3LB9A

Crystal structure of the b. circulans cpa123 circular permutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
ATFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVWGASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Circular permutation of Bacillus circulans xylanase: a kinetic and structural study.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 45
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lb9A00
2B42B 2DFBA 1ENXA 2VULA 3B7MA 2DCKA 1BCXA 1C5IA 3WP4A 3AMQA 2D97A 1UKRA 3VZNA 3MF9A 2BW8A 2QZ3A 1XNCA 3RI8A 2F6BA 3WQ0A 1REDA 3AMNA 3LGRA 1HV0A 3WQ7A 2Z79A 2NQYA 3AMMA 3EXUA 3M4FA 3AMPA 3AKTA 3ZSEA 3WP5A 1HV1A 4HKOA 4HKLA 4S2DA 3WP3A 2VUJA 1H0BA 2DCJA 3MFAA 3MF6A 2DCYA 4S2HA 3VZKA 2NLRA 1BK1A 1OA3A 3VLBB 3VZMA 3HD8B 1H4GA 2DFCA 2BWAA 3VZOA 3WR0A 1TE1B 1OLRA 2BVVA 3AMHA 3VZLA 3O7OA 1UU5A 1NLRA 2C1FA 3AKQA 4S2GA 3LB9A 1XYPA 1YNAA 2JEMA 1M4WA 3RI9A 4NPRA 3WP6A 1H4HA 1KS4A 1OA4A 3WXPA 2QZ2A 5K9YA 1XYOA 3WY6A 3VHOA 4HK8A 1XNBA 1XXNA 3MFCA 1AXKA 1IGOA 1REEA 1C5HA 3WT3A 1XNDA 1XYNA 1REFA 5HXVA 1H8VA 1KS5A 3VL9A 1UU4A 2B45X 2VGDA 2JENA 4S2FA 3B5LB 4H7MA 3VL8A 3AKSA 4XQDA 2BWCA 1XNKA 3AKRA 1UU6A 5EJ3A 1HIXA 2D98A 1F5JA 1OLQA 4HK9A 3AKPA 1BVVA 3VGIA 1OA2A 3WQ1A 1PVXA 4XQWA 4HKWA 4XQ4A 3VHPA 1QH7A 2JICA 3VHNA 1T6GC 2DCZA 1QH6A 1W2UA 5K7PA 3VZJA 2B46X 4XPVA 2VG9A 1H1AA 3WX5A 4IXLA
chains in the Genus database with same CATH superfamily
1QKQA 3WUCA 1IKPA 4N8MA 4BHPA 1YIFA 3W9AA 4D8MA 5BNNA 1NCRB 5F1RA 1I5PA 4CVUA 2LM3A 1VBE2 1GLHA 1KFXL 4YVWB 3USSA 5JPNB 2ZGOA 3N7MA 4WM8B 1OD3A 1UYZA 2CTVA 2XJQA 2JG8C 4CDWB 5FMDA 4JZRA 2IFWA 4COWA 1X9TA 3SITA 5FZOB 4A41A 1VRBA 4OQ9A 4Z8BA 4IESA 2XBO3 2PLV2 4HFSA 4XTMA 1FNZA 1MEC1 4P08A 3ZXEA 3ZXDA 4FFHA 1US2A 3MIFA 2SLIA 4QPGA 3WP3A 2I74A 4V2WA 4E4DX 1D4M3 4EWDA 5ACA1 1POV0 2D6PA 1FPN2 3J4UH 2PAMA 3MF6A 1QJZA 2W47A 3H8UA 4LITA 4M0HA 1LCLA 3FBYA 4Z1VA 3O1VA 4LBJA 4Y5SA 2JG8A 1HRI3 1PK6C 2DURA 2W3JA 1W8WA 5FXXA 1QQP1 2JXAA 2BPA2 4LQRA 4TLFA 2ETEA 5F2SA 5FAXA 5DN2A 1HX6A 2H6CA 3AL6A 2XQRA 3LEMA 4QX7A 3ZDVA 4D69A 3KQRA 2VMGA 1DP0A 4QX0A 1WW4A 1XYPA 4UF0B 4AZZA 4MGQA 1ND3A 3MW3A 4D7TA 1M4WA 5CKNA 1TG7A 1D4M2 1LKNA 1OT5A 2YU1A 3C3VA 1ZRRA 1WUVA 3RZHA 1HN0A 2TNFA 1IQAA 3B93A 3DPRA 5FLHA 3RGBA 3ETQA 3B9IA 1NLSA 1RTVA 1RHI1 4OHXA 4E4SA 4Q0VA 1Q8SA 2ZEZA 2NP0A 2VL4A 3RDIA 3WG2A 3FMGA 1HB2A 4N43B 2WT1A 2Z2SB 3EJKA 2C9AA 2N7GA 2GN3A 2X10A 2WABA 5GLUA 2VC9A 3POEA 2G1MA 4R9BA 3NV3A 1DIWA 3S6PA 3TEXA 4ARYA 5CA6A 4BPZA 3ZLIA 2XJSA 5FY7A 1LOBA 4E4HA 5C9AC 1SFNA 1EUUA 1Y43B 4BQ5A 4HONA 4TZDA 2C6SA 5FZCA 4Y1VA 3M3IA 1YFYA 2BFUL 3QD6A 4NN0A 2PYTA 5FZKA 2GNTA 5BNOC 1IOAA 3AFKA 2QFEA 1H8TC 1LULA 1CZVA 2WIIB 3VKLA 3URFA 1RUC2 1J59A 1WZXA 1V6JA 1PMHX 1ULDA 2EICA 5A3WA 3WCSA 1MS9A 2V5YA 4GH4B 2F17A 5LB6A 2BBVA 1R082 1L7RA 3J7HA 3SQOA 4DXZA 1W9SA 3IMMA 4N53A 5GJ6A 2HWE2 2DYCA 3U78A 1XE8A 3RYRA 2XLGA 1A6CA 4M4PA 1BJQA 1AYM3 3D8CA 1N3PA 2E9QA 4CP2A 2J1TA 2AZ5A 1PGL2 1DLCA 2E63A 2DVGA 2BFUS 4M3CA 2YYOA 4MUVA 2D97A 1LOCA 3CJIC 5E1RA 5A7WB 5C6CA 3V64A 1QJU3 2YG0A 2J22A 1COV2 3MIDA 4QGMA 5L7OA 2HWB3 1NCRA 4NAOA 5T3NA 3OGJA 5AVPA 3R4SA 2GH8A 5FRAA 3U11A 3DKQA 3VBHA 2JIJA 4UBHA 2EAKA 3RRDA 1C57A 3WQ7A 4BQ1A 3PMSA 4EJRA 2NQYA 4YGEA 4Q8LA 3M1HA 2HWE3 4CCMA 1WCDJ 4OI1A 3J26N 4EN7B 2XLAA 3R6SA 2FCVA 2JDPA 2W1WA 3AM2A 5TSWA 1NA1C 4S2DA 5EFUA 4ZZ8A 1ND3C 3MV11 3CJIA 1SZBA 3USUB 5FMCA 4FVVA 1WLCA 3AC0A 2ZAAA 1TMF2 2WA3A 5IVFA 2LUWA 1B35A 1L7QA 4XF3A 4LBMA 3H8RA 1NOVA 3PVEA 3HNYM 3POBA 3T3YA 4XJUA 2EALA 5KHGA 5J96B 5IVJA 3KVAA 3EB7A 3C7GA 5IUQA 5F7UA 3JD73 4OFGA 2YXSA 4RGAA 1SPPB 5DUUA 5FPLA 4EE2A 1RUOA 1R092 4N9IA 2YBKA 4B3NA 4Q4W3 4HVRA 4AEMA 3GALA 4FTEA 3AZZA 1H9PA 1P8JA 3I2DA 3HVDA 5DAPA 3VB9A 2DWRA 2GNBA 4GA9A 4Q4Y2 5T55A 4H14A 1C1LA 4ASMB 1KS4A 1OA4A 2RJKA 5EJ1B 2CAUA 4PDWA 4YVSB 3ILNA 4Y3OA 1PZ7A 1LEMA 2ZEWA 1N1YA 3WLUA 3H42B 1C1FA 4AI8A 1OOPA 1YQ8A 2WO3A 4B8EA 2XR4A 3KHCA 2XHNA 5I8SA 1MZEA 4AQSA 3ZMNA 3H3ZA 3DCQA 2AEZA 1UOFA 1OQ1A 3FE5A 3RPQA 1I3HA 1RVF3 2GC2A 3GBFA 2W1SA 5EYXA 3HQXA 1CWPA 4OHYA 4H7MA 1BEV1 1CJDA 3VKNA 4XTPA 5C70A 4LO8A 3INAA 1V6LA 5FPXA 3D4KA 1JZ7A 5JSPA 1S0IA 4MXVA 2D40A 2FDJA 4UW5A 4CUBA 5BNPB 3EQEA 1X50A 1Y9MA 2E53A 1QIQA 4D7SA 4PIYA 4JCKA 4BQ2A 3EMRA 4NOTA 5DZFA 1BMV2 2RR11 2AEYA 1LTEA 3S5QA 4AEDA 4BXFA 1ND3B 4P9XA 2VNOA 2YY1A 1YJKA 2C4XA 3HBKA 4QDRA 5DZGA 4BMBA 5FPAA 1UD1A 1SDDB 3SISA 2XPJA 3KVBA 4CEYA 3H8XA 1H30A 1VJ2A 5CKQA 5J7MA 2H6BA 3DEMA 3EHKA 5CVRA 3BVCA 4LBQA 3ACLA 2Q1FA 5LEKA 4LT5A 1KEXA 1MS5A 5G04L 3TN92 3B01A 4CXWA 3NV4A 2W52A 1UQXA 5B4XA 4RGKA 3J7NA 2GU9A 1AR71 1N3QA 4KBZA 5CEHA 2A6WA 4K6BA 1C5IA 5H9QA 5ANQA 3D0SA 3TN91 1URXA 5LY1A 2PQQA 2PHXA 2WUHA 3IZOA 5FZMA 3UJQA 4IEQA 4K1ZA 3UL2A 2QQOA 4BYYA 1AXZA 2WNVB 1W8OA 3UETA 1XNCA 5A7OA 4AI2A 1XU1A 2JWPA 2F4LA 3RI8A 1AR62 5C8CB 2ERFA 1DYOA 4K20A 3POFA 1ENRA 2HEVF 1HJGA 4UW6A 1CX4A 1RUH2 2WA4A 3AZYA 4E4ZA 5C3PA 4DO0A 4FPCA 4X8PA 2BGOA 4Z2AA 2CGNA 1SCSA 5DAQA 1GBGA 2CDOA 1R083 3KV5A 3BI3A 2VUJA 3O1SA 3E6DA 4PT6A 2GALA 1J1LA 5IWFA 5F6KA 2R063 2JKBA 5A6ZA 3ACFA 4BLJA 2BRTA 1EV12 4GH4A 2WN3A 4COYA 2BGPA 2NM1A 1DG6A 4N7UA 5JPMB 2Q30A 1MVEA 1GP6A 3DYOA 1CIYA 1R1A2 3FJSA 4IGQA 4OQ8A 1DQ0A 1YI9A 1RUJ2 3HD8B 3BTZA 2BWAA 1QXJA 3I2KA 2R042 4HXCA 3RG0A 5J98B 1W3XA 1NG0A 4DB5A 1GOFA 4CP1A 2PLV3 1VBE1 3K3NA 3JD71 5BV6A 1D7PM 2GP3A 5IFPA 1UKGA 1FV2A 2VQAA 2VNGA 5F6LB 1HRI1 1RUD1 1CAXA 3CDZB 3OD4A 2DV9A 1X8MA 5F9TA 4SBVA 5FZ1A 4AVTA 5HI0A 4GALA 2W2IA 1MZFA 1W9YA 2UY9A 4GZ9A 2GP5A 3MIHA 5FYHA 5BXXA 1JHJA 4EN6B 3VUOA 2BVBA 3RQ0A 2CAVA 4AW7A 1JYXA 1F35A 1F2NA 4N9HA 1JYVA 1F4AA 1YO8A 1ZZBA 4OMCA 5CNAA 5ACA2 4INDA 2EIGA 4A6SA 1WCKA 5IJRA 3THDA 2BEOA 3ZYPA 4M4RA 2ZX4A 1MS1A 2ZMNA 2E6VA 2IFRA 3GZUC 3WG1A 2VZPA 2VCCA 3JBG1 1W99A 4O9EA 2FDHA 1V70A 4W8JA 5IK4A 2H0VA 1GUIA 4CUCA 1UU6A 4DXTA 2B5HA 3X29B 3VBUB 1KXGA 2GH2A 1RUG2 4B4QA 5A70A 2XVKA 2XVGA 1ZBE1 2JECA 5DXDA 4YGDA 4H55A 4XIOA 3BB6A 1W2AX 1XQNA 3LA3A 3PUHA 3IIIA 1V6NA 3K51A 4CPBA 1CAVB 2VOTA 3W5NA 1KGYA 4CXYA 2P1BA 4C1WA 5B4NA 3KT4A 3ZVXA 1D4M1 3BODA 1WBFA 2R1DA 2TEPA 4ONUA 3KWVA 1ODNA 3UT0A 2Y33A 1BBT1 1V6OA 1O7FA 1F9KA 2CU5A 4RGGA 4AQ6A 2UU8A 4IGOA 2YZ4A 4CEWB 4U36A 2ZBJA 4AE2A 2CGPA 4XACA 1HXS2 1SEFA 3GCWA 4L0PA 2WL1A 2QBXA 1YCIA 2GC3A 5LBBA 2VUDA 3KV9A 1VAVA 4D94A 1IKQA 1WW7A 2YUEA 4GULA 3I3EA 2LS6A 3Q8BA 2VPVA 2WNUB 4IEUA 4Y4RA 1OQEA 2MNGA 1H1MA 1VMFA 3ZFEC 1POQA 2FMYA 4GH4C 3OGRA 2HWD1 1O4TA 3F2ZA 3O12A 2A7AA 3O0XA 5FPBA 3AMQA 3WDXA 2BOIA 3WP4A 4EN9B 4PBPA 4WM8A 4KNCA 1CAUB 5A3LA 2Y38A 5T5LA 3ZYIB 2KA3A 1FOD1 3I2HA 1OURA 1MS8A 3M3QA 4QGNA 4RFT0 1UX6A 3NWKA 1G9CA 2HWD2 4QDSA 1JW6A 4Z07A 2D43A 1SLLA 3C8XA 2XMLA 3PIJA 2DVAA 3M4FA 3EXUA 2ZAHA 3IDCB 4NUBA 3SCFA 2Y64A 1FYUA 4W4ZA 4WM8C 2VCAA 3H7YA 3I49A 2Y6LA 1AL23 2JG8B 4GB33 3B9CA 1AL0G 1IPSA 2R073 4XBQA 2A3WA 2PAKA 4HSLA 5CYYA 1G7YA 1QOSA 5J1XA 2Q1MA 2QUOA 5T50A 1HQNA 4CDQB 2VQUA 1OA3A 3BN6A 3MGUA 2X5IC 2Y0OA 2WAOA 4XZUG 1FMD3 4I30A 4YZ5A 2MHFA 4Q4X3 3WR0A 1TE1B 5FZHA 3VKMA 3ALQA 4DUWA 1PGSA 1ULOA 5D8AB 2BDRA 4AXOA 4COUA 3SMHA 4MGIE 4MX3A 4AGVA 5DMYA 4Q4V3 2DU0A 5DZEA 3BIEA 5FOBB 4ZY9A 3DPRB 4TTGA 4XAAA 2W91A 3AXEA 5FO8B 4JTOA 2VZUA 3HWJA 4ZKTB 3PUAA 4Q2FA 3ZDSA 5ERLA 4Q4X1 3OG2A 1XNBA 1HLCA 2Q0AA 1US3A 1BQPA 2WZ8A 1GZWB 4N43A 4NHXA 5E16A 5BPXA 3HQRA 1H6XA 1QJX2 3ZXAC 4LUMA 1EV13 4UFLA 1PK6A 1ACCA 1QJY2 5FZGA 2EAAA 2RMU1 1H8VA 1W8ZA 3I2JA 4Q1PA 3K75B 4QHOA 4ATFA 2BZDA 5IAXA 4UFIA 2ORXA 2G19A 3AP5A 1DYKA 2XOMA 1ZBA2 4EN0A 4YLZA 1XNKA 1BBT2 1Q8OA 4YM0A 2PHUA 2ZCWA 4XDQA 1KQRA 2RS13 4AVAA 2CNAA 4OHZA 4HLTA 4UW3A 4Y20A 3FLTA 1QNYA 1CJPA 1LRHA 1A8DA 1W06A 5FZ7A 5LK5A 1G9DA 1S0EA 1OLQA 4PQ9A 5IYYA 3BKZA 2HBTA 4XF9A 1WCQA 5C33A 3USUA 1PNFA 2LTNA 2WN2A 1VBE3 1C8M2 3GM8A 4ISRA 1AZDA 1NZIA 2EVXA 1GOGA 3WF0A 4RSUA 1UYXA 4CPBD 2ZPXA 2DTWA 1DGRN 3ACHA 2O8OA 1ASJ2 3AJZA 4GAZA 5FYMA 5I8TA 3TNQA 5ANNA 3SEEA 3VHNA 5A1AA 1MQTC 2P3KA 2Y6GA 1BBT3 2R061 1R1A1 2RS12 4KI5M 4AQ2A 4QB1A 4P9YA 3I59B 4LK7A 2XUEA 5F5IA 2JDAA 3IKWA 4AAPA 4Z2WA 1V6IA 1JYTA 5GALA 4AR2A 1V9U1 3MPPG 2VECA 1RUF2 2G9ZA 1D2SA 3WHTA 4ZXKA 3JD72 3UV9A 3CNAA 5LK7B 2RS11 1AR93 2XDVA 2VZQA 4YW3A 1HRI2 4TWTA 5ABJC 5A3OA 3DYPA 5FKCA 5C9AA 4WVMA 3WDWA 2ZX3A 1BK0A 3KGZA 3U4SA 3ITQA 4ARXA 1NA1A 1V6MA 2Z4FA 4LO6B 1YFXA 1NCQB 2CV6A 4CDUB 4F83A 3CKHA 5FP3A 4Q4Y3 5T54A 5FZ0A 3H9AA 1UY0A 3MO4A 4KGQA 2XJPA 4YFZA 2LROA 3AMMA 4RQPC 5FK8A 4IE4A 4K21A 2IXHA 4RR3C 3CJIB 2WT0A 4GKXA 1JUHA 3WF4A 2J1AA 3VBOA 3A4UA 1CQ9A 4ISQA 1MVQA 3ST7A 1X8EA 1K5MC 1X82A 4S2HA 3OSDA 3VDBA 1BK1A 1W0OA 1QJEA 4IE0A 3NNMA 1AR63 4MGSA 1SPPA 2ADDA 4GQ7A 3HNMA 1VBA1 2I07B 3VD7A 3N7KA 2ZGPA 1I9RA 4QPYA 4CDQA 4NIDA 3M3CA 2VQTA 3VZOA 4Q4V1 1UO9A 1WMDA 4XW3A 4C1XA 3N4MA 3UYJA 1W6QB 3WG4A 5FP9A 3NNLA 3E5UA 1LJ7A 1K42A 4QHZA 3MUZ1 1SLIA 5D8AA 2OUHA 1DDLA 4J6GA 2QJVA 3N7LA 1DLLA 4KBBA 4WM7B 2WWUA 5K8SA 1YFUA 3R4DB 5I91A 3C2UA 3BGAA 2JDHA 2D3SA 5JOXA 1OOPB 4FFFA 3A0KA 4M3CE 4N53C 2B9UA 3ME2A 4FOVA 4XJWA 2ZHMA 1RXFA 4DINB 4UOJA 4Y1UA 1W39A 2LALA 3JZVA 4QGLA 3QH7A 1VLNA 5A6YA 4XDPA 2VZ3A 3I3QA 2WC2A 4I2OA 1NUKA 2EIDA 2VZRA 3OCPA 4MLOA 4UI9L 2Y34A 4LLOA 3POIA 3RNSA 1NKGA 1OSGA 2ZA9A 4XMAA 5LW9A 1LENA 1OF3A 2UYBA 1RC6A 3ZYHA 3E1F1 5J48A 5FZ9A 1HIXA 3ZKYA 4XYXA 4URTA 4CCLA 4EROA 1UOBA 1EPZA 1ASJ1 5FZIA 3FN9A 5FYZA 2ARBA 5BNPA 1DZRA 4OI0A 3AZVA 4I0AA 1OUSA 2XQXA 3TWIA 3ZPYA 1OH4A 4G3YC 2FCUA 4RQPB 5CBLA 4JC1A 2GMMA 3LPGA 4Y26A 4Q4W1 1COV3 5FMBA 1YQ2A 4OUMA 1NYWA 4HKWA 4AOCA 1HKDA 3K4ZA 5JIUA 2ES3A 4NHMA 3WNXA 3K2OA 5FQ0A 1KJRA 3NKGA 4TYSA 3SNMA 2FZ1A 3SXWA 5IK7A 4FSJA 4FFIA 3S7IA 2HKXA 2J1VA 2P17A 4BZ4A 4C91A 3HAGA 5FZFA 3LPFA 4YSFA 4NIGA 1GNZA 2ZOEB 4RL7A 4OI4A 4IEPA 3KB5A 2KD7A 1J3QA 2CGOA 4CEWC 1YEWA 2B42B 2PHFA 3ZYJB 2OVUA 3TEZA 1YC61 3KQ4B 3S30A 2WO7A 5KC5A 2AC1A 2AYHA 3O5SA 2WSVA 4HPKA 1AX2A 2R071 3OPTA 1AX1A 2D6LX 1TME1 4B7EA 3OBAA 5FIXA 5ISLA 1WA4A 5IAVA 3CU7A 2KM2A 1LU2A 4R4ZA 5DABA 1SHWB 5AC91 2VE1A 1WMEA 4NRMA 3T0BA 3RWKX 4XOGA 5L9BA 4FO9A 3W58A 1TME2 1X36A 2ZEYA 1H0BA 4YW6A 4CE8A 4AI3A 1O4ZA 2DVFA 3RMYA 3AX4A 4JDNA 1XNAA 3HN3A 4IDZA 2NLRA 2WLQA 3ETPA 4YGBA 4XFIA 3VD9A 3WDVA 1QNWA 4JVAA 4PLOA 1WBLA 2MPFA 4WM7C 3TEWA 5FMOS 4W6YA 3KS7A 2HWD3 2V4VA 5F39A 1OI6A 4HBNA 1JOJA 1JMUB 4PBOA 3S57A 4XMIA 3ZSJA 1EAH3 2R1BA 5DUWA 5CG8A 2LW8A 2BVVA 2C0ZA 2C24A 3LOIA 2VMCA 1UU5A 5IVYA 3CHXA 2QQNA 2B8MA 3RJRA 4IW3A 1PO13 3EO6A 1TME3 4LIVA 1YQ5A 1Z7S3 2X5IB 4K3UA 4NRQA 5FWEA 3SHRA 1GZTA 1QOTA 4HVOA 4TLGA 4ORFA 4RFRB 2QZ2A 1YI7A 4ET7A 1NCQA 4HZFA 3VBFB 4NIHA 1VMHA 4LO7A 3P3NA 4M00A 3MFCA 1V6KA 3ACIA 3J7LA 1BYHA 1NY72 1YQCA 1AR81 4HANA 3ZX7A 2G9FA 4JGZC 5DDJ3 5FYUA 4NJ4A 2XVLA 4MGZE 4XBNA 5F5QA 1AYM2 4IV3B 4K40A 4YZ4A 1QHDA 1RJ7A 2R0HA 1WCSA 2FDIA 3OB8A 3AKRA 4LPLA 4NPLA 4FAHA 2FQPA 2VCBA 1AR82 2JB4A 2I45A 3TN93 2WFF1 1BHGA 4B4RA 5FZ8A 5C8CC 3TOJA 1Y4WA 3GYDA 4XVHA 1X33A 2RM23 3T30A 5LA1A 4RHV1 1BVVA 4MGYE 3NW4A 4D6RA 4A3ZA 1ULFA 3NNJA 1PVXA 2XKOA 3VD4A 5EWSA 4LBOA 2WQ4A 1AR91 1LECA 4XDOA 2DU1A 2GDFA 2D5HA 5KWRA 3V0BA 3UESA 4AVVA 1BKZA 2WNUA 5JXHA 1PIV1 1K5MA 1TMF3 2R072 3JQWA 4GMP1 4OZOA 2WS92 2BNOA 1BXHA 5DAVA 3WX5A 4C0HA 5FP7A 1N47A 1BCXA 2ZGSA 4P9JA 3JU9A 1XBFA 2O1QA 2WZR1 2PHLA 3I2IA 4XZPA 2XLFA 3DUIA 1O4YA 2OA2A 4R4XA 4FCAA 2YBSA 5FOJB 2YDEA 1UZYA 3GBWA 3LGRA 4PF1A 1V0AA 1CR7A 2OX0A 1RITA 3OUHA 4XJZA 5IHRA 3FL7A 3OTFA 1RB8G 3ZSEA 3CJXA 3A21A 3HNBM 1LHNA 5LRRA 2X8KA 3MFAA 2QVSB 4LKDA 3H50A 4NAMA 4J1XA 3MBWA 4AFBA 4DXRA 4AFMA 3VBSC 2ARXA 2EA7A 2QQMA 2BP6A 2OT7A 4NRPA 1Y7BA 5H9RA 4COZA 4BWOA 2I2SA 5K0UB 1UCXA 3DKWA 1APNA 1W2TA 3A23A 1QXRA 2GZWA 2G9GA 3GHNA 3NAPB 5BNNC 4FOWA 2O0OA 4COVA 1RHI3 4QPIA 2IXKA 1VBB3 3MPBA 5LZ6A 1SMVA 5FZDA 2Z69A 1HRV1 5CFDA 2DF7A 1RUE2 1UAIA 5SV5A 4YARA 5BNPC 1E57A 3GZAA 1XOYA 1YNAA 4MHRA 4O7XA 4CCJA 1W03A 1XPWA 1W2NA 2DCTA 2NN8A 3S5AA 3GZEA 4P9GA 5FZAA 3PVBB 1UY4A 4KU7A 5L7OB 1GWKA 2OZJA 3AYAA 3W5MA 3MLLA 3T0AA 1K12A 1C8M3 4DY5A 5LEJA 2YU2A 1K5JA 4PDWB 3VBHB 1Y9GA 1A8MA 2RS52 4MH0E 3W20A 1XXNA 4TXWA 1HRV3 2VZOA 3T1MA 2PLV1 3IAPA 2MEV3 5KBFA 4Z92B 4QX3A 5FUPA 3WUDA 5C5UA 5F3EA 3WCRA 2DDUA 2Q1ZB 2B45X 4LORA 4AGRA 1PNGA 1S0DA 2VGDA 4RHV2 5FY4A 3TYJA 1S0GA 2GC0A 3IBMA 2OKXA 4QKFA 1UPIA 2BUKA 2EF6A 2UWCA 3N36A 2PA7A 3I97A 1EAH2 2VBBA 1ZZ7A 3LEGA 1AR92 3FZ3A 4XEZA 1UZVA 4PLNA 1SLTA 4RA0A 4AVBA 1F5JA 4YW5A 5LA2A 2WYFA 4IEOA 4OMDA 3VBRC 4B29A 2AH2A 1K3IA 3IPVA 4P9IA 1VBD2 1XB9A 2JG9A 4QPGB 3D3AA 3DN7A 5FZEA 3ZFGC 5HPOA 1AJKA 3P3PA 4AVCA 5KHKA 1HB4A 1WWYA 1LHUA 5JZGB 4XQWA 2R16A 4NWWA 1HB3A 1SQ4A 2E7QA 4HOOA 1CPNA 1QJFA 4FAGA 5KHIA 3LDRA 2OPWA 4KWJA 2QCSB 2ATFA 3U37A 5A1LA 1JZ3A 1CD3G 3ZSMA 1VR3A 1SG3A 5LY2A 2P6CA 4AK3A 2OW4A 5I0SA 1DQ1A 1OUXA 2VU9A 4UW4A 4WVVA 3ZIWA 4XFBA 1PM4A 4XPVA 4Y1ZA 2HWC1 4KG8A 1N1SA 5FJHA 5FP8A 3SH3A 4GMP3 3C7OA 3WD5A 1XRUA 4JGYA 1GWMA 4FPFA 4YWAA 1ND2A 3FWEA 2ZGKA 1EUTA 5DUXA 1JU4A 4XILA 4H3WA 1MQTA 1DGWA 1GWLA 1QF3A 2VXRA 4KWLA 2A3XA 4CU7A 4ZU7A 4LHNA 1POV1 2BNNA 4HT1T 2JDUA 1KJLA 1FMD2 2D3PA 3T4VA 5A32B 1VE0A 2DVBA 1E5RA 4IE6A 3KCYA 4LLFA 3AP7A 4O65A 4OCTA 5FBZA 5IK8A 2UY8A 1JODA 1ULEA 2Q4SA 3BTYA 4J25A 1FXZA 2FDKA 2P5BA 4HKLA 4AWDA 5EQUA 1E5IA 3NJVA 3GDBA 4XHBA 3MEPA 2YGLA 3RMXA 3RYKA 3OEBA 4CDUC 3RZKA 4AEDB 4AFDA 1XU2A 4M01A 3PMEA 3VZKA 4JRLA 5J3UA 2AUYA 2P34A 4GXLA 1TNRA 3MI8A 3PNAA 2W46A 1RVF1 1W04A 1SLAA 4LKEA 2IUWA 4PLMA 4X6RB 2W92A 1U5ZA 5HV0A 5JOZA 1IPKA 3GJBA 3O1TA 1JXNA 1Q56A 5FJKA 3N9OA 2R30A 1UIJA 5ABJA 1GICA 1LB2A 1QJY3 3VZLA 3NJXA 4FPYA 4Y1YA 3LB9A 4LIUA 1VMJA 5IK5A 3Q8EA 3VDDC 4QPGC 4OHVA 2RDSA 1UX7A 1XE0A 4GWJA 4IEWA 2A6YA 4G9SB 4K1YA 5JVVA 1MACA 3RSJA 3MUY1 4MGKE 1O3RA 1HJFA 4HN1A 1TVGA 4YFWA 1MS3A 3GHMA 3PJYA 1GU3A 1DQ6A 2JD9A 2Z42A 1XYOA 4PIXA 1XSQA 4UFMA 4BLIA 1UY3A 1RUI1 1UPSA 2W0XA 1VIWB 5FZ3A 4CA9A 5FXZA 3IDBB 2IXIA 1LOAA 1ZRIA 3LZZA 1OLME 3ECQA 3W59A 1R093 1R64A 1C5HA 2D6OX 3L2HA 5LATA 1MEC3 4SLIA 5DG2A 3SKJE 1REFA 3IDEA 5DPNA 2ENRA 5CFCB 5EPAA 2YBPA 1ASJ3 3FFZA 2XJUA 4CDXC 2NMNA 2ZGMA 2VMEA 3L2YA 1Z7S2 3H1MA 4AEJA 4AFCA 1VBB2 3PUSA 1GSLA 4DRRA 3AXDA 1RUE3 4Q1RA 4AVSA 5EJZB 2ARAA 4BK5A 1LOGA 4CDWC 5HCAA 3KCXA 2EXHA 4BOWA 4TSVA 4JGZB 2A5ZA 3ZO0B 3WG3A 1W05A 3FUOA 1W6PB 5JLVA 2W68A 4QPIB 2BBAA 5CFDC 3KM5A 1ENSA 1O8PA 4XF0A 2VZVA 2Y6HA 4ASKA 1UMHA 2W08A 2ZABA 1ZVFA 5G05L 3DGTA 1WLWA 2A70A 2A6VA 3LSDA 1W6OB 2MEV2 2P3IA 4QU2A 4DXSA 1EP0A 4IGPA 2RDNA 1W8NA 2OUJA 4TN7A 1EV11 4BK4A 5FCCA 1AR83 2QQUA 3K77A 3M2MA 1NY71 1CN1A 1YJLA 5DDJ1 2G4IA 3H1WA 3SH4A 1WLTA 4FPOB 4OYUA 1ZZ9A 5EP9A 2LRPA 2MEV1 4QD2A 2FDFA 4IQPA 5CB7A 1HN1A 3MW2A 4D6SA 2VOWA 3FHIB 4GD4A 4MADA 5E8AA 2ZZQA 3CBNA 4CP0A 1O59A 4LE3A 4META 1POV3 4I02A 1XC6A 4IEZA 5GLTA 3WHUA 5C7GA 2ZHNA 3MF9A 4DMIA 5FYTA 1LGBA 5T5OA 4E8DA 1ULCA 1NXD1 1F15A 3DF0A 3O1OA 2QQPA 4G4FA 4QWNA 2WNOA 5HXMA 1VBD3 2A73B 3NJYA 5HCFA 5H9PA 4XC9A 5GZEA 1RUC3 3LEKA 3H7JA 4JDMA 4DFSA 5F5AA 2AENA 1W9FA 1QY4A 3NSTA 2VZSA 2YPJA 4XXPA 2WS93 3ILFA 4OUEA 2JG9C 2VCMA 3AZWA 3ENRA 3FHAA 3DECA 1B35B 1ALYA 1OXCA 3NV2A 2OQ6A 3KV6A 1FV3A 5JZGA 4EV0A 3N9QA 3CO2A 2GNMA 1ST8A 4DEVA 1WMFA 4CDXB 1UY1A 4YW2A 2RE9A 3I2OA 3O1MA 4BIFA 2DVDA 3BTAA 4AGGA 3VZMA 1O3TA 2JE8A 3LKJA 1O8SA 4XIKA 4D7YA 3RZGA 2IXCA 4FQZA 3ZN5A 3ZFFA 3OOXA 2WZR2 1RUI2 2XONA 4E2GA 3GGLA 4YVWC 2JEMA 4HG6B 5DG1A 4KL1A 3WW2A 2XJVA 2RVAA 2HWF2 4PCRA 5T52A 5C4WC 2ZX2A 1OFSA 2R49A 3QH6A 3WNMA 3ZN4A 1G9BA 5JOWA 3QCWA 4X8NA 1ZRFA 2FZ2A 3NKTA 1L7LA 4L99A 2Y60A 4IE5A 4O61A 1KRIA 4Q0SA 1Z7S1 4BJ0A 1AJOA 3AYDA 1YQ6A 1OHFA 1DQ4A 2YMZA 3LIGA 4QX8A 5FK7A 3VHOA 2QQLA 2DBNA 2K2SA 4QT6A 4XUTA 3WT3A 3LIHA 3J9SA 2UYAA 4FOYA 4JHZA 2ZHLA 3BCWA 2W94A 4KQ7A 2ZX0A 2D44A 5JAXA 3KLSA 4OHWA 1PK6B 4W6XA 1YRZA 3FLRA 5FBJA 3UGGA 1H1IA 3POSA 4A3XA 3KT1A 4XQDA 1PM7A 4LBLA 4CRQA 5C3RA 2P37A 2XJTA 5KXBA 4CCKA 2KXLA 5LBCA 2WO2A 4A7YA 1S2BA 1H9WA 5EHDA 4BQ3A 3HMYA 3POGA 2JX9A 2BYVE 5E6HA 4Q26A 1JBCA 3ES1A 5CZKA 3SH5A 4URAA 3MV01 4JRAA 4ASLA 3V0AB 5A1FA 4FPGA 1W90A 3O0VA 4YM3A 1RUD2 4LHKA 4NIIA 4K8RB 3NNFA 1QJU1 3NVCA 1S0CA 3E97A 4LNVA 2PQSA 4NWVA 2HWB1 1K5MB 1PGL1 1FOD3 2QKDA 2RG4A 1XJAA 3WV6A 4AAXA 5A3NA 2IXLA 3A22A 5IT6A 3N9LA 1QDOA 4YYOA 1GZWA 4ZPIA 5A7NA 3IT8A 1GV9A 3I59A 4RN5A 2DCKA 1UW8A 2RS33 4A6OA 4WV8A 1Y3TA 1EAH1 2NMOA 3ROUA 4A44A 5FXVA 1Q5OA 3P1IA 4CU8A 4FPKA 2WINB 5C8CA 3UGFA 2WNUC 1B35C 1PO23 5IVVA 1WD4A 1ULPA 1HXS3 1RUG1 2AGSA 1LOEA 2HJIA 2ZEXA 3ZXKA 4YZ1A 2GSYA 1L3JA 1K45A 3BOPA 3MIGA 1U5XA 2X53S 3ZXLA 5A6QA 1ND2C 4HN0A 3U4XA 4NO4A 4XJAA 4B7KA 1COV1 2R7EB 1EYBA 2ADEA 4CCCA 2VNVA 1YLLA 5C4WA 2E32A 1ZNPA 1LHVA 3FC0A 1YIPA 4XFGA 1W6PA 4R9CA 4WZFA 1J83A 3MICA 2X05A 5FYBA 3BTXA 1QOOA 2C9KA 1AR61 1UY2A 4DRVA 2GNDA 3UGHA 1H8TA 2DCYA 1ULGA 1QGLA 3PHMA 4V1PA 4XUQA 4Y33A 2RMU2 2QTWB 3LA7A 4OLLA 2ZJCA 4XE9A 1VB2A 2XH6A 4QKDA 1AVBA 2CHHA 3ATGA 4Y22B 4R8HA 4BQWA 1DYPA 2WAAA 3CF6E 3VD3A 1PO22 4OUSA 4F7ZA 1NT0A 2RDRA 4KU8A 4MZUA 4Q0UA 5GLVA 3MZHA 1JZ5A 1H4GA 2YHJA 4J1WA 4AEKA 4CTEA 4FQ4A 4P02B 4YGCA 2JDMA 1OLRA 4MHUA 3AMHA 1J3RA 1YHFA 2P3YA 5DAXA 1RIRA 3O1RA 1U12A 3VDAA 4DQAA 4RS5B 3I3MA 1ZZ8A 1AR73 1GQHA 1M06G 4AHZA 3FLPA 3WDTA 1D4VB 5GM0A 5K0UC 4NPRA 4MXWB 2WWSA 1O3SA 1H4HA 3AK0A 4LA3A 4XURA 1SFPA 4ZU4A 1WD3A 1VBC3 3WOGA 1TEIA 2AR6A 4QDQA 2VVFA 3DYMA 1DU3D 2VMHA 5A7SA 4WVWA 4LR4A 4YRDA 3H1YA 3AYEA 1VPHA 3OPZA 3PUQA 3OGVA 3WVJA 1YFWA 1ZM1A 2XWJB 3PURA 2R062 1IS6A 2EIBA 1IGOA 3J8F3 3T2TA 4YG0A 2ZKNA 1DHKB 4CCOA 3DXTA 5IVBA 1SLBA 5FUNA 3ZR6A 1C28A 2D6NA 1LOFA 5KHHA 4AHWA 1F4HA 1ZREA 2OPKA 3RWNA 4PDWC 1BVP1 4ZXEA 5A7QA 2CWSA 3V65A 1OC1A 4LBNA 1DGWX 2ARCA 4YM2A 3D5OA 2VNRA 2WZR3 5BUVA 1UXXX 2D98A 2Y6JA 1QJU2 3ZSKA 1DBNA 1UMZA 5F32A 1CAVA 1JZ4A 2HWB2 3HBZA 4YW7A 3SC7X 1Q8VA 3MLKA 4HVQA 3ZXFA 4UFKA 5JXGA 1GYKA 2ZMKA 2CWMA 3OD0A 4AF9A 4YM1A 3BUCA 4CEWA 1QJX3 2R32A 5F3GA 4C90A 4I09A 2ILMA 2JE9A 1LHOA 2JB8A 3AP6A 2VXJA 1UWWA 5L73A 3LOBA 3VBSB 3ZYGA 2QE3A 3Q8AA 4BMEA 2WKKA 5FYYA 1QQP2 3I3BA 4QKNA 1J84A 3MIEA 2RR12 1TNFA 3OUJA 4EZHA 1D2QA 3KSCA 5EYYA 5EZWA 1W28A 4Q8KA 2B46X 1VBA2 1HDKA 2BTVC 3VBOC 2OXBA 4BXSV 4CCDA 4F8AA 3B69A 1LAJA 4FFGA 4BQYA 5EV7A 1ND2B 1FPN3 2B39A 5FREA 4FBFA 1DQ2A 3M7AA 1HXS1 1OKOA 1RUG3 4FOQA 1MQTB 4JKMA 5F2WA 5C3OA 2QQIA 2B4KA 2HWF1 3PU3A 1ZBA1 2K46A 5FPVA 2YPDA 4QM9A 3ZMOA 1LOFC 3N35A 1XNTA 4L2NA 2XWBB 1PIV3 1TMF1 4Q5OA 4A2UA 2F6BA 1UZ0A 4HPKB 5A32A 2Z79A 4DPNA 5A80A 1RHI2 2RR13 5GKAC 2VQ0A 3MIBA 4CUAA 1GZ9A 3AMPA 3AVSA 5D2AA 2R6QA 3VBHC 3U0ZA 5FY8A 1W0NA 3HOBA 5A3MA 5I8YA 1U5IA 3PTRB 1RL3A 3POJA 4RS5C 1EY2A 5GZGA 3TRSB 4IV3C 4Q4Y1 1YXWA 1LGCA 5DDJ2 2VR4A 4BM8A 4CP9A 4KH9A 1W8HA 2PAEA 4E8CA 3N9PA 1PGW2 2DFCA 2YC4A 4NHKA 5SV8A 1OH3A 2RM21 4QQOA 5A3UA 2PTMA 2WFPA 3VBRA 1NAEA 4XUPA 1S1AA 2E51A 1JYWA 3Q8FA 3BIWE 3RZZA 3T2PA 2V5DA 3CLPA 1I6XA 1SBFA 1Z0HA 1PGW1 4FXGB 1YUDA 2RM22 4E27A 4ZONA 2HH9A 5B2GB 3HT2A 1GKBA 1O3QA 4YW1A 5FZLA 4LK6A 1LGNA 3BOWA 2YC0A 1QEXA 1BEV2 1DFQA 1FX5A 2ET1A 2VAUA 1QXPA 2YFZA 4XF1A 5JUVA 5JR2A 5CG9A 2VO5A 2WT2A 1PVC3 5FO9B 2X09A 2VW0A 5T5PA 5C4WB 1FPN1 5F3CA 5KXDA 1RUI3 1AHSA 1SACA 1W6MA 1KS5A 1ZBE2 2VM9A 3N7JA 4JV4A 4B1LA 1UU4A 4XCAA 5C5TA 4UXAA 3HIFA 1GMMA 2Y8KA 3B5LB 4MGTA 1H8TB 2CSGA 1S0BA 1ONAA 3KD4A 1DZTA 5LWBA 4GJYA 4QQLA 4JGZA 1LHWA 5FYVA 5A7PA 4KGGA 1SBEA 3LSEA 1MZ6A 2JIGA 3A7QA 3LEIA 2FCTA 1AXYA 3E5QA 3I8TA 2XJRA 4Q4V2 4JQRA 4BDVB 5AFBA 1JZ8A 5CFCC 4YG3A 3IWZA 3KGLA 2GN7A 1I1EA 1PVC2 3U07A 1GP4A 1WCUA 1JU3A 2ET7A 5KHJA 1PMJX 5FY1A 5L9RA 4PI0A 4AI1A 2VOVA 5C8WA 4LUKA 1DGLA 2BERA 2X5IA 2VVEA 3IDAA 1MPXA 2C26A 4L97A 2EIEA 3TNPB 2W1UA 2Q8CA 1GNYA 3AP9A 5K7PA 4GWNA 4QQHA 1W3VA 2CDPA 3T2QA 5I0RA 4MG2A 4CDQC 1G9FA 4XFFA 5T5JA 2P4EA 2WQZC 4EYUA 2JDNA 5GLWA 1H1AA 4UAPA 3NAPC 2WQ8A 5BNNB 4IXLA 1RJ8A 1MR5A 3RJ2X 4QB2A 2WBKA 4LOTA 1RUJ3 2VMDA 5JIAA 4BQXA 2R043 1NLQA 2QQKA 4LOSA 4I3GA 3VDDB 3WINE 2ZGTA 4CDWA 4AQTA 5FDBA 4AFAA 1UXZA 2GAUA 3HPNA 1HQWA 3IAQA 5FZOA 2NZ9A 4I0WB 4RR3A 2J1EA 2HWF3 3A0NA 4NIAA 4FPEA 4QX1A 3UKVA 2E7AA 5J36A 3AKTA 3ZR5A 3T09A 1H2LA 2YFUA 3APBA 4QQ2A 3WP5A 1RUJ1 2JE7A 4L92A 1UNBA 2D5FA 2ZGLA 2DUQA 3TBDA 1QQP3 1PX4A 2XUMA 3POWA 2UWBA 3ZYBA 5JSRA 1H2NA 1F31A 3ZIXA 2IWGB 1T2XA 3P5BA 1OVSA 2XKPA 2FD8A 1UZWA 2FMDA 4UT5A 1X9PA 4YG6A 3GF6A 3VHRA 2P3JA 2VJXA 3H3UA 3F95A 4I0BA 4UBGA 2A3YA 1G6NA 5LCWL 1Q8QA 4C0BA 4YVSC 4UF0A 3OYWA 4BA6A 2FDGA 1WKYA 1XE7A 4KG0A 3WNOA 4QAWA 5A3TA 4QMAA 5FV3A 3VBRB 1BMV1 1NZCA 3FUQA 3ZFGB 2GC1A 1JTZX 2OS2A 5CFDB 1A34A 1WW6A 1F8VA 4P9LA 5FQ0B 2HLEA 2Q8DA 5CKMA 4PQQA 1U5YA 1IG0A 1QJX1 5AVAA 2WNVA 3WXPA 4Z82A 3IM0A 1BZWA 1ZRCA 1N3OA 1QWRA 5LRSA 1FT9A 5C71A 4ZU5A 4QXBA 2PN5A 4IERA 5FY0A 2YROA 4ES9A 1LU1A 4HK8A 4LTAA 3ZXJA 4BU2A 2QNKA 5FWJA 4AHXA 1WA6X 1W2OA 4GMP0 4ATEA 2WS91 3I4IA 4PJYA 4Q29A 4NE9A 2JJ6A 1VRH1 4JKKA 5FY9A 5A33B 2CL2A 3G7DA 2IZWA 4C8DA 1PVC1 1VAMA 5J37A 5FY5A 1PO21 2HYKA 4AHYA 2KR2A 3C7HA 2QDRA 5K0UA 1VBC2 2F4PA 2RJ2A 2VW2A 1ZZCA 3KV4A 4A4AA 3T2OA 3KHBA 3J8F1 2ZMLA 3V0AA 4ITCA 2VZ1A 4BB3A 1S55A 3CL1A 4HK9A 4CZSA 4QHBA 4XJ9A 2QQVA 2OYZA 2JDZA 2QQWA 2J42A 4CEYC 2JG9B 2OIIA 3DPRC 1JYCA 2VBPA 3R05A 5E89A 5KC6A 2Y26A 1BEV3 4A45A 3VHPA 3CIHA 4WVZA 1SFYA 5L36A 2OZ6A 2WZEA 1CAXB 4NR1A 2JICA 2WFF3 3VKOA 3FBMA 2A6XA 3MW4A 1W2UA 1ZYBA 3JUUA 3AYCA 4LE4A 4MOAA 4DNYA 5GZCA 2WNVC 4L9BA 5H9SA 2JDKA 1XSRA 2GMEA 2D93A 5CISA 5A7WA 1PX3A 3B7MA 2Y0IA 1JH5A 2W95A 4IV1A 2A6ZA 3M3OA 5FR3A 1O91A 2A71A 1QDCA 1UKRA 4MXWA 3WF2A 1RUE1 3E6BA 3OBTA 5L9VA 2HWC3 4LEJA 4W50A 4XAEA 2YV8A 2DUOA 4JQTA 3AZXA 3ZXGA 2CY6A 1JS9A 4OI2A 4YVSA 4MYEA 2D7FA 1WGPA 3WNPA 3P6BA 1R1A3 3BPZA 4Y1XA 5JOYA 3AL5A 2WFF2 1REDA 4NROA 3VBUA 3VBFA 2VVDA 2IC1A 3NNGA 4LXLA 4P5YA 3O1PA 2ZX1A 3U14A 5CIRA 2TBVA 1HV1A 3LWCA 2RS51 2J1UA 4K8FA 4AG4A 1FAYA 3Q9OA 3WNKA 4GIQA 3DL3A 3ON7A 2WRAA 5AFEA 4IV3A 2ZTNA 4XF4A 2J1RA 2W9XA 2SBAA 3JBG2 4IEXA 4NVPA 4M3CF 4ZHNA 5FPUA 4FT8A 5I0DA 3OY8A 1PIV2 3HN1A 3PIGA 1OF4A 3ZYRA 4IUGA 3ZM8A 2A1XA 4AI9A 5A3PA 3SEPA 2XGXA 3FFQA 1S0FA 1CVNA 2C1FA 1OQDA 1OKQA 1GOHA 1GFF2 1NQJA 1NXMA 5ABJB 4QPIC 1GR3A 3SKVA 3QACA 3UNPA 4DS0A 1ZZ6A 1GQGA 4CEYB 4D3WA 3PJQA 4U2AA 1VRH2 2VW1A 3JBG3 1RUH1 4FXKB 1IZ3A 4FTSA 5APAA 2PHTA 1IG3A 2HYXA 4UWDA 4XETA 3WW1A 4CSWA 1UOGA 2RJLA 4RR3B 4XABA 4I3PA 4PF5A 1CAWA 2C5DA 2O14A 4EN8B 3UK9A 4K9SA 4OZXA 4RD7A 3PDQA 4GJZA 4MO3M 5BY5A 1O5LA 3BU0A 1AYN3 1XYNA 4QXHA 1OLMA 4FP2A 3GBGA 4QXCA 1DF0A 2VBDA 4S2FA 2Q8EA 1VBA3 1FOD2 5A33A 3T4HB 1C8M1 1CIWA 3E5XA 1RMU1 1RUNA 3RZMA 1W8FA 1VRH3 2A75A 2R041 4Q4W2 3H0OA 4LO4B 5FTTC 4NPMA 5FYIA 3M70A 1DGRA 1CPMA 2FHRA 2XHKA 3OPWA 4FPJA 1W6NA 5L19A 3WDYA 4K7JA 1SCRA 2RS53 5GLZA 3ZFFC 4OULA 1FMD1 4IV1C 1NE4A 4CXXA 2XL9A 1FI2A 1C4RA 3WQ1A 1J3PA 1JUIA 4E2SA 3V0BB 4MVTA 1JN2P 1V9U2 3BPSA 1D0HA 3D0JA 3IIAA 5FZBA 2NPIA 1EPWA 3VBSA 3WF3A 3S0MA 4WBBA 5LA9A 1LEDA 3ELNA 4LBQB 5D1IA 3PL0A 3T0DA 3ORJA 2WR9A 3JQXA 4UFHA 5LASA 4WZCA 1T6GC 3ZKUA 1AL21 4GB31 5DUVA 5IATA 5JMOA 5E88A 1W6OA 1G86A 4I01A 5DAWA 1UN1A 5FZ4A 4N43C 2VG9A 3IMNA 4LBQD 2L9LA 4FTBA 2DFBA 3SCGA 1Y9QA 1ZA7A 1AL22 3CQOA 4GB32 4XUOA 5DQ0A 3WZ1A 5C3SA 1MS0A 4LMFA 3ACGA 3ZSLA 2BJSA 3JCIA 5FO7B 4NHYA 4QQPA 2R0FA 3THPA 4EWEA 2QQJA 1OPMA 4QB6A 2BW8A 2QZ3A 2PMWB 5C9AB 1PMIA 2WDBA 4JKLA 5CU1A 5JWPA 2Q8OA 2IVIB 5I0TA 4JX0A 4R9DA 3AFGA 4CDUA 4Q4X2 4Y20B 2W1QA 4IETA 3POYA 4BE3A 5F37A 2ZGNA 2PHWA 3HQUA 3VBFC 5KR7A 1JOPA 3S7EA 1VBD1 3KZ4C 1FNYA 4HKOA 3HT1A 1W6MB 3GZTB 3LA2A 1QJY1 1T6BX 2V09A 3OEAA 1PHMA 5FYCA 2WNEA 3NMBA 1GANA 3IN9A 3ZFEA 2B9VA 1KDMA 2D6KA 4CP9B 2GMPA 1C3HA 3VKFC 4DIQA 5AC92 4JHTA 3CZUA 1MZ5A 3PVNA 1ZBE3 1VBC1 2XG3A 4LBKA 1TZOA 3VLBB 3I2FA 1TQ5A 4Q0QA 2TUNA 2VMIA 3MYXA 3J8F2 2HWC2 1H2MA 4HMZA 5CAZA 4IEYA 5M0TA 3GNEA 1CX1A 3AKQA 3PVOA 4S2GA 3M3EA 1NQDA 4QXKA 5F5CA 3ZFFB 4D0QA 3THTA 4IV1B 2Q5TA 5BNQA 2K0GA 5F3IA 3RI9A 2BQPA 2IVJA 4LHSA 1UIKA 2ZZJA 5IFTA 4ZS2A 1GQPA 2XBO2 3LF7A 4CYDA 3PUIA 4WM7A 4CU6A 3NJZA 3BYWA 3KCCA 2VY0A 5K9YA 1RXGA 3B3QE 2DBIA 3OUIA 3K3OA 3WY6A 3TEYA 3N9NA 1RUD3 4BQ4A 3LFIA 1AYM1 2XB6C 1OPOA 2VTXJ 1AXKA 1S2EA 1Q3EA 3ZOIA 1RUF1 3I7DA 3WQBA 1UL9A 4JGYB 5FKBA 4H2AA 5HXVA 3VBOB 4MSVA 5FFOC 5I0UA 3NRUA 3VL9A 1CAUA 1MS4A 2JENA 2PXJA 1O6UA 4FI9A 3SCHA 4XUNA 1OD5A 3JXSA 3RVHA 2ORZA 5EJ3A 2EXJA 2WYSA 1G9AA 1X7NA 2RHPA 2PHDA 2P6HA 4R52A 1W8UA 1DZQA 3ILRA 1G8WA 3G6JB 3IPVB 4M0NA 1RYYA 3FX3A 5EXOA 4EWAA 1RUF3 3WSOA 2K9ZA 1IPJA 4HSJA 3ES4A 1W6QA 3AKPA 3VGIA 3O0WA 1C8NA 3O1UA 4X6QB 1R1ZA 3GJAA 4KWKA 5LBFA 4N7IA 3WEZA 1MEC2 2BNMA 3QBQA 4LO5B 4FPLA 4XXAA 3BALA 4R9AA 3UKTA 2JD4A 4DZGA 2UURA 4KWUA 3MDPA 4IL7A 3K46A 1UMIA 1NCRC 1YWKA 1IS4A 1S4CA 2BOJA 1S2KA 2DCZA 4HL0A 4LHLA 4P9WA 3K48A 1AYN2 3DV8A 1GNHA 4XFAA 4YNIA 3WNNA 5JI7A 2RMU3 4YZ3A 3VZJA 3JB8A 3LAGA 1W8TA 4RHV3 2EXKA 3T08A 2VULA 4UFJA 1ENXA 2WJSA 3UKNA 3H8OA 3ZFGA 1QU0A 3VDDA 4BH9A 4PI2A 3OGGA 3VZNA 4M3CB 5IW0A 1J58A 3VBUC 1YYNA 5JCTA 3ABZA 3QOPA 1QMJA 2ZHKA 3AMNA 1HV0A 3AJYA 3WW3A 4AI0A 3THCA 3VV1A 4DOUA 4MV2A 5JI9A 5JSOA 1V9U3 4ZZ5A 3WW4A 1AUYA 1ODMA 5CFCA 2DCJA 5FMOL 3RS6A 4QPWA 2WO1A 4W6WA 1LNSA 3B00A 3SLIA 3WDUA 4JGYC 1IHMA 3QLQA 1CONA 3MHZA 4GWIA 2ZGRA 1CZTA 1B09A 1IS3A 1HW5A 2BGCA 3HJRA 3J7MA 3LDKA 3WNLA 2J7MA 3AVRA 5JR7B 4BISA 3NL1A 2PHRA 3LE0A 1W0PA 2D6MA 3PLQA 2QDNA 3JB4C 3U1XA 3GCXA 1PO11 3OYWB 1OOPC 4QM8A 2V73A 4NHLA 4Q0PA 1JYNA 4QU1A 5JDBA 2UWAA 4GWMA 4Y5TA 3RYPA 1J1TA 1JZ6A 2CYFA 2D3RA 2VTFA 2Z5WA 3CZJA 2IXJA 2VMFA 3KF5A 5J09A 3LD8A 4O9GA 2ZGUA 1UYYA 5GZDA 1PZ9A 2RDQA 1H2KA 1UYPA 3HR9A 4YPJA 3PTYA 5BNOA 1NE6A 2E7TA 1R081 2W5FA 3O14A 4JAAA 4W65A 3VN4A 4BCUA 3U75A 5HCHA 3ZN6B 5JXIA 5JXJA 3KT7A 1Q8PA 2HWE1 3H3LA 5AC93 2ZACA 4PIZA 4A7KA 2VOXA 5FLJA 1H6YA 2HEYF 2EXIA 1RGSA 4YW4A 4CUGA 2XXZA 2J1SA 5FPZA 1VALA 3VL8A 4DY3A 1NX9A 2BWCA 1JZ2A 3EBRA 5HCBA 4XBLA 3D6EA 4DEQA 2RV9A 2VD7A 4CCNA 2VTXA 2OQ7A 2V4AA 3B94A 3WF1A 3ASIA 4UYBA 4B1MA 1W9WA 4QX2A 1AYN1 1IS5A 1HQLA 1KDKA 3VDCA 4QX5A 2VH9A 1E5HA 4RS5A 1CGPA 2DUPA 2ZXQA 4XFHA 3B02A 5L7OC 1AF9A 1OMIA 5HV4A 3KMHA 1Q43A 3GXUA 1JI6A 2HBUA 4XQ4A 5C3QA 3CMGA 4CDXA 2PELA 3DXUA 3OY8B 4CU9A 1QH6A 1VAKA 2JDYA 5FXWA 2FBEA 1F5FA 4FPHA 3OGSA 4P00B 4XJ8A 5GZFA 2V72A 4P5HA 1UF2C 2ID4A 4A42A 1E5SA 1U0AA 3I2GA 4L8QA 3U10A 4V2VA 3C7EA 4YVWA 2ZGQA 4HETA 4WVMB 3RFRA 1RMU2 3LCPA 1NA1B 3OJBA 3AB0A 3LQCA 1ENQA 4DUVA 1KD7A 1UZZA 2VUCA 3RZLA 3M8LA 5JMCA 4Y4YA 5D21A 1ZX5A 1OFNA 3C7FA 2W87A 3WQ0A 4DUXA 2W39A 3HEIA 5IVEA 1KFUL 1CAWB 5KXCA 3T1LA 3E6CC 3LDBA 1N1VA 2WLPA 1WW5A 4H7LA 4NMIA 5FUIA 1PO12 4BIOA 5JZGC 1CESA 2AREA 4RYDA 1LESA 1ZA4A 4A7ZA 1RUC1 2YGMA 3CEWA 4D6QA 5EIYB 5KXEA 1HRV2 3MLJA 5F8PA 2RS32 4GKYA 3I54A 4LULA 4F3JA 1ZRDA 2HEWF 2WZPP 1RMU3 1A3KA 1I5ZA 1W9TA 4Y5Z0 5LBEA 1STMA 2JKXA 4N90A 5LA0A 2ZKLA 1W6NB 2B7YA 2H0BA 4ZS3A 1RINA 3W21A 2RS31 4ES8A 1JOBA 3KF3A 4XHXA 1S0JA 3D82A 4PHZA 1Z78A 3K4DA 3NAPA 3O7OA 3PU8A 1NLRA 1RVF2 4KMQA 4FP3A 4QKBA 4EZ4A 5A6XA 2NYYA 4B4PA 3ZYFA 1DQ5A 3LFMA 3ZPOA 5HBAA 3WP6A 1A78A 3OBRA 4OVEA 4YZ2A 1NCQC 2ZS6B 1DCSA 3K4AA 3UJOA 3Q8CA 3V56A 3OBZA 3BU7A 5IVCA 5CADA 1JYIA 3TAYA 4LA2A 4XCBA 4IEVA 3I3DA 1HB1A 1AX0A 2E33A 3NO8A 4EQVA 1CZSA 1REEA 1VP6A 1KITA 2XL7A 2VZTA 1XNDA 3ZN6A 3N3HA 3R0RA 2X29A 4AEDC 1PZ8A 4E2QA 2P2KA 1AR72 1LODA 3AKSA 2AACA 2Y6FA 1SBDA 3OF1A 2YC2A 3EYPA 4LJHA 2WWJA 3NQHA 4JDOA 4LKFA 5FYSA 4AL9A 1OVPA 2O8QA 2E26A 1D0GA 4RQPA 2WSUA 3AP4A 1WLDA 5D8AC 1R091 1SDWA 4AYUA 1WMXA 1LR5A 1VB4A 1V00A 5I93A 3FHQA 1UOJA 2E31A 1VBB1 1OA2A 3L9JT 2BV4A 5FP4A 1N1TA 3RZJA 5FLIA 2VOKA 2XBO1 3IB3A 1IQDC 3ZFEB 2BU9A 4L11A 1BLZA 1OBNA 1SLCA 5BYNA 4N53B 1QH7A 1JHNA 4IE7A 4Y22A 1ZBA3 2PFWA 3VD5A 2Y6KA 1O5UA 4Q27A 1RUH3 1GP5A 4P14A 5K4LA 4CCEA 5ACA3 5BNOB 4LKSA 1GZCA 3TB0A 2DTYA 4JTNA 4XFCA 4E9KA 3NV1A 4Y24A 2YB7A 1FATA 3N9MA 3R4UA 5FZ6A 2VUAA
chains in the Genus database with same CATH topology
1QKQA 3WUCA 1IKPA 4BHPA 1YIFA 3W9AA 5F1RA 5BNNA 1NCRB 2LM3A 1VBE2 1GLHA 1KFXL 4YVWB 3USSA 5JPNB 2ZGOA 3N7MA 4WM8B 2CTVA 2XJQA 2JG8C 4CDWB 2IFWA 4COWA 3SITA 4Z8BA 4IESA 2XBO3 2PLV2 4HFSA 4XTMA 1FNZA 1MEC1 3ZXEA 3ZXDA 3MIFA 4QPGA 2SLIA 3WP3A 2I74A 4E4DX 1D4M3 4EWDA 5ACA1 1POV0 2D6PA 1FPN2 3J4UH 2PAMA 3MF6A 1QJZA 3H8UA 4M0HA 4Z1VA 1LCLA 3FBYA 4LBJA 2JG8A 1HRI3 1PK6C 2DURA 1QQP1 2JXAA 2BPA2 4TLFA 2ETEA 5FAXA 1HX6A 2H6CA 4D69A 3KQRA 2VMGA 1WW4A 1XYPA 1ND3A 3MW3A 4D7TA 1M4WA 1D4M2 1LKNA 3C3VA 1ZRRA 1WUVA 2TNFA 3B93A 1IQAA 3DPRA 5FLHA 3ETQA 3B9IA 1NLSA 1RTVA 1RHI1 4OHXA 4E4SA 4Q0VA 1Q8SA 2NP0A 3RDIA 3WG2A 3FMGA 4N43B 2WT1A 2Z2SB 3EJKA 2C9AA 2N7GA 2GN3A 5GLUA 4R9BA 3NV3A 1DIWA 3S6PA 5CA6A 4BPZA 2XJSA 1LOBA 5C9AC 1SFNA 1Y43B 4TZDA 4Y1VA 3M3IA 1YFYA 2BFUL 3QD6A 4NN0A 2PYTA 5BNOC 2GNTA 1IOAA 3AFKA 2QFEA 1H8TC 1LULA 2WIIB 3VKLA 3URFA 1RUC2 1J59A 1V6JA 1ULDA 3WCSA 1MS9A 2V5YA 4GH4B 2BBVA 1R082 4DXZA 4N53A 5GJ6A 2HWE2 2DYCA 1XE8A 3RYRA 2XLGA 1A6CA 1BJQA 1AYM3 3D8CA 1N3PA 2E9QA 4CP2A 2AZ5A 1PGL2 2E63A 2DVGA 2BFUS 4M3CA 2YYOA 4MUVA 2D97A 1LOCA 3CJIC 5E1RA 5C6CA 3V64A 1QJU3 4QGMA 1COV2 3MIDA 5L7OA 2HWB3 1NCRA 5T3NA 3OGJA 5AVPA 3R4SA 2GH8A 5FRAA 3U11A 3VBHA 4UBHA 2EAKA 3RRDA 1C57A 3WQ7A 4BQ1A 3PMSA 4EJRA 2NQYA 4YGEA 4Q8LA 3M1HA 2HWE3 4EN7B 1WCDJ 4OI1A 3J26N 2XLAA 3R6SA 3AM2A 5TSWA 1NA1C 4S2DA 5EFUA 1ND3C 3CJIA 3USUB 4FVVA 1WLCA 2ZAAA 1TMF2 2WA3A 2LUWA 1B35A 4XF3A 4LBMA 1NOVA 3PVEA 4XJUA 2EALA 5KHGA 5J96B 5IUQA 3JD73 4OFGA 2YXSA 4RGAA 5DUUA 1RUOA 1R092 4N9IA 4B3NA 4Q4W3 4HVRA 4AEMA 3GALA 3AZZA 1H9PA 3I2DA 2DWRA 2GNBA 4GA9A 4Q4Y2 5T55A 4H14A 1C1LA 4ASMB 1KS4A 1OA4A 2RJKA 2CAUA 4PDWA 4YVSB 3ILNA 1PZ7A 1LEMA 1N1YA 3WLUA 1C1FA 4AI8A 1OOPA 4B8EA 5I8SA 1MZEA 3ZMNA 3H3ZA 1OQ1A 3FE5A 3RPQA 1I3HA 1RVF3 2GC2A 3GBFA 5EYXA 3HQXA 4OHYA 4H7MA 1BEV1 1CJDA 3VKNA 4XTPA 4LO8A 3INAA 1V6LA 5FPXA 3D4KA 5JSPA 1S0IA 4MXVA 2D40A 4UW5A 5BNPB 3EQEA 1X50A 2E53A 4D7SA 4PIYA 4JCKA 1BMV2 4NOTA 5DZFA 2RR11 1LTEA 4AEDA 1ND3B 4P9XA 2VNOA 2YY1A 1YJKA 5DZGA 4BMBA 1UD1A 3SISA 2XPJA 4CEYA 1H30A 1VJ2A 5J7MA 2H6BA 3EHKA 5CVRA 4LBQA 3ACLA 4LT5A 5LEKA 1MS5A 3TN92 3B01A 3NV4A 2W52A 2GU9A 1AR71 1N3QA 2A6WA 4K6BA 1C5IA 5H9QA 3D0SA 3TN91 1URXA 2PQQA 2PHXA 3UJQA 4FTEA 4IEQA 4K1ZA 3UL2A 4BYYA 1AXZA 2WNVB 4AI2A 1AR62 1XNCA 1XU1A 3RI8A 5C8CB 2ERFA 4K20A 1ENRA 2HEVF 4UW6A 1CX4A 1RUH2 2WA4A 3AZYA 4E4ZA 4FPCA 4X8PA 2CGNA 1SCSA 1GBGA 1R083 2VUJA 3E6DA 2GALA 1J1LA 5F6KA 2R063 2JKBA 4BLJA 4COYA 1EV12 4GH4A 2NM1A 1DG6A 4N7UA 5JPMB 2Q30A 1MVEA 3FJSA 1R1A2 1DQ0A 1YI9A 1RUJ2 3HD8B 2BWAA 1QXJA 2R042 3RG0A 5J98B 1NG0A 4DB5A 4CP1A 2PLV3 1VBE1 3JD71 5BV6A 1UKGA 1FV2A 2VQAA 2VNGA 5F6LB 1HRI1 1RUD1 1CAXA 3OD4A 2DV9A 1X8MA 5F9TA 4SBVA 4AVTA 5HI0A 4GALA 1MZFA 2UY9A 3MIHA 5BXXA 4EN6B 3VUOA 2BVBA 3RQ0A 2CAVA 4AW7A 1F2NA 4N9HA 1YO8A 1ZZBA 5CNAA 5ACA2 4INDA 2EIGA 1WCKA 2BEOA 3ZYPA 2ZX4A 1MS1A 2ZMNA 2E6VA 2IFRA 3GZUC 3WG1A 3JBG1 4O9EA 1V70A 5IK4A 2H0VA 1UU6A 2B5HA 3X29B 3VBUB 1KXGA 2GH2A 1RUG2 2XVKA 2XVGA 1ZBE1 2JECA 5DXDA 4YGDA 4H55A 4XIOA 3BB6A 1XQNA 3LA3A 1V6NA 3K51A 1CAVB 4C1WA 3KT4A 3ZVXA 1D4M1 3BODA 1WBFA 2R1DA 2TEPA 4ONUA 1BBT1 1V6OA 1O7FA 1F9KA 4RGGA 4AQ6A 4CEWB 2UU8A 2YZ4A 4U36A 2ZBJA 4AE2A 2CGPA 1HXS2 1SEFA 2WL1A 1YCIA 2GC3A 4D94A 1VAVA 1IKQA 1WW7A 2YUEA 4GULA 4IEUA 2VPVA 2WNUB 1OQEA 2MNGA 1H1MA 3ZFEC 2FMYA 4GH4C 2HWD1 1O4TA 3O12A 3O0XA 2A7AA 3WP4A 3WDXA 3AMQA 4EN9B 4PBPA 4WM8A 4KNCA 1CAUB 5A3LA 2Y38A 5T5LA 3ZYIB 2KA3A 1FOD1 1MS8A 3M3QA 4QGNA 4RFT0 1UX6A 3NWKA 1G9CA 2HWD2 1JW6A 4Z07A 2D43A 1SLLA 2DVAA 3M4FA 3EXUA 2ZAHA 3IDCB 3SCFA 1FYUA 4WM8C 3H7YA 1AL23 2JG8B 4GB33 3B9CA 1AL0G 2R073 4XBQA 2A3WA 2PAKA 4HSLA 1G7YA 1QOSA 2Q1MA 2QUOA 5T50A 1HQNA 4CDQB 1OA3A 3MGUA 2X5IC 2Y0OA 4YZ5A 1FMD3 4I30A 2MHFA 4Q4X3 3WR0A 1TE1B 3VKMA 3ALQA 1PGSA 5D8AB 4AXOA 4COUA 3SMHA 4MGIE 4MX3A 4AGVA 4Q4V3 2DU0A 5FOBB 3DPRB 3AXEA 5FO8B 4JTOA 3HWJA 4ZKTB 4Q2FA 3ZDSA 4Q4X1 1XNBA 1HLCA 2Q0AA 1BQPA 4N43A 1GZWB 5E16A 5BPXA 1QJX2 3ZXAC 4LUMA 1EV13 1PK6A 1QJY2 4B4QA 2EAAA 2RMU1 1H8VA 4Q1PA 4ATFA 3AP5A 1DYKA 1ZBA2 4EN0A 4YLZA 1XNKA 1BBT2 1Q8OA 4YM0A 2PHUA 2ZCWA 4XDQA 1KQRA 2RS13 4AVAA 2CNAA 4OHZA 4HLTA 4UW3A 4Y20A 3FLTA 1QNYA 1CJPA 1LRHA 1A8DA 1G9DA 5LK5A 1S0EA 1OLQA 4PQ9A 4XF9A 5C33A 3USUA 1PNFA 2LTNA 1VBE3 1C8M2 4ISRA 1AZDA 2EVXA 4RSUA 2ZPXA 2DTWA 1DGRN 2O8OA 1ASJ2 3AJZA 5I8TA 3TNQA 3VHNA 1MQTC 2P3KA 1BBT3 2R061 1R1A1 2RS12 4AQ2A 4P9YA 3I59B 3IKWA 4Z2WA 1V6IA 5GALA 1V9U1 3MPPG 2VECA 1RUF2 1D2SA 3WHTA 4ZXKA 3JD72 3UV9A 3CNAA 5LK7B 2RS11 1AR93 4YW3A 1HRI2 4TWTA 5ABJC 5C9AA 4WVMA 3WDWA 2ZX3A 3KGZA 1NA1A 1V6MA 4LO6B 4CDUB 1YFXA 1NCQB 2CV6A 4F83A 4Q4Y3 5T54A 3H9AA 4KGQA 2XJPA 4YFZA 3AMMA 4RQPC 4K21A 2IXHA 4RR3C 3CJIB 2WT0A 4GKXA 1JUHA 3VBOA 3A4UA 1CQ9A 4ISQA 1MVQA 3ST7A 1X8EA 1K5MC 1X82A 4S2HA 1BK1A 1W0OA 1AR63 4GQ7A 1VBA1 2I07B 3N7KA 2ZGPA 1I9RA 4QPYA 4CDQA 3M3CA 3VZOA 4Q4V1 1WMDA 4XW3A 4C1XA 3N4MA 1W6QB 3WG4A 3E5UA 1LJ7A 1SLIA 5D8AA 2OUHA 1DDLA 4J6GA 2QJVA 3N7LA 1DLLA 4KBBA 4WM7B 5K8SA 1YFUA 3R4DB 5I91A 3C2UA 2D3SA 5JOXA 1OOPB 3A0KA 4M3CE 4N53C 2B9UA 3ME2A 4FOVA 4XJWA 2ZHMA 4DINB 4Y1UA 1W39A 2LALA 3JZVA 4QGLA 3QH7A 1VLNA 2WC2A 4I2OA 3OCPA 4MLOA 3RNSA 4LLOA 1OSGA 2ZA9A 4XMAA 1LENA 2UYBA 1RC6A 1HIXA 4XYXA 4URTA 4EROA 1EPZA 1ASJ1 2ARBA 5BNPA 1DZRA 4OI0A 3AZVA 4I0AA 3TWIA 3ZPYA 4G3YC 4RQPB 5CBLA 4JC1A 2GMMA 4Y26A 4Q4W1 1COV3 4OUMA 1NYWA 4HKWA 1HKDA 2ES3A 4NHMA 3WNXA 5FQ0A 1KJRA 3NKGA 4TYSA 3SNMA 2FZ1A 3SXWA 5IK7A 4FSJA 3S7IA 2HKXA 2P17A 4BZ4A 4C91A 3HAGA 4YSFA 1GNZA 2ZOEB 4RL7A 4OI4A 4IEPA 3KB5A 1J3QA 2CGOA 4CEWC 2B42B 2PHFA 3ZYJB 2OVUA 3S30A 5KC5A 2AYHA 3O5SA 2WSVA 4HPKA 1AX2A 2R071 1AX1A 2D6LX 1TME1 4B7EA 1WA4A 3CU7A 2KM2A 1LU2A 4R4ZA 5AC91 1WMEA 4XOGA 4FO9A 3W58A 1TME2 1X36A 1H0BA 4AI3A 1O4ZA 2DVFA 3RMYA 3AX4A 4JDNA 2NLRA 2WLQA 4YGBA 4XFIA 3WDVA 1QNWA 4JVAA 4PLOA 1WBLA 2MPFA 4WM7C 5FMOS 4W6YA 3KS7A 2HWD3 1OI6A 4HBNA 1JOJA 4PBOA 4XMIA 3ZSJA 1EAH3 2R1BA 5DUWA 5CG8A 2BVVA 2C0ZA 3LOIA 1UU5A 2B8MA 3RJRA 1PO13 3EO6A 1TME3 1Z7S3 2X5IB 4K3UA 3SHRA 1QOTA 4HVOA 4ORFA 2QZ2A 1YI7A 1NCQA 4HZFA 3VBFB 4LO7A 3P3NA 4M00A 3MFCA 1V6KA 1BYHA 1NY72 1AR81 4HANA 3ZX7A 2G9FA 4JGZC 5DDJ3 4XBNA 2XVLA 4MGZE 5F5QA 1AYM2 4IV3B 4K40A 4YZ4A 1QHDA 1RJ7A 2R0HA 1WCSA 3AKRA 4FAHA 2FQPA 1AR82 2I45A 3TN93 2WFF1 4B4RA 5C8CC 3TOJA 3GYDA 1X33A 2RM23 4RHV1 1BVVA 4MGYE 3NW4A 1ULFA 1PVXA 2XKOA 5EWSA 4LBOA 2WQ4A 1AR91 1LECA 5KWRA 2DU1A 2GDFA 2D5HA 3V0BA 4AVVA 1BKZA 2WNUA 1PIV1 1K5MA 1TMF3 2R072 3JQWA 4GMP1 2WS92 2BNOA 1BXHA 3WX5A 4C0HA 1N47A 1BCXA 2ZGSA 4P9JA 3JU9A 2O1QA 2WZR1 2PHLA 4XZPA 2XLFA 3DUIA 1O4YA 2OA2A 4R4XA 4FCAA 5FOJB 2YDEA 1UZYA 3GBWA 3LGRA 1CR7A 1RITA 4XJZA 3OTFA 1RB8G 3ZSEA 3CJXA 1LHNA 5LRRA 2X8KA 3MFAA 2QVSB 4ES8A 3H50A 4J1XA 4AFBA 4AFMA 3VBSC 2ARXA 2EA7A 1Y7BA 5H9RA 4COZA 4BWOA 2I2SA 5K0UB 1UCXA 3DKWA 1APNA 1QXRA 2GZWA 2G9GA 3GHNA 3NAPB 5BNNC 4FOWA 2O0OA 4COVA 1RHI3 4QPIA 2IXKA 1VBB3 3MPBA 1SMVA 2Z69A 1HRV1 5CFDA 2DF7A 1RUE2 1UAIA 5SV5A 4YARA 5BNPC 1E57A 3GZAA 1YNAA 2DCTA 2NN8A 4P9GA 3PVBB 4KU7A 5L7OB 2OZJA 3AYAA 3MLLA 4DY5A 1C8M3 5LEJA 4PDWB 3VBHB 2RS52 1A8MA 4MH0E 1XXNA 3T1MA 1HRV3 2PLV1 5KBFA 2MEV3 4Z92B 3WUDA 3WCRA 2Q1ZB 2B45X 4AGRA 1PNGA 1S0DA 2VGDA 4RHV2 3TYJA 1S0GA 2GC0A 3IBMA 1UPIA 2BUKA 2EF6A 2UWCA 3N36A 2PA7A 1EAH2 1ZZ7A 1AR92 3FZ3A 4XEZA 4PLNA 1SLTA 4RA0A 4AVBA 1F5JA 4YW5A 4IEOA 3VBRC 4B29A 2AH2A 3IPVA 4P9IA 4QPGB 1VBD2 2JG9A 3ZFGC 3DN7A 1AJKA 3P3PA 4AVCA 5KHKA 1LHUA 5JZGB 4XQWA 2R16A 4NWWA 1SQ4A 2E7QA 1CPNA 4FAGA 5KHIA 4KWJA 2QCSB 2ATFA 1CD3G 3ZSMA 1VR3A 4AK3A 5JIUA 2OW4A 5I0SA 1DQ1A 2VU9A 4UW4A 4WVVA 3ZIWA 4XFBA 4XPVA 4Y1ZA 2HWC1 4KG8A 1N1SA 3SH3A 4GMP3 3WD5A 1XRUA 4JGYA 4FPFA 1ND2A 3FWEA 2ZGKA 4XILA 4H3WA 1MQTA 1DGWA 2VXRA 1QF3A 4KWLA 2A3XA 4ZU7A 4LHNA 1POV1 2BNNA 4HT1T 1KJLA 1FMD2 2D3PA 5A32B 4LLFA 2DVBA 5FBZA 5IK8A 3KCYA 3AP7A 2UY8A 1ULEA 2Q4SA 1FXZA 4HKLA 4AWDA 4XHBA 3MEPA 2YGLA 3RMXA 3RYKA 4CDUC 4AEDB 4AFDA 1XU2A 4M01A 3PMEA 3VZKA 4JRLA 5J3UA 2AUYA 2P34A 4GXLA 1TNRA 3MI8A 3PNAA 1RVF1 1SLAA 4PLMA 4X6RB 1U5ZA 5JOZA 1IPKA 1JXNA 1Q56A 2R30A 1UIJA 5ABJA 1GICA 1LB2A 1QJY3 3VZLA 4FPYA 4Y1YA 3LB9A 5IK5A 3VDDC 4QPGC 4OHVA 4IEWA 2A6YA 4G9SB 4K1YA 5JVVA 1MACA 3RSJA 1O3RA 4MGKE 4HN1A 4YFWA 1MS3A 3GHMA 3PJYA 1DQ6A 2Z42A 1XYOA 4PIXA 4BLIA 1RUI1 1UPSA 2W0XA 1VIWB 3IDBB 2IXIA 1LOAA 3LZZA 3ECQA 3W59A 1R093 1C5HA 2D6OX 3L2HA 1MEC3 4SLIA 5DG2A 1REFA 3IDEA 2ENRA 5CFCB 1ASJ3 3FFZA 2XJUA 4CDXC 2NMNA 2ZGMA 3L2YA 1Z7S2 3H1MA 4AEJA 4AFCA 1VBB2 1GSLA 4DRRA 3AXDA 1RUE3 4Q1RA 4AVSA 1LOGA 4CDWC 5HCAA 3KCXA 2EXHA 4BOWA 4TSVA 4JGZB 2A5ZA 3ZO0B 3WG3A 3FUOA 1W6PB 5JLVA 2W68A 4QPIB 5CFDC 3KM5A 1ENSA 4XF0A 2W08A 2ZABA 1ZVFA 3DGTA 1WLWA 2A70A 2A6VA 3LSDA 1W6OB 2MEV2 2P3IA 4QU2A 1EP0A 2OUJA 1EV11 5FCCA 1AR83 3M2MA 1NY71 1CN1A 1YJLA 5DDJ1 2G4IA 3H1WA 3SH4A 1WLTA 4FPOB 1ZZ9A 4QD2A 2MEV1 4IQPA 5CB7A 3MW2A 2VOWA 3FHIB 5E8AA 2ZZQA 4CP0A 4META 4LE3A 1POV3 4I02A 4IEZA 5GLTA 3WHUA 2ZHNA 3MF9A 4DMIA 1LGBA 5T5OA 1ULCA 1NXD1 3DF0A 2QQPA 4G4FA 1VBD3 2A73B 5HCFA 5H9PA 5GZEA 1RUC3 4DFSA 3H7JA 4JDMA 2AENA 1QY4A 3NSTA 2YPJA 4XXPA 2WS93 3ILFA 2JG9C 3AZWA 3ENRA 1B35B 1ALYA 3NV2A 1FV3A 5JZGA 4EV0A 3CO2A 2GNMA 1WMFA 4CDXB 4YW2A 2RE9A 4BIFA 2DVDA 3BTAA 4AGGA 3VZMA 1O3TA 3LKJA 4XIKA 4D7YA 2IXCA 4FQZA 3ZN5A 3ZFFA 2WZR2 1RUI2 4E2GA 4YVWC 2JEMA 5DG1A 4KL1A 3WW2A 2XJVA 5T52A 2HWF2 4PCRA 5C4WC 2ZX2A 1OFSA 2R49A 3QH6A 3ZN4A 1G9BA 5JOWA 3QCWA 4X8NA 1ZRFA 2FZ2A 3NKTA 4L99A 1KRIA 4Q0SA 1Z7S1 1AJOA 3AYDA 1OHFA 1DQ4A 2YMZA 3VHOA 2K2SA 4QT6A 3WT3A 3J9SA 2UYAA 4FOYA 2ZHLA 3BCWA 4KQ7A 2ZX0A 2D44A 5JAXA 3KLSA 4OHWA 1PK6B 4W6XA 1YRZA 3FLRA 1H1IA 3POSA 4A3XA 3KT1A 4XQDA 1PM7A 4LBLA 4CRQA 2P37A 2XJTA 5KXBA 2KXLA 4A7YA 1S2BA 1H9WA 3HMYA 2JX9A 2BYVE 5J48A 4Q26A 1JBCA 3ES1A 3SH5A 4JRAA 4ASLA 3V0AB 4FPGA 3O0VA 4YM3A 1RUD2 4LHKA 1QJU1 3NVCA 1S0CA 3E97A 4LNVA 4NWVA 2HWB1 1K5MB 1PGL1 1FOD3 2QKDA 3WV6A 2IXLA 5IT6A 1QDOA 4YYOA 1GZWA 3IT8A 1GV9A 3I59A 2DCKA 1UW8A 2RS33 4WV8A 1Y3TA 1EAH1 2NMOA 3ROUA 1Q5OA 5C8CA 4FPKA 2WINB 2WNUC 1B35C 1PO23 1WD4A 2AGSA 1HXS3 1RUG1 2HJIA 1LOEA 3ZXKA 4YZ1A 2GSYA 1L3JA 3MIGA 3BOPA 1U5XA 2X53S 3ZXLA 1ND2C 4HN0A 3U4XA 4NO4A 4XJAA 4B7KA 1COV1 1EYBA 5C4WA 1YLLA 3FC0A 1ZNPA 1LHVA 4XFGA 1YIPA 1W6PA 4R9CA 4WZFA 3MICA 1QOOA 1AR61 4DRVA 2GNDA 1H8TA 1ULGA 2DCYA 1QGLA 3PHMA 4V1PA 2RMU2 3LA7A 4OLLA 4XE9A 2ZJCA 1VB2A 2XH6A 1AVBA 3ATGA 4Y22B 4R8HA 1DYPA 3CF6E 4F7ZA 1PO22 4OUSA 4Q0UA 4KU8A 4MZUA 5GLVA 3MZHA 1H4GA 2YHJA 4J1WA 4AEKA 4CTEA 4FQ4A 4YGCA 1OLRA 3AMHA 1J3RA 1YHFA 1RIRA 1U12A 4DQAA 4RS5B 1ZZ8A 1AR73 1GQHA 1M06G 4AHZA 3FLPA 3WDTA 1D4VB 5GM0A 5K0UC 4NPRA 4MXWB 2WWSA 1O3SA 1H4HA 3AK0A 4LA3A 4ZU4A 1WD3A 1VBC3 3WOGA 1TEIA 2AR6A 2VVFA 1DU3D 2VMHA 4WVWA 4LR4A 4YRDA 3H1YA 3AYEA 3OPZA 3WVJA 1YFWA 1ZM1A 2XWJB 2R062 1IS6A 3T2TA 1IGOA 3J8F3 4YG0A 2ZKNA 1DHKB 1SLBA 1C28A 2D6NA 1LOFA 5KHHA 4AHWA 1ZREA 2OPKA 3RWNA 4PDWC 1BVP1 2CWSA 3V65A 4LBNA 1DGWX 4YM2A 3D5OA 2VNRA 2WZR3 5BUVA 2D98A 1QJU2 3ZSKA 1DBNA 1UMZA 1CAVA 2HWB2 3HBZA 4HVQA 1Q8VA 3MLKA 3ZXFA 1GYKA 2ZMKA 2CWMA 3OD0A 4AF9A 4YM1A 4CEWA 1QJX3 2R32A 4C90A 4I09A 2ILMA 2JE9A 1LHOA 3AP6A 5L73A 3LOBA 3VBSB 3ZYGA 2QE3A 4BMEA 2WKKA 1QQP2 3MIEA 2RR12 1TNFA 1D2QA 3KSCA 5EYYA 5EZWA 4Q8KA 2B46X 1VBA2 1HDKA 2BTVC 3VBOC 4F8AA 3B69A 5EV7A 1ND2B 1FPN3 2B39A 5FREA 4FBFA 1DQ2A 3M7AA 1HXS1 1RUG3 4FOQA 1MQTB 2HWF1 1ZBA1 4QM9A 3ZMOA 1LOFC 3N35A 4L2NA 2XWBB 1PIV3 1TMF1 4A2UA 5A32A 2F6BA 4HPKB 2Z79A 4DPNA 1RHI2 2RR13 5GKAC 2VQ0A 3MIBA 1GZ9A 3AMPA 3VBHC 2R6QA 3U0ZA 5A3MA 5I8YA 1U5IA 1RL3A 4RS5C 1EY2A 5GZGA 3TRSB 4IV3C 4Q4Y1 1YXWA 1LGCA 5DDJ2 4BM8A 4KH9A 2PAEA 1PGW2 2DFCA 4NHKA 5SV8A 2RM21 4QQOA 2PTMA 2WFPA 3VBRA 1S1AA 2E51A 3BIWE 3RZZA 3CLPA 1I6XA 1SBFA 1Z0HA 1PGW1 4FXGB 1YUDA 2RM22 4E27A 5B2GB 3HT2A 1GKBA 1O3QA 4YW1A 1LGNA 3BOWA 2YC0A 1BEV2 1DFQA 1FX5A 2ET1A 4XF1A 1QXPA 5CG9A 2WT2A 1PVC3 5FO9B 2VW0A 5T5PA 5C4WB 1FPN1 5KXDA 1RUI3 1AHSA 1SACA 1W6MA 1KS5A 1ZBE2 3N7JA 4JV4A 1UU4A 4UXAA 3HIFA 3B5LB 1H8TB 1S0BA 1ONAA 3KD4A 1DZTA 4QQLA 4JGZA 1LHWA 4KGGA 1SBEA 3LSEA 1MZ6A 5DUXA 4EWEA 3E5QA 1AXYA 3I8TA 2XJRA 4Q4V2 4JQRA 5AFBA 5CFCC 4YG3A 3IWZA 3KGLA 2GN7A 1I1EA 1PVC2 3U07A 2ET7A 5KHJA 4AI1A 2VOVA 5C8WA 4LUKA 1DGLA 2X5IA 2VVEA 4L97A 3TNPB 3AP9A 5K7PA 4GWNA 4QQHA 5I0RA 4CDQC 1G9FA 4XFFA 5T5JA 2WQZC 5GLWA 1H1AA 3NAPC 5BNNB 4IXLA 1RJ8A 1MR5A 3RJ2X 1RUJ3 5JIAA 2R043 3VDDB 4I3GA 3WINE 2ZGTA 4CDWA 4AQTA 5FDBA 4AFAA 2GAUA 1HQWA 2NZ9A 4I0WB 4RR3A 2HWF3 3A0NA 4FPEA 3UKVA 2E7AA 5J36A 3AKTA 1H2LA 3APBA 4QQ2A 3WP5A 1RUJ1 2JE7A 4L92A 2D5FA 2ZGLA 2DUQA 3TBDA 1QQP3 2XUMA 3POWA 5JSRA 2UWBA 1H2NA 1F31A 3ZIXA 2IWGB 2XKPA 2FMDA 4YG6A 3GF6A 3VHRA 2P3JA 3H3UA 4I0BA 4UBGA 2A3YA 1G6NA 1Q8QA 4C0BA 4YVSC 3OYWA 4BA6A 1XE7A 4KG0A 1BMV1 4QMAA 3VBRB 1NZCA 3FUQA 3ZFGB 2GC1A 1JTZX 5CFDB 1WW6A 1F8VA 4P9LA 5FQ0B 1U5YA 1QJX1 5AVAA 2WNVA 3WXPA 4Z82A 3IM0A 1BZWA 1ZRCA 1N3OA 1QWRA 5LRSA 1FT9A 4ZU5A 2PN5A 4IERA 2YROA 4ES9A 1LU1A 4HK8A 4LTAA 3ZXJA