3LB9A

Crystal structure of the b. circulans cpa123 circular permutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
ATFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVWGASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Circular permutation of Bacillus circulans xylanase: a kinetic and structural study.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 45
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lb9A00
2D97A 1T6GC 4XPVA 2QZ3A 1YNAA 2DCYA 1OLRA 3WP6A 3LGRA 3VGIA 3ZSEA 1HV1A 1REEA 1XYPA 4HK9A 2BWAA 3VLBB 2D98A 3WP3A 3M4FA 3WQ1A 2JEMA 1HIXA 1C5HA 3HD8B 2DFBA 1BCXA 3AMMA 1UKRA 2Z79A 1H4HA 4HKOA 1QH7A 3VZNA 1H1AA 2JENA 1HV0A 1UU4A 3VL8A 1XNDA 1AXKA 3RI8A 2DFCA 1XNBA 5K9YA 2NQYA 3MF9A 3WY6A 3MF6A 2JICA 1M4WA 2DCZA 1XXNA 2BW8A 1ENXA 4S2GA 5K7PA 1OA2A 1TE1B 1PVXA 1H8VA 2DCJA 4HKLA 5EJ3A 3WR0A 1QH6A 2VULA 3WP4A 2DCKA 2B45X 4NPRA 1BVVA 2B46X 4S2FA 1W2UA 3AKTA 3WQ7A 1F5JA 2QZ2A 4HK8A 1H0BA 3VZLA 1H4GA 1REFA 1XNKA 1XYOA 3AMHA 3O7OA 4S2DA 2BWCA 1OLQA 1XYNA 1NLRA 3LB9A 2VGDA 3WQ0A 3VHPA 3WX5A 4XQWA 4H7MA 3MFAA 2F6BA 3AKPA 1UU6A 2NLRA 3AMPA 3VZMA 3VZJA 3VHOA 3AKQA 1XNCA 4S2HA 1KS4A 3B5LB 2B42B 3WXPA 3EXUA 3VZKA 4IXLA 1KS5A 3B7MA 4XQDA 3AKSA 3RI9A 1REDA 2C1FA 2VG9A 4HKWA 3VZOA 4XQ4A 3MFCA 3AMQA 5HXVA 3WP5A 3VL9A 1C5IA 3WT3A 1OA4A 3AMNA 3VHNA 1OA3A 1BK1A 3AKRA 1UU5A 2VUJA 1IGOA 2BVVA
chains in the Genus database with same CATH superfamily
1LEMA 5DQ0A 2QQUA 3BPSA 5T55A 1CZSA 4Q29A 1V6JA 4FFHA 4WVWA 2P3JA 2IVIB 1Z7S3 1S0DA 2NM1A 2WQZC 4HN1A 5FYVA 4B7KA 5BV6A 5EP9A 1RUG3 3W21A 3ZKYA 2Y8KA 2OA2A 1G6NA 4HOOA 3VBFA 1RUNA 2BWAA 3RSJA 4LULA 1Y43B 1H6YA 1QU0A 4QPWA 1X36A 3I59B 4BPZA 1FT9A 3M2MA 5F5IA 2D6OX 2XONA 2PHTA 1CAVA 4LUMA 3KB5A 1LOAA 3ZYRA 4HMZA 3DYPA 2Y33A 4P02B 5DPNA 1SCRA 4QQHA 4AEDA 3OGGA 4N8MA 3ZYGA 4NR1A 4Q4W2 3WF0A 1GP5A 3PUSA 4XURA 3GHNA 5C33A 1FNYA 1NCQA 1O7FA 4ISQA 4ZU5A 1TZOA 2VOTA 5DUVA 4Y26A 3TOJA 2ZEYA 4BK5A 2D3SA 1YCIA 2YMZA 2JG9C 3HQUA 4P9LA 3JB4C 2VXJA 2XLGA 4BLIA 3BKZA 3T4HB 4OI2A 3VBRC 4N43B 3WD5A 4AFMA 5GZGA 4M01A 1DQ2A 1EV13 4ITCA 4I2OA 1H9PA 4I02A 2DCJA 4Q4W1 4CDUC 1RUOA 4YARA 2FCTA 1MZ5A 3VDBA 5JDBA 4JRLA 2BPA2 1CAWA 1JOBA 2ZOEB 4GH4B 4AVTA 4BU2A 4COYA 2WO2A 2EF6A 3GM8A 1N1YA 1O3TA 1WMXA 2JDMA 2O14A 3T2PA 1PO12 2I2SA 3KSCA 3ZPYA 1UNBA 2ZACA 3KHCA 1B35A 4FP3A 4AVSA 4FFGA 4EWAA 1WA4A 1W6NB 2ZEZA 1Q8SA 2XDVA 5CG9A 2C6SA 4LKSA 4PIYA 1RUI3 1YIPA 1OPOA 2G19A 1HXS3 4JKKA 2DF7A 3UESA 2VVFA 3D4KA 3A22A 2F4PA 1WCUA 5EIYB 4XQWA 3IDBB 4ZU7A 2XG3A 2ARCA 1VBD1 5BY5A 4W4ZA 3BCWA 5LBBA 1W9YA 2WFF2 1PO11 3B00A 3B5LB 3BN6A 1DLCA 2Q8EA 3T4VA 1W39A 3B7MA 4AE2A 3RI9A 2KD7A 1AR72 1NZIA 2JE9A 2ZABA 3LIGA 1VPHA 1X9PA 4KMQA 2W3JA 1UQXA 5KHIA 5KXBA 2RR13 1R092 3GYDA 2VZRA 3AMNA 3RYRA 3ZKUA 3NWKA 1UYXA 1BBT3 3PVOA 4EWEA 3OEAA 4D7TA 4KWLA 2WZR2 2WFF1 4QXKA 2JE7A 2HWE3 4GMP1 3LKJA 4DEVA 2CU5A 1W0NA 2PN5A 1IS3A 1PGW2 2WO1A 4BYYA 4XPVA 5L7OC 3LA2A 5A3PA 1WCKA 2XH6A 1R1ZA 2D93A 2VZUA 3FBYA 1LJ7A 2VCMA 1AR71 5FFOC 5GM0A 1OLRA 3WP6A 3O1UA 5CBLA 3RZLA 1MS8A 3VGIA 1NA1B 1KEXA 5GALA 1QF3A 3J7HA 4NIIA 1Z7S2 2P2KA 3DCQA 4CCJA 2PAMA 1R091 5EYYA 1RUG2 1VBE1 2JDHA 3ZFGB 3N9MA 5DAWA 5LCWL 2Y6LA 5D8AC 4IGQA 4X8PA 4EV0A 4XXAA 1Y7BA 2VZQA 3LSDA 1QNYA 2WZR1 5IJRA 4QWNA 5F2WA 3BTXA 3J26N 1QJZA 1HRI3 1PGW1 2WNVC 4XIOA 3GXUA 2R043 2XQXA 1V0AA 4FPJA 4LKDA 5TSWA 3V64A 4D7YA 5JAXA 5FJKA 4RGGA 2ID4A 3ACGA 1CJDA 1H4HA 2W1UA 1D0GA 5KXEA 5GZCA 2WNUC 1Z7S1 4U2AA 4JCKA 4FI9A 1RXGA 1OOPC 1XU1A 5C5UA 3NJZA 3ZXAC 2D7FA 4AI2A 1DG6A 3I59A 2GNBA 3ROUA 1DYOA 1DGWX 3PIGA 1RTVA 1B09A 1W06A 3WUCA 3ZSJA 1QJU3 2VOWA 3ETQA 4AGVA 4CDXB 1W8HA 4Z1VA 4QKDA 3SCHA 4JTNA 1CIWA 5FYMA 4OHWA 2BW8A 4QDRA 3GGLA 2VZ1A 4S2GA 3WF1A 3M8LA 4WZCA 5CFDC 1H2KA 1JU3A 3PMEA 4HZFA 1H8VA 3THDA 2VU9A 2WRAA 4GIQA 4QB2A 1EV12 1CVNA 3G7DA 3ON7A 4GB33 4UFJA 3TBDA 1OPMA 1WWYA 1R1A3 4FAHA 3WUDA 2AREA 3INAA 4DPNA 4ASLA 3I3BA 1ND2C 1TQ5A 3E97A 4NRMA 4Y3OA 3CQOA 1QMJA 4XFIA 4BH9A 3D5OA 1H8TB 3AZXA 3C7OA 5A32A 3VUOA 2GMEA 2XB6C 1X82A 5DG1A 4KU7A 2VCAA 1NG0A 5FRAA 1YJKA 4N43A 1J1LA 4NN0A 4YFZA 3U4XA 2JKXA 2QZ2A 2A3WA 2Y6FA 3I2HA 3GZEA 4LIVA 5ABJC 3ES4A 5IAVA 4ES9A 3I2IA 4WM7B 4EZ4A 3O7OA 1S0CA 2PHUA 1EV11 2XVKA 4GH4A 5KHHA 4URAA 2FD8A 3UYJA 1HB2A 5JLVA 4LKFA 4IL7A 1HXS2 3IIAA 1F8VA 1UOFA 1QJEA 4IEPA 4YLZA 5GLZA 1MQTB 1AX1A 1NE6A 3G6JB 2ATFA 1UOBA 3IKWA 4YGCA 3ZXFA 1W6NA 3C7EA 3DPRB 2X5IB 1PK6C 3FBMA 5IVJA 4P9JA 4DZGA 4W6XA 2BV4A 4B8EA 5LW9A 1VALA 3A21A 3NV1A 1OKOA 4XAEA 4B3NA 2EXHA 4J6GA 3IN9A 4R4XA 3VKMA 3LA7A 2PA7A 2ZHNA 3HT1A 4XDOA 3I3EA 3HN1A 1OUXA 4KBZA 4XQ4A 1ZNPA 5HXVA 4FTBA 1HXS1 4O65A 4DUVA 3JXSA 1DQ0A 2RR12 4D94A 5JWPA 1UU5A 4AVBA 1BBT2 2EAKA 3KGLA 4UFIA 1VAVA 5JSRA 1ND3A 1DQ6A 1LTEA 2HWE2 2IZWA 1HLCA 1OD3A 2RJ2A 3K3OA 1ULDA 1YNAA 1JS9A 2VMDA 3OGJA 1AR93 2VZPA 2WFPA 5F37A 2VTXA 3NMBA 4RFT0 4I09A 3S7IA 5FPAA 3ZXDA 3AZYA 2FQPA 3ZMNA 3FJSA 1UAIA 3LFIA 1UZZA 4BIFA 4IEQA 4QD2A 4QKBA 1LOFC 2HJIA 5FZ6A 1BBT1 1W0OA 3BPZA 3KWVA 4N7IA 3UJOA 3VDDC 5J36A 4QDSA 2QQIA 4AFDA 2UY9A 2ZGLA 2DVDA 2HWE1 4FPFA 4QPGC 2BERA 4RL7A 4JX0A 4CCMA 4A6SA 1LGCA 1PGSA 4LKEA 1NA1A 2PLV2 3BTAA 5J09A 1GLHA 3MGUA 3J9SA 4QT6A 2VQTA 2XKPA 4UWDA 1ZBA1 1O4YA 1JOPA 1LU1A 3HBZA 3VZNA 1GNYA 3NJVA 4YW1A 3ZFGA 3VB9A 3I2KA 1K5JA 1PO23 1RMU3 4PF1A 3OD4A 3OG2A 4O9EA 1W8WA 2AENA 3GNEA 2JX9A 4CCOA 5L7OB 1W8OA 4UF0B 4XVHA 1Y9MA 5FYBA 4FQZA 2VVEA 3LF7A 4HETA 1RVF3 3DV8A 1CX1A 5DN2A 3ZFFB 1QJU2 4E27A 4FPOB 4I30A 2PLV1 5JOYA 1OF3A 1T2XA 3LA3A 4LBJA 4U36A 1XSRA 2UWCA 2YU2A 4CXXA 4UW6A 1R083 1CAUB 4JC1A 3D0JA 4M3CF 2D6MA 4L0PA 2Q1ZB 2MPFA 4G3YC 4XETA 2GNMA 1YQ5A 3LWCA 2X05A 5IVFA 4QXCA 1R1A2 2JDUA 3WW4A 4WBBA 4CEYA 3OB8A 1ST8A 1H2LA 3T3YA 3M7AA 3SKVA 4GMP0 1W2UA 3KCYA 1QJU1 4B1LA 1QJX3 1KD7A 1O91A 4HVQA 4AHWA 1E57A 4NE9A 3B93A 3BUCA 3MZHA 4QPIB 4FCAA 1XNKA 3HQRA 3EBRA 4IE5A 1CZVA 3RMXA 2Y6HA 1D7PM 1VMJA 1MEC3 3LB9A 1H8TA 3LDKA 4RQPB 3UK9A 3VZMA 1R1A1 2Z42A 3P6BA 3POEA 4YM3A 5IYYA 3WNLA 3H42B 4OCTA 3MBWA 1VB2A 4XTMA 2RS53 5FIXA 3VBFC 2YYOA 2PHRA 3DEMA 4N7UA 3VZKA 1F15A 2CYFA 2OKXA 2WWUA 4WM7A 3X29B 3I2GA 1REDA 3AZVA 4QX7A 5LBEA 5JOZA 2J42A 2D5HA 1ZA4A 2O8QA 1HRV2 4IV1B 3E5UA 2R32A 4FQ4A 2VE1A 4DEQA 4AEDC 1EYBA 1HQNA 1VMFA 1YUDA 1MQTA 4FFFA 1CZTA 4YZ1A 1C5IA 1V70A 3WT3A 3POJA 4M4RA 2C5DA 1RC6A 4CDQA 3AKRA 2V72A 1FYUA 2YUEA 1LHUA 2X5IA 5BNOB 5J37A 5ACA2 5KC5A 3CDZB 1YJLA 2VVDA 4L99A 5EXOA 3ELNA 2ZXQA 5IFTA 4PT6A 1OXCA 5FZ1A 5J7MA 3SXWA 4EZHA 1A6CA 2VCCA 2NMOA 1VAKA 4L92A 4PBOA 1APNA 5BNPB 4E2SA 3WZ1A 2WZEA 3OPZA 5FYTA 1LKNA 1ULPA 1HRV1 3OBTA 3RYPA 4CU6A 2QQPA 1AR92 4ARYA 1QXPA 5F5QA 5E88A 3MW3A 1I6XA 2R49A 2WN3A 4LBOA 2ZEXA 2H6BA 3EMRA 2MHFA 1ZZ6A 1MVEA 3ZYBA 3IIIA 4Q2FA 4DXRA 1O4ZA 5HPOA 5CG8A 2D98A 1X8EA 5ACA1 5KWRA 1GNZA 1PNGA 3OBAA 4G9SB 1HIXA 1VBA3 2D44A 2CSGA 4LPLA 4QGMA 4WV8A 5FZOA 4NRPA 4AQ6A 4MG2A 1SDDB 1DGRA 1WMEA 1B35C 3I8TA 4LO7A 4JAAA 5F3IA 2RG4A 1IS5A 1GKBA 1AR91 4PDWB 3DXTA 1QH7A 3OEBA 2WJSA 1IS4A 1GOFA 1JYNA 1NQDA 4K7JA 2VAUA 4IV3B 5T5JA 1UW8A 5HV0A 3IMMA 1UY1A 2VZ3A 2WUHA 3CF6E 1NXMA 4ORFA 2BFUL 4XIKA 4ZY9A 1AJOA 1HDKA 2A6VA 3CKHA 2EICA 2HYKA 5F9TA 3OF1A 1AF9A 4Y20A 1AL0G 1RVF2 4RSUA 3UL2A 2JICA 4HPKB 4B4PA 3LPGA 5FYIA 2DCZA 3R4SA 2G4IA 3ZR6A 2X8KA 2ZJCA 3OUHA 3CBNA 3WNPA 5JMCA 4HBNA 1OUSA 1R082 1WBLA 2Y6JA 3KV9A 3PMSA 4NO4A 1QIQA 4UBGA 5H9RA 5L7OA 1V00A 1I5ZA 4UF0A 3U10A 4YGDA 3AVRA 3QBQA 2R0FA 1MS1A 2D43A 4NHKA 5DMYA 5I0DA 3GJBA 2WT2A 2RS11 2Y26A 1CAUA 1W04A 1ZX5A 1H0BA 2X10A 2NPIA 5A7WA 3MW4A 1VBB3 3IAPA 1UYPA 2IC1A 1R081 5KHGA 1O3RA 1NLRA 4NROA 3AP9A 1UX6A 3PTRB 3TEYA 4OI0A 2WLPA 1AXYA 2NLRA 2ZGNA 4Y4RA 3I3DA 2Y6GA 4XMIA 2JXAA 2RS52 2ZHLA 2IFWA 4AF9A 1EAH3 1NAEA 2BNNA 3AXDA 4XQDA 3VKFC 4AL9A 3R0RA 3I49A 1WCSA 1NUKA 1JZ7A 2WABA 1IPSA 2PFWA 4RHV3 1EUTA 1NYWA 3OCPA 4QHBA 4BMBA 1TNFA 4RQPA 4XDQA 2TUNA 1KXGA 2JKBA 5FK7A 5JOWA 2EIDA 1URXA 3HOBA 4HVOA 5T5OA 5KHKA 4HSLA 1GWKA 2NZ9A 2DBIA 2D6NA 2R7EB 1YFYA 1UOJA 2RS51 4FOVA 1O5UA 4DO0A 2ZS6B 1W2OA 4IV1A 1PIV2 1Q8QA 3HMYA 4YG0A 4J25A 3BB6A 4I3PA 1JN2P 1GOGA 4FXGB 4QDQA 3ZSEA 1J3PA 4CRQA 3ITQA 4URTA 1TEIA 1NQJA 3CNAA 2XJRA 4PI2A 3H1YA 3Q8FA 2XXZA 4WVMB 1FNZA 4LLOA 1GICA 5A7QA 5BNOA 5A3MA 5IVCA 3IDEA 2XJSA 4IE4A 2DU0A 2R0HA 3DKQA 4YZ5A 3HAGA 5JR7B 4LE4A 4CCEA 4DNYA 5FZMA 4H55A 3H3UA 1RUJ1 3MICA 1NE4A 1PIV1 4JHZA 5FJHA 4FVVA 3E6DA 1DIWA 5CFCB 5JOXA 4HKOA 1BXHA 4LOSA 3WW1A 3EB7A 5E8AA 3ZX7A 2B39A 4N9IA 3AYCA 5F7UA 4AQSA 2P6CA 1HV0A 2W2IA 2WAOA 4LQRA 1QXJA 4NWWA 2XJPA 4IE6A 2QDRA 4GH4C 4Y22B 3VBSB 3U14A 2EIBA 1PM4A 3WG3A 4BQYA 1WCDJ 2YDEA 1YIFA 1NKGA 3OGSA 4XJ9A 2YG0A 4META 2MNGA 3USUB 5JZGB 5DAVA 1PX4A 2ZAHA 3ME2A 4DFSA 3J8F3 1OQDA 1ZYBA 2BFUS 2WA3A 3SHRA 2VXRA 2GN7A 4PDWA 4FBFA 3PTYA 2VNOA 5BNQA 2AR6A 3ZO0B 2YC2A 4IV3A 5EJ3A 4IW3A 5FP4A 3SQOA 2BRTA 3HJRA 3WR0A 5H9SA 4D0QA 2ZHMA 3QLQA 4IEOA 2XL7A 2WKKA 5FYUA 3WV6A 4Y4YA 3S5QA 3AZWA 2VTXJ 1V6KA 3VD5A 3FLPA 1G9AA 1OQEA 2RVAA 3H3ZA 1A8DA 1AYM1 1PNFA 2IWGB 2QCSB 1GU3A 2ZX1A 3LEMA 4AWDA 5HV4A 3POWA 3AP5A 3WINE 1MZ6A 3MO4A 5KC6A 3SCFA 1ND3C 2H0VA 3MV01 2WWJA 2OUHA 5ANNA 2HWC3 3E6BA 1SACA 1VAMA 1MVQA 3FHAA 5CNAA 1F9KA 2AACA 1JZ3A 2LALA 2DUOA 2G9ZA 2N7GA 1VBB2 3VDAA 5LY2A 4OHYA 3N36A 2Y60A 1IKPA 4NMIA 3AMPA 4CSWA 4F7ZA 2P5BA 2W1WA 4W6YA 3ZVXA 4RD7A 1VBD3 4Q0SA 2B4KA 5IT6A 3MIHA 4MSVA 5LK7B 1ZRIA 3EXUA 3AP4A 3MLJA 4LOTA 5D1IA 4L11A 4AEMA 3R05A 1VJ2A 4MGKE 1EAH2 5J96B 4B7EA 4NHMA 1XE8A 5FZEA 2YBSA 5FXZA 3PL0A 2WAAA 5BUVA 4RHV2 1NA1C 4JKMA 5CB7A 2EAAA 4M00A 1RUH3 2C0ZA 2DBNA 3ACHA 4CU7A 2B9VA 5FP7A 3ZFGC 1OC1A 1QJFA 3ZDVA 3ABZA 2V73A 1HJFA 4BK4A 3WDVA 5SV8A 4BXFA 1OQ1A 5IK5A 4YRDA 2A73B 4DUXA 3CJIB 1FOD3 4Y1YA 4JQTA 2L9LA 1FV3A 5F6LB 1EAH1 1XE7A 2OPKA 1G86A 2ZCWA 4LITA 1WW7A 4FPLA 1C3HA 4RHV1 2V4VA 2YY1A 1SCSA 1FV2A 1HV1A 1MS9A 2D40A 3AYDA 3LOBA 1SBDA 1XRUA 3FE5A 3MUY1 4KGQA 1O3QA 2A70A 4PF5A 4FPGA 1R093 1VBE3 2HBTA 4QX1A 4RFRB 3M4FA 4DY5A 1O5LA 3NO8A 5CAZA 5SV5A 2WZR3 5H9QA 4CEYC 5JXHA 3KV5A 3TRSB 4AI3A 2JDZA 4J1XA 4JTOA 5LA0A 5K4LA 2OQ6A 3AMMA 4BHPA 2Z79A 5D2AA 1RJ7A 2XR4A 2VW2A 5A6YA 5A3WA 5FOJB 4WVMA 1J3RA 4MXVA 1OLMA 4NHXA 4OLLA 3O1SA 3BU0A 5IK8A 4XFHA 1UKGA 4N9HA 1QGLA 2RJLA 2A75A 4BQXA 1WD4A 3O14A 4ASKA 4UW3A 4BZ4A 1H8TC 4CUAA 2UURA 1WCQA 1W28A 4N90A 3TEWA 5CFCA 1W03A 4CPBA 3PU8A 1SQ4A 5FZIA 3J8F2 3V0BB 4MYEA 3SH3A 5JIAA 3VKNA 2WL1A 1ZM1A 4WM7C 4O9GA 3AVSA 4HKLA 2JDAA 2BU9A 4Y22A 5DAQA 2Z5WA 3VBSA 4EN8B 4F3JA 4LBLA 1OD5A 4K6BA 1H6XA 1UO9A 4Y1XA 1F35A 1A78A 1MQTC 1RJ8A 1VIWB 5JZGA 4A45A 5HXMA 1AUYA 4NIAA 3RWKX 4CDQC 3S30A 2JD9A 5JXGA 2H0BA 2HEYF 1TNRA 2OVUA 2X5IC 1SBEA 1STMA 2HEWF 1UIKA 5CVRA 4IEUA 3J8F1 3NNGA 4LUKA 5KXDA 2YHJA 1REFA 3MLLA 3VBHB 5C8WA 3JB8A 4YW7A 4S2DA 3M70A 3GCXA 2HWC2 2WLQA 1Q3EA 4QQPA 3UKVA 3H8OA 3WX5A 2E26A 1MR5A 5HI0A 1YFWA 4QHZA 5C71A 4Q27A 2B8MA 3VZJA 1QEXA 2EXIA 4Z2AA 2OIIA 4AHXA 2JB4A 3N7KA 4PQQA 4IEZA 1GWMA 2VR4A 3H9AA 2B42B 2RJKA 1GUIA 1VBD2 4E9KA 1MZFA 3N3HA 3HEIA 5LEKA 3MV11 2R1BA 3T09A 1LOCA 4OYUA 5BPXA 2VECA 3ZIXA 1S55A 4K1ZA 4Z8BA 3O1TA 4AXOA 1NZCA 3TN93 5IVVA 4QQLA 5IVYA 2HWC1 1WZXA 4H7LA 3ZN5A 3B01A 4NIHA 1AXZA 4COWA 3KF3A 2R1DA 1RHI2 1W6QB 3GBWA 1RUH2 4LHKA 1BK1A 4XHXA 3SH4A 3CHXA 3GDBA 5A3OA 2P1BA 5LATA 2VUJA 3C7GA 3DF0A 2WYSA 1PVC1 4XF4A 3EO6A 1K5MB 2QDNA 2VO5A 4LA2A 2GN3A 2JG8A 3JU9A 2ZX3A 1FOD2 3VD7A 1LULA 1JW6A 2PHXA 4QAWA 1Q8VA 5C3QA 4CZSA 1DGLA 2ZKNA 3LE0A 4AI0A 3W5NA 1WW4A 1REEA 2I07B 2ZGPA 4RA0A 2VM9A 4YZ3A 3T2QA 3VKOA 1AL23 1RHI1 2BOIA 2WO3A 1RUH1 2FZ1A 4MGZE 3QH6A 3CJIA 2BVBA 3A0KA 4Q8LA 2YU1A 3LQCA 3WP3A 4AVAA 5C9AB 5JPNB 2BOJA 3C2UA 3LFMA 1LODA 1VBE2 1DU3D 5FMDA 2AEZA 1JYIA 3I7DA 4Q0QA 2X09A 3NRUA 1FOD1 3PVBB 3HD8B 3MYXA 3BVCA 5A6QA 4OHZA 1XSQA 4I01A 4YW5A 4MH0E 1E5RA 4AR2A 4X8NA 4GD4A 1S0FA 2YC4A 3RS6A 2RV9A 1ZBA3 2YZ4A 3OY8B 5AFBA 4P9IA 3U07A 3D3AA 3MIBA 1VRH3 3DXUA 4OZXA 4QX0A 2ET7A 2D3PA 3AM2A 2QQNA 3HNBM 2IUWA 1XNDA 4QU1A 4XMAA 5FLJA 4ZONA 5LWBA 2PQSA 4HG6B 2NQYA 2YFUA 4GA9A 3KVBA 1BMV2 3OYWB 1S1AA 5EPAA 5A33B 3S57A 1XXNA 4XHBA 2EXJA 4E8CA 4UFLA 2JDPA 2BP6A 1M06G 4P9WA 2ZGKA 2W46A 2PLV3 3WDWA 2VZTA 5AC93 3BIEA 1W8ZA 3TNPB 1ZBE2 5JVVA 3GHMA 4Q1PA 2VULA 1AX2A 3PJYA 2B9UA 5FZGA 2YPDA 4MGIE 1JZ6A 4AG4A 1LAJA 1RUF3 1PZ7A 3SLIA 2XKOA 5FPZA 1C1LA 1BMV1 3FFZA 2HEVF 3V0BA 4AYUA 3WDXA 1YHFA 3ZMOA 3GF6A 3ZSKA 1YWKA 1GV9A 3H8XA 3CO2A 3KZ4C 4DRVA 2CAUA 5BNNB 2ZMLA 1UN1A 3C3VA 4RGKA 1OLQA 4HN0A 2WIIB 4IV1C 5FO9B 4XDPA 4IETA 4YVSB 1ZBE1 1C8M1 3ASIA 1RGSA 4XFAA 5FMBA 3AKPA 1X33A 4ZPIA 5FUIA 2E7AA 5FO8B 4CDWB 3FL7A 3WDTA 4Q4X3 2J1AA 1GOHA 4Y1VA 4XJZA 4Y5TA 5BNOC 2BNOA 3K75B 3IM0A 5CKMA 2K46A 4ZS2A 3VKLA 4AI1A 1ZZ8A 1V6IA 1YQ2A 5FKCA 3N9QA 4GKXA 4IUGA 3VBHA 4ZHNA 1QWRA 1IPJA 4NAOA 3UGGA 3NV3A 1LGNA 4Q4Y2 4CP9B 1YI9A 2GP5A 1AR63 1U5IA 2QQKA 4UYBA 1QOOA 1CIYA 3WDUA 3NV2A 3TN92 2ZGOA 4BA6A 4PI0A 3FHIB 2Z2SB 5GZEA 1WMFA 1FPN3 4AFAA 4D3WA 2KR2A 2RDNA 4QU2A 1JZ2A 1RITA 2WO7A 3I2JA 5C3SA 1ZRCA 4K1YA 2VJXA 3TB0A 4BE3A 5JXIA 3FX3A 2ZGUA 2A7AA 2VQAA 1U5YA 4W6WA 2VD7A 2BTVC 2YC0A 3HN3A 4LBNA 1IG0A 5K0UC 2DUPA 2XWBB 2WBKA 3ILFA 3LEKA 4Q4Y1 5CU1A 1ZRDA 5FQ0B 3ZM8A 2VOVA 4PDWC 2WQ8A 4NAMA 4KWJA 1SMVA 3TN91 1HRV3 4BB3A 4UOJA 4LT5A 2NN8A 5I0TA 3S0MA 2PQQA 4IV3C 5LEJA 2HKXA 1AL22 1QY4A 4J1WA 4LBQB 1KDMA 1PMIA 1K5MA 3IB3A 5JI7A 1VP6A 1AZDA 3LSEA 3WQ1A 5LB6A 4HSJA 5DDJ3 2ZX0A 1C28A 3AYEA 3DL3A 1O8SA 5ACA3 1MS3A 3VBOB 4QMAA 5JR2A 2DFBA 2P17A 4XZPA 4DRRA 2BBVA 4YW3A 4IGOA 3NNJA 3LEGA 3VBUB 1QDOA 3NVCA 3PHMA 1ENSA 3RWNA 3WF2A 1XNAA 4BCUA 2JG9B 3PURA 4EE2A 5FK8A 5FY9A 4XFFA 3KM5A 1PMHX 3VL8A 4ASMB 3LDRA 5C9AA 5IK4A 3AP7A 1ZBA2 1AL21 4X6QB 1F4HA 4NJ4A 3RVHA 2GNTA 4JVAA 1AXKA 4JKLA 1VRH2 4KWUA 1RUE3 4GJZA 2Q8OA 2E6VA 3RI8A 3VBRB 1UXZA 4CDUB 4CUBA 3Q8CA 1OFNA 2Y0IA 4UT5A 3OTFA 4YG3A 5FZ3A 3OPTA 5F8PA 2Q8DA 2PHDA 3O0VA 4DQAA 3HNMA 4FPYA 3OY8A 3K51A 4XW3A 2IVJA 4INDA 1JZ5A 4ISRA 5AC92 1XPWA 1EPWA 1ZVFA 3AFGA 3O1OA 4M3CB 2ADEA 3HVDA 1WMDA 2WINB 1VRH1 3MPPG 4XUPA 5A33A 2JJ6A 3TEZA 5LBCA 3VD4A 3B3QE 3J4UH 4GWMA 1RUF2 2QQMA 1JMUB 1BK0A 4GAZA 4HK8A 5FZAA 4MVTA 4M0HA 1MZEA 1RUD2 2R071 3FUOA 3GCWA 5C7GA 2RS13 1LB2A 1NCRB 3PIJA 1CAXB 5AC91 3V56A 4LORA 1W90A 3VHPA 1SLBA 3APBA 4A42A 5T52A 3RDIA 3RQ0A 2E33A 4FT8A 5C8CB 2KA3A 2W95A 3BYWA 2PAEA 2O8OA 2ZZJA 3W5MA 1XNCA 1NOVA 3T2TA 2C26A 2WZ8A 4P9GA 5EHDA 4Q4X2 1RUF1 4FXKB 3N9PA 4CDXA 3IAQA 5BNNA 2CV6A 2AEYA 3CLPA 1RUD1 2ARXA 3GBFA 3UETA 4SLIA 4KL1A 1W3XA 2ARAA 4HKWA 2AUYA 4UFMA 5E6HA 4YVSA 2GZWA 1DZRA 4BLJA 5DG2A 4A2UA 4H2AA 3MEPA 4MGYE 1J1TA 2VNRA 2YROA 3IWZA 3WP5A 3WEZA 4CDWA 1UZWA 2VY0A 1AR62 4PCRA 4ZXEA 3SH5A 2PHFA 3HPNA 4IE0A 4LE3A 1KGYA 2B7YA 4IESA 4TSVA 2J1TA 5J3UA 4K21A 5FWEA 1FPN2 3NSTA 1EPZA 4Q4X1 2VMEA 2DURA 3AX4A 1T6GC 4OFGA 1XNTA 4XABA 4CP9A 4FPEA 2E63A 4QM9A 5HCHA 3LGRA 2O0OA 3K48A 5CFCC 3NAPB 3ZFEB 5J1XA 1H2MA 2AGSA 4R9DA 4MHRA 2LS6A 3PUQA 2FDKA 3WCSA 1AR61 2ENRA 4OUSA 2ZGQA 3RRDA 4AEJA 4NWVA 5DZEA 2YGLA 1VRBA 3URFA 3VBSC 5FPBA 1FPN1 1JTZX 1WLCA 3BGAA 4D6RA 2Q5TA 1S0EA 4YVWB 3OGRA 4FPCA 2WNUB 4TLFA 5JZGC 5FZKA 1NCQC 3DPRA 3SITA 1UCXA 4LJHA 2VOKA 5DDJ2 5FQ0A 2IXHA 3D82A 1D4M1 4LTAA 3N7MA 4QQ2A 5AVAA 3NNFA 1RUJ3 1PIV3 5JXJA 3AB0A 5LBFA 1MS4A 4HXCA 4DMIA 2J1SA 2V4AA 4XFBA 4Y24A 1VBC3 3RG0A 3POBA 2YBKA 3CZJA 3EQEA 3DYMA 4LBQA 4OHXA 3N9NA 1MPXA 4OULA 3ZXKA 2WR9A 5FY1A 3MIEA 4BM8A 2OZJA 3NKGA 3K3NA 4CCNA 5FOBB 1GWLA 4Q5OA 1C57A 2TBVA 3ZXLA 4P9XA 5CFDB 4WM8B 1JOJA 1QQP1 4PLMA 3VBOA 3M3CA 5FY5A 3NJYA 5FXVA 1RUE2 1CN1A 4FTEA 2AYHA 4MGTA 4CCLA 1Y4WA 5DDJ1 3VBUA 4YW2A 4GWNA 1TME2 5FY7A 1JXNA 1ND2B 4GJYA 1J3QA 5CZKA 3WG1A 4KI5M 1JUHA 1S0BA 1SLAA 4XTPA 2XL9A 4AAPA 3DN7A 5A6ZA 2JWPA 4NIDA 4XCAA 4KQ7A 3WP4A 1S2BA 5IK7A 3RFRA 2IXKA 2QUOA 1W6MB 3JZVA 3LPFA 1AR82 2VNVA 4CDUA 1VB4A 1EP0A 5IVEA 1JYTA 1RUE1 1E5HA 1F5JA 1DZQA 3LCPA 2P34A 4AHYA 4IEWA 1AYM3 1TME1 4UW4A 3ZYJB 3AYAA 4IQPA 1QOTA 2JG8C 5A70A 4PLNA 5A3UA 4JV4A 4L97A 2RS12 4MGQA 4M3CA 2OQ7A 3HT2A 3HQXA 4TLGA 1LNSA 4C1XA 1PK6B 2ZX2A 4Q1RA 1UPSA 1NY72 4JDNA 4CCCA 4XXPA 1XOYA 4YGBA 5FY0A 4BMEA 1AR81 4KG8A 1JHNA 1YI7A 2QKDA 1OFSA 1UL9A 1YQ8A 2C4XA 2V5DA 1BJQA 2VUCA 1JUIA 5FZ9A 3U0ZA 1N1SA 3CJIC 2GALA 4PJYA 3ZLIA 4DINB 4W65A 3ZFFA 1NCRA 2W1QA 1LESA 3OSDA 3J7LA 5FLIA 1OVPA 3W9AA 1CAXA 4QB6A 4XBLA 4BQ4A 5JI9A 5EV7A 2OZ6A 3JBG2 2ZEWA 1N1VA 3M3QA 3F2ZA 5C8CA 1XC6A 4TYSA 3NL1A 3FLTA 1OHFA 5EQUA 1NY71 4BQ3A 4KBBA 1D2QA 1W99A 2D5FA 4UXAA 5CEHA 3WCRA 3FFQA 4XJWA 5GZDA 5JUVA 5FZ4A 2BVVA 4CEWB 2D97A 2K0GA 2A6YA 2VL4A 5JCTA 4FFIA 2JECA 1ULCA 1WLTA 2JIJA 2LRPA 4ZZ5A 3BOPA 1C4RA 2OW4A 4TTGA 1TVGA 4GZ9A 1WKYA 5KBFA 3JBG1 2GC2A 1COV1 4AOCA 1UY4A 4QGNA 4QPIA 2V5YA 2E53A 1IS6A 2VNGA 5FP8A 2QQJA 2W91A 4D8MA 3ZSLA 4LO8A 1US3A 4COUA 1P8JA 3KT7A 2UU8A 2CHHA 4P9YA 2FDIA 1DCSA 1Q8PA 1UZVA 5M0TA 1DBNA 3B69A 2F17A 1OVSA 1C5HA 5A7NA 2KM2A 3C7HA 3NAPA 1FMD2 1L3JA 3MIFA 3ZFEA 1JBCA 4JGZB 4FO9A 2TNFA 4LO6B 2GMMA 5I8SA 1L7RA 4PHZA 3WHTA 3HNYM 1DFQA 1RUJ2 5J98B 3JD73 1XBFA 3H1WA 1W8FA 4B4QA 3THPA 4CPBD 1OT5A 4NPLA 1VBC2 2GC1A 3I3QA 4RN5A 4YVWA 3VHRA 5D21A 2WSVA 5C4WB 1CWPA 1GR3A 1W6PB 2LROA 3W20A 3WNXA 2GU9A 1GZWB 1NXD1 4ATFA 4LK7A 3N7LA 4DY3A 2ORZA 1M4WA 1ZA7A 4OVEA 1UWWA 1DQ4A 2J1UA 1FMD1 3OUIA 4COVA 1W6OB 4FPHA 5I8YA 3B9CA 2RS33 2Q30A 1ZZCA 4YM1A 1OSGA 4KGGA 5BNPA 2VMFA 4MV2A 3VBHC 3POGA 1A34A 5CADA 1KFUL 4ZU4A 2ZGTA 5L9VA 4TZDA 5FV3A 3MPBA 4D69A 3IBMA 1W8UA 2HLEA 4N43C 3TEXA 1N3QA 1VBC1 3OBRA 5A7OA 5CFDA 4WM8A 5CKQA 3T1LA 4AZZA 2B45X 1L7LA 3Q8AA 3FN9A 5L9BA 3BTZA 2WC2A 5IATA 1SBFA 4FOYA 4C0BA 2W08A 2CY6A 5FP9A 5T3NA 1Y9GA 5FPLA 2NYYA 2ZAAA 4UFHA 3CZUA 3K77A 1JHJA 1CGPA 1AYM2 3AMHA 1WA6X 3DECA 3LOIA 2BWCA 2HBUA 4I3GA 3ZYFA 4DXZA 5HCAA 1CR7A 3R6SA 1W6MA 2F6BA 3FMGA 4QX8A 2A3YA 2ILMA 1CQ9A 2OT7A 3QH7A 2CTVA 3H7YA 2VUAA 1EUUA 4C0HA 3OPWA 4JDOA 1FATA 2YGMA 3ZXEA 3SCGA 3T1MA 4BOWA 5EWSA 1WUVA 4I0AA 3THTA 1O4TA 2DVGA 1F5FA 4CXWA 5C3PA 2BYVE 2A6WA 1DHKB 3H1MA 4LA3A 1DGWA 4HPKA 4A7ZA 5DAPA 4Z82A 4CYDA 1S2EA 3HR9A 5F3EA 1T6BX 4TN7A 3D8CA 1NLQA 4D6SA 1SLTA 4WVVA 2K2SA 4WVZA 4CTEA 4AFBA 3ST7A 1DGRN 3CMGA 2D3RA 1SFNA 3NV4A 4XUTA 4XUQA 4IEXA 1LOEA 1O8PA 2OS2A 3NJXA 2A5ZA 4CCKA 1FX5A 5C9AC 2A71A 1WD3A 4AQ2A 4BQWA 3ETPA 1N47A 2OUJA 4ONUA 3A23A 1PVC3 3I2DA 3JUUA 2DCYA 3IZOA 2J22A 1IKQA 1S0GA 4LBKA 4Q4V3 2D6KA 2DU1A 5APAA 3L2HA 5FY8A 4BQ2A 5A1FA 1U5ZA 4RS5B 2W68A 3LD8A 3I3MA 1UPIA 2WSUA 1ZZ9A 3AZZA 4RGAA 2OPWA 1XYPA 1GQHA 2EA7A 2KXLA 4R8HA 1DP0A 2ES3A 2PXJA 2R30A 2VBBA 4UI9L 2VZOA 1QOSA 1X8MA 3ACIA 4YFWA 3UV9A 1RHI3 3OBZA 4LK6A 1N3OA 4V2WA 5GJ6A 4CEWA 4UW5A 3FWEA 3CL1A 4XUOA 1G7YA 3AK0A 4JZRA 3WG4A 1XB9A 4K3UA 1Q5OA 4YYOA 4CE8A 4OMDA 1LU2A 3WNNA 3WNMA 3OUJA 5KHJA 2Y6KA 2DV9A 2XLFA 1DYPA 1AJKA 5FZBA 2SLIA 2XJUA 1G9CA 5LZ6A 3JD72 2YPJA 5G05L 2CGNA 3QACA 2ZGMA 3PVEA 1JH5A 3PVNA 3RZKA 2DVFA 1XNBA 3MF9A 2C9AA 4AFCA 2WS92 5CA6A 1IZ3A 2CL2A 3J7NA 4JGZA 4C8DA 3DUIA 1PMJX 2RDQA 2BZDA 4CDXC 2RDSA 4G4FA 5F6KA 5BNNC 2RS32 1LEDA 1YLLA 3NKTA 3P1IA 1POQA 1V6MA 1Q43A 1ULFA 4R9CA 4XFCA 5C4WA 3JD71 3KD4A 2DCKA 1DF0A 1W6PA 5FZHA 1SFYA 2MEV1 2XVLA 4LMFA 1GZWA 1G9BA 4H3WA 4XC9A 4Y5Z0 5FPUA 4NOTA 4X6RB 2P6HA 5FXWA 3T30A 2WS91 1QJY3 1W6OA 2G1MA 2Y0OA 2E7QA 2OX0A 1W8TA 4ZXKA 5IVBA 5JSPA 2VW1A 4W8JA 3KQ4B 3GZTB 1N1TA 1XE0A 2YB7A 2RS31 5FMCA 2RHPA 5LA1A 3MFAA 3POSA 3WW2A 1W05A 1PM7A 3POFA 1ZBE3 1C8M3 5FR3A 3AJZA 1SDWA 1OI6A 1JYVA 4FOQA 4DXTA 4S2HA 3WG2A 1KS4A 2VC9A 3ZXGA 3A0NA 4W50A 1D0HA 1SLCA 1FAYA 3USUA 5FYZA 5BYNA 2UYBA 5EZWA 2XJVA 5FKBA 2VG9A 3UKTA 2OYZA 5CYYA 3DPRC 3WSOA 5HBAA 4EROA 3UNPA 4NIGA 2Q8CA 3AMQA 3THCA 3ZN6B 3OGVA 4IEYA 1OKQA 1E5SA 1OA3A 3ACFA 4LHSA 4CUGA 5FBJA 1UX7A 2Q4SA 1YQCA 2AH2A 2W94A 3H8UA 2ORXA 4EN0A 1O6UA 4EQVA 4A7YA 4BQ5A 5HCFA 3VBOC 1O59A 1PVC2 2VW0A 3ZYPA 1YXWA 4Q4V2 5KXCA 3VBUC 2B5HA 3SEEA 3UT0A 4AVVA 4Q4Y3 5F32A 1DDLA 3PDQA 5FAXA 4DOUA 4E2GA 5A32B 2YBPA 4DXSA 5A7PA 2W92A 4XACA 3WOGA 4OZOA 2XOMA 2HWD3 1ZZ7A 2E9QA 2BGCA 4MADA 5DZGA 3ZXJA 3FHQA 2XHNA 4QXBA 4XF3A 4AQTA 3KMHA 1NLSA 3KCXA 1SZBA 3ILRA 1JYWA 4YZ2A 4DIQA 5FWJA 1J83A 5JMOA 4RS5A 3H50A 1BCXA 3VV1A 3WNKA 2QNKA 4DUWA 3C7FA 2UWBA 4Q4V1 3B02A 3H7JA 3POIA 1PHMA 1H1AA 1A3KA 2GMPA 3WVJA 2CNAA 4OI4A 2Y34A 2CDPA 1WLWA 2PHWA 4OUEA 1GANA 1X50A 1UYZA 4JGYB 4CCDA 1IOAA 4QX5A 3KT4A 2BNMA 1WW6A 3FZ3A 3ZYIB 5B4NA 3GJAA 3S5AA 5K9YA 3SC7X 3LZZA 3WHUA 3PUIA 1U0AA 3KT1A 5GLUA 3EYPA 4BIOA 4K20A 1SG3A 5C3OA 3O1MA 1ENXA 1GP4A 2PMWB 4PIXA 4A44A 1PVXA 2P3YA 2XWJB 5JSOA 4HLTA 3ZFFC 1NCRC 2FHRA 3PJQA 2FMYA 4P5HA 2J1RA 1KJLA 2WZPP 3L9JT 1POV1 1QH6A 3L2YA 4TXWA 2GDFA 1CPMA 5C8CC 1YO8A 2R16A 3O0XA 2JB8A 1ND3B 2R6QA 3O1VA 3I54A 4K8RB 4E4SA 3KV6A 4CP1A 3N35A 5G04L 4C90A 4FSJA 3CIHA 4R9AA 4GWJA 2LM3A 1JI6A 1CX4A 1QJY2 3ZR5A 2ETEA 3IPVB 2E7TA 1UMHA 1XYOA 4V2VA 1I3HA 3IDAA 2IXCA 1XYNA 2R073 1TG7A 4QX2A 3BOWA 1SLIA 3TNQA 3D0SA 5BXXA 3KLSA 4L8QA 3K46A 4QPIC 5E16A 3AJYA 3E6CC 1C8M2 2FMDA 3JQWA 2G9GA 5KR7A 2YV8A 3OD0A 2XUEA 1ALYA 2G9FA 4GULA 4PBPA 5FZ7A 4RQPC 3U75A 2IFRA 1K12A 2ZTNA 5A3NA 5IHRA 1KS5A 5LY1A 3LDBA 4XEZA 1QJY1 2VPVA 3OJBA 2FDHA 2Q1FA 2XUMA 4FTSA 1ULOA 1UY0A 2QVSB 5LK5A 1RUD3 3MDPA 3NAPC 4MO3M 1YC61 1OH3A 4QB1A 3ZFEC 4NHYA 5FZCA 2CGOA 1JZ8A 1YRZA 2Y38A 2BDRA 3OOXA 4N53B 4XBQA 2O1QA 2XJQA 1G9DA 3UKNA 2BBAA 4XILA 2E31A 4RYDA 3LEIA 4O61A 4OUMA 4MHUA 4YVWC 5AFEA 1QHDA 3U78A 2DTYA 1PX3A 1ULEA 5IW0A 1Z78A 3PLQA 1RUG1 1UIJA 4AGRA 1MS0A 3ZN6A 2W1SA 1JODA 4GALA 4LXLA 5IUQA 5CKNA 2PELA 1Y3TA 5FZ8A 3NQHA 5DUWA 2FZ2A 2DVAA 3PUHA 4M0NA 5FYSA 4CEYB 5BNPC 3T0BA 5GKAC 4RR3B 1BHGA 1LRHA 2Q0AA 2VH9A 1R64A 3UGFA 4LLFA 4YW4A 2HWD2 3K2OA 4WM8C 1DYKA 2H6CA 5H9PA 4Z07A 5CISA 1LHNA 3ALQA 4IE7A 4LBQD 2V09A 3I4IA 4XUNA 2WWSA 4P08A 3QOPA 1V6NA 1HW5A 4AI9A 1D4M3 2LW8A 2VOXA 3FC0A 4I0WB 3NNLA 3AL6A 3ZSMA 5C3RA 4XFGA 5FZFA 4OQ8A 1X9TA 1VR3A 1KITA 4XJUA 1W6QA 1KQRA 4Q0VA 1Z0HA 2BEOA 4MOAA 5FDBA 1FXZA 2CWMA 2HWD1 2SBAA 3AC0A 4Y1UA 5EJZB 4YW6A 2I74A 1ASJ3 1W2TA 2DUQA 2RM23 3MF6A 5GLTA 4CVUA 1QQP3 5FMOL 2FCUA 2IXIA 1RUI2 1OA2A 1TE1B 4YSFA 3Q9OA 3RZHA 3T08A 2EXKA 4XJAA 3USSA 3MIDA 3CJXA 1H2NA 5F1RA 5LA2A 1HKDA 3TAYA 4BJ0A 2ZMKA 4CDQB 4JHTA 4JGYA 1E5IA 4QGLA 5FZ0A 3Q8BA 3CEWA 4YGEA 1C1FA 5EYXA 3ZDSA 2E32A 3RNSA 4Y5SA 2JD4A 2B46X 2QQLA 4GXLA 1UOGA 4BWOA 3AKTA 2WT1A 4MLOA 2C9KA 4M3CE 1RUI1 1SLLA 3RGBA 4H14A 5HCBA 3O1PA 3HBKA 1I9RA 3VDCA 3POYA 1H4GA 1WLDA 4Q0PA 1TME3 2IXJA 1HB1A 1LCLA 1WBFA 4H7MA 2FCVA 2P3IA 2R072 5DAXA 1RL3A 3ZYHA 2FDGA 3VHOA 3O12A 3AKQA 5F3GA 1GYKA 3RJ2X 4E4DX 5FZOB 5LASA 1GBGA 1AR83 1YQ6A 4LEJA 1TMF3 3IPVA 4CEWC 3N9LA 4IXLA 3WQBA 2NMNA 3B9IA 3AKSA 3OYWA 4V1PA 1FI2A 3BI3A 4M4PA 1ACCA 4B4RA 3I2FA 2RR11 3VZOA 1F4AA 2BGPA 3JQXA 3RMYA 4CU9A 5FY4A 2UWAA 5FZDA 1HRI2 2EIEA 2QQVA 3ECQA 4QM8A 1IGOA 4KNCA 4Y20B 3U11A 5DZFA 2R042 2TEPA 1J58A 3RZZA 5C70A 3PUAA 3SEPA 5I0UA 4IERA 2E51A 1OBNA 3P5BA 3U1XA 4LO5B 4PIZA 4JGZC 3VN4A 4CP0A 4AW7A 1QXRA 1SHWB 4N53A 3BIWE 3JBG3 2X29A 1XJAA 1COV3 2VQUA 3S6PA 5C6CA 1GMMA 1K3IA 1POV0 1Q56A 4HK9A 1O3SA 3B94A 4FPKA 1J84A 2GH2A 3CU7A 1JZ4A 5EJ1B 1SPPB 1KRIA 1HRI1 2DTWA 2ZKLA 5DUUA 3T2OA 2FDJA 5C4WC 2XBO3 3VD3A 3I2OA 2JEMA 2R041 1KFXL 4I0BA 5FYHA 1F31A 2WA4A 3BODA 1WW5A 3EJKA 5A7WB 1LHVA 3K4AA 4XOGA 3KF5A 1UKRA 2QQWA 5GLVA 2P3KA 4GB32 4XZUG 1UYYA 3I97A 1H1MA 2HWB3 3H8RA 2ZHKA 3W58A 3K4DA 3QD6A 4A7KA 2JENA 2VCBA 5FPVA 4RR3A 1D4M2 5D8AB 2IXLA 5A7SA 4AK3A 4NUBA 1ENRA 3LIHA 2DDUA 2ZX4A 1UF2C 1ZZBA 1OF4A 3KCCA 2W87A 2DFCA 2W47A 2K9ZA 3KGZA 4EYUA 1S0IA 4HL0A 2W39A 2WNVB 4CU8A 1F2NA 3ACLA 4LHNA 5DABA 3TWIA 5LA9A 1Q8OA 5FUNA 1UY2A 4K9SA 1ASJ2 2RM22 1RB8G 5K7PA 1QQP2 1BEV3 3PNAA 4GB31 4GQ7A 4COZA 1IPKA 1H1IA 1LOGA 5FMOS 1FMD3 3SISA 4LNVA 1H30A 1W3VA 2PAKA 4B29A 3R4UA 3GZAA 4A41A 1OOPB 4IEVA 1ZRFA 4XE9A 2D6LX 3E5QA 1HN0A 4HT1T 1MACA 1GP6A 5A1LA 4Z2WA 2QQOA 3QCWA 1BVVA 1OH4A 4K8FA 4NPRA 4QXHA 3O1RA 2W0XA 3O0WA 1IG3A 2GAUA 4JQRA 5FO7B 4E2QA 2PTMA 3KQRA 2EALA 2A1XA 1WGPA 4A6OA 3J7MA 1ASJ1 2ZGSA 2RM21 3DYOA 1U12A 3F95A 3VZLA 2DYCA 2XMLA 4MXWB 1SEFA 3WDYA 1RXFA 5L73A 1BVP1 5E89A 2WDBA 4YPJA 1GZTA 3KV4A 1HX6A 3BU7A 3PU3A 2JG9A 4D7SA 4YNIA 3U4SA 5F39A 4QKFA 4Q0UA 1G9FA 5T54A 3VBRA 3WXPA 1HQWA 1UZ0A 3GBGA 5FZLA 1ULGA 3MI8A 2P4EA 5ABJB 5LRSA 5T50A 4Q8KA 1TMF2 4NVPA 2VMCA 2W9XA 1VMHA 4CP2A 3T0DA 5A3TA 1LHWA 1J59A 3RYKA 1ZRRA 4R4ZA 4RS5C 4R52A 3MFCA 5I8TA 5GLWA 2AC1A 2JDYA 5FBZA 3ZIWA 4BDVB 1GSLA 3U37A 4Z92B 1K42A 4XBNA 4E4HA 4CUCA 1XU2A 4YWAA 2VQ0A 1UMIA 2RMU3 1UZYA 1W0PA 1YEWA 2HWF3 5K0UB 3ENRA 5L9RA 5ERLA 5IAXA 4CXYA 4GKYA 2VZVA 1G8WA 3MW2A 1QDCA 4L9BA 5FPXA 2QZ3A 1TMF1 1DLLA 3P3NA 2XLAA 4O7XA 1Y9QA 4B1MA 4F8AA 2LTNA 3NNMA 4KG0A 2OXBA 1UD1A 2ZZQA 1PO22 1RMU2 1ODNA 2VBPA 2LUWA 1LECA 1VE0A 1IHMA 2I45A 4GWIA 5FYCA 1GZ9A 3T0AA 2XPJA 1DQ1A 3GZUC 1NT0A 4KU8A 4ES8A 2JIGA 1COV2 3IMNA 5F5CA 4ZKTB 4LHLA 4XJ8A 2J1EA 4KH9A 5T5PA 1OMIA 2WN2A 1AX0A 4Q26A 1BKZA 2XBO2 2ZBJA 3WF3A 4F83A 5I91A 2DVBA 1CONA 2JDKA 4KWKA 5CIRA 1JYXA 3O5SA 3AXEA 3AL5A 2VMIA 1V9U3 3UGHA 3V0AB 1W9WA 2EVXA 2FBEA 1PO21 1PZ9A 1RMU1 1RUC3 1W2AX 1W9FA 1YFUA 2ET1A 2WNOA 2XJTA 5FCCA 2HWB2 3ZOIA 4C1WA 2ADDA 1SPPA 1UU4A 4A3XA 4D6QA 2A6XA 2RDRA 3TYJA 3W59A 1RVF1 1S2KA 4OHVA 3BALA 3NW4A 4L2NA 5B4XA 3VDDB 1QJX2 3VD9A 4C91A 4BXSV 1EY2A 4QPGB 5A1AA 5L36A 2XBO1 2VZSA 2Y64A 3M3IA 2ZMNA 5A3LA 3V65A 3DKWA 2GP3A 3RPQA 4K40A 5LRRA 4E4ZA 2ARBA 2HH9A 1GQGA 1MEC2 2ERFA 4XF0A 1NX9A 5D8AA 1BEV2 4P00B 1OLME 2R063 2HWB1 5FP3A 3RZJA 1C8NA 4IGPA 2XQRA 3ILNA 5AVPA 2YFZA 1HB4A 2WNVA 3RZMA 4OI1A 1QJX1 1KJRA 2GC3A 4AAXA 3WNOA 2MEV3 1D4VB 2ZGRA 3H3LA 3A7QA 4XYXA 1CD3G 5L19A 3UJQA 4LBMA 2WNUA 1GZCA 1SFPA 2WS93 4UBHA 2Z69A 4XF9A 3N9OA 1OOPA 1MEC1 1H9WA 2XHKA 4EJRA 1VLNA 3WLUA 1BEV1 4ARXA 4FOWA 2FDFA 2F4LA 3KHBA 2VGDA 2GC0A 1LENA 3WW3A 2GNDA 1UU6A 1YFXA 4AI8A 1AYN3 5FLHA 4YZ4A 4Y1ZA 3ATGA 4HONA 4ET7A 4WZFA 1X7NA 1ONAA 2YXSA 1OURA 2BGOA 1LR5A 4EN9B 4MXWA 2QJVA 2CGPA 1W2NA 4UAPA 4QPYA 1UMZA 5FREA 2C1FA 4QQOA 1ND2A 4P14A 1S4CA 4AGGA 1W8NA 3ORJA 1N3PA 4XF1A 1UXXX 3LAGA 3ZPOA 3VHNA 5E1RA 1MS5A 5FYYA 1UY3A 4A3ZA 1PGL2 1VBA2 3EHKA 3VBFB 3WF4A 2JDNA 4CA9A 5F5AA 2RMU2 2QTWB 4MUVA 5ABJA 5J48A 2HWF2 3MHZA 5JIUA 2VBDA 5I93A 4IDZA 3IT8A 1US2A 4OQ9A 1W9SA 5I0RA 3D6EA 1CAVB 5F2SA 4SBVA 2EIGA 1RYYA 3C8XA 2A6ZA 4HFSA 2AZ5A 4TWTA 4MZUA 4ZZ8A 3ES1A 5C5TA 1K5MC 4AEDB 1AHSA 2W52A 2J7MA 1GFF2 4DB5A 4MGSA 3K4ZA 2Q1MA 2GH8A 3Q8EA 2Z4FA 5K0UA 3VLBB 1NCQB 1PGL1 4HANA 5B2GB 1HN1A 1PK6A 1VBA1 3P3PA 4JGYC 2RMU1 1PZ8A 1LHOA 2HWF1 2QFEA 1GNHA 1YYNA 4DS0A 2UYAA 4JRAA 4E8DA 3DGTA 5DXDA 4Q4W3 1CESA 2A3XA 2HYXA 1GQPA 3KS7A 3HWJA 2D6PA 3GALA 4LO4B 3M3OA 5EFUA 2C24A 3RZGA 1V9U2 2VMHA 2PYTA 4P5YA 1RUC2 1V6LA 5ISLA 1JYCA 1JU4A 1AVBA 1CAWB 1U5XA 1BLZA 2VTFA 4FAGA 4A4AA 2CDOA 3SKJE 1HB3A 3WY6A 1CPNA 5IWFA 2W5FA 3ZN4A 1B35B 1BYHA 4FP2A 3V0AA 3E1F1 1ZREA 5FTTC 2WT0A 4AVCA 5A80A 2UY8A 3KVAA 5I0SA 4QKNA 1V9U1 4XAAA 1ODMA 4R9BA 2BQPA 1DZTA 1LOFA 1BZWA 1RUC1 1BQPA 3FLRA 3S7EA 2R062 3VDDA 3M1HA 1XQNA 1W9TA 3MUZ1 1HQLA 1PO13 3FUQA 1POV3 4PQ9A 4AEKA 4QPGA 1IQDC 1I1EA 4YG6A 4OMCA 4S2FA 2JG8B 1QKQA 1RINA 5FUPA 3WQ7A 4HVRA 4YM2A 4AHZA 3JCIA 2MEV2 2QBXA 4BISA 1QNWA 1HJGA 2XVGA 1VBB1 5FXXA 3BTYA 5ANQA 1V6OA 3HIFA 4PLOA 2NP0A 1L7QA 2WQ4A 4ZS3A 2CAVA 2JE8A 1DQ5A 5K8SA 2ZPXA 2VUDA 1KDKA 3SNMA 1LGBA 2DCTA 2XGXA 3MLKA 5T5LA 3WQ0A 4NPMA 2VMGA 2BUKA 2R061 1ENQA 2WFF3 4EN7B 2DWRA 1RIRA 2GSYA 1CJPA 4GMP3 1D2SA 4N53C 1S0JA 1AYN2 4NHLA 4YVSC 4JDMA 4Y33A 4ATEA 4UFKA 4LIUA 3E5XA 3A4UA 3MIGA 5F3CA 3N4MA 1AR73 3M3EA 2X53S 2J1VA 4BQ1A 4CDWC 3SMHA 4EN6B 4NRQA 2P37A 4QHOA 5GZFA 4EWDA 3H0OA 5IFPA 2RE9A 1K45A 1LOBA 2PHLA 2QE3A 2WYFA 3N7JA 5DUXA 5JPMB 2CWSA 4LR4A 3VL9A 2WNEA 1OA4A 4QX3A 4XCBA 3RJRA 2ZA9A 2BJSA 3AP6A 1IQAA 1AYN1 4RR3C 1I5PA 4YM0A 3R4DB 3IDCB 3AFKA 1A8MA 4MX3A 5A6XA
chains in the Genus database with same CATH topology
1LEMA 5T55A 4Q29A 1V6JA 4WVWA 2P3JA 2WQZC 1Z7S3 1S0DA 2NM1A 4HN1A 5BV6A 4B7KA 1RUG3 2OA2A 1G6NA 3VBFA 1RUNA 2BWAA 3RSJA 4LULA 1Y43B 1QU0A 1X36A 3I59B 4BPZA 1FT9A 3M2MA 2D6OX 2PHTA 1CAVA 4LUMA 3KB5A 1LOAA 3ZYRA 4HMZA 1SCRA 4QQHA 4AEDA 3OGGA 3ZYGA 4NR1A 4Q4W2 3GHNA 5C33A 1FNYA 1NCQA 1O7FA 4ISQA 4ZU5A 5DUVA 4Y26A 3TOJA 2D3SA 1YCIA 2YMZA 2JG9C 4P9LA 3JB4C 2XLGA 4BLIA 4OI2A 3VBRC 4N43B 3WD5A 4AFMA 5GZGA 4M01A 1DQ2A 1EV13 4ITCA 4I2OA 1H9PA 4I02A 2DCJA 4Q4W1 4CDUC 1RUOA 4YARA 1MZ5A 5JDBA 4JRLA 2BPA2 1CAWA 2ZOEB 4GH4B 4AVTA 4COYA 2EF6A 1O3TA 1N1YA 1PO12 2I2SA 3KSCA 3ZPYA 2ZACA 1B35A 4FP3A 4AVSA 4EWAA 1WA4A 1W6NB 1Q8SA 5CG9A 4PIYA 1RUI3 1YIPA 1OPOA 1HXS3 2DF7A 2VVFA 3D4KA 2F4PA 4XQWA 3IDBB 4ZU7A 2XG3A 1VBD1 5BY5A 3BCWA 2WFF2 1PO11 3B00A 3B5LB 1W39A 3B7MA 4AE2A 3RI9A 1AR72 2JE9A 2ZABA 5KHIA 5KXBA 2RR13 1R092 3GYDA 3AMNA 3RYRA 3NWKA 1BBT3 3PVOA 4EWEA 4D7TA 4KWLA 2WZR2 2WFF1 4QXKA 2JE7A 2HWE3 4GMP1 3LKJA 2PN5A 1IS3A 1PGW2 4BYYA 4XPVA 3LA2A 1WCKA 2XH6A 1R1ZA 2D93A 3FBYA 5FFOC 1LJ7A 5GM0A 1AR71 1OLRA 3WP6A 5CBLA 1MS8A 3VGIA 1NA1B 5GALA 1QF3A 1Z7S2 2P2KA 2PAMA 1R091 5EYYA 1RUG2 1VBE1 3ZFGB 5D8AC 4X8PA 4EV0A 4XXAA 1Y7BA 3LSDA 1QNYA 2WZR1 3J26N 1QJZA 1HRI3 1PGW1 2WNVC 4XIOA 2R043 3V64A 5TSWA 4FPJA 4D7YA 5JAXA 4RGGA 1CJDA 1H4HA 1D0GA 5KXEA 5GZCA 2WNUC 1Z7S1 4U2AA 4JCKA 1OOPC 1XU1A 3NJZA 3ZXAC 2D7FA 4AI2A 1DG6A 3I59A 2GNBA 3ROUA 1DGWX 1RTVA 1B09A 3WUCA 3ZSJA 1QJU3 2VOWA 3ETQA 4AGVA 4CDXB 4Z1VA 3SCHA 4JTNA 1CIWA 4OHWA 2BW8A 4S2GA 3M8LA 4WZCA 5CFDC 1H2KA 3PMEA 4HZFA 1H8VA 2VU9A 4GIQA 4D94A 1EV12 1CVNA 3G7DA 4GB33 3TBDA 1OPMA 1R1A3 4FAHA 3WUDA 2AREA 3INAA 4DPNA 4ASLA 1ND2C 1TQ5A 3E97A 1QMJA 4XFIA 4BH9A 3D5OA 1H8TB 3AZXA 5A32A 3VUOA 2GMEA 2XB6C 1X82A 5DG1A 4KU7A 1NG0A 5FRAA 1YJKA 4N43A 1J1LA 4NN0A 4YFZA 3U4XA 2QZ2A 2A3WA 5ABJC 3ES4A 4ES9A 4WM7B 3O7OA 1S0CA 2PHUA 1EV11 2XVKA 4GH4A 5KHHA 5JLVA 1F8VA 4IL7A 1HXS2 3IIAA 4IEPA 4YLZA 5GLZA 1MQTB 1AX1A 1NE6A 3G6JB 2ATFA 3IKWA 4YGCA 3ZXFA 1W6NA 3DPRB 2X5IB 1PK6C 3FBMA 4P9JA 4DZGA 4W6XA 4B8EA 1VALA 3NV1A 4B3NA 2EXHA 4J6GA 3IN9A 4R4XA 3VKMA 3LA7A 2PA7A 2ZHNA 3HT1A 3HN1A 4XQ4A 1ZNPA 5HXVA 4FTBA 1HXS1 1DQ0A 2RR12 5JWPA 1UU5A 4AVBA 1BBT2 2EAKA 3KGLA 5JSRA 1VAVA 1ND3A 1DQ6A 1LTEA 2HWE2 2IZWA 1HLCA 1ULDA 1YNAA 3OGJA 1AR93 2WFPA 4RFT0 4I09A 3S7IA 3ZXDA 3AZYA 2FQPA 3ZMNA 3FJSA 1UAIA 1UZZA 4BIFA 4IEQA 4QD2A 1LOFC 2HJIA 1BBT1 1W0OA 3BPZA 4N7IA 3VDDC 3UJOA 5J36A 4AFDA 2UY9A 2ZGLA 2DVDA 2HWE1 4FPFA 4QPGC 4RL7A 1LGCA 1PGSA 1NA1A 2PLV2 3BTAA 5J09A 1GLHA 3MGUA 3J9SA 4QT6A 2XKPA 1O4YA 1ZBA1 1LU1A 3HBZA 3VZNA 3ZFGA 4YW1A 1PO23 1RMU3 3OD4A 4O9EA 2AENA 3GNEA 2JX9A 5L7OB 4FQZA 2VVEA 4HETA 1RVF3 3DV8A 3ZFFB 1QJU2 4E27A 4FPOB 4I30A 2PLV1 5JOYA 3LA3A 4LBJA 4U36A 2UWCA 4UW6A 1R083 1CAUB 4JC1A 3D0JA 4M3CF 2D6MA 2Q1ZB 2MPFA 4G3YC 4XETA 2GNMA 3LWCA 1R1A2 3WW4A 4WBBA 4CEYA 1H2LA 3M7AA 4GMP0 1W2UA 3KCYA 1QJU1 1QJX3 1KD7A 1O91A 4HVQA 4AHWA 1E57A 3B93A 3MZHA 4QPIB 4FCAA 1XNKA 3RMXA 3EBRA 1MEC3 3LB9A 1H8TA 4RQPB 3UK9A 3VZMA 1R1A1 2Z42A 4YM3A 1VB2A 4XTMA 2RS53 3VBFC 2YYOA 2PHRA 4N7UA 3VZKA 2CYFA 4WM7A 3X29B 1REDA 3AZVA 5JOZA 2D5HA 1ZA4A 2O8QA 1HRV2 4IV1B 3E5UA 2R32A 4FQ4A 4AEDC 1EYBA 1HQNA 1YUDA 1MQTA 4YZ1A 1C5IA 1V70A 3WT3A 2C5DA 1RC6A 4CDQA 3AKRA 1FYUA 2YUEA 1LHUA 2X5IA 5BNOB 5J37A 5ACA2 5KC5A 1YJLA 2VVDA 4L99A 5EXOA 3ELNA 5J7MA 3SXWA 1A6CA 2NMOA 1VAKA 4L92A 4PBOA 1APNA 5BNPB 4E2SA 3WZ1A 2QQPA 3OPZA 1LKNA 3RYPA 1HRV1 3OBTA 1AR92 1QXPA 5F5QA 5E88A 3MW3A 1I6XA 2R49A 4LBOA 2H6BA 2MHFA 1ZZ6A 1MVEA 4Q2FA 1O4ZA 5CG8A 2D98A 1X8EA 5ACA1 5KWRA 1GNZA 1PNGA 4G9SB 1HIXA 1VBA3 2D44A 4QGMA 4WV8A 4AQ6A 1WMEA 1DGRA 1B35C 3I8TA 4LO7A 4JAAA 1IS5A 1GKBA 1AR91 4PDWB 1QH7A 2WJSA 1IS4A 1NQDA 4K7JA 4IV3B 5T5JA 1UW8A 3CF6E 1NXMA 4ORFA 2BFUL 4XIKA 1AJOA 1HDKA 2A6VA 2HYKA 5F9TA 3OF1A 1AF9A 4Y20A 1AL0G 1RVF2 4RSUA 3UL2A 2JICA 4HPKB 4B4PA 2DCZA 3R4SA 2G4IA 2X8KA 2ZJCA 5JMCA 4HBNA 4NO4A 1R082 1WBLA 3PMSA 4UBGA 5H9RA 5L7OA 1V00A 1I5ZA 3U10A 4YGDA 3QBQA 2R0FA 1MS1A 2D43A 4NHKA 2WT2A 2RS11 2Y26A 1CAUA 1ZX5A 1H0BA 2NPIA 3MW4A 1VBB3 2IC1A 1R081 5KHGA 1O3RA 1NLRA 3AP9A 1UX6A 4OI0A 2WLPA 1AXYA 2NLRA 2ZGNA 4XMIA 2JXAA 2RS52 2ZHLA 2IFWA 4AF9A 1EAH3 2BNNA 3AXDA 4XQDA 3VKFC 3R0RA 1WCSA 4RHV3 2PFWA 1NYWA 3OCPA 4QHBA 4BMBA 1TNFA 4RQPA 4XDQA 2TUNA 1KXGA 2JKBA 5JOWA 1URXA 4HVOA 5T5OA 5KHKA 4HSLA 2NZ9A 2D6NA 1YFYA 2RS51 4FOVA 1O5UA 2ZS6B 4IV1A 1PIV2 1Q8QA 3HMYA 4YG0A 3BB6A 4I3PA 1JN2P 4FXGB 3ZSEA 1J3PA 4CRQA 4URTA 1TEIA 1NQJA 3CNAA 2XJRA 3H1YA 4WVMB 5BNOA 1FNZA 4LLOA 1GICA 5A3MA 3IDEA 2XJSA 4YZ5A 2DU0A 2R0HA 3HAGA 5JR7B 4LE4A 4DNYA 4H55A 3H3UA 1RUJ1 3MICA 1NE4A 1PIV1 4FVVA 3E6DA 1DIWA 5CFCB 5JOXA 4HKOA 1BXHA 3WW1A 3ZX7A 5E8AA 2B39A 4N9IA 3AYCA 4AQSA 1HV0A 1QXJA 4NWWA 2XJPA 2QDRA 4GH4C 4Y22B 3VBSB 3WG3A 1WCDJ 2YDEA 1YIFA 4XJ9A 4META 2MNGA 3USUB 5JZGB 2ZAHA 3ME2A 4DFSA 3J8F3 1OQDA 1ZYBA 2BFUS 2WA3A 3SHRA 2VXRA 2GN7A 4PDWA 4FBFA 3PTYA 2VNOA 5BNQA 2AR6A 3ZO0B 4IV3A 5EJ3A 3WR0A 5H9SA 2ZHMA 3QLQA 4IEOA 2XL7A 2WKKA 3WV6A 4Y4YA 3AZWA 1V6KA 3FLPA 1G9AA 1OQEA 3H3ZA 1A8DA 1AYM1 1PNFA 2IWGB 2QCSB 4AWDA 2ZX1A 3POWA 3AP5A 3WINE 1MZ6A 5KC6A 3SCFA 1ND3C 2H0VA 2OUHA 2HWC3 3E6BA 1SACA 1VAMA 1MVQA 5CNAA 1F9KA 2LALA 2DUOA 2N7GA 1VBB2 4OHYA 3N36A 1IKPA 3AMPA 4F7ZA 4W6YA 3ZVXA 4RD7A 1VBD3 4Q0SA 5IT6A 3MIHA 4MSVA 5LK7B 3EXUA 3MLJA 3AP4A 5D1IA 4L11A 4AEMA 3R05A 1VJ2A 4MGKE 1EAH2 5J96B 4B7EA 4NHMA 1XE8A 5BUVA 4RHV2 1NA1C 5CB7A 2EAAA 4M00A 1RUH3 2C0ZA 3ZFGC 2V73A 3WDVA 5SV8A 5IK5A 1OQ1A 4YRDA 2A73B 3CJIB 1FOD3 4Y1YA 1FV3A 5F6LB 1EAH1 1XE7A 2OPKA 1G86A 2ZCWA 1WW7A 4FPLA 1C3HA 4RHV1 2YY1A 1SCSA 1FV2A 1HV1A 1MS9A 2D40A 3AYDA 3LOBA 1SBDA 1XRUA 3FE5A 4KGQA 1O3QA 2A70A 4PF5A 4FPGA 1R093 1VBE3 3M4FA 4DY5A 1O5LA 3NO8A 5CAZA 5SV5A 2WZR3 5H9QA 4CEYC 3TRSB 4AI3A 2JDZA 4J1XA 4JTOA 3AMMA 4BHPA 2Z79A 1RJ7A 2VW2A 5FOJB 4WVMA 1J3RA 4MXVA 4OLLA 5IK8A 4XFHA 1UKGA 4N9HA 1QGLA 2RJLA 2A75A 1WD4A 3O14A 4UW3A 4BZ4A 1H8TC 2UURA 4N90A 5CFCA 1SQ4A 3J8F2 3V0BB 4MYEA 3SH3A 5JIAA 3VKNA 2WL1A 1ZM1A 4WM7C 4O9GA 4HKLA 4Y22A 3VBSA 2Z5WA 4EN8B 4F3JA 4LBLA 1OD5A 4K6BA 4Y1XA 1A78A 1MQTC 1RJ8A 1VIWB 5JZGA 1AUYA 4CDQC 3S30A 2H0BA 2HEYF 1TNRA 2OVUA 2X5IC 1SBEA 2HEWF 5CVRA 1UIKA 4IEUA 3J8F1 4LUKA 5KXDA 2YHJA 1REFA 3MLLA 3VBHB 5C8WA 3JB8A 4S2DA 3M70A 2HWC2 2WLQA 1Q3EA 4QQPA 3UKVA 3WX5A 1MR5A 5HI0A 1YFWA 4Q27A 2B8MA 3VZJA 2EXIA 2OIIA 4AHXA 3N7KA 4IEZA 3H9AA 2B42B 2RJKA 1VBD2 4E9KA 1MZFA 3N3HA 5LEKA 2R1BA 1LOCA 5BPXA 2VECA 3ZIXA 1S55A 4K1ZA 4Z8BA 4AXOA 1NZCA 3TN93 4QQLA 2HWC1 4H7LA 3ZN5A 3B01A 1AXZA 4COWA 2R1DA 1RHI2 1W6QB 3GBWA 1RUH2 4LHKA 1BK1A 4XHXA 3SH4A 2VUJA 3DF0A 1PVC1 4XF4A 3EO6A 1K5MB 2QDNA 4LA2A 2GN3A 2JG8A 3JU9A 2ZX3A 1FOD2 1LULA 1JW6A 2PHXA 1Q8VA 4CZSA 1DGLA 2ZKNA 4AI0A 1WW4A 1REEA 2I07B 2ZGPA 4RA0A 4YZ3A 3VKOA 1AL23 1RHI1 1RUH1 2FZ1A 4MGZE 3QH6A 3CJIA 2BVBA 3A0KA 4Q8LA 5L7OC 3WP3A 4AVAA 5C9AB 5JPNB 3C2UA 1LODA 1VBE2 1DU3D 1JYIA 3I7DA 4Q0QA 3PVBB 1FOD1 3HD8B 3MYXA 4OHZA 4I01A 4YW5A 4MH0E 4X8NA 1S0FA 3RS6A 1ZBA3 2YZ4A 3OY8B 5AFBA 4P9IA 3U07A 4OZXA 3MIBA 1VRH3 2ET7A 2D3PA 3AM2A 5FLJA 4XMAA 1XNDA 2NQYA 4GA9A 1BMV2 3OYWB 1S1AA 5A33B 1XXNA 4XHBA 2EXJA 1M06G 4P9WA 2ZGKA 5AC93 2PLV3 3WDWA 3TNPB 1ZBE2 5JVVA 3GHMA 4Q1PA 2VULA 1AX2A 3PJYA 2B9UA 4MGIE 4AG4A 1RUF3 1PZ7A 3SLIA 2XKOA 5FPZA 1C1LA 1BMV1 3FFZA 2HEVF 3V0BA 4AYUA 3WDXA 1YHFA 3ZMOA 3GF6A 3ZSKA 1YWKA 1GV9A 3CO2A 3KZ4C 4DRVA 2CAUA 5BNNB 2ZMLA 1UN1A 3C3VA 1OLQA 4HN0A 2WIIB 4IV1C 5FO9B 4IETA 4YVSB 1ZBE1 1C8M1 3ASIA 1RGSA 4XFAA 3AKPA 1X33A 2E7AA 5FO8B 4CDWB 3WDTA 4Q4X3 4Y1VA 4XJZA 5BNOC 2BNOA 3IM0A 4AI1A 3VKLA 1ZZ8A 1V6IA 3VBHA 4GKXA 1QWRA 1IPJA 3NV3A 1LGNA 4Q4Y2 1YI9A 1AR63 1U5IA 1QOOA 3WDUA 3NV2A 3TN92 2ZGOA 4BA6A 3FHIB 2Z2SB 5GZEA 1WMFA 1FPN3 4AFAA 4D3WA 4QU2A 1RITA 1ZRCA 4K1YA 3TB0A 4BE3A 3FX3A 2ZGUA 2A7AA 2VQAA 1U5YA 4W6WA 2YC0A 2BTVC 4LBNA 5K0UC 2DUPA 2XWBB 3ILFA 4Q4Y1 5CU1A 1ZRDA 5FQ0B 2VOVA 4PDWC 4KWJA 1SMVA 3TN91 1HRV3 4LT5A 2NN8A 5I0TA 3S0MA 2PQQA 4IV3C 5LEJA 2HKXA 1AL22 1QY4A 4J1WA 4LBQB 1KDMA 1PMIA 1K5MA 5JI7A 1VP6A 1AZDA 3LSEA 3WQ1A 4HSJA 5DDJ3 2ZX0A 1C28A 3AYEA 3DL3A 5ACA3 1MS3A 3VBOB 4QMAA 2DFBA 2P17A 4XZPA 4DRRA 2BBVA 4YW3A 3VBUB 1QDOA 3NVCA 3PHMA 1ENSA 3RWNA 4BCUA 2JG9B 4XFFA 3KM5A 3VL8A 4ASMB 5C9AA 5IK4A 3AP7A 1ZBA2 1AL21 4X6QB 2GNTA 4JVAA 1AXKA 2Q8OA 1VRH2 3RI8A 1RUE3 3VBRB 2E6VA 4CDUB 1OFNA 2Y0IA 3OTFA 4YG3A 2PHDA 3O0VA 4DQAA 4FPYA 3OY8A 3K51A 4XW3A 4INDA 4ISRA 5AC92 1EPWA 1ZVFA 3AFGA 4M3CB 1WMDA 2WINB 1VRH1 3MPPG 5A33A 2JJ6A 3B3QE 3J4UH 4GWMA 1RUF2 4HK8A 4MVTA 4M0HA 1MZEA 1RUD2 2R071 3FUOA 2RS13 1LB2A 1NCRB 1CAXB 5AC91 3V56A 3VHPA 1SLBA 3APBA 5T52A 3RDIA 3RQ0A 4FT8A 5C8CB 2KA3A 2PAEA 2O8OA 2ZZJA 1XNCA 1NOVA 3T2TA 4P9GA 4Q4X2 1RUF1 4FXKB 4CDXA 5BNNA 2CV6A 3CLPA 1RUD1 2ARXA 3GBFA 4SLIA 4KL1A 4BLJA 4HKWA 4YVSA 2AUYA 2GZWA 1DZRA 5DG2A 4A2UA 3MEPA 4MGYE 1J1TA 2VNRA 2YROA 3IWZA 3WP5A 4CDWA 2VY0A 1AR62 4PCRA 3SH5A 2PHFA 4LE3A 2B7YA 4IESA 4TSVA 5J3UA 4K21A 1FPN2 3NSTA 1EPZA 4Q4X1 2DURA 3AX4A 1T6GC 4OFGA 4FPEA 2E63A 4QM9A 3LGRA 2O0OA 3K48A 5CFCC 3NAPB 3ZFEB 1H2MA 2AGSA 4R9DA 3WCSA 1AR61 2ENRA 4OUSA 2ZGQA 3RRDA 4AEJA 4NWVA 5DZEA 2YGLA 3VBSC 3URFA 1FPN1 1JTZX 1WLCA 2Q5TA 1S0EA 4YVWB 4FPCA 2WNUB 4TLFA 5JZGC 1NCQC 3DPRA 3SITA 1UCXA 2VOKA 5DDJ2 5FQ0A 2IXHA 3D82A 1D4M1 4LTAA 3N7MA 4QQ2A 5AVAA 1RUJ3 1PIV3 3AB0A 1MS4A 4DMIA 4Y24A 4XFBA 1VBC3 3RG0A 3EQEA 4LBQA 4OHXA 4OULA 4BM8A 3ZXKA 3MIEA 2OZJA 3NKGA 5FOBB 3ZXLA 1C57A 2TBVA 4P9XA 5CFDB 4WM8B 1JOJA 1QQP1 4PLMA 3VBOA 3M3CA 1RUE2 1CN1A 4FTEA 2AYHA 5DDJ1 3VBUA 4YW2A 4GWNA 1TME2 1JXNA 1ND2B 1J3QA 3WG1A 1JUHA 1S0BA 1SLAA 4XTPA 2XL9A 3DN7A 4KQ7A 3WP4A 1S2BA 5IK7A 2IXKA 2QUOA 1W6MB 3JZVA 4CDUA 1AR82 1VB4A 1EP0A 1RUE1 1F5JA 1DZQA 3LCPA 2P34A 4AHYA 4IEWA 1AYM3 1TME1 4UW4A 3ZYJB 3AYAA 4IQPA 1QOTA 2JG8C 4PLNA 4JV4A 4L97A 2RS12 4M3CA 3HT2A 3HQXA 4C1XA 1PK6B 2ZX2A 4Q1RA 1UPSA 1NY72 4JDNA 4XXPA 4YGBA 4BMEA 1AR81 4KG8A 1JHNA 1YI7A 2QKDA 1OFSA 1UL9A 1BJQA 1JUIA 3U0ZA 1N1SA 3CJIC 2GALA 4PJYA 4DINB 4W65A 3ZFFA 1NCRA 1LESA 5FLIA 3W9AA 1CAXA 4XBLA 5JI9A 5EV7A 2OZ6A 3JBG2 1N1VA 3M3QA 5C8CA 4TYSA 3NL1A 3FLTA 1OHFA 1NY71 4KBBA 1D2QA 2D5FA 4UXAA 3WCRA 3FFQA 4XJWA 5GZDA 2BVVA 4CEWB 2D97A 2K0GA 2A6YA 5JCTA 2JECA 1ULCA 1WLTA 3BOPA 1C4RA 2OW4A 5KBFA 3JBG1 2GC2A 1COV1 4QGNA 4QPIA 2V5YA 2E53A 1IS6A 2VNGA 3ZSLA 4LO8A 4COUA 3KT7A 2UU8A 4P9YA 1Q8PA 1DBNA 3B69A 1C5HA 2KM2A 3NAPA 1FMD2 1L3JA 3MIFA 3ZFEA 1JBCA 4JGZB 4FO9A 2TNFA 4LO6B 2GMMA 5I8SA 3WHTA 5J98B 1DFQA 1RUJ2 3JD73 3H1WA 4B4QA 3THPA 1VBC2 2GC1A 4YVWA 3VHRA 5C4WB 2WSVA 1GR3A 1W6PB 3WNXA 4ATFA 2GU9A 1GZWB 1NXD1 3N7LA 4DY3A 1M4WA 4OVEA 1DQ4A 1FMD1 4COVA 1W6OB 4FPHA 5I8YA 3B9CA 2RS33 2Q30A 1ZZCA 4YM1A 1OSGA 4KGGA 5BNPA 4MV2A 3VBHC 5CADA 1KFUL 4ZU4A 2ZGTA 4TZDA 3MPBA 4D69A 3IBMA 4N43C 1N3QA 1VBC1 3OBRA 5CFDA 3T1LA 4WM8A 2B45X 2WC2A 1SBFA 4FOYA 4C0BA 2W08A 2CY6A 5T3NA 2NYYA 2ZAAA 1CGPA 1AYM2 3AMHA 3LOIA 4I3GA 2BWCA 4DXZA 5HCAA 1CR7A 3R6SA 1W6MA 2F6BA 3FMGA 2A3YA 2ILMA 1CQ9A 3QH7A 2CTVA 3H7YA 2VUAA 4C0HA 4JDOA 1FATA 2YGMA 3ZXEA 3SCGA 3T1MA 4BOWA 5EWSA 1WUVA 4I0AA 3THTA 1O4TA 2DVGA 1F5FA 2BYVE 2A6WA 1DHKB 3H1MA 4LA3A 1DGWA 4HPKA 4A7ZA 4CYDA 4Z82A 3HR9A 3D8CA 1SLTA 4WVVA 2K2SA 4WVZA 4CTEA 4AFBA 3ST7A 1DGRN 2D3RA 1SFNA 3NV4A 4IEXA 1LOEA 2A5ZA 1FX5A 5C9AC 2A71A 1WD3A 4AQ2A 1N47A 2OUJA 4ONUA 1PVC3 3I2DA 3JUUA 2DCYA 4LBKA 1IKQA 1S0GA 4Q4V3 2D6KA 2DU1A 3L2HA 1U5ZA 4RS5B 2W68A 1UPIA 2WSUA 1ZZ9A 3AZZA 4RGAA 1XYPA 1GQHA 2EA7A 2KXLA 4R8HA 2ES3A 2R30A 1QOSA 1X8MA 3UV9A 4YFWA 1RHI3 5GJ6A 4CEWA 1N3OA 4UW5A 3FWEA 3CL1A 1G7YA 3AK0A 3WG4A 4K3UA 1Q5OA 4YYOA 1LU2A 5KHJA 2DV9A 2XLFA 1DYPA 1AJKA 2SLIA 2XJUA 1G9CA 3JD72 2YPJA 2CGNA 3QACA 2ZGMA 3PVEA 1JH5A 3PVNA 2DVFA 1XNBA 3MF9A 2C9AA 4AFCA 2WS92 5CA6A 1IZ3A 2CL2A 4JGZA 3DUIA 4CDXC 4G4FA 5F6KA 5BNNC 2RS32 1LEDA 1YLLA 3NKTA 1V6MA 1Q43A 1ULFA 4R9CA 4XFCA 5C4WA 3JD71 3KD4A 2DCKA 1DF0A 1W6PA 1SFYA 2MEV1 2XVLA 1G9BA 1GZWA 4H3WA 4Y5Z0 4NOTA 4X6RB 2WS91 1QJY3 1W6OA 2Y0OA 2E7QA 4ZXKA 5JSPA 2VW1A 3GZTB 1N1TA 2RS31 2RHPA 3MFAA 3POSA 3WW2A 1PM7A 1ZBE3 1C8M3 3AJZA 1SDWA 1OI6A 4FOQA 4S2HA 3WG2A 1KS4A 3ZXGA 3A0NA 1D0HA 1SLCA 1FAYA 3USUA 5BYNA 2UYBA 5EZWA 2XJVA 2VG9A 3UKTA 2OYZA 3DPRC 5HBAA 4EROA 3AMQA 3ZN6B 4IEYA 1OKQA 1OA3A 2Q4SA 2AH2A 4EN0A 3H8UA 4A7YA 5HCFA 3VBOC 1PVC2 2VW0A 3ZYPA 1YXWA 4Q4V2 5KXCA 3VBUC 2B5HA 4AVVA 4Q4Y3 1DDLA 5FAXA 4DOUA 4E2GA 5A32B 3WOGA 2HWD3 2BGCA 1ZZ7A 2E9QA 5DZGA 3ZXJA 4XF3A 4AQTA 3KMHA 1NLSA 3KCXA 3ILRA 4YZ2A 4RS5A 3H50A 1BCXA 3VV1A 2QNKA 2UWBA 4Q4V1 3B02A 3H7JA 1PHMA 1H1AA 1A3KA 2GMPA 3WVJA 2CNAA 4OI4A 1WLWA 2PHWA 1GANA 1X50A 4JGYB 1IOAA 4QX5A 3KT4A 2BNMA 1WW6A 3FZ3A 3ZYIB 5K9YA 3LZZA 3WHUA 1U0AA 3KT1A 5GLUA 4BIOA 4K20A 1ENXA 4PIXA 1PVXA 5JSOA 2XWJB 4HLTA 3ZFFC 1NCRC 2FHRA 3PJQA 2FMYA 4P5HA 1KJLA 2WZPP 3L9JT 1POV1 1QH6A 3L2YA 2GDFA 1CPMA 5C8CC 1YO8A 2R16A 3O0XA 1ND3B 2R6QA 3I54A 4E4SA 4CP1A 3N35A 4C90A 4FSJA 4R9AA 2LM3A 1CX4A 1QJY2 2ETEA 3IPVB 2E7TA 1XYOA 1I3HA 2IXCA 1XYNA 2R073 3BOWA