3LB9A

Crystal structure of the b. circulans cpa123 circular permutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
b'ATFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVWGASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Circular permutation of Bacillus circulans xylanase: a kinetic and structural study.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 45
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3lb9A00
1XYPA 1OLRA 3VL9A 3AKPA 3MFCA 3AMHA 3WQ7A 3WXPA 3AKSA 1T6GC 1H4GA 1H1AA 2DCZA 2NQYA 1PVXA 5HXVA 2QZ2A 1OA3A 1UU6A 3AMNA 4XPVA 1OLQA 3WP6A 2BWCA 2DCJA 1H0BA 4NPRA 1H8VA 3WQ1A 1UU5A 1KS4A 1XXNA 2QZ3A 3AMQA 3VZLA 2BWAA 3LB9A 3AMMA 3MFAA 3AKTA 2VG9A 3VHNA 1W2UA 4S2DA 5K7PA 3AMPA 5K9YA 3VHOA 2B45X 3MF9A 3VHPA 3ZSEA 1HV0A 2DCYA 3B7MA 3VZNA 2D98A 2JENA 3WP4A 2NLRA 2DFBA 4S2FA 2JEMA 2BW8A 3M4FA 1F5JA 1REEA 1XNBA 5EJ3A 3VZJA 1UU4A 2DCKA 4S2GA 3VZMA 4H7MA 3B5LB 3LGRA 2VGDA 1QH7A 2VULA 4HKWA 4XQWA 1AXKA 1BVVA 3RI9A 1OA2A 1H4HA 1REFA 3WP5A 3VZOA 2F6BA 3WY6A 4HK9A 1XYOA 2VUJA 3VZKA 1XNKA 4XQ4A 2B42B 4HKOA 2C1FA 4HKLA 3WR0A 1OA4A 4HK8A 4S2HA 3VGIA 1REDA 1M4WA 2Z79A 3AKRA 4IXLA 3WT3A 3AKQA 1NLRA 3VL8A 3WP3A 1TE1B 2JICA 3VLBB 2DFCA 1XNCA 1C5HA 1C5IA 1KS5A 1UKRA 1XYNA 1IGOA 2BVVA 2B46X 1BCXA 3O7OA 4XQDA 1YNAA 3HD8B 1HV1A 3RI8A 3WX5A 1HIXA 3EXUA 1QH6A 1ENXA 3MF6A 3WQ0A 2D97A 1XNDA 1BK1A
chains in the Genus database with same CATH superfamily
4WM7B 3MIHA 4JHZA 5C4WC 4N53A 1AR83 3VDCA 5K8SA 5EIYB 3CF6E 3LDBA 3NAPC 3X29B 3WQ7A 3ZXDA 5GZDA 2LROA 4DRVA 4MGSA 4HLTA 3NV3A 5L73A 2XJQA 3AL5A 4QM8A 4K7JA 5FKCA 3C7FA 2IUWA 1UAIA 5FLJA 5IVEA 4MXWA 3WF3A 1H0BA 4EWAA 4FT8A 1UZYA 1QJU1 4CDUA 5CADA 3VBSC 1JOJA 2DU1A 2P1BA 2OQ7A 1QGLA 1GWMA 2VL4A 2ADEA 3LE0A 4PCRA 3EYPA 3R4SA 3AMMA 3KT1A 1W9FA 1PGL1 3VKOA 1VRBA 1DIWA 4JHTA 3ZXFA 4GKXA 2RVAA 1W2UA 2BP6A 1VBE3 4HMZA 2AR6A 2P6CA 1XQNA 3I2KA 4JKKA 1AL22 3OPWA 4K8FA 2XUMA 1ZZ9A 2G9FA 3VDDB 1JYIA 2FCTA 3UJQA 4DB5A 5KHGA 3JQWA 1LAJA 2D98A 3VDAA 2H6BA 2ZEXA 1DYPA 3THPA 5GZGA 1CQ9A 5ISLA 3BTAA 1GNHA 2HWD2 2VNOA 4BQWA 1JUIA 1S0EA 1GNYA 1AR61 1REEA 2DV9A 2QBXA 2WZR1 2AEZA 2GC3A 2IFRA 2HWF2 2QQVA 2ZGQA 3NRUA 4URAA 3POFA 2H6CA 3H8UA 3SKJE 3O1SA 4CP2A 2WNVB 1JOPA 2VQUA 3PHMA 2O14A 1HXS1 4AI9A 3I2IA 1TME2 3AP5A 4QX2A 4CCOA 4FPKA 2YZ4A 1CPMA 1ASJ3 1QH7A 5JI7A 1RVF3 5E16A 2ID4A 3ENRA 3AXEA 3RZZA 1VB2A 1QNYA 3KM5A 1NYWA 4XFIA 2BDRA 3VKLA 1PX3A 1AR91 1K12A 1MVQA 3M3IA 1UYXA 4CPBA 3LDKA 2WLQA 5DN2A 4OQ8A 4H3WA 1HB3A 3EHKA 2W1SA 4LITA 4GIQA 2BGCA 4MX3A 3S7EA 2Q8EA 4E2GA 4M3CE 4YGCA 1G6NA 2G1MA 1D2SA 4HKOA 4PI2A 4AI0A 4IGPA 4W4ZA 4XHXA 1F2NA 3J7LA 5F9TA 1VBC2 3RQ0A 2ZAHA 1J1TA 3GZUC 5FZOB 2XVLA 4K1ZA 1HRV2 2EIGA 4WM8A 5FZ0A 1DU3D 4QX5A 1W90A 3BPZA 4QPYA 4XJ8A 5DZFA 3DV8A 1J84A 1EP0A 1H8TB 4WVMA 1N1YA 1YYNA 2MEV2 5FWEA 1NE6A 1W6OB 4NRQA 4Z1VA 2VZQA 3K46A 5J36A 3J7HA 3I2JA 3NJZA 4QX0A 5DQ0A 1QMJA 1ULFA 1W9WA 1HIXA 3T0DA 3NNGA 4EV0A 1PM4A 3WCSA 5KHKA 5ACA2 2GNTA 4G9SB 1AVBA 1G7YA 3HOBA 4ZS2A 2XKOA 3WD5A 1XNDA 1V9U3 4A45A 2AC1A 1D4M3 4JGYA 1W3VA 4BH9A 1OLRA 3Q8AA 3HQRA 2YHJA 1OQ1A 2JE7A 2VMFA 1ALYA 5KWRA 4KG0A 1H9PA 4LHSA 4B8EA 2IXIA 1YQCA 1ZA7A 4HPKB 1V00A 2J1AA 4QDQA 3OGSA 1JH5A 5BY5A 1UU6A 3PVBB 4EE2A 4L9BA 3VD4A 2WA3A 2WFF3 3CZUA 4XF4A 3TYJA 4E4HA 5HCBA 3WG1A 3D5OA 1L7LA 1UU5A 3E97A 1RUD3 4K21A 1SLTA 4QKNA 3S6PA 1PVC3 4IUGA 4FAGA 1CAXB 4V1PA 1XC6A 4UFMA 1NG0A 3PL0A 5FMCA 3J7NA 3VBHC 3ZN6A 3OTFA 5IVBA 3PTYA 4AWDA 2ZGRA 1LCLA 4FI9A 1WLTA 1SLAA 4Y24A 1IPSA 1QJEA 1AYM3 3S30A 5CFDC 4IE4A 5A3UA 1O3QA 1L7RA 3TRSB 2Z4FA 3MGUA 1PGSA 5FZGA 4E2QA 4DO0A 4COZA 4DNYA 2XBO2 3M4FA 5A70A 3HMYA 2HWD1 3GF6A 3ILRA 4AFAA 4GJYA 3JU9A 2A3WA 1RUH2 1OOPB 2WJSA 1UL9A 1VB4A 2ZHKA 5EYXA 2HBTA 1I9RA 4X6QB 3U75A 4WV8A 4E2SA 3U0ZA 1XU1A 5GM0A 3A23A 4YZ1A 4XHBA 3WNXA 1PHMA 5C3OA 1LGCA 4HOOA 2R063 3RZGA 1TME1 2IXHA 4D6RA 4O9GA 4GB32 3UKNA 4HG6B 1ZRIA 3HAGA 4XQWA 3WUDA 3KV6A 4GULA 5JDBA 1JYVA 5FQ0B 1ONAA 1X9TA 4CYDA 3PU8A 5FWJA 4LOSA 2VZVA 2P37A 3QOPA 4QXBA 5F39A 4E4ZA 2WWJA 5C8CA 4WVVA 1X8EA 1QJX2 4YM1A 5GKAC 1NOVA 1O59A 2WDBA 3FHAA 2JIGA 2VOTA 4CCKA 3DF0A 4MHRA 1W9YA 4XCAA 1KFXL 1VBC1 3ACIA 5IK4A 3OD4A 2RDNA 3KQRA 1HRV1 2ZGSA 5L9BA 2PAEA 5A7PA 5GZEA 5IVJA 3VL8A 4WM7C 3ZM8A 3WP3A 1T6BX 2LM3A 4N7IA 1FI2A 4XFAA 2WYSA 4AL9A 1J59A 4YGEA 1VPHA 3RGBA 4KMQA 4AQ6A 1LHVA 3NWKA 1M06G 1LNSA 3RI8A 1VAMA 3K77A 5E89A 4LBQA 1RL3A 3F95A 3BN6A 3ZXGA 3IPVA 2C5DA 3B69A 4Z07A 1LB2A 3EO6A 4I0BA 2NYYA 1CN1A 2XKPA 5ACA1 4IV3A 4I3PA 4G3YC 4RR3C 4I0WB 1FPN3 3VKNA 5J48A 4AVCA 5FZMA 5FJKA 2CAVA 2ETEA 5FXXA 1G9FA 4QB2A 2DF7A 2B8MA 3LD8A 1OVPA 2CDPA 1YQ2A 2R49A 1ZRFA 3VDDC 1NX9A 3O0WA 3H8OA 3LPFA 1OD3A 4CRQA 5AFBA 2NQYA 2ZA9A 2N7GA 4GQ7A 5HXVA 3BYWA 3E5QA 3AMNA 2VMHA 2RR12 3LF7A 4JRAA 3H1YA 1Q5OA 2HWE2 3DPRA 4LR4A 2Y0IA 3ZIWA 4AI1A 4E9KA 4O65A 2J1UA 5FZLA 1H8VA 1UW8A 1DQ4A 1GUIA 3PVNA 5C8WA 1TEIA 3BB6A 3CU7A 5E6HA 1SQ4A 4LHKA 2QZ3A 3WNKA 4AFCA 3MLLA 4GA9A 4CXWA 2WQ8A 4YW3A 5FPAA 3N7KA 5F6LB 3LFIA 3T3YA 2XLFA 2X5IA 2ZGLA 3C7OA 2WNVC 4Q4Y3 3SITA 4QDRA 1NLSA 1C8M1 2VTXJ 4CPBD 1W39A 1JYWA 1NZCA 2WT2A 2HWC3 4AF9A 1WD4A 4CP0A 3H7YA 1IS6A 4YZ4A 5CAZA 3VBUA 2VMDA 1RUE3 2TEPA 4XILA 2JG8A 2XVGA 4S2FA 3K3OA 1JBCA 2BW8A 3FUOA 3A0KA 4AHWA 5FOJB 1AYN3 2XBO1 3JCIA 4XDQA 5A3PA 4A41A 1NA1A 3WW2A 2WNUA 4W65A 3LEGA 4Y5SA 4LT5A 3AL6A 3PUAA 4RFT0 2YROA 5FMOS 4ZXEA 5TSWA 4BLJA 1YQ5A 3ZKYA 3O0VA 2X09A 1ENSA 3IZOA 1KRIA 4HONA 5IK5A 3BUCA 5LBEA 3MPBA 5FP3A 3J4UH 4GB31 5FYYA 1TVGA 1BVVA 3WDTA 3WF4A 1H8TC 5IVCA 3LOIA 2E7AA 1GZ9A 1Y9QA 3A0NA 4D7YA 5JPNB 1YWKA 4QXHA 1RUJ2 5F8PA 1YCIA 5F5QA 1ND3B 1HRI3 2V09A 2EAAA 3HNBM 2RDQA 3THDA 3H9AA 5EP9A 3CL1A 2QQJA 1R082 1QJX1 4COUA 5GLVA 1KGYA 2YXSA 2JWPA 3ILNA 4AYUA 1OA4A 2RG4A 4HK8A 4QHBA 5A33A 5A7OA 5A1FA 4XBNA 1PZ8A 1YQ8A 1YIFA 4ASMB 2B5HA 3NJVA 4IXLA 1SZBA 1MS4A 1UNBA 2CY6A 2TUNA 2ZEWA 5DUUA 1W9TA 2BERA 3OG2A 3PMSA 3GHMA 1C1LA 1CAWB 3T1LA 2ERFA 1PK6B 1BBT3 1C5HA 3CJIA 5IATA 5IJRA 4NPLA 3KWVA 4OI2A 4GWNA 3JD72 1OPMA 2X10A 3I2GA 4ET7A 2RS11 1VBA3 1X9PA 3WNLA 5DZEA 1VE0A 4M3CA 3O12A 2AGSA 2FDGA 1WLCA 5AC93 4Y1XA 1Y9GA 1A6CA 3WHUA 4CSWA 2C6SA 1W28A 2QDNA 2GC1A 2XJTA 3VHRA 1H2MA 4JDMA 4QHOA 1K42A 1NCQB 3RVHA 3HT2A 1GZCA 1UX7A 4Y4YA 1VRH3 2VVDA 2Z2SB 3VL9A 3ZFEB 5JOWA 4GWMA 2OUHA 2ZGNA 4ZXKA 2R043 3MDPA 2ET1A 1HN1A 3AM2A 2W87A 3OEAA 1H4GA 2VZTA 5GLUA 4L99A 2D6LX 4LBOA 4D6SA 1UY2A 4N9IA 1MQTA 1S2KA 3N9QA 1VAKA 5FRAA 5LA2A 4Q29A 2YGLA 4YVWA 2RR11 2HWE1 5FXWA 1Q8QA 3MHZA 5FP4A 1JHJA 3IIIA 2H0BA 2W52A 3AMQA 3G6JB 1OOPC 4I3GA 3I3QA 4Q0PA 3WG4A 4BLIA 5F5CA 5T5PA 3AFGA 4AFDA 4J25A 1E5IA 1XSQA 2PQQA 3J8F1 1DQ2A 3VD7A 5K7PA 4QM9A 4R9BA 1O3SA 4EZHA 2GALA 2BGPA 1XOYA 4FPCA 5B2GB 5FY4A 4EZ4A 1GQGA 1DG6A 1WBFA 4LEJA 4A42A 5J1XA 1RUC2 3DKQA 3RJRA 3WP4A 2EVXA 4CCMA 3POBA 4AVTA 1SFPA 3NL1A 5J37A 2ZHNA 4PDWB 4F3JA 3ZSKA 4BQYA 1ZRRA 4XFFA 3HBKA 4K40A 5I0RA 3R6SA 2I2SA 1D0HA 2WWUA 3N9NA 2J1RA 4PJYA 4W8JA 3TB0A 2QJVA 5BNQA 5BNOC 5FZIA 1F35A 1C8NA 4XC9A 5H9SA 2LRPA 2AZ5A 1NCRA 3W5NA 5BNNA 1VR3A 1ZVFA 2ZX1A 3TN92 1R64A 4N7UA 1POV3 1IPJA 4PLOA 2QCSB 4RA0A 3AVSA 3W59A 1DZTA 3OBTA 5LW9A 3WF1A 4AQSA 4LBQD 5JIAA 3RI9A 3S0MA 1JTZX 1OA2A 3IDAA 5FYCA 1ZZ8A 5HCAA 3PU3A 1V70A 5JOZA 4PLMA 1RUJ1 2FD8A 2A3YA 1LOCA 5FZBA 1HQLA 2EALA 4NROA 5E1RA 4TSVA 3RMYA 2B42B 3VN4A 1ZBA2 3POEA 5LK7B 4RYDA 3RYKA 4MV2A 1R081 4DMIA 5L36A 3UT0A 3KS7A 1CJDA 3K51A 4AW7A 3ES1A 2K0GA 4BQXA 5D21A 1FOD2 1UD1A 3ABZA 4MGQA 3MUZ1 4QGMA 1GZWB 1RHI3 2OVUA 3AYEA 4YYOA 5ERLA 4DXSA 1WA6X 1OQEA 3U11A 1WMDA 2QQIA 3ELNA 4FBFA 3S5AA 4ARYA 2DFCA 4JCKA 4X8PA 2JECA 2P17A 1G9CA 1GQHA 1UKRA 3IMMA 2XWJB 1IKQA 2GC2A 4FPOB 1E5RA 2IXLA 2XJSA 1GWLA 2BGOA 3JD71 4LUMA 1FNYA 1O5UA 4CDWB 2VZ3A 1NQDA 2Q8CA 1QH6A 2JDKA 2A7AA 3ZDVA 2DUQA 4FXGB 4JVAA 5A3MA 4OZXA 2RS33 1YXWA 2YBSA 4IE7A 4UF0A 5A3WA 5LRSA 1FXZA 1QDCA 2VY0A 4RSUA 1SCSA 4MYEA 4Y22B 2RDSA 2WN2A 3I3MA 2O0OA 3MFCA 2NP0A 2RV9A 2F4LA 2RMU1 1H1AA 3FFQA 1LULA 3HJRA 1GP5A 2EICA 4P5YA 4CP9A 5FY9A 3AB0A 4P9YA 5I0UA 3QH7A 4YW7A 2BPA2 3ZN4A 2BWCA 3PVEA 1X36A 1Q3EA 1WZXA 1X8MA 2Y38A 3LEIA 3ZLIA 4MO3M 4B7EA 4HSLA 1CAUB 2WT0A 1AR82 4NE9A 2ARBA 3AFKA 2ZGKA 3RWNA 5A6XA 1A3KA 1EAH3 1LHUA 1Y3TA 3PUQA 4QX3A 3VZLA 1XU2A 2HYXA 1ZA4A 3GHNA 3LA3A 3LB9A 4Z92B 2QVSB 4FTSA 3MFAA 2WFPA 2A1XA 4HXCA 4KNCA 2CSGA 1LGBA 4GZ9A 2J1TA 2VUDA 1Y9MA 1QQP3 4S2DA 4XJAA 1RIRA 1LU2A 3IMNA 3RYPA 5FPUA 1YHFA 4CCNA 3QD6A 5FTTC 5C9AA 3VHPA 1SFNA 1MZ5A 4L97A 3ZSEA 4UFKA 4AAXA 3THTA 1U5ZA 4AZZA 5FZCA 4Y26A 2Q8OA 4YM3A 3V0BB 1RUC1 2BV4A 3QACA 1L3JA 1OKOA 1DLCA 2RM23 1ND3C 2VR4A 4MH0E 2W1UA 4BJ0A 3BTZA 5FO9B 4KH9A 1VBE2 4FPJA 3T09A 3WCRA 1DFQA 1O7FA 2AH2A 1PIV3 5FIXA 3POYA 3LCPA 3IWZA 4NAOA 4B1LA 4HVRA 4XFHA 2XONA 4MUVA 1I1EA 1LOBA 5D1IA 1E5HA 4JRLA 3ZYPA 3MW4A 1PO21 4P9XA 2D3RA 1F4HA 3NKTA 1OBNA 1X7NA 2A6XA 4HKWA 4QPIB 4YW6A 3WLUA 3VBOA 2UURA 3Q8EA 1UY1A 1SHWB 2GZWA 1H4HA 3PNAA 4QPGB 4C1WA 1UWWA 4CDQB 4ZKTB 2P2KA 4LO8A 5L7OB 4LQRA 4AEKA 1FMD2 4NIIA 3T2OA 2ZGMA 4LOTA 2PHRA 4FAHA 5K0UB 3AVRA 3HR9A 4RQPB 1VLNA 1UZZA 2WC2A 3ACFA 2GNDA 4AOCA 3E6CC 3UYJA 2XQXA 1ASJ2 1W99A 3SCHA 1ZBA1 2WABA 5FY1A 1ZBE3 3IB3A 3W58A 3JBG3 1REDA 1M4WA 2Z79A 5FY5A 2R32A 1ND2A 2BOJA 4JGZB 3VBHB 4JQRA 3UV9A 4R9CA 2HEYF 1FOD1 1NCQC 3RWKX 4FPYA 4M3CF 3M3EA 3GJBA 1FATA 4Y20B 3ZFEC 1W0OA 3ZFFA 2XLGA 1GP4A 2PAMA 5T5LA 4BDVB 1RUI1 3FLPA 2DTYA 4NMIA 4KWKA 2AUYA 5IUQA 1SPPB 3BVCA 2DCTA 2EA7A 2QQKA 3I59B 3LOBA 3WQ0A 2ZX3A 1UOGA 2GU9A 2KD7A 3P5BA 4WVWA 2W1QA 5A7WB 1G9DA 3MZHA 1V6JA 4DUWA 4ZPIA 2V5YA 1OUXA 1W9SA 5GZCA 2PQSA 3AYAA 1JS9A 4V2WA 2D3PA 3GZTB 2EAKA 4Z2WA 3TNPB 1WCSA 2ARAA 4KL1A 4P9IA 5B4XA 4AK3A 2YYOA 2E26A 1A34A 4K6BA 1LU1A 5FZ3A 1RUF3 1WGPA 3O1TA 1UF2C 5ABJB 3WNMA 5FPBA 4N43A 3OY8A 1WCKA 2WRAA 4XOGA 2WS93 2DCJA 4QU2A 4KU7A 5FPZA 4KG8A 4PDWC 2OW4A 3M3QA 1URXA 1XBFA 2Z5WA 1E5SA 5JLVA 1W6QB 5FYMA 3ZYIB 4RGGA 3KSCA 4CDXA 1GMMA 4NRMA 4A3XA 1JODA 3OGGA 3OCPA 1BK0A 2XL7A 2VZPA 3AXDA 3GJAA 3I2DA 4IV1B 5KHJA 4WZCA 5A6YA 1QJY3 3IBMA 2XJRA 2ARXA 2YFUA 3LAGA 4QPWA 4Q5OA 2PELA 3LDRA 4YGDA 1W05A 3QH6A 1KXGA 1WBLA 1YC61 3WDYA 1PVC2 1S4CA 4FFHA 3OGRA 2O8OA 3HVDA 4CEWB 2HWB3 3USSA 2V4AA 4ZU4A 3RRDA 5FZ7A 1AXZA 4BB3A 5JAXA 2PHLA 3AX4A 1R1ZA 3Q8CA 2XR4A 4BCUA 3HEIA 2FZ1A 4V2VA 2ADDA 2ZABA 1VBE1 2XHKA 5IAVA 2K2SA 5EQUA 1W8FA 1ULGA 1AJOA 1RUG3 4RR3B 5FY8A 5FR3A 2W5FA 4PBPA 1OF4A 4TLGA 1CVNA 2JKXA 3VZMA 5HCHA 4XDPA 3IDCB 1JU3A 1NY72 3WQBA 5A7QA 2H0VA 1UXXX 4CEYA 4YFZA 4Q4X3 3LSDA 5D8AA 5GJ6A 4DRRA 4ISRA 3AZWA 4HVQA 1QJFA 1CAVB 2P3JA 3SISA 4LULA 4ATFA 3MIDA 5FZEA 1H1IA 1EUTA 2SBAA 1US2A 1REFA 4BA6A 3FL7A 3USUA 1Y7BA 1UXZA 3VZOA 4AEDA 2WUHA 1FMD1 3ON7A 1SLBA 3VZKA 2XH6A 2ILMA 2VCBA 4MADA 5F37A 2R062 4E8DA 4NIAA 2VQTA 4CDWC 4HKLA 3GALA 4NHYA 1ASJ1 2A6YA 2KA3A 3E1F1 4NN0A 2Y6FA 2CTVA 2GH2A 1O8SA 1LR5A 5FO7B 4ORFA 2P6HA 4HZFA 1QJU3 3FBMA 2YY1A 4YG0A 3M3OA 3KD4A 3GGLA 3H0OA 5LY2A 3KF3A 1R093 2JICA 2JDUA 2WYFA 1GOFA 4OULA 2YV8A 5IK8A 1C5IA 2OA2A 1XYNA 1WCDJ 1Q56A 1ZRDA 1WCUA 4CUBA 2FBEA 1ZZ6A 5CYYA 2ZKLA 2WZEA 4QB1A 1D7PM 4XZUG 4UBHA 2XGXA 3IAPA 4YZ5A 1LECA 4EWDA 2DVAA 2FZ2A 2PLV2 3KB5A 4I30A 4Y5TA 4HETA 2IVIB 1MR5A 4GWJA 1YJKA 5FZDA 5KHHA 1AR63 3WDUA 3WZ1A 1IHMA 4LKEA 1XYPA 3SC7X 3ZFGA 1PO12 4HANA 2K46A 4XIKA 2SLIA 3OGVA 5T5OA 2L9LA 4LIUA 3TEYA 2EXIA 2VBPA 4JC1A 4NO4A 4QB6A 5A7NA 5CB7A 3WNPA 1HXS3 4GXLA 2ZACA 1YO8A 4OHXA 4IE5A 2FHRA 4QWNA 1G9BA 1NZIA 2Q1FA 3HBZA 4LK6A 3VBRA 2ZMNA 4LXLA 1FPN2 1RXGA 2VMCA 2CGOA 2TNFA 3SH3A 1HQNA 1RMU2 2R30A 1UX6A 1AR93 2BVBA 5GZFA 4YVSB 1OVSA 3R05A 4H14A 2P3IA 4B4QA 1IZ3A 3BPSA 5EYYA 3EMRA 4YZ2A 3O5SA 3VHNA 4MGKE 5JZGA 3H3UA 1SCRA 4XVHA 3Q8FA 4QPIC 5T50A 3N7MA 5FXVA 2D3SA 4RGKA 4XMAA 3VZNA 5KXEA 4OLLA 1PNGA 3KT4A 4B4PA 1K5MB 2CGPA 4QPGC 4CDQC 1UOFA 4M0HA 4A44A 5FZFA 5L7OC 3A4UA 5L9VA 2XDVA 5K0UC 4RQPC 1YJLA 5DMYA 4QAWA 1NXD1 1GBGA 2JD4A 1LHOA 2WWSA 4Q1RA 5AFEA 1AX2A 2ES3A 2G4IA 2PN5A 2BTVC 1OFSA 1O5LA 1Q8PA 2PXJA 2J1SA 2ZGOA 4N9HA 4AI3A 1GP6A 2QQNA 4JGZC 4D7SA 1NY71 3AZYA 3JUUA 2JB4A 2YB7A 4JKLA 1X82A 1KDMA 4R9AA 4RS5A 1W0PA 1U5IA 4IEUA 3W9AA 2WQ4A 3ORJA 4IQPA 4UW6A 1AL21 2PHDA 4IESA 4N90A 3WP5A 1SDWA 3M3CA 2GP5A 1PMJX 2B9VA 1TMF3 4FQZA 1EPZA 3THCA 1F15A 4MXWB 4D7TA 1RB8G 1XRUA 1DBNA 4CDUB 3ES4A 3FJSA 2VOKA 2Q8DA 2RHPA 4C1XA 2ZKNA 1AUYA 1JYCA 1VMHA 4B4RA 2HWF1 5DAWA 3ZYRA 2VQ0A 5FP7A 2OQ6A 5C70A 1JZ4A 3LEMA 4A4AA 1HRI2 5LY1A 1TQ5A 3DECA 3OBZA 4JQTA 3IDBB 1OURA 2ZHMA 3MI8A 1I5PA 3H42B 5FUNA 4OI1A 4C0HA 2OKXA 3WOGA 2BQPA 5A1AA 3Q9OA 1KFUL 4XF0A 5H9RA 1KS5A 4AVVA 4QXKA 2A71A 2EXJA 2YG0A 2BVVA 1BCXA 4J6GA 3IM0A 5IT6A 4M0NA 1BEV2 5A1LA 2NMOA 2XOMA 3WDVA 2W0XA 4DZGA 3WX5A 5ABJC 4QQLA 2W94A 1S2BA 4XUPA 2JD9A 5BNOB 1OLME 2A6WA 1P8JA 1STMA 1HB4A 3ZR5A 1YRZA 5FYTA 5A3TA 2PLV1 2BEOA 3DXTA 2HWD3 3NV4A 1QXRA 4R4ZA 4OHZA 2WR9A 3KZ4C 3LA7A 4LBMA 1US3A 3ZR6A 1S0BA 3O1PA 4AG4A 3IDEA 3HQXA 4IV1C 4QD2A 5J98B 4LIVA 4OQ9A 1CAWA 1PO11 3W21A 1OSGA 4A7ZA 1QXPA 2JG9A 3EJKA 4M4RA 1PK6A 3WV6A 4L8QA 4LBJA 1MEC3 2MEV1 5IHRA 3T0AA 2AREA 1TME3 2PYTA 3HN1A 5M0TA 1WW5A 3V56A 4DIQA 1ODNA 2XG3A 4FFIA 1FPN1 4CEWC 3B9CA 2TBVA 2JDNA 5G04L 4NPRA 4YM0A 2PAKA 1CONA 1RMU1 2Q4SA 2R042 2W08A 2XUEA 4RGAA 3PVOA 5GLWA 2QTWB 4AHYA 2MHFA 5LASA 5BNPA 4JV4A 1G9AA 4K3UA 4JKMA 4WM8B 1NT0A 1W6PA 4CUCA 4UW5A 2VG9A 3MUY1 3DN7A 3T2PA 4WVMB 4CUGA 1O3TA 3CLPA 3ZYBA 2DCYA 1W8WA 4U36A 1JZ2A 1AJKA 1RTVA 1MS0A 1X33A 2FDIA 5CFCA 4AI2A 4FP2A 2E33A 3R0RA 4Y4RA 4E27A 1RC6A 4B3NA 3FN9A 4TXWA 5IFTA 2B9UA 4QT6A 2XVKA 4BQ2A 4CCJA 1XSRA 4URTA 1JZ3A 3N9OA 2W95A 1B35A 4X8NA 2R1BA 2WNEA 4JGYB 4YM2A 3NQHA 1UMIA 3VBFA 4YW4A 2JJ6A 2RE9A 2Y6HA 4QQ2A 3SNMA 3WF2A 3OBAA 3EQEA 4BQ3A 5ACA3 3T0BA 5CA6A 4TTGA 1JMUB 1EPWA 4FVVA 3BTXA 4IL7A 1O4ZA 4Y3OA 5FZ4A 4CP1A 1F9KA 5D2AA 3POSA 4DUVA 5DAQA 5T3NA 2ATFA 2EIBA 4OUEA 4E4DX 3APBA 5JR2A 1VBD2 3HIFA 1XNKA 4P9WA 5A3OA 5JOXA 5FAXA 4A6OA 5C71A 1JYXA 3A21A 3B94A 2D7FA 5LA0A 3WINE 3NMBA 5LRRA 2A6ZA 1EYBA 3GDBA 4M4PA 4CE8A 1RUH1 5FYVA 3WG2A 5FV3A 5FMDA 4AGGA 4BISA 5F7UA 3ZN6B 2NN8A 2I07B 4XIOA 5C4WA 4I02A 4AVAA 5FO8B 3VDBA 2GNMA 2PMWB 3NAPA 5I0SA 1HRI1 2WL1A 3ITQA 3WUCA 1V6IA 3E6BA 2R6QA 4FPGA 3VKFC 5LEKA 1C8M3 2IXCA 1IGOA 2O1QA 2FDJA 1A8DA 1WCQA 3PIJA 4JDNA 4YW1A 5LK5A 3VD3A 4AI8A 2A70A 5K4LA 1VBB3 5LCWL 1GU3A 1W8UA 1BEV1 2K9ZA 4UYBA 4WBBA 1CZVA 4RHV3 3JB4C 3HN3A 4E8CA 3VBSA 2FDKA 5CG9A 1PGW2 1RJ7A 1D2QA 1GLHA 2WO2A 2BFUL 2V72A 3F2ZA 1WW4A 4YVSC 5EJ1B 2XBO3 2Y0OA 3CQOA 4IEOA 4IERA 4B1MA 3PUIA 4XF9A 2WAOA 5LBCA 3ZSJA 3N35A 5G05L 5DDJ2 4EN8B 5CKQA 2VAUA 3WNNA 2D6NA 2QFEA 3AKSA 3NNMA 4IDZA 1FX5A 4QX8A 3RS6A 2E53A 2GMMA 1IQAA 3WSOA 1BLZA 2RS32 4ZONA 4AFMA 3K48A 1LJ7A 3FHQA 2OXBA 4NVPA 1AX0A 4B29A 5C8CB 1K5MC 4GB33 4XUNA 4YRDA 3DXUA 3O0XA 5AVAA 5KC6A 5DABA 3WQ1A 5A32A 2C9AA 1LOFC 3DYPA 5KHIA 2R041 3H1MA 2BWAA 2A5ZA 1OFNA 1AXYA 1AX1A 1EV13 1W6MA 3OPTA 4LBKA 1QJX3 2B4KA 1W8OA 4LTAA 5C3RA 4FOQA 3WW3A 1OH3A 2P4EA 3DCQA 1C1FA 4INDA 4FCAA 4GMP0 1DP0A 4N53C 4OFGA 3O1UA 5DUWA 1LOEA 2R0FA 3HNYM 1GICA 4PLNA 1RINA 4YFWA 5FFOC 5FP9A 4BYYA 3I2HA 3OYWA 1SLIA 4MOAA 2W46A 4ASLA 3AZVA 1HB2A 2FCVA 3KGZA 3KVAA 2DVBA 3ZPYA 4Y1YA 4QQOA 2E31A 2YPDA 3NJYA 4LBQB 5FMOL 3OD0A 1MACA 2GC0A 3FLRA 1O4TA 3IPVB 5EXOA 1GNZA 4YLZA 2D40A 2RS13 4IV3B 4OVEA 4PIYA 5F3IA 4CDUC 2BNOA 3OPZA 5IFPA 1J3QA 2B7YA 2FMDA 3GCWA 4W6WA 4UAPA 3L2YA 4I2OA 1ZNPA 4QKDA 5H9PA 5A6ZA 1DDLA 3B5LB 5JPMB 3PUHA 3LGRA 2WZPP 4CEYC 3VD9A 5BUVA 2LTNA 1IKPA 1AXKA 2J7MA 1QHDA 1O91A 3FX3A 1PIV2 3KCCA 4M00A 2WSVA 5FK7A 5J7MA 1EY2A 4QQPA 2W2IA 4HK9A 1UPSA 1XYOA 2VUJA 2YU1A 3SH5A 1VBD1 2MPFA 4XQ4A 3E5UA 3KLSA 4NHXA 3G7DA 4YPJA 3H7JA 4JTNA 5LZ6A 2J42A 2RDRA 5T52A 1AF9A 3RNSA 1POV1 3NW4A 1MVEA 3GBGA 4LNVA 3NV2A 3POJA 1WMXA 3HWJA 2HWE3 2WIIB 2HH9A 3T2TA 4CA9A 1UYPA 3H1WA 1SLLA 3NNFA 4QKFA 4XUQA 1D4VB 4BQ1A 3CNAA 2VJXA 2D6OX 2EIDA 4FXKB 4XF1A 3VBUB 1KITA 4LO4B 3ST7A 2PHTA 3JBG2 3J8F3 2JG8B 4XE9A 4BZ4A 4DOUA 4LLFA 1BYHA 3NSTA 1O3RA 4Q4V3 4A2UA 4I0AA 1COV2 3I54A 1IPKA 4BQ5A 1DGLA 1ENRA 1I5ZA 5FY7A 5JCTA 1CX4A 4AE2A 1OT5A 1GKBA 3I3DA 2BUKA 4BK4A 1W3XA 1GR3A 1XNTA 4LMFA 4B7KA 1NA1B 1UMHA 1QXJA 2RS52 2WNUB 1Q8SA 4AR2A 1ZRCA 1UZWA 2ZMKA 1PGW1 1BK1A 1V6NA 5DZGA 2HKXA 3VBHA 5I8YA 1FT9A 4UXAA 5DPNA 2D5FA 2LALA 2LUWA 3ZO0B 3FFZA 4QX7A 2AYHA 5F32A 4WM8C 4OUSA 1HJGA 1XB9A 2OT7A 3N3HA 3U1XA 1PZ9A 5CFDA 3AMHA 2F4PA 5DDJ1 1VP6A 4IEYA 3B9IA 5F2SA 1T6GC 3H3LA 4XEZA 4GH4A 1J3PA 4OZOA 1LHWA 3IT8A 3WDXA 3NNJA 5CIRA 5JXJA 4UWDA 5F6KA 1SG3A 1OLQA 1W04A 4GMP1 5FCCA 3V0AA 1CIYA 3I49A 2VZUA 4Q4W2 1OKQA 1OLMA 3MYXA 1JN2P 5A33B 3R4UA 1XXNA 3OB8A 1RUJ3 1DGWA 1LOGA 4XJUA 2MNGA 1UIJA 1H6XA 1RUF2 1W6NA 3CZJA 2WN3A 3ZIXA 5KC5A 4BMBA 4NR1A 4LJHA 2X29A 2ZS6B 1SLCA 5A6QA 4UOJA 4JGYC 5K9YA 2WS92 2YPJA 1SBFA 1WW7A 4XFCA 4YARA 4R52A 1XE0A 3MICA 4R4XA 3CJIB 1HV0A 4Y1VA 4IGQA 2GN3A 1KQRA 1S0CA 1SBEA 1YLLA 5LWBA 4A7KA 5CVRA 3POGA 1MS9A 3P1IA 3P3NA 2I74A 1PM7A 4M3CB 1AR72 2XJUA 4XETA 3OF1A 4NWVA 1YUDA 4UFHA 1QJY2 5HI0A 4MG2A 4LPLA 3I3BA 2DCKA 2CAUA 4OCTA 1YQ6A 1N47A 3JD73 4NOTA 1DYOA 1VALA 1OXCA 1YFUA 4W6YA 5CKMA 5APAA 1J58A 2AENA 5FZ6A 1TG7A 1WWYA 4WM7A 5BPXA 1CX1A 4CU7A 1Z7S3 4TYSA 3AZZA 5LA1A 1UQXA 4CU8A 1CWPA 1WUVA 2ZAAA 3BTYA 3ETQA 1UN1A 2BNMA 1MQTB 5F5AA 1NE4A 3ALQA 1UKGA 3AK0A 3OSDA 1WKYA 2IFWA 4RFRB 5FYSA 4ATEA 1W2OA 3ZKUA 2DUOA 2RMU3 3VUOA 4XYXA 4OMDA 1XPWA 2QKDA 5J09A 1UPIA 1ODMA 1OHFA 2JDZA 5DAVA 3VGIA 4AHXA 2OPWA 3AKRA 1UCXA 3ZX7A 1DCSA 4OI4A 1JYNA 1NQJA 3ZDSA 2VMGA 1DGRA 2WZ8A 3TN91 3VDDA 1JXNA 2VXRA 4DS0A 1MZFA 4YW5A 4XDOA 4HVOA 3KHBA 4EN6B 2DUPA 1K5JA 4KWJA 1SMVA 1KJLA 3MEPA 4XAAA 5ANQA 5FLIA 4P9LA 1N1TA 5C8CC 1COV1 4L2NA 4KQ7A 2BRTA 4IEWA 1R092 1RUC3 3PMEA 2WAAA 2FDFA 1EUUA 1RVF2 2D97A 2XQRA 3MO4A 1C3HA 3KQ4B 1NCRB 2E7TA 2RS51 1BZWA 2WNVA 3PJQA 3FHIB 5BNNB 1W2TA 4ZZ8A 5KBFA 5BXXA 4LO6B 3AJZA 2W91A 5C3SA 1H30A 5LB6A 2RJKA 3WXPA 4PQQA 3MPPG 2VZ1A 2ZZQA 3AYDA 3DKWA 1I3HA 5DAXA 1PO23 4PF5A 4UW3A 3FZ3A 4KWLA 1A8MA 3KGLA 4QX1A 1ZM1A 3MW2A 3KV9A 3KCYA 4FOYA 3SXWA 3LEKA 3O14A 4QXCA 1U5XA 3K3NA 3NNLA 1A78A 4Q4W1 4F8AA 1KS4A 1U5YA 2D93A 1XJAA 2O8QA 3I97A 4P08A 4QU1A 1PNFA 1HLCA 4XZPA 3K4DA 5FKBA 5FZOA 3WHTA 5I91A 4IV3C 4EJRA 1IS4A 1HW5A 1WLDA 3AKTA 3C7GA 2VNRA 2Y34A 3D82A 2QQMA 2UY9A 3D3AA 3URFA 1MPXA 4KBBA 5FZ1A 5KXCA 3UKVA 2WS91 1H8TA 2QUOA 4K1YA 3QLQA 4OHYA 1SFYA 2YFZA 1SACA 4Y33A 1NUKA 5FYUA 1W6OA 3VV1A 5JSRA 1MZEA 4GALA 5FLHA 1V9U2 4SLIA 2D6MA 2VUAA 2YU2A 2Z69A 4MHUA 1D4M2 1S2EA 4QQHA 5FZHA 4ES8A 2HLEA 3DPRC 2XMLA 1ZZBA 5DUXA 1AR71 5HCFA 2R073 3SMHA 1RUI3 2ZTNA 2GN7A 3CEWA 3VZJA 1QJY1 3WW4A 4BE3A 3RZHA 1VAVA 4ITCA 1AR81 4UF0B 3RMXA 1QF3A 4AFBA 3N7JA 3BOPA 1G8WA 1UYYA 2VW2A 2X5IC 2V4VA 3PTRB 4DQAA 3AP7A 2C26A 5HBAA 5KXBA 1ZZ7A 1LOAA 5FZAA 3VB9A 2WFF2 2W9XA 1C57A 1JZ7A 1NLQA 4XMIA 4CP9B 4CCDA 3BU0A 1W8NA 3OGJA 3ACGA 4HPKA 1RUD2 3UJOA 3I4IA 2NM1A 3MV11 3VBUC 4N8MA 4XBQA 1BVP1 1F5FA 2JG8C 4DFSA 2E6VA 4R8HA 4TZDA 4NHLA 5JSOA 2ORXA 2Q5TA 4J1WA 3D6EA 4XTMA 1W8HA 2IXKA 1K45A 3M1HA 3MV01 1AYM2 3KCXA 5JSPA 1NA1C 4FFGA 2WNUC 1CAXA 1S0FA 2GDFA 3PDQA 4UBGA 3SEPA 3ZYJB 1HX6A 1LHNA 3AKQA 3M7AA 4FPHA 1TMF2 2ZGUA 4HT1T 1R1A3 4LBNA 4LUKA 4PHZA 3VD5A 2FQPA 5C9AB 4HBNA 5FPLA 1TE1B 3KVBA 3T4HB 2ORZA 3VLBB 1K3IA 4ES9A 1N1VA 4PIZA 3RPQA 4UFLA 4QKBA 5FREA 3UETA 3BCWA 4AGVA 5EPAA 2VM9A 1W2NA 3WW1A 2YBKA 4NIGA 3HNMA 5CKNA 1IG0A 3OUJA 3QBQA 1UY0A 2DBNA 1G86A 2YUEA 3BOWA 5JVVA 3T4VA 3UESA 2YC0A 2VCAA 4NRPA 1JYTA 1ENXA 1OOPA 4L11A 1JUHA 1YEWA 1R091 2VMIA 2ZEZA 4LHLA 1CZTA 1H6YA 1FAYA 5DG1A 1RVF1 3I3EA 5JOYA 3H50A 4TLFA 3OOXA 4CXYA 1Z78A 2I45A 2WQZC 4BHPA 4WVZA 3IAQA 4NIDA 4DINB 2CWSA 3FUQA 5I8SA 1JOBA 4XCBA 3VBOB 1OF3A 5FQ0A 5EV7A 5DXDA 2Y6KA 3ASIA 3C3VA 1CESA 2DCZA 3CJIC 1O6UA 2YBPA 3J26N 4XXAA 4CTEA 4YSFA 5LEJA 2XB6C 3OUHA 3CBNA 3WP6A 2ZGPA 2PHFA 2JDAA 2AACA 2PHXA 5BNOA 1W8ZA 3LQCA 2OYZA 2VUCA 1FMD3 2JDMA 3AP9A 2NMNA 1OMIA 1ND2B 2NPIA 3C2UA 4HSJA 4U2AA 4ZHNA 1MEC2 5FPXA 3K75B 1GV9A 4AGRA 3M70A 3P3PA 2DDUA 3ETPA 2QQLA 5CISA 2WZR3 1T2XA 2E32A 4P00B 5JMCA 1CJPA 1RYYA 2VCCA 5FMBA 3RSJA 1N1SA 2CWMA 3ZFFB 1WMFA 5C3PA 3WF0A 5JIUA 5T55A 1N3PA 3DGTA 5C33A 1H2NA 4TWTA 5J3UA 3NJXA 1B09A 2DFBA 4CCEA 2QQPA 2JEMA 2XJPA 2ZXQA 1MQTC 1V9U1 2ARCA 2Y64A 3BGAA 4YVWC 2G9GA 1RITA 1MS3A 1D4M1 2XWBB 2VTFA 3ACLA 1VMJA 4K20A 1V0AA 1MZ6A 4PT6A 2BBVA 5LBFA 5IVFA 4Q8KA 2W1WA 1UY4A 1BKZA 4CUAA 4XXPA 5T54A 1VMFA 2PHWA 2QQOA 3CKHA 3O1VA 1UY3A 4MLOA 4IGOA 2X53S 3WNOA 2OIIA 2E51A 3A7QA 4X6RB 5KR7A 2A75A 3IKWA 3POIA 3SQOA 2WFF1 3WEZA 5FYHA 4O9EA 1YIPA 3JQXA 2F6BA 1RUD1 4KU8A 4N43B 3OY8B 4W6XA 1PVC1 4FTEA 1TZOA 5FZKA 5I0DA 4GJZA 2CHHA 4Q4Y2 1LTEA 1CGPA 2Q0AA 1IQDC 4Y1ZA 2QQUA 4UI9L 2C1FA 3U4XA 3BIEA 4DY5A 1Y4WA 1L7QA 2HWC2 4KGGA 4NUBA 4CDXB 1ZZCA 2BJSA 4FO9A 3WT3A 4AQ2A 1AYM1 1RUE2 1NCRC 1F4AA 3H3ZA 3LA2A 4Y5Z0 2HEVF 5BNNC 2BYVE 2JB8A 1TMF1 4BXSV 4LLOA 4N53B 1O8PA 1AYN2 1V6OA 3AP6A 2BZDA 1XNCA 2PTMA 3BKZA 2B46X 1ULCA 3N9LA 5SV8A 1YNAA 1QOOA 1HV1A 2UY8A 5L9RA 5HV0A 4IW3A 3GZAA 3WVJA 5A7SA 4NIHA 4IEXA 4FFFA 4LKDA 1DQ5A 2R061 2JDHA 4XABA 1C8M2 5GLTA 4Q0VA 1IS5A 1UO9A 1UIKA 5EFUA 1BQPA 4CEYB 1VBB2 3R4DB 4AQTA 5D8AB 3AKPA 3UK9A 3UNPA 5CZKA 2D44A 4RHV2 3CMGA 1Y43B 4Z82A 3KF5A 2BOIA 5FXZA 1ULOA 3W20A 4L92A 2Y6LA 1U12A 1HDKA 4XW3A 4GH4C 5FZ8A 1HN0A 3USUB 2Y6JA 2JXAA 4AEDB 4COWA 3HT1A 2QZ2A 3N36A 4XPVA 1ND3A 3C8XA 5FOBB 2J1EA 5JXGA 1GANA 2ZCWA 2R1DA 3BALA 1AL23 3HPNA 4XF3A 4Q0UA 1J1LA 2CYFA 5C5UA 4XBLA 1BBT2 1TNRA 3SHRA 1WD3A 2WO7A 4YZ3A 1JZ6A 2E7QA 1MEC1 4ZU5A 2BBAA 3I2OA 2ZPXA 2HYKA 3AMPA 3GNEA 1VBA2 3VHOA 2HWF3 3MF9A 2UWAA 3T2QA 4BM8A 4LK7A 3B7MA 4TN7A 5AC92 3ZXEA 3NO8A 4GD4A 5I93A 1IG3A 2P34A 3IIAA 4NWWA 2VCMA 1EV12 1SEFA 1W0NA 4MSVA 1UZ0A 4C8DA 2PHUA 5FDBA 2QDRA 1VRH2 2P3YA 4P02B 4Z8BA 1Q8VA 4DEQA 3MIGA 2W47A 3BU7A 4NJ4A 5B4NA 1FV2A 1IS3A 5FP8A 1GOHA 4DUXA 1E57A 1NCQA 3ZFGB 4DXZA 1NAEA 1S0IA 2C9KA 3KHCA 2VGDA 5FUPA 2VULA 3ZFEA 2PLV3 1S0DA 4JAAA 3D0SA 1LESA 5F3GA 5C9AC 1VBC3 2VO5A 3QCWA 4D3WA 4AAPA 2XLAA 1HRV3 2GAUA 2RS12 4CVUA 1SDDB 4K8RB 4E4SA 3VBRB 1PO13 3L9JT 2LW8A 3U14A 1KD7A 1PMHX 1PX4A 2AEYA 2XXZA 4RL7A 3SEEA 2ZJCA 2OPKA 3TEWA 4P9GA 4Q4Y1 1GZTA 2MEV3 1S55A 2J22A 3WR0A 1X50A 2C0ZA 3TOJA 2PA7A 3FMGA 4SBVA 5LBBA 4MGTA 2HWC1 1YI7A 5IAXA 5A3LA 1W2AX 1J83A 5GLZA 1RMU3 1RUE1 1XNAA 5FK8A 2Y60A 4BIOA 5JZGB 2BFUS 3AC0A 4NAMA 4YG3A 4ARXA 4CCCA 4JTOA 5F2WA 4UW4A 2NZ9A 2DU0A 1RJ8A 1DGRN 1AYN1 1WW6A 2IVJA 4HFSA 4MGYE 3VBOC 3WG3A 4AEJA 2OZJA 3S57A 4XTPA 3O7OA 1LENA 4YGBA 1N3QA 3CO2A 3LIGA 1ZX5A 4XJZA 2DYCA 4PDWA 1AL0G 4RD7A 2IZWA 4EYUA 3TEXA 2VBBA 4FPFA 4AEMA 5JWPA 1PMIA 3GYDA 2VW1A 4GKYA 2VMEA 2D5HA 2F17A 5F5IA 5EHDA 5DUVA 2ZHLA 5F1RA 3H8RA 3J8F2 3LIHA 1ND2C 2YGMA 4FP3A 4XACA 3ILFA 4Q4V2 2OZ6A 1VBB1 5JXIA 2JE8A 2FDHA 3M2MA 1GOGA 4RS5B 4RHV1 4OYUA 1F31A 2OS2A 2XJVA 4MXVA 3N9MA 3ZFFC 1C28A 4F83A 4ZU7A 5CEHA 4BU2A 2W3JA 4LBLA 4CZSA 1PVXA 4FOVA 1POV0 2ZX2A 4HN0A 5IK7A 5E8AA 2V5DA 5L19A 4LHNA 1LEMA 2VZOA 1HQWA 1RHI2 1KEXA 5I0TA 1Q8OA 4QDSA 4KGQA 4D69A 5JUVA 2VBDA 3JB8A 2EXHA 3MW3A 2Y26A 3UL2A 4QMAA 1XE8A 2HJIA 5F3EA 4D0QA 4D6QA 3N7LA 1ULDA 3LPGA 3W5MA 1GFF2 1BBT1 1GZWA 4H7LA 3MBWA 5LATA 3FWEA 3NV1A 1RUH3 2DVGA 5EZWA 4HL0A 3SCGA 4BQ4A 3O1RA 1VBA1 4BPZA 5CG8A 2JENA 2WINB 2ZX0A 4I01A 2NLRA 4D94A 3T30A 5AC91 1FNZA 4EWEA 5GALA 3GCXA 3LKJA 1F5JA 1ULEA 5FBZA 2WSUA 2ZGTA 1EV11 3NVCA 4BWOA 5JR7B 4N43C 4CDWA 5EJ3A 1XNBA 4Y1UA 1VRH1 1CPNA 3RZJA 3JXSA 3POWA 1BEV3 1LGNA 1H1MA 4H55A 4CDXC 3ZXJA 3GZEA 4Y22A 3Q8BA 2BNNA 4C90A 3CDZB 2YC2A 1CR7A 2JG9B 2WO1A 3ACHA 1S0JA 4OHWA 4ONUA 3GM8A 2CNAA 3UKTA 1QDOA 4FSJA 2IXJA 1F8VA 2Y33A 3B3QE 1HB1A 3MIFA 1BXHA 3FBYA 1EAH2 2ZEYA 1UMZA 2W39A 4EN9B 3BI3A 3B02A 1QWRA 1OUSA 4PBOA 1OC1A 4Q8LA 3L2HA 2HBUA 3INAA 1QQP2 1CAUA 4IEZA 1WMEA 5C5TA 2UU8A 4Q2FA 1Z7S2 4BIFA 1TNFA 5DG2A 5BNPB 1DQ6A 1KDKA 2A73B 1DQ0A 4OI0A 1W6PB 1DQ1A 4LE4A 5JXHA 2JX9A 5EJZB 4PQ9A 1W03A 5CNAA 5F3CA 2XL9A 2RMU2 2RM22 4BOWA 5D8AC 1QOTA 4A6SA 1GWKA 1J3RA 4A7YA 1LRHA 5CFCB 4XQDA 3V0BA 2KM2A 2A3XA 2VW0A 4IE6A 1ACCA 1LODA 2D6PA 3J9SA 4AEDC 1RXFA 4IEVA 5A80A 3DPRB 4FOWA 3UGHA 3V65A 3J7MA 1C4RA 3DYOA 4FTBA 4J1XA 5FY0A 1DHKB 2JDPA 1MS1A 1QY4A 5E88A 2D43A 3B00A 3K4ZA 1B35B 1DZQA 3GXUA 3LZZA 3RZKA 2W68A 4MZUA 2RR13 2VPVA 4LA3A 3RYRA 2X5IB 4BK5A 1W8TA 3VBFB 4IEQA 4NHKA 3CHXA 1JHNA 4QHZA 4Q4V1 1NKGA 3KV4A 4QPIA 4O61A 1JW6A 2VVEA 4AXOA 2Y8KA 4PF1A 3NKGA 2LS6A 1UOBA 4LORA 1AZDA 3PUSA 3MLJA 4QPGA 2QNKA 4JDOA 3I8TA 1ZBE2 4CDQA 2EXKA 5JI9A 5L7OA 4QGNA 2GMPA 1OA3A 4QGLA 3ATGA 3MIEA 2VECA 4R9DA 5K0UA 3ZYGA 1NXMA 1Q43A 2Q30A 4RQPA 5C3QA 4KI5M 4ZZ5A 4MGZE 3SCFA 3CIHA 3AYCA 1RHI1 3IN9A 2VOVA 2JIJA 1WLWA 5FUIA 3ME2A 1KJRA 1JZ8A 4P9JA 2FCUA 4LO5B 1MS5A 2UYBA 2E9QA 2UYAA 2BU9A 1VBD3 4NHMA 3TAYA 4UT5A 4C91A 1PO22 4DXTA 4JGZA 2ZZJA 5C4WB 2V73A 2WNOA 3N4MA 3NAPB 3S5QA 2G9ZA 3ZFGC 4JX0A 2B45X 3S7IA 5C6CA 4EROA 1RGSA 4Y20A 2VOWA 3RFRA 2VC9A 3FE5A 3VKMA 2E63A 2YDEA 4LKSA 3V64A 3PURA 4W50A 2XHNA 4HN1A 3E5XA 2RJ2A 3C7EA 3KT7A 2DWRA 2RS31 3RJ2X 4Q0SA 1BJQA 2R7EB 3UGFA 3VBRC 3ZYHA 4CU6A 1SPPA 3VBSB 1DF0A 1UU4A 3I59A 3RZLA 4BXFA 4PI0A 3CJXA 4EN0A 3ZPOA 3KV5A 5A7WA 1GSLA 2DVDA 3SKVA 2RJLA 3KMHA 2Q1MA 1QKQA 2VNGA 1D0GA 3MIBA 2X05A 5BYNA 4P14A 3ZMNA 4H7MA 3ZXAC 1R083 2DVFA 3P6BA 5SV5A 4ZY9A 5JZGC 1DLLA 1WA4A 3ZXLA 2R072 1YFYA 1RUI2 1LKNA 2R16A 2D6KA 4COVA 2X8KA 3GBFA 5FYBA 3WY6A 2IC1A 5ABJA 1EAH1 3ZXKA 5DDJ3 3TBDA 2J1VA 5A3NA 1YFXA 5FYIA 2Z42A 1FYUA 5FZ9A 2KXLA 3D8CA 3DEMA 4OUMA 5IWFA 5A32B 1OD5A 4BMEA 3O1OA 4CXXA 5CU1A 2VOXA 2VH9A 3OEBA 4EQVA 1QQP1 1VIWB 1GYKA 1W6QA 4GMP3 2JE9A 1Z7S1 1W6MB 2UWBA 4DPNA 1DGWX 5IVYA 3AJYA 2C24A 4IV1A 3ZVXA 1BMV2 1Z0HA 3MLKA 2WKKA 3T1MA 4DEVA 2HWB2 1N3OA 2R0HA 4META 2QQWA 3DL3A 2RM21 4DY3A 4UFIA 1QJZA 4PIXA 2FMYA 3N9PA 3OYWB 4FPLA 4RS5C 3U07A 4GAZA 2B39A 1PIV1 1RUG2 2VQAA 3HD8B 4ASKA 3GBWA 4CEWA 1RUOA 2VU9A 3FLTA 4YVWB 1R1A2 2VVFA 4COYA 1JZ5A 5C7GA 4EN7B 4FQ4A 5IYYA 1H9WA 1H2LA 4OMCA 4Q4X2 1QU0A 2GMEA 1OPOA 2PFWA 5HPOA 1JU4A 4G4FA 3ZSMA 4Q26A 4IEPA 4RR3A 2CL2A 3LSEA 1CIWA 3UGGA 5J96B 4Q27A 4CCLA 2IWGB 1QIQA 5FJHA 2JDYA 1CAVA 3ECQA 1JI6A 5FPVA 2VZSA 2WT1A 4LA2A 2YMZA 2XPJA 3BIWE 1HJFA 4AVSA 3I7DA 2VE1A 2GH8A 4AVBA 5T5JA 2ZX4A 1OI6A 1ZBE1 4XJWA 2Q1ZB 3JBG1 3ROUA 1ULPA 2GSYA 1QJU2 2WLPA 2VTXA 3OJBA 1PZ7A 2Y6GA 3PIGA 1W06A 4LE3A 3SH4A 5FBJA 1PGL2 4Z2AA 2A6VA 4XFBA 2CV6A 3U37A 4M01A 1POQA 2ZBJA 5JMOA 1BHGA 3U78A 3RDIA 1V6MA 1UOJA 1QEXA 4UFJA 4GWIA 5KXDA 3TNQA 5FYZA 3JZVA 1ENQA 2CGNA 2P5BA 4LKFA 2JG9C 1PK6C 2VNVA 3OUIA 1QNWA 3TWIA 2YC4A 1CD3G 2ZOEB 3TN93 2VD7A 3AZXA 1MS8A 5EWSA 3D0JA 2GNBA 5DAPA 1V6LA 1U0AA 3T08A 1AR62 4H2AA 1ZREA 4MVTA 2WZR2 3E6DA 3A22A 3SLIA 1ZYBA 2CDOA 4S2GA 1AHSA 3LWCA 2CU5A 3O1MA 4YW2A 3ZN5A 3HQUA 1HXS2 2OX0A 5BNPC 1COV3 1DYKA 2GP3A 1CZSA 4YNIA 4YWAA 3K4AA 2WA4A 1O4YA 1ST8A 1RUF1 1ZBA3 3B01A 3BODA 4DXRA 3PLQA 5BV6A 2DBIA 1UZVA 2C4XA 5CFDB 5HXMA 2RS53 3LFMA 2EF6A 3B93A 4ISQA 4WZFA 2WO3A 4F7ZA 3I2FA 5IVVA 1I6XA 2OUJA 1AR92 3EB7A 4GH4B 5AVPA 3M8LA 1FOD3 2R071 4JZRA 4AHZA 1OH4A 2DTWA 2HEWF 4XAEA 2QE3A 5CFCC 3TEZA 4XURA 3V0AB 2VZRA 2KR2A 4IE0A 1FV3A 4K9SA 3FC0A 5CBLA 2EIEA 4KWUA 3ZYFA 4OHVA 1UYZA 4LO7A 1IOAA 4Q0QA 4C0BA 4YVSA 5H9QA 4FPEA 4NPMA 1H2KA 1S1AA 3DYMA 4S2HA 1RUNA 4O7XA 2P3KA 1W6NB 3D4KA 2G19A 4Q1PA 1V6KA 1B35C 1LEDA 4Q4W3 4P5HA 1HKDA 3DUIA 4I09A 1NLRA 2WBKA 4XUOA 2JKBA 4YG6A 1BMV1 3ZSLA 3VBFC 2W92A 3H8XA 2VXJA 2HWB1 3EBRA 1APNA 1YI9A 3ZMOA 4RN5A 3K2OA 5ANNA 5IW0A 1S0GA 3PJYA 1K5MA 4MGIE 2ENRA 3AP4A 4KBZA 3U10A 3U4SA 4ZS3A 1RUG1 1SBDA 3C7HA 4A3ZA 1YFWA 1LOFA 3EXUA 3WDWA 3ZOIA 1DZRA 1QOSA 2UWCA 1R1A1 3OBRA 5HV4A 3MF6A 4IETA 1GQPA 4Q4X1 5LA9A 1OQDA 4CU9A 2ZMLA 5I8TA 1VJ2A 1XE7A 4XUTA 4XFGA 4L0PA 4XJ9A 2ET7A 3RZMA 2DURA 3RG0A 1AR73 4D8MA
chains in the Genus database with same CATH topology
4WM7B 3MIHA 5C4WC 4N53A 1AR83 5K8SA 3CF6E 3X29B 3NAPC 3WQ7A 3ZXDA 5GZDA 4DRVA 4HLTA 3NV3A 5L73A 2XJQA 4QM8A 4K7JA 1UAIA 5FLJA 4MXWA 1H0BA 4EWAA 4FT8A 1UZYA 1QJU1 4CDUA 5CADA 3VBSC 1JOJA 2DU1A 1QGLA 4PCRA 3R4SA 3AMMA 3KT1A 1PGL1 3VKOA 1DIWA 3ZXFA 4GKXA 1W2UA 1VBE3 4HMZA 2AR6A 4K8FA 1XQNA 3VDDB 1JYIA 1AL22 2XUMA 1ZZ9A 2G9FA 3UJQA 4DB5A 5KHGA 3JQWA 2D98A 2H6BA 1DYPA 3THPA 5GZGA 1CQ9A 3BTAA 1GNHA 2HWD2 2VNOA 1JUIA 1S0EA 1AR61 1REEA 2DV9A 2WZR1 4TZDA 2IFRA 2GC3A 2ZGQA 2HWF2 2H6CA 3H8UA 4CP2A 2WNVB 3PHMA 1HXS1 1TME2 3AP5A 4FPKA 2YZ4A 1CPMA 1ASJ3 1QH7A 5JI7A 1RVF3 5E16A 3ENRA 3AXEA 3RZZA 1VB2A 1QNYA 3KM5A 1NYWA 4XFIA 3VKLA 3M3IA 1AR91 1MVQA 2WLQA 4H3WA 3EHKA 4GIQA 2BGCA 4MX3A 3S7EA 4E2GA 4M3CE 4YGCA 1G6NA 1D2SA 4HKOA 4AI0A 4XHXA 1F2NA 5F9TA 1VBC2 3RQ0A 2ZAHA 1J1TA 3GZUC 2XVLA 4K1ZA 1HRV2 2EIGA 4WM8A 1DU3D 4QX5A 3BPZA 4QPYA 4XJ8A 5DZFA 3DV8A 1EP0A 1H8TB 4WVMA 1N1YA 1YYNA 2MEV2 1NE6A 1W6OB 4Z1VA 5J36A 3NJZA 1QMJA 1ULFA 1HIXA 4EV0A 3WCSA 5KHKA 5ACA2 2GNTA 4G9SB 1AVBA 1G7YA 3WD5A 2XKOA 1XNDA 1V9U3 1D4M3 4JGYA 4BH9A 1OLRA 2YHJA 1OQ1A 2JE7A 5KWRA 1ALYA 4KG0A 1H9PA 4B8EA 2IXIA 4HPKB 1V00A 1JH5A 5BY5A 1UU6A 3PVBB 4L9BA 2WA3A 2WFF3 4XF4A 3TYJA 5HCBA 3WG1A 3D5OA 1UU5A 3E97A 1RUD3 4K21A 1SLTA 3S6PA 1PVC3 4FAGA 1CAXB 4V1PA 1NG0A 3VBHC 3ZN6A 3OTFA 3PTYA 4AWDA 2ZGRA 1LCLA 1WLTA 1SLAA 4Y24A 1AYM3 3S30A 5CFDC 1O3QA 3TRSB 3MGUA 1PGSA 4E2QA 4COZA 4DNYA 2XBO2 3M4FA 3HMYA 2HWD1 3GF6A 3ILRA 4AFAA 3JU9A 2A3WA 1RUH2 1OOPB 2WJSA 1UL9A 1VB4A 2ZHKA 5EYXA 1I9RA 4X6QB 4WV8A 4E2SA 3U0ZA 1XU1A 5GM0A 4YZ1A 4XHBA 3WNXA 1PHMA 1LGCA 2R063 1TME1 2IXHA 4O9GA 4GB32 3UKNA 4XQWA 3HAGA 5JDBA 3WUDA 4GULA 5FQ0B 1ONAA 4CYDA 2P37A 3QOPA 4E4ZA 5C8CA 4WVVA 1X8EA 1QJX2 4YM1A 5GKAC 1NOVA 3DF0A 1KFXL 1VBC1 5IK4A 3OD4A 3KQRA 1HRV1 2ZGSA 2PAEA 5GZEA 3VL8A 4WM7C 3WP3A 2LM3A 4N7IA 1FI2A 4XFAA 1J59A 4YGEA 4AQ6A 1LHVA 3NWKA 1M06G 3RI8A 1VAMA 5E89A 4LBQA 1RL3A 3ZXGA 3IPVA 2C5DA 3B69A 4Z07A 1LB2A 3EO6A 4I0BA 2NYYA 1CN1A 2XKPA 5ACA1 4IV3A 4I3PA 4G3YC 4RR3C 4I0WB 1FPN3 3VKNA 5J48A 4AVCA 2CAVA 2ETEA 1G9FA 2DF7A 2B8MA 2R49A 1ZRFA 3VDDC 3O0WA 4CRQA 5AFBA 2NQYA 2ZA9A 2N7GA 4GQ7A 5HXVA 3E5QA 3AMNA 2VMHA 2RR12 4JRAA 3H1YA 1Q5OA 2HWE2 3DPRA 4LR4A 2Y0IA 3ZIWA 4AI1A 4E9KA 5C8WA 1H8VA 1UW8A 1DQ4A 3PVNA 1TEIA 3BB6A 3CU7A 1SQ4A 4LHKA 2QZ3A 4AFCA 3MLLA 4GA9A 4YW3A 3N7KA 5F6LB 2XLFA 2X5IA 2ZGLA 3SITA 2WNVC 4Q4Y3 1NLSA 1C8M1 1W39A 1NZCA 2WT2A 2HWC3 4AF9A 1WD4A 4CP0A 3H7YA 1IS6A 4YZ4A 5CAZA 3VBUA 1RUE3 2TEPA 4XILA 2JG8A 2XVGA 4S2FA 1JBCA 2BW8A 3FUOA 3A0KA 4AHWA 5FOJB 1AYN3 2XBO1 3JCIA 4XDQA 1NA1A 3WW2A 2WNUA 4W65A 4LT5A 5FMOS 4RFT0 4BLJA 2YROA 5TSWA 3O0VA 1ENSA 1KRIA 5IK5A 3MPBA 3J4UH 4GB31 3WDTA 1BVVA 1H8TC 3LOIA 2E7AA 1GZ9A 1Y9QA 3A0NA 4D7YA 5JPNB 1YWKA 1RUJ2 1YCIA 5F5QA 1ND3B 1HRI3 2V09A 2EAAA 3H9AA 3CL1A 1R082 1QJX1 4COUA 5GLVA 2YXSA 3ILNA 4AYUA 1OA4A 4QHBA 4HK8A 5A33A 4XBNA 1PZ8A 1YIFA 4ASMB 2B5HA 4IXLA 1MS4A 2CY6A 2TUNA 5DUUA 3PMSA 3GHMA 1C1LA 1CAWB 3T1LA 2ERFA 1PK6B 1BBT3 1C5HA 3CJIA 4OI2A 4GWNA 3JD72 1OPMA 2RS11 1VBA3 5DZEA 4M3CA 3O12A 2AGSA 1WLCA 5AC93 4Y1XA 1A6CA 3WHUA 2QDNA 2GC1A 2XJTA 3VHRA 1H2MA 4JDMA 1NCQB 3HT2A 1GZCA 4Y4YA 1VRH3 2VVDA 2Z2SB 3VL9A 3ZFEB 5JOWA 4GWMA 2OUHA 2ZGNA 4ZXKA 2R043 3MDPA 2ET1A 3AM2A 1H4GA 5GLUA 4L99A 2D6LX 4LBOA 5FRAA 4N9IA 1MQTA 1S2KA 1VAKA 4Q29A 2YGLA 4YVWA 2RR11 2HWE1 1Q8QA 2H0BA 2W52A 3AMQA 3G6JB 1OOPC 4I3GA 4Q0PA 3WG4A 4BLIA 5T5PA 3AFGA 4AFDA 3J8F1 2PQQA 1DQ2A 5K7PA 4QM9A 4R9BA 1O3SA 2GALA 4FPCA 5B2GB 1GQGA 1DG6A 1WBFA 4LEJA 1RUC2 3RJRA 3WP4A 2EVXA 4AVTA 3NL1A 5J37A 2ZHNA 4PDWB 4F3JA 3ZSKA 1ZRRA 4XFFA 5I0RA 4K40A 3R6SA 2I2SA 1D0HA 4PJYA 3TB0A 2QJVA 5BNQA 5BNOC 1C8NA 5H9SA 2AZ5A 1NCRA 5BNNA 1VR3A 1ZVFA 2ZX1A 3TN92 4N7UA 1POV3 1IPJA 4PLOA 2QCSB 4RA0A 3W59A 1DZTA 3OBTA 4AQSA 4LBQD 5JIAA 3RI9A 3S0MA 1JTZX 1OA2A 1ZZ8A 5HCAA 1V70A 5JOZA 4PLMA 1RUJ1 2A3YA 1LOCA 1HQLA 2EALA 5E1RA 4TSVA 3RMYA 2B42B 3VN4A 1ZBA2 5LK7B 3RYKA 4MV2A 1R081 4DMIA 5L36A 3KS7A 1CJDA 3K51A 4AW7A 3ES1A 2K0GA 1FOD2 1UD1A 4QGMA 1GZWB 1RHI3 2OVUA 3AYEA 4YYOA 1OQEA 3U11A 1WMDA 3ELNA 4FBFA 2DFCA 4JCKA 4X8PA 2JECA 2P17A 1G9CA 1GQHA 1UKRA 2XWJB 1IKQA 2GC2A 4FPOB 2IXLA 2XJSA 3JD71 4LUMA 1FNYA 1O5UA 4CDWB 1NQDA 1QH6A 2A7AA 2DUQA 4FXGB 4JVAA 5A3MA 4OZXA 2RS33 1YXWA 5LRSA 1FXZA 1QDCA 2VY0A 4RSUA 1SCSA 4MYEA 4Y22B 2O0OA 3MFCA 2NP0A 2RMU1 1H1AA 3FFQA 1LULA 3AB0A 4P9YA 5I0UA 3QH7A 2BPA2 3ZN4A 2BWCA 3PVEA 1X36A 1Q3EA 2Y38A 1X8MA 4B7EA 4HSLA 1CAUB 2WT0A 1AR82 2ARBA 3AFKA 2ZGKA 3RWNA 1A3KA 1EAH3 1LHUA 1Y3TA 3VZLA 1XU2A 1ZA4A 3GHNA 3LA3A 3LB9A 4Z92B 2QVSB 4FTSA 3MFAA 2WFPA 4KNCA 1LGBA 1QQP3 4S2DA 4XJAA 1RIRA 1LU2A 3IMNA 3RYPA 1YHFA 5C9AA 3QD6A 5FTTC 3VHPA 1SFNA 1MZ5A 4L97A 3ZSEA 3THTA 1U5ZA 4Y26A 2Q8OA 4YM3A 3V0BB 1RUC1 3QACA 1L3JA 2RM23 1ND3C 4MH0E 5FO9B 4KH9A 1VBE2 4FPJA 3WCRA 1DFQA 1O7FA 2AH2A 1PIV3 3POYA 3LCPA 3IWZA 4HVRA 4XFHA 4MUVA 1I1EA 1LOBA 5D1IA 3ZYPA 4JRLA 3MW4A 1PO21 4P9XA 2D3RA 3NKTA 4QPIB 1X7NA 2A6XA 4HKWA 3WLUA 3VBOA 2UURA 2GZWA 1H4HA 3PNAA 4QPGB 4C1WA 4CDQB 4ZKTB 2P2KA 4LO8A 5L7OB 4AEKA 1FMD2 2ZGMA 2PHRA 4FAHA 5K0UB 3HR9A 4RQPB 1VLNA 1UZZA 2WC2A 2GNDA 3E6CC 1ASJ2 3SCHA 1ZBA1 1ZBE3 3W58A 3JBG3 1REDA 1M4WA 2Z79A 2R32A 1ND2A 4JGZB 3VBHB 4JQRA 3UV9A 4R9CA 2HEYF 1FOD1 1NCQC 4FPYA 4M3CF 3M3EA 1FATA 4Y20B 3ZFEC 1W0OA 3ZFFA 2XLGA 2PAMA 5T5LA 1RUI1 3FLPA 2DTYA 4KWKA 2AUYA 5IUQA 2DCTA 2EA7A 3I59B 3LOBA 3WQ0A 2ZX3A 2GU9A 3MZHA 4WVWA 1G9DA 1V6JA 2V5YA 5GZCA 3AYAA 2D3PA 3GZTB 2EAKA 4Z2WA 3TNPB 1WCSA 4KL1A 4P9IA 4AK3A 2YYOA 4K6BA 1LU1A 1RUF3 1WGPA 1UF2C 5ABJB 4N43A 3OY8A 1WCKA 4XOGA 2WS93 2DCJA 4QU2A 4KU7A 5FPZA 4KG8A 4PDWC 2OW4A 3M3QA 1URXA 2Z5WA 5JLVA 1W6QB 3ZYIB 4RGGA 3KSCA 4CDXA 4A3XA 3OGGA 4IV1B 3OCPA 2XL7A 3AXDA 3I2DA 5KHJA 4WZCA 1QJY3 3IBMA 2XJRA 2ARXA 3LAGA 2PELA 4YGDA 3QH6A 1KXGA 1WBLA 3WDYA 1PVC2 2O8OA 4CEWB 2HWB3 3USSA 4ZU4A 3RRDA 1AXZA 5JAXA 2PHLA 3AX4A 1R1ZA 4BCUA 2FZ1A 2ZABA 1VBE1 2XHKA 2K2SA 1ULGA 1AJOA 1RUG3 4RR3B 4PBPA 3VZMA 1CVNA 3IDCB 1NY72 2H0VA 4CEYA 4YFZA 4Q4X3 3LSDA 5D8AA 5GJ6A 4DRRA 4ISRA 3AZWA 4HVQA 1CAVB 2P3JA 3SISA 4LULA 4ATFA 3MIDA 1H1IA 2SBAA 1REFA 4BA6A 3USUA 1Y7BA 3VZOA 4AEDA 1FMD1 1SLBA 3VZKA 2XH6A 2ILMA 2R062 4CDWC 4HKLA 3GALA 1ASJ1 2A6YA 2KA3A 4NN0A 2CTVA 2GH2A 1LR5A 5FO7B 4ORFA 4HZFA 1QJU3 3FBMA 2YY1A 4YG0A 3M3OA 3KD4A 3H0OA 1R093 2JICA 4OULA 2YV8A 5IK8A 1C5IA 2OA2A 1XYNA 1WCDJ 1Q56A 1ZRDA 2FBEA 1ZZ6A 2ZKLA 4UBHA 2XGXA 4YZ5A 1LECA 4EWDA 2DVAA 2FZ2A 2PLV2 3KB5A 4I30A 4HETA 1MR5A 1YJKA 3WDUA 5KHHA 1AR63 3WZ1A 1IHMA 1XYPA 3ZFGA 1PO12 4HANA 4XIKA 2SLIA 5T5OA 2EXIA 4NO4A 4JC1A 5CB7A 1HXS3 4GXLA 2ZACA 1YO8A 4OHXA 2FHRA 1G9BA 3HBZA 3VBRA 2ZMNA 1FPN2 2CGOA 2TNFA 3SH3A 1HQNA 1RMU2 2R30A 1UX6A 1AR93 2BVBA 5GZFA 4YVSB 3R05A 4H14A 2P3IA 4B4QA 1IZ3A 5EYYA 4YZ2A 3O5SA 3VHNA 4MGKE 5JZGA 3H3UA 1SCRA 4QPIC 5T50A 3N7MA 2D3SA 4XMAA 3VZNA 4OLLA 1PNGA 3KT4A 4B4PA 1K5MB 2CGPA 4QPGC 4CDQC 4M0HA 5L7OC 3A4UA 5K0UC 4RQPC 1YJLA 1NXD1 1GBGA 2JD4A 1LHOA 2WWSA 4Q1RA 5AFEA 1AX2A 2ES3A 2G4IA 2PN5A 2BTVC 1OFSA 1O5LA 1Q8PA 2ZGOA 4AI3A 4N9HA 4JGZC 4D7SA 1NY71 3AZYA 3JUUA 1X82A 1KDMA 4R9AA 4RS5A 1W0PA 1U5IA 4IEUA 3W9AA 2WQ4A 4IQPA 4UW6A 1AL21 2PHDA 4IESA 4N90A 3WP5A 1SDWA 3M3CA 1TMF3 4FQZA 1EPZA 4MXWB 4D7TA 1RB8G 1XRUA 1DBNA 4CDUB 3ES4A 3FJSA 2VOKA 2RHPA 4C1XA 2ZKNA 1AUYA 1JYCA 4B4RA 2HWF1 3ZYRA 2VQ0A 1HRI2 1TQ5A 3IDBB 3MI8A 2ZHMA 4OI1A 4C0HA 3WOGA 2BQPA 5KXEA 3Q9OA 1KFUL 4XF0A 5H9RA 1KS5A 4AVVA 4QXKA 2A71A 2EXJA 2BVVA 1BCXA 4J6GA 3IM0A 5IT6A 4M0NA 1BEV2 2NMOA 3WDVA 4DZGA 2W0XA 3WX5A 5ABJC 4QQLA 1S2BA 5BNOB 2A6WA 1YRZA 2PLV1 2BEOA 3NV4A 2HWD3 1QXRA 4R4ZA 4OHZA 3LA7A 3KZ4C 4LBMA 1S0BA 4AG4A 3IDEA 3HQXA 4IV1C 4QD2A 5J98B 1CAWA 1PO11 4A7ZA 1OSGA 1QXPA 2JG9A 3EJKA 1PK6A 3WV6A 4L8QA 4LBJA 1MEC3 2MEV1 2AREA 1TME3 2PYTA 3HN1A 1WW5A 3V56A 2XG3A 1FPN1 4CEWC 3B9CA 2TBVA 4NPRA 4YM0A 2PAKA 1CONA 1RMU1 2Q4SA 2R042 2W08A 4RGAA 3PVOA 5GLWA 4AHYA 2MHFA 5BNPA 4JV4A 1G9AA 4K3UA 4WM8B 1W6PA 4UW5A 2VG9A 3DN7A 4WVMB 1O3TA 3CLPA 2DCYA 4U36A 1AJKA 1RTVA 1MS0A 1X33A 5CFCA 4AI2A 4FP2A 3R0RA 4E27A 1RC6A 4B3NA 2B9UA 4QT6A 2XVKA 4URTA 1B35A 4X8NA 2R1BA 2WNEA 4JGYB 4YM2A 3VBFA 4YW4A 2JJ6A 2RE9A 4QQ2A 3SNMA 5ACA3 5CA6A 3EQEA 4FVVA 1EPWA 4IL7A 1O4ZA 4CP1A 1F9KA 3POSA 5T3NA 2ATFA 4E4DX 3APBA 1VBD2 3HIFA 1XNKA 4P9WA 5JOXA 5FAXA 3B94A 2D7FA 3WINE 5LRRA 2A6ZA 1EYBA 1RUH1 3WG2A 4AGGA 3ZN6B 2NN8A 2I07B 4XIOA 5C4WA 4I02A 4AVAA 5FO8B 2GNMA 3NAPA 5I0SA 1HRI1 2WL1A 3WUCA 1V6IA 3E6BA 2R6QA 4FPGA 3VKFC 5LEKA 1C8M3 2IXCA 1IGOA 2O1QA 4JDNA 1A8DA 4YW1A 5LK5A 4AI8A 2A70A 1VBB3 1BEV1 2K9ZA 4WBBA 4RHV3 3JB4C 3VBSA 5CG9A 1PGW2 1RJ7A 1D2QA 1GLHA 2BFUL 4YVSC 1WW4A 2XBO3 2Y0OA 4IEOA 4IERA 4XF9A 3ZSJA 3N35A 5DDJ2 4EN8B 2D6NA 2QFEA 3AKSA 3RS6A 1FX5A 2E53A 2GMMA 1IQAA 2RS32 4AFMA 3K48A 1LJ7A 4NVPA 1AX0A 4B29A 5C8CB 1K5MC 4GB33 4YRDA 3O0XA 5AVAA 5KC6A 3WQ1A 5A32A 2C9AA 1LOFC 5KHIA 2R041 3H1MA 2BWAA 2A5ZA 1OFNA 1AXYA 1AX1A 1EV13 1W6MA 4LBKA 1QJX3 4LTAA 4FOQA 3WW3A 4INDA 1C1FA 4FCAA 4GMP0 4N53C 4OFGA 5DUWA 1LOEA 2R0FA 4PLNA 1GICA 4YFWA 1RINA 5FFOC 4BYYA 3OYWA 1SLIA 4ASLA 3AZVA 3KGZA 2DVBA 3ZPYA 4Y1YA 4QQOA 4LBQB 5FMOL 3OD0A 1MACA 2GC0A 3FLRA 1O4TA 3IPVB 5EXOA 1GNZA 4YLZA 2D40A 2RS13 4IV3B 4OVEA 4PIYA 4CDUC 2BNOA 3OPZA 1J3QA 2B7YA 2FMDA 4W6WA 3L2YA 4I2OA 1ZNPA 5H9PA 1DDLA 3B5LB 5JPMB 2WZPP 3LGRA 4CEYC 5BUVA 2LTNA 1IKPA 1AXKA 1QHDA 1O91A 3FX3A 1PIV2 3KCCA 4M00A 2WSVA 5J7MA 1EY2A 4QQPA 4HK9A 1UPSA 1XYOA 2VUJA 3SH5A 1VBD1 2MPFA 4XQ4A 3E5UA 3KLSA 3G7DA 3H7JA 4JTNA 5T52A 1AF9A 3RNSA 1POV1 3NW4A 1MVEA 3GBGA 4LNVA 3NV2A 3HWJA 2HWE3 2WIIB 3T2TA 3H1WA 1SLLA 1D4VB 4BQ1A 3CNAA 2D6OX 4FXKB 4XF1A 3VBUB 1KITA 4LO4B 3ST7A 2PHTA 3JBG2 3J8F3 2JG8B 4XE9A 4BZ4A 4DOUA 4LLFA 1BYHA 3NSTA 1O3RA 4Q4V3 4A2UA 4I0AA 1COV2 3I54A 1IPKA 1DGLA 1ENRA 1I5ZA 5JCTA 1CX4A 4AE2A 1GKBA 2BUKA 1GR3A 4B7KA 1NA1B 1QXJA 2RS52 2WNUB 1Q8SA 1ZRCA 2ZMKA 1PGW1 1BK1A 1V6NA 5DZGA 2HKXA 3VBHA 5I8YA 1FT9A 4UXAA 2D5FA 2LALA 2LUWA 3ZO0B 3FFZA 2AYHA 4WM8C 4OUSA 3N3HA 1PZ9A 5CFDA 3AMHA 2F4PA 5DDJ1 1VP6A 4IEYA 3B9IA 1T6GC 4XEZA 4GH4A 1J3PA 1LHWA 3IT8A 3WDXA 5CIRA 5F6KA 5FCCA 1OLQA 3V0AA 4GMP1 4Q4W2 1OKQA 3MYXA 1JN2P 5A33B 3R4UA 1XXNA 1RUJ3 1DGWA 1LOGA 4XJUA 2MNGA 1UIJA 5KC5A 1RUF2 1W6NA 3ZIXA 4BMBA 4NR1A 2X29A 2ZS6B 1SLCA 4JGYC 5K9YA 2WS92 2YPJA 1SBFA 1WW7A 4XFCA 4YARA 4R52A 3MICA 4R4XA 3CJIB 1HV0A 4Y1VA 2GN3A 1KQRA 1S0CA 1SBEA 1YLLA 4A7KA 5CVRA 1MS9A 3P3NA 2I74A 1PM7A 4M3CB 1AR72 2XJUA 4XETA 3OF1A 4NWVA 1YUDA 1QJY2 5HI0A 2DCKA 2CAUA 1N47A 3JD73 4NOTA 1VALA 1YFUA 4W6YA 1J58A 2AENA 4WM7A 5BPXA 1Z7S3 4TYSA 3AZZA 1WUVA 2ZAAA 3ETQA 1UN1A 2BNMA 1MQTB 1NE4A 3ALQA 1UKGA 3AK0A 2IFWA 4ATEA 3VUOA 2DUOA 2RMU3 4XYXA 2QKDA 5J09A 1UPIA 1OHFA 2JDZA 3VGIA 4AHXA 3AKRA 1UCXA 3ZX7A 4OI4A 1NQJA 3ZDSA 2VMGA 1DGRA 3TN91 3VDDA 1JXNA 2VXRA 4DS0A 1MZFA 4YW5A 4HVOA 4EN6B 2DUPA 5FLIA 4KWJA 1SMVA 1KJLA 3MEPA 4P9LA 1N1TA 5C8CC 1COV1 4L2NA 4KQ7A 4IEWA 1R092 1RUC3 3PMEA 1RVF2 2D97A 1C3HA 1NCRB 2E7TA 2RS51 1BZWA 2WNVA 3PJQA 3FHIB 5BNNB 5KBFA 5BXXA 4LO6B 3AJZA 1H30A 2RJKA 3WXPA 3MPPG 2ZZQA 3AYDA 3DKWA 1I3HA 1PO23 4PF5A 4UW3A 3FZ3A 4KWLA 1A8MA 3KGLA 1ZM1A 3MW2A 3KCYA 4FOYA 3SXWA 3O14A 1U5XA 4Q4W1 1A78A 4F8AA 1KS4A 1U5YA 2D93A 2O8QA 4XZPA 1PNFA 1HLCA 3WHTA 5I91A 4IV3C 4EJRA 1IS4A 1HW5A 1WLDA 3AKTA 2VNRA 3D82A 2UY9A 3URFA 4KBBA 4OHYA 5KXCA 3UKVA 2WS91 1H8TA 2QUOA 4K1YA 3QLQA 1SFYA 1SACA 1W6OA 3VV1A 5JSRA 1MZEA 4GALA 5FLHA 1V9U2 4SLIA 2D6MA 2VUAA 2Z69A 4ES8A 1D4M2 4QQHA 3DPRC 5DUXA 1ZZBA 5HCFA 1AR71 3SMHA 2R073 3WW4A 1RUI3 2ZTNA 2GN7A 3CEWA 3VZJA 1QJY1 4BE3A 1VAVA 4ITCA 1AR81 3RMXA 1QF3A 4AFBA 3N7JA 3BOPA 1G8WA 2VW2A 2X5IC 4DQAA 3AP7A 5HBAA 5KXBA 1ZZ7A 1LOAA 2WFF2 1C57A 4XMIA 3OGJA 4HPKA 1RUD2 3UJOA 3I4IA 2NM1A 3VBUC 4XBQA 1BVP1 1F5FA 2JG8C 4DFSA 2E6VA 4R8HA 4NHLA 5JSOA 2Q5TA 4J1WA 3D6EA 4XTMA 2IXKA 3M1HA 1AYM2 3KCXA 5JSPA 1NA1C 2WNUC 1CAXA 1S0FA 2GDFA 4UBGA 3ZYJB 1HX6A 1LHNA 3AKQA 3M7AA 4FPHA 1TMF2 2ZGUA 4HT1T 1R1A3 4LBNA 4LUKA 2FQPA 5C9AB 4HBNA 1TE1B 3VLBB 4ES9A 1N1VA 4PIZA 3RPQA 5FREA 3BCWA 4AGVA 3WW1A 3QBQA 2YUEA 1G86A 3BOWA 5JVVA 2YC0A 1ENXA 1OOPA 4L11A 1JUHA 1R091 2VMIA 4LHLA 1FAYA 5DG1A 1RVF1 5JOYA 3H50A 4TLFA 1Z78A 2I45A 2WQZC 4BHPA 4WVZA 4DINB 2CWSA 3FUQA 5I8SA 3VBOB 5FQ0A 5EV7A 5DXDA 3ASIA 3C3VA 3CJIC 1CESA 2DCZA 3J26N 4XXAA 4CTEA 4YSFA 5LEJA 2XB6C 3WP6A 2ZGPA 2PHFA 2PHXA 5BNOA 2OYZA 1FMD3 3AP9A 2NMNA 1OMIA 1ND2B 2NPIA 3C2UA 4HSJA 4U2AA 1MEC2 5FPXA 1GV9A 4AGRA 3M70A 3P3PA 2WZR3 5JMCA 1CJPA 3RSJA 1N1SA 2CWMA 3ZFFB 1WMFA 5JIUA 5T55A 1N3PA 3DGTA 5C33A 1H2NA 4TWTA 5J3UA 1B09A 2DFBA 2QQPA 2JEMA 2XJPA 1MQTC 1V9U1 4YVWC 2G9GA 1RITA 1MS3A 1D4M1 2XWBB 3ACLA 4K20A 1MZ6A 2BBVA 4Q8KA 1BKZA 4XXPA 5T54A 2PHWA 4MLOA 2X53S 2OIIA 2E51A 4X6RB 2A75A 3IKWA 2WFF1 4O9EA 1YIPA 3JQXA 2F6BA 1RUD1 4KU8A 4N43B 3OY8B 4W6XA 1PVC1 4FTEA 4Q4Y2 1LTEA 1CGPA 2Q0AA 4Y1ZA 3U4XA 2C1FA 2HWC2 4KGGA 4CDXB 1ZZCA 4FO9A 3WT3A 4AQ2A 1AYM1 1RUE2 1NCRC 3LA2A 3H3ZA 4Y5Z0 2HEVF 5BNNC 2BYVE 1TMF1 4LLOA 4N53B