLFA 5C44C 1JUMA 1TWGJ 4PJLA 2GIVA 2X1CA 4LOCA 1IV6A 4IRIA 4LK0A 1I27A 2K40A 2R7FA 4A3FC 1SANA 2JVHA 5EGEA 4XRSA 4ZTJA 4HEA2 1D5VA 5FLMK 3DPTA 1V3FA 3EUHC 3COAC 2YPRA 5BS6A 1ZQ1C 1YIOA 3FXQA 5C4XK 3ZMSA 3CMYA 2E2HC 2HKOA 1W7PB 2LOOA 4E70A 3I4MC 4A3GC 3L2CA 1WQGA 1JHHA 1XXCA 4ZYDA 2DK5A 3S16K 2GXAA 2R7ZA 2K3FA 1UELB 4BY7K 1TWHA 3FM3A 1LDKB 4DYCA 1FOYA 4HF2A 4BQOA 2VBXA 5HS9A 4UY8I 3M8FA 4FQGA 5M5WK 5EEAA 4IKFA 2EIMH 4CCOA 1WJ5A 4QPOA 1TP4A 3ZMVA 1ETVA 3B6AA 1IN8A 1MJ9A 2EIKH 2ZJRF 3Q0VA 5DCMB 2KPMA 2ZJPF 3A2KA 3BOQA 3GTGA 1B8IA 1UB9A 1IN5A 1FWZA 4UV9A 2CSOA 3WTZA 4AIDA 1E0EA 4PCQA 1SFOK 4C3JJ 2A68A 4HA8A 1A6IA 2X6YA 2FQ4A 4XKCA 4RB3C 1J98A 3HUGA 2LVSA 5FFZA 1HA8A 3BY6A 2P4WA 3KETA 1W36D 3GTPC 1D8JA 4NUBA 2O61A 2CRGA 2FQ3A 5CVUA 3RCOA 2DA1A 3SJMA 2CW0F 4BQAA 3S2HJ 3NEUA 1O28A 1X31C 3Q3QA 1JJ8C 1TBXA 3QP5A 4U88A 2WB1D 3S1NJ 2YU9J 2TRTA 2H6BA 3IWZA 2A69F 1WI3A 5ED4A 1FNNA 2E2IC 3I53A 2NVTC 2XAFA 3EYIA 1IG7A 1Y8RB 1WVRA 4YIRX 2XB0X 1HOMA 3CESA 4KA4A 1RZ4A 1YQAA 3PNYA 3BJ6A 3M8EA 4MO7A 2PFBA 5IYCK 1AKHA 3L1PA 5IORA 1G3YA 3QPTA 1A35A 5M5XK 2EV5A 4RDUA 3AAFA 3CQZJ 2XAQA 1G2HA 3GFJA 3BG3A 2NVYC 1I6VA 4CICA 1HI9A 3MZYA 3IRRA 4EQQA 3PO3K 1WJBA 4RB0A 4I02A 2JA8J 1O7FA 5ICFA 2VXDA 4W1UA 2K86A 1I6HJ 4E4HA 1QVTA 2L9NA 3T0YA 4FCYA 2RQQA 3H0DA 3O8GA 4XSXA 3BP3A 3B73A 3LSIA 3F23A 2L02A 1BI2A 1TWAK 4UUSB 1FIPA 3FK6A 5E3LA 3WTSC 2R5ZB 4G7OF 1UG0A 3JRIA 4CA0A 4YG2A 3GTOK 1GE9A 1G3TA 1QPMA 1XGMA 3BP8A 3GWZA 3PQKA 3GTJK 1JUPA 2L0KA 2A6EF 2DFHA 4KJZA 1N25A 5KCMA 2NVTJ 2RV8A 5IYBC 4II2A 1WJFA 4P5OA 2ETHA 5HDNA 1A36A 4ZDOA 2XUBA 2OBPA 4MEYF 3BROA 3IKTA 1HC8A 3DBLB 1NG7A 2M2EA 1O3TA 2R7UA 2V9VA 3CUQA 3HEFA 1I50K 2LY9A 1EV7A 2KJBA 1RKTA 4PSWA 5H6RA 1I3QA 3J7AO 1YCLA 2H8WA 2VUMK 4ZH4F 2JJ7A 4J00A 4PGHA 3GCMA 1R9TC 4AUXA 1X1CA 1T8IA 1P92A 4A3BJ 5J8CA 1FIAA 5LHHA 1WQFA 1IAWA 2D5VA 1U6GA 5E3MA 3MMYB 5D6EA 1LFUP 1L0OC 3QAHA 3J7ZI 3KYLA 1ZELA 4OIPA 4KMUA 1D1AA 3JSTA 4M74A 3REOA 1SC7A 3SFIA 2XSDC 1MNDA 4OIOF 3I58A 4CO8A 1HW1A 1U5TA 4AYBL 1LEAA 1XX5A 3KP7A 3ZQLA 1ZRCA 3HYIA 2QSFX 1ZKGA 1MJAA 3BDDA 1Y0UA 4GT9A 4QJVA 5FROA 3S17K 3FZVA 3I59B 2P5MA 5J6XA 1F9NA 3EQLA 2X1EA 1ISEA 3OR2C 4I09A 2XF6A 1R5ID 5FLMC 1KZHA 3LSJA 1U3EM 4XIDA 4GTAA 3DCFA 3DQVC 3LAJA 1JKQC 2LSOA 2HOEA 4CXFA 2Q2EA 4LR2A 5C4XC 3ZQFA 2EK5A 1JVIA 3SZYA 2E1MB 2CQQA 2YR2A 3FXRA 3OOUA 4G0VA 2MD5A 3OYBA 2XAHA 2ZO4A 2H6CA 1FP2A 2N8GA 1WWXA 4ZJZA 3I55I 4HRIA 1ZH5A 3S16C 5KAIC 1TWHK 1OR7C 4N9HA 4ENJA 4BY7C 3IH4A 5LBQA 2FU4A 1DGRM 1VI0A 2LKPA 2KHMA 1OJLA 4BKXA 4QTRA 5C3EK 3E0JB 3SDBA 3LAPA 1JI8A 2WY8Q 1ETOA 4LK1A 2QQ9A 1BI0A 1LPQA 3K70C 4DZJA 4HX7A 2K9QA 2EBBA 1XSVA 3PSFA 4Z6YA 4G0WA 2JMWA 3AH5A 5FKKA 4P9UA 1F4KA 1SFOC 2BY2A 2XKPA 5AIQA 4KM9A 5EF6A 2K02A 3L4JA 1BM9A 1RUNA 3DLAA 1G51A 2E34A 4BXUA 3L4KA 5JVOA 1FP1D 5GP9A 1BJZA 2VXZA 2YU3A 3GXOA 1BI3A 3W6VA 4XSZA 4F93B 4HZFA 2KDZA 1SD4A 2OF7A 2M30A 1JKRC 1OLTA 1Z7UA 1R6RA 1XC5A 5BPDA 2WAQA 2QF7A 3KE2A 1Y6IA 4L18B 3VOEA 4MGRA 1XGSA 3BC8A 1X2NA 3OYIA 3GSIA 3T01A 2YX4A 3BT9A 4DW6A 1SMYA 3Q9SA 4YELA 3FMSA 2XB5A 4DYRA 2O0YA 4AH6A 2PN6A 2XVCA 2Y75A 2FD5A 2WAFA 4A3IJ 3GIRA 5DCMA 3WTUC 5IYCC 4NQWB 2UUZA 3PO2K 3ULQB 2K27A 3G1LA 5CPRB 4HDVA 1T95A 2CH0A 1L3LA 1LNWA 2Z3YA 2QQBA 3S1QK 1LFBA 1IDYA 3TTGA 3PO3C 3W2WA 3G6EI 2E1NA 5HLHA 3EUHA 4GO1A 5LRRA 4DQ2A 3CJTB 5J4YA 3EETA 3H5AA 1POGA 4AVPA 3S15J 4PFOA 1T6SA 3K6GA 4ZDLA 1ZN2A 2LY2A 4R1HA 2F5EA 3AG3H 2DLLA 2X1DA 3EUKL 4MTEA 3CMAI 4BY1J 1TWAC 2NS0A 1BDFA 2HOAA 2HXOA 2KT0A 1JOEA 1NHAA 1HDDC 1GT0C 1LEBA 3F6OA 3PIOF 5L3CA 1O24A 1KU3A 3GTJC 2V1UA 2P81A 3ECHA 3OWTA 1XMAA 1QGPA 2O8XA 2OV7A 1BR4A 4MTDA 1VQ9I 1H88C 2LRDA 1XG1A 2EQRA 2W7VA 4LK0F 3GTLK 1I5ZA 2ELHA 4HNTA 2X9DA 4GZYA 1I50C 2QEXI 2O7OA 2COBA 5CQGA 1CQTA 3HTUA 4B47A 3JRHA 3CD6I 5LLQA 3NRVA 1U8BA 2HFHA 4UB8C 5HDGA 4A3KC 1N75A 2G7UA 1YIJI 1N77A 2DOEA 3GEZA 2VUMC 2M0MA 2ISYA 4E7IA 2VE9A 3A01B 1O3RA 4Q4ZA 1FYKA 2DO7A 4G8XA 4EJWA 1R49A 3CAGA 4JK1A 3GTPA 3ERMA 2FF4A 2VBYA 4UUSA 5M5YK 3DFGA 2FJ1A 3RZOJ 4HX8A 3FHNA 2R5ZA 3QYEA 3Q5FA 4BBSJ 1VGXA 2JH3A 5FJ8K 4A0YA 3GTMJ 1MMAA 1QNTA 1SMTA 4XMYA 4AYBD 1WJEA 2X51A 2V1XA 2R93K 3ZR8X 4KMFA 1MSFC 1P7IA 5LHGA 2X6XA 1B72A 3P7NA 3S2WA 4JX4A 4BHPA 2IGMA 4M72A 3H35A 2IGOA 3ZQ7A 1J2XA 3S17C 1DQUA 2FEZA 4XOPA 3WODF 2K9MA 2XC7A 2GSUA 1T2KA 4NC6A 3S8PA 3VYTB 1R1TA 2QA4I 3S14K 2NVYA 4ZC3A 3ZQQA 1ZK8A 4HG2A 5BNGA 4CDGA 1IZ1A 3T5XA 4HNUA 1JT0A 2PMZA 4EM1A 2P6SA 2DXIA 2EJRA 1Y1WK 3K69A 2X4HA 1OKRA 2R3SA 2XGXA 1Y1VK 1ZR4A 4WILA 2XF7A 1O3SA 1HKTA 1WPKA 4LGWA 2GBYA 5D6FA 3M9AA 3TL4X 2GSNA 4NNJA 4M6VA 4WF2A 1TWHC 3KYCB 3I5UA 2Y0SL 2X48A 4A3JK 2KIQA 3LFKA 1VQMI 3GO5A 2P5LC 3UNGC 1B9NA 3KZZA 5TISC 4IO9F 2CV0A 4BXXK 4PSXA 5C3EC 5IOSA 5CVVA 1QO0D 1TWGK 4F92B 4FE7A 4KDDA 1WQ2A 3G73A 1K4SA 3A03A 3I59A 4G6DA 4EATA 1KONA 2Q8KA 1ZXOA 5L3FA 4IVNA 3HOWJ 3GUDA 3PUFA 1W0UA 1SAXA 2G0EA 5IOTA 3DEUA 3CCYA 3SZTA 2NVXJ 2D2WA 5TGTA 1IW7A 5FFXA 2OPTA 3KEOA 4U0WA 4A0XA 2V9PA 1R5HA 1P2FA 3BTLA 2L9RA 4EEFG 4XSXF 3LSPA 1YNJA 2NVUB 2X6OA 2DDAA 2V6TA 4QPQA 2CQXA 1TT0A 2JUCA 2VJ4A 4G7ZA 4D7NA 4YG2F 4BKWA 3HRMA 5F0CA 5FLXZ 3F0CA 4DGWB 1YITI 2XPWA 1OFCX 2L7KA 3RSNA 3H3VL 1XDUA 3AFHA 3S0XA 4CYDA 3LSTA 4A3EJ 3OL4A 4ESJA 3G2BA 4CH7A 4RM2A 4KDPA 1PJ6A 3V4GA 2E7WA 3I56I 4KMAA 3G71I 2BW3A 3QPHA 4B8XA 2VQLA 5GTHC 3Q9VA 4DJAA 2IA2A 3VODA 2D6FC 1P9QC 3PO2C 3QP6A 2ZUEA 2M7BA 3H9JA 3LQQA 2X6WA 4XKVA 4C3JK 4M9XA 2M0CA 2VE8A 2WAQN 2O5JA 1R4MB 2ESNA 1IXCA 3HM5A 4EJOA 2Y3PA 2CU7A 1JE8A 3E7LA 5F1RA 1WFXA 2DQLA 3JTGA 1ZYRA 4IHVA 4C2MJ 2JSPA 5B3SH 3FBNB 5FD5A 1MD0A 5LFAA 3S2HK 2HS5A 3G3ZA 3L2UA 2K9SA 3T02A 1YHQI 3S1NK 1ZVUA 4E7KA 1XTAA 3ZN0A 2VJJA 3FXJA 1WQHA 2YU9K 2LBFB 2BYVE 4M6YA 3RJPA 1O26A 1MMSA 1BW6A 3AL0C 3H0GJ 2K7LA 3TOBA 1XS9A 2DFFA 3GFLA 3KP3A 2WC2A 1Q1HA 1OYYA 1I39A 2Y48A 1T56A 3K4LA 1R4NB 2PX9A 5F08A 1BA5A 2VBWA 3GTLC 3EQLF 4A3CJ 2QLZA 3CQZK 4KFCA 2ID6A 1Y56A 5KK1A 3WHBA 4QIWN 1SFOA 2CUFA 2DI3A 3S1QJ 2JA8K 2KMUA 1ZGJA 1I6HK 3WTYC 1YG2A 1UMQA 4BUPA 4I76A 4YFNA 4KB2A 3OIPA 4CZZA 2Y0MA 3LQRA 1EJ9A 2E5ZA 1PVEA 1TW3A 2O6GE 1GXPA 3KEQA 5JHFA 1A31A 2DW4A 4BYYA 1X1PA 1UCRA 3W6KB 3OIOA 2GAHC 1ERDA 2YSRA 3IH3A 3F8BA 4AIHA 2VKVA 3FISA 3DXJA 1K79A 3K0LA 3Q0UA 2FSWA 5AONA 3DLLF 2WB1L 2DTZA 2GQQA 1XXBA 3N0CA 1Q1VA 2R93C 1Z0XA 3N0BA 5J40A 1BS2A 1MMNA 2CUJA 1X3ZB 4N0BA 4DOZA 4LK1F 4RAYA 2JK3A 2A6HA 4M73A 4LLLA 1EKEA 4HX4A 1PUFA 1NK3P 1IXRC 4PJNA 4IEJA 2O8KA 4HF0A 2XGDA 5K5QA 4S0HB 3S14C 2HKXA 2DJIA 4HQEA 4ITVA 3BJOA 4C9YA 2Z9OA 1P4XA 2EZKA 1YFHA 5D4SA 3F3XA 3SQNA 4U7BA 1Y1WC 4S05A 1IDZA 3ZN1A 1E2XA 3A01A 1Y1VC 2WAEA 4OWRB 4A3BK 1V54H 3ZOBA 1TNTA 3FXMA 3MAJA 4M3GA 2ZC2A 3KEYA 2Q0OA 2XF5A 3J81Z 4OMYA 2R7TA 1IO2A 3HRUA 2Y0SD 4BQNA 3QOEA 2FE3A 1TWAA 1KQ9A 1F7UA 5J1YA 4XCHA 3R60A 2XROA 4A3JC 2K85A 1X1BA 4CZCA 4KC6A 3HOXC 1J59A 1SMYF 3VWBA 3V7SA 3RYRA 3W2VA 1WH7A 4BXXC 4Y4RA 3GTJA 2PMZN 1DUXC 1XSXA 2HVQA 5IT3A 3L2QA 1TWGC 2NVQJ 1GUUA 1XMXA 1TQMA 2HTSA 4MFDA 1MMGA 4H0EA 3CTAA 4TV7A 2P7CB 3IAM2 3A1YA 2M87A
chains in the Genus database with same CATH topology
1I50A 1W5TA 2PLYA 3C3WA 1ZG3A 3HRTA 2NRAC 3JAMZ 2VUMA 5TRDA 1B4BA 2EFNA 1IF1A 1F1ZA 1XGNA 3FXUA 4L9NA 4BHCA 4KM8A 2GXGA 2FMYA 2M5WA 3BZ6A 4ASNA 3PQJA 3GVAA 5IOQA 1DP7P 3WGHA 3ZMTA 1FOKA 3TOAA 2VBZA 2X0LA 4KARA 5JI6A 4EMSA 4C3JC 4A6EA 1O29A 1TNSA 3FMQA 4ETSA 2DPUA 1KYWA 4Q4ZF 3WE3A 1ZAOA 3H3UA 4P5AA 2CFAB 4RGSA 5CVIA 2Z5UA 1EH7A 1BIBA 2PG4A 4WWCA 3DPLC 3T8TA 3CJNA 5K5RA 2CQKA 4HF1A 1KYZA 4RB2C 1LQ1A 2W25A 3F8NA 5LGUA 5DUKA 1B6AA 5L3DA 2HR3A 3HSFA 4UXNA 1MZBA 1ONVA 4LFUA 3MMLB 2QZ8A 1PDNC 3E6CC 4U7DA 3KP4A 1KU2A 5H6QA 5H20A 3C7JA 1HXDA 1D3YA 4EV0A 3K2ZA 1H0MA 1FSEA 4JK1X 2M8EA 1LJ9A 3BPVA 5J8FA 1P4WA 4ZZLA 1XB4A 1Z05A 1UHMA 3IC7A 5CJ9A 4IHSA 4FHTA 4BH9A 1IW7F 1XDSA 2A07F 2STWA 1REPC 2RVCA 4HV5A 4WXCA 5AIPA 1O57A 1ZG5A 2GAUA 2E7XA 3K1MA 3VEPA 3F72A 5D8KB 4RAZA 2JTVA 1P6RA 5E1WA 1I1SA 4ENMA 2VOOA 3R4KA 3P9CA 1H9GA 1FBQA 3RKWA 4OMZA 2P6TA 3I64A 2VC0A 3GTLA 4QWQA 2CYYA 4LQYA 2YX7A 2D1VA 3RIRA 1SFUA 5A2QZ 2R7DA 4IF4A 2FXAA 3GZ6A 1K78A 1ZYRF 3FF5A 3V8LA 1J75A 1HW2A 1BC8C 3TDZC 2WWYA 1IRGA 4EGZA 3ML6A 3L09A 3D5LA 5BPIA 5ERIA 3MFKA 2W57A 2R93A 3E97A 1O7LA 4FZBA 4HYEA 3KLOA 3WTXC 4GYIA 4IXAA 3HSEA 4GTDA 1HSJA 4YFNF 2P8TA 3KP2A 3TO6A 1IRFA 5FB2A 5IT9K 1Y1WA 2KIMA 3F22A 1Y1VA 4KASA 4L5JA 4ZYGA 5HOOA 3DXJF 4Q5SF 1QBJA 4A2UA 1R7JA 3CLOA 5LEKA 2A6HF 2EFPA 1QZYA 1LVAA 1MGTA 3C18A 2CGPA 3RTRA 2W84A 1YLFA 1TWGA 1XCBA 1I1GA 4BAYA 2J5OA 4CHUA 2NNYA 2FBKA 3L9FA 2RGVA 4FT8A 1G3SA 3E5UA 1AB4A 1TWCA 1W7PA 1R23A 2CFAA 3GYHX 2DPDA 1XXAA 1FZPB 5ILVA 4YIFA 4KN4X 3FHZA 3M7GA 2QBYB 2GA2A 1ZLKA 1YYVA 3IWFA 1B59A 4EJVA 3IHUA 4N9IA 1EK8A 4F7ZA 5DDGA 3O6BB 2KIFA 2WTEA 1RI7A 4HV6A 2UZKA 2EV6A 4GCVA 3EDPA 4ILDA 3WU0A 4AIKA 2O03A 4XLPF 4BLAA 2CO5A 2EFOA 4Y15A 2KRFA 2JRTA 2YU9A 1YTYA 4AIJA 3BPXA 3DP7A 4YIIA 3GF2A 3E6MA 4EGYA 1JXSA 5ILSA 2HZTA 1RNLA 2FOKA 3CQZA 2OAZA 1EH6A 1R5GA 1OYWA 4KICA 1FBUA 2OU2A 3OOPA 3P9KA 4Q47A 5CHPA 4GYGA 1W5SA 3LA2A 3ZMZA 4I2OA 4J3NA 4UHTA 2P5KA 5E17F 4P96A 2KKOA 5JFEA 4HBLA 2LF7A 1ULYA 2E1CA 5JHUA 4LD5A 1KGSA 2L4MA 1ZARA 4KNYA 4U0VA 2A68F 4G6QA 2AXLA 3ZPLA 3FWEA 5K5OA 2HWVA 3F6VA 1BC7C 1XN7A 2DK8A 5E18F 2HYFA 2Z99A 1ZGAA 2GZWA 2UXNA 3BUEA 1O2BA 3MWMA 2OQRA 1U8RA 4GTBA 1YS7A 2JPBA 1GXQA 2COMA 3TO7A 1YW9A 3B02A 4OOIA 2ISZA 2HQRA 1UFMA 3T8RA 3IRQA 4HDUA 3SZPA 4JBAA 5L3BA 4C2MC 4EM0B 2ZFZA 3F8MA 3KLNA 2O61A 3GFMA 3RI4A 1WI9A 3HTSB 1J0RA 3O2PE 1S8NA 2OZ6A 4I0BA 3I0TA 4LLGF 2M45A 4XRFA 2J5PA 3DKWA 1QZZA 1FY7A 1WCMA 4D0PA 1IS1A 1O2AA 5EEHA 3PFIA 5D4RA 4PDKA 4P55A 2W85A 2D1HA 3J80K 3GFIA 1U2WA 2DTRA 4GGGA 3KP6A 4OIPF 1TWFA 3WGIA 1USSA 3MEXA 4JQFA 3BJAA 5E20A 2QBYA 2ZNZA 2MLKA 2VOPA 3E3VA 2MH2A 1O3QA 4RGRA 4NQWA 2RN7A 5HVQC 2DU9A 5E1XA 1OYIA 3L00A 1TTYA 3ABTA 1R36A 4O5VA 1FLIA 5FD6A 2V1DA 1R00A 3ECOA 3JSPA 3G4AA 4OIRF 1KU7A 1XMKA 1J9IA 3TDUC 1R1VA 2HTJA 2HGCA 5TJ3A 1PP7U 3L7WA 4ON0A 4R79A 5HS8A 2PMHA 1HQCA 2O3FA 2MC3A 4HAMA 2FNAA 2P5VA 1EH8A 2BBYA 4ZYHA 2L3DA 4C3HC 1H9TA 2G7HA 2IA1A 1Z9CA 3H92A 3AQPA 4XSZF 3F21A 1T98A 4OINF 2IW5A 1KQ4A 3HIFA 3U1DA 5D5VB 3CDHA 3N3YA 3RDIA 5BMZA 1O27A 1S29A 4BLBA 3GTMA 5HLGA 3H3ZA 1PUEE 2EWNA 4PZJA 1TW2A 2ADUA 2MH9A 4KIFA 2XCQA 3K9TA 1R1UA 4UVCA 3N97A 1GVJA 3JTHA 5LHIA 3ABUA 4KAWX 1U5TB 4BHBA 2ZMEB 4P9FA 4LG0B 1RUOA 4BNCA 2PBIA 3RPQA 4O6JA 4GTFA 5CLSA 1FT9A 4M9SA 2IPQX 3CUOA 3AQOA 3LA3A 5BQTA 1T0FA 1G6NA 3GLXA 1MDMB 2XIGA 5D8LB 5ICEA 1SFXA 1I6XA 4UVAA 2NVXA 3BWGA 3SXYA 4UV8A 4AD9A 4ZYEA 3G4CA 4QLCU 1CF7B 4L0YB 3QOPA 2RC4A 4ESFA 1WIHA 2NYXA 2ZKZA 1RIOH 4YFXF 2VC1A 4HLYA 1K6OA 2RKHA 4O3MA 4KN7X 4XBFA 1ZRFA 1BGWA 5BOXA 1S7AA 3V8KA 5DUIA 5F64A 3IL2A 2GSOA 1BJAA 2F5CA 2EA4A 2KWAA 2BGCA 3LA7A 5LGNA 3MZHA 2RDPA 3DV8A 4A6DA 5KVRA 3V8JA 2HQNA 4LMYA 3V7CA 1TLHB 5DYMA 4DDQA 3O3KA 1AWCA 3H0GA 1SD5A 3FMRA 3ZMDA 2W24A 3E5XA 1B9MA 1ZHFA 2OZUA 2KJCA 3HOSA 2QM3A 1PP8F 3WE2A 2VN2A 2OD5A 1KU9A 3R0JA 3QX3A 2JT1A 4Y17A 1ON1A 4FX0A 4G7ZF 4L5IA 4M1XA 4ZZDA 4WXDA 5LRSA 3OEPA 1BBYA 4Q48A 4U0YA 1ZBSA 2RNJA 3GTQA 5FO5A 3OREA 5E1ZB 1J7KA 1USTA 2BE5F 3M1EA 3TGNA 4A5MA 1Z1DA 1XSDA 1T38A 1YO5C 3TO9A 2EFWA 4EJUA 2LF8A 4K2EA 2CFXA 5CVJA 2H27A 4LB6B 2M1BA 2FNPA 4WK8F 3WG9A 4G7HF 3KP5A 5L3GA 3I71A 4S04A 2XCRB 1BI1A 3NUHA 2EFQA 6PAXA 5K1YA 3FOEA 2UWMA 4RGUA 4ENNA 4IPAA 1FSHA 5D5XB 1HKQA 4HLXA 1Z6RA 1ZLJA 3EYYA 4FX4A 2QENA 1MJBA 2VT3A 3WTTC 1KQ8A 3JW4A 2VT2A 1FX7A 3HHHA 2CWEA 3F8FA 1D8KA 3D0SA 2H09A 4KATA 2ZMEA 2IVMA 3HSRA 1V4RA 1IN4A 3FKIA 1IUYA 2PI0A 4LG0A 4NHJA 5EEGA 4WX9A 2JA5A 3IKVA 4L9JA 2K4JA 3KFWX 4KB4A 2K4BA 4IRGA 3GW2A 3RYPA 1YW7A 1FYLA 4KMHA 5HS7A 1MDMA 1BOAA 3MQ0A 2G9WA 1IN7A 1BJTA 1G4DA 1CF7A 2F2EA 2OA4A 1STZA 1FYMA 2CG4A 2P7VB 2BEOA 4FM9A 3NQOA 5D5WB 5FGMA 4L9VA 2HYGD 2GA1A 2HEOA 2B0LA 5CVRA 1DPRA 2ZXJA 2XASA 3GX4X 1U78A 3R0AA 3FX3A 1XD7A 3SFZA 4OIQF 2IP2A 1IN6A 3JSOA 1C0WA 3E5QA 5DD8A 2TDXA 4Y13A 2ZNYA 5HDKA 5FLXK 3FOFA 4UUVA 4XLNF 2JA7A 1OMIA 1GHCA 1WSUA 2V79A 5E8IA 4A12A 2NAZA 2PMUA 4IJAA 2E2HA 4M6XA 4GXOA 2PHCB 4CGZA 5DEQA 2PEXA 4B09A 4EM2A 2QQAA 2ZJ2A 1FBSA 4MQVA 4C3IC 5HLIA 2FRHA 3MCZA 2RQPA 2A3SA 3WGGA 1R58A 5F6FA 1LDDA 3RKYA 2DFIA 2XCOA 2JPCA 4IRHA 5LGTA 1UHWA 1OPCA 2DBBA 3V7RA 2GXBA 2A5YB 2F5DA 4GTCA 2L54A 3ROUA 1BIAA 2FBHA 3U2RA 5IT9Z 4MNUA 2MLGA 4RGXA 2B63A 3WTWC 2ACJA 4P5BA 2ZCWA 2RGRA 3FM5A 2E2IA 4KT5C 1VTNC 1Z6TA 1R22A 1X3UA 4GFQA 1HW5A 1F5TA 3R6SA 2PQ8A 4WCGA 1YS6A 2R92A 2XAJA 3WTVC 3KZYA 4Z2YA 3K1NA 3VFZA 3LWFA 2DT5A 3F8CA 4I7HA 1QQIA 2C6YA 1SD6A 2XV4S 3W6JB 1W7PD 2WV0A 2NNNA 2EV0A 2AS5F 2EA2A 3VB2A 3J81K 3HOTA 2JZYA 1EH1A 3N4MA 3QU3A 3OPFA 4MHGA 2FA5A 2EB7A 5E8GA 3TQNA 1W4MA 4KIBA 2HDCA 2VODA 3HRSA 2F5FA 1FC3A 1JHFA 4HW0A 1YW8A 4HQMA 4KIGA 4R8HA 1R9TA 2Z33A 2KIUA 3RKXA 1S7OA 4KYWA 2DAOA 4NB5A 4YFKF 1DD5A 4WXHA 3U9GA 1K7AA 3JAMK 5JFRA 3I4PA 3GTOA 5CYVA 4G0UA 1AOYA 2JSCA 5L3EA 2QVOA 3HHGA 1MKMA 1T39A 2XAGA 3DF8A 1CGPA 3P9IA 2H94A 1TQPA 3ZMUA 4ESBA 1DPUA 2LDUA 1E17A 3C1DA 4KUMA 3ERED 2IJLA 1DDNA 3LPXA 3RPUA 1KA8A 1HSTA 3QRFF 1HKSA 1OR7A 1BN5A 5DD4A 1ZRDA 4RB1A 3E6DA 5LEJA 4A5NA 2QWWA 2UXXA 5ICCA 1FPQA 3TKYA 4A0ZA 3CUQC 3VA7A 1ON2A 5JR3A 1B1BA 3CO6C 3ELKA 4LLNA 2DQRA 4EVIA 1P4AA 2XRNA 5ICGA 4MEXF 4EJTA 1HBXG 4GTLA 4KMDA 2OQGA 1K83A 2L01A 4I98B 2STTA 1LB2A 4PGGA 2IT0A 2LNBA 2V6CA 4ENKA 2FBIA 2ZBKA 3ISPA 1S6LA 1U5TC 3GZ5A 4KMUX 3CO7C 3E6BA 3SHFA 1IXSB 2MBFA 4IHTA 3CUQB 1ZREA 2A61A 3GTKA 2L4AA 1LDJA 4LJZF 3K1PA 2BV6A 1B4AA 1K78B 4L0ZB 1XCVA 4L9TA 2GWRA 1G3WA 2QYOA 2XHKA 4MQ9F 5DV5A 3WU1B 1SD7A 2D45A 2IA0A 2PJPA 5D5UB 1Z91A 4G9YA 5ILUA 4LB5A 4M9ZA 3KCCA 4HOBA 5DCFA 1WKMA 3T1BA 1ODDA 4GTEA 1KQ0A 2ESHA 4DNCA 1WRJA 2XKOA 5EGHA 3I54A 4UNOA 1SFEA 3R61A 3ZP5A 4UVBA 4RS8A 1JGSA 1J5YA 1ZG1A 2MA3A 4M71A 1O25A 4I01A 1A04A 2ZFWA 2QUFA 1XGOA 4OU0A 3QU6A 5TJJA 4G94A 2RH6A 3J80Z 2FMLA 1TQIA 3OV8A 5A2QK 2IRFG 2VONA 1S3JA 2JA6A 4AWXB 4I0AA 5JVTA 2GIVA 4IRIA 1I27A 2R7FA 5EGEA 1D5VA 3DPTA 1V3FA 3COAC 2YPRA 5BS6A 1YIOA 3FXQA 3ZMSA 2HKOA 1W7PB 4E70A 3L2CA 1WQGA 1JHHA 1XXCA 4ZYDA 2DK5A 2R7ZA 1TWHA 3FM3A 1LDKB 4HF2A 2VBXA 5HS9A 3M8FA 3ZMVA 1IN8A 1MJ9A 5DCMB 3GTGA 3BOQA 1UB9A 1IN5A 1FWZA 4UV9A 2CSOA 3WTZA 4PCQA 4HA8A 4RB3C 3HUGA 5FFZA 3BY6A 2P4WA 3KETA 1D8JA 2FQ3A 5CVUA 2CW0F 4BQAA 3Q3QA 3NEUA 1O28A 1TBXA 3QP5A 4U88A 2H6BA 3IWZA 2A69F 5ED4A 1FNNA 3I53A 2XAFA 3EYIA 4KA4A 1RZ4A 1YQAA 3BJ6A 3M8EA 2PFBA 5IORA 1G3YA 3QPTA 2EV5A 3AAFA 2XAQA 3GFJA 4CICA 3MZYA 3IRRA 4EQQA 4RB0A 4I02A 1O7FA 5ICFA 2K86A 3T0YA 3B73A 3F23A 2L02A 1BI2A 3WTSC 4G7OF 1GE9A 1G3TA 1QPMA 1XGMA 3BP8A 3GWZA 3PQKA 2A6EF 2RV8A 4P5OA 5HDNA 2ETHA 2XUBA 2OBPA 4MEYF 3BROA 3IKTA 1O3TA 2V9VA 3CUQA 1EV7A 2KJBA 5H6RA 1I3QA 3J7AO 4ZH4F 4PGHA 1P92A 5J8CA 5LHHA 1WQFA 1IAWA 1U6GA 5D6EA 1L0OC 3QAHA 4M74A 3REOA 4OIOF 3I58A 4CO8A 1HW1A 1U5TA 1LEAA 3KP7A 1ZRCA 3HYIA 1MJAA 3BDDA 1Y0UA 4GT9A 3FZVA 3I59B 2P5MA 5J6XA 1F9NA 1ISEA 4I09A 1U3EM 4GTAA 3DQVC 3LAJA 2LSOA 2HOEA 4CXFA 2Q2EA 4LR2A 2EK5A 2YR2A 3FXRA 4G0VA 2MD5A 2XAHA 2ZO4A 2H6CA 1FP2A 1WWXA 1ZH5A 4N9HA 4ENJA 5LBQA 2FU4A 2LKPA 3LAPA 2QQ9A 1BI0A 4HX7A 1XSVA 4G0WA 3AH5A 4P9UA 1F4KA 2XKPA 5AIQA 4KM9A 3L4JA 2K02A 1BM9A 1RUNA 3L4KA 4BXUA 5JVOA 1FP1D 2VXZA 2YU3A 3GXOA 1BI3A 4HZFA 1SD4A 2M30A 1Z7UA 5BPDA 3KE2A 4L18B 3VOEA 4MGRA 1XGSA 2YX4A 3Q9SA 3FMSA 2O0YA 2PN6A 2XVCA 2Y75A 5DCMA 3WTUC 3ULQB 2K27A 4HDVA 1L3LA 1LNWA 2Z3YA 2QQBA 2E1NA