3LBSA

Crystal structure of the cytoplasmic tail of (pro)renin receptor as a mbp fusion (maltose-bound form)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
372
structure length
372
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDRELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAADPGYDSIIYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the intracellular domain of (pro)renin receptor fused to maltose-binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose-binding periplasmic protein, Renin receptor
total genus 120
structure length 372
sequence length 372
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lbsA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3lbsA01
5CBSA 4IGRA 3K1PA 4DXUA 4GD5A 5FTHA 1FTLA 5JK4A 1O63A 3OO9A 1NH7A 3IB2A 3OO6A 4YU0A 4DLDA 2XXTA 2XX9A 5EYFA 1BKAA 1FQDA 2HCAA 4N07A 1EZ9A 1SI1A 2HEUA 2V3QA 3CFZA 2XXYA 4DE8A 2G93A 1OQHA 2XXHA 2ZXTA 3O2AA 3C31A 3TODA 1R9LA 1ZMGA 1SW1A 3FIRA 4ZZAA 3DELB 4KD5A 4OESA 3BKIB 1H43A 3OSRA 1YCJA 3K6WA 3RTWB 4H5GA 4NF8A 4WXJA 1RYOA 4ZEBA 3MC2A 1NNFA 2QS2A 1Z7NE 3E9XA 5CMKA 5KDTB 4F39A 5ITOA 3VLVA 1OLAA 2ZYOA 1A8FA 4FIMA 1IXHA 1US4A 3FXUA 5I57B 4POWA 4HCWA 2OBGA 3EHTA 3PUZE 3VDFA 1BLFA 4U21A 5ICTA 4H8JA 3QSLA 4IO5A 3DP8A 1WVJA 3BFTA 4F31B 4M1VA 5IKBA 1USYE 3S9NC 2DE2A 1R6ZA 3H6UA 3IB0A 4OXVA 5HM4B 1T0KA 1Z7ME 3VFJA 1Y20A 2E1SA 2UYFA 2Z23A 3IO6A 3M3KA 4GXAA 4P0GA 4F3GA 5B70A 5L9SA 5FHOA 3HSTA 3GXAA 3SEUA 1CE2A 3PPOA 4BDOA 3H4ZA 3DP6A 3M3FA 1B3LA 3H3GA 3TTKA 1SDXA 2A5SA 2FA7A 4LZ7A 3MW0A 5H8FA 3G7WA 3RY3A 4ELQA 1B40A 3MQ9A 4PE5B 1B0LA 4JWOA 4YB5A 2A5TA 2PT2A 3K6XA 3KN7A 3VLWA 2RC8A 4YZZA 3LUYA 1UTBA 4NMYA 1H76A 3TPAA 2I3WA 2XXVA 1IUDA 1B05A 4Q30B 3TTMA 2YLNA 1LB8A 3IO4A 3O28A 1TWYA 1D9VA 4AB5A 3FV1A 1UIUA 4IY5A 3G3HA 4YB6A 4C1UA 2Z22A 1LAHE 2KLFA 2DVCA 3N5LA 2UVGA 3PPRA 1NH8A 4KYDA 5TPAA 3K2DA 4EQBA 2VHAA 3PMXA 3UP9A 1RYXA 1Q35A 2I6EA 4R6YA 3TTNA 5AA2D 4KI0E 1UIVA 4AB6A 3FJGA 4MF3A 5CRYA 3MVYA 4DXCA 1SVXB 4DCYA 4F22A 1EZOA 4F1UA 4I62A 3E13X 2DSFA 3KOTA 4NF5A 4R6KA 2I4CA 2Q88A 4OHNA 5L8DA 1H44A 4NF6A 2DS9A 3ZKKA 1BP5A 3N6UA 5TU0A 4Q0CA 1LBCA 3PPNA 2RCBA 1MXYA 2QSXA 5A5XA 1FQFA 1B9JA 1IQ7A 1LAFE 3HCQA 5J1DA 2I0BA 1OIBA 3M3LA 1RKMA 2O51A 4RK2A 5FHNA 5I57A 4IGTA 1MS7A 5EHMA 2X26A 4IO3A 2AL4A 3CFXA 4JSOA 4R2BA 4X1DA 2H9BA 3MZ1A 4OERA 3S4UA 3C9HA 3TCGA 3TQWA 1GGGA 2OWTA 2Q8JA 4RYAA 2H25A 3PMWA 4U22A 3P7IA 2F35A 3TTLA 5KCJB 2HQ0A 1ZBMA 4KR5A 4NF4B 2O69A 5DTBA 1FQEA 5EHSA 3L6GA 3KJTA 1SD3A 3G3FA 4YKKA 1FQAA 5TP9B 2RINA 3SEVA 4OWDA 4GVOA 2D21A 2DWAA 2CMOA 2UVHA 4HCYA 1Y4TA 4PETA 4FEBA 3H6TA 3I3VA 4GIZA 3U1OA 1PB9A 2ESNA 1AH5A 1N7XA 2Z8FA 3FGSA 3T66A 3U93A 1N0TA 3QIMA 3LBSA 3UN6A 1LFHA 3FZVA 3KZGA 4G4PA 1NNTA 3IK6B 3MPKA 4OZ9A 3TDJA 3MZ9A 3ONMA 3N6TA 4MLVA 4BDQA 1NL5A 4H1XA 3OO8A 1A7LA 3AXFA 2F7BA 2F8DA 4WKMA 5CI5A 3MVXA 1MG1A 1PBPA 4GQOA 3TYHA 4XKNA 4LVQA 3OMBA 4EQ9A 1AL3A 2VGQA 1LSTA 4R73A 4GL8A 3TQLA 2NOOA 2VP1A 2ONRA 2ALUA 1BTJA 3O6IA 3OEKA 1FQCA 3A3CA 1A99A 4X48A 5CMCA 3C36A 2OLBA 1YTVA 3MVZA 3T93B 2Y7KA 1ZIUA 2I3VA 3FASA 3TCFA 4ZEDA 3H03A 4R74A 5I2NB 4LZ5A 4IO4A 2ZYMA 4MH5A 4QFLA 2PT1A 4OFLA 4OFJA 3FJMA 3U94A 3T9XB 4DXBA 4F3BA 3CSBA 5L9OA 5F7VA 3JV9A 1PEBA 1Y1ZA 4KPTA 1UTHA 2ZYNA 1IIWA 3KN8A 1IEJA 1PC3A 4EXLA 1ZTYA 2XXIA 2O7IA 3PPPA 4KFQA 4R6HA 1B6HA 2Q2CA 5BWJA 3MBPA 1TXFA 1D3KA 4GF8A 5F1QA 4EF2A 2G29A 2I58A 2P2AA 1Y9UA 1FW0A 1US5A 2PMSA 4F3SA 2RC7A 4HS7A 4P0IA 3T9HB 1PB8A 2DE4A 3C35A 4ND9A 1B3EA 4O3AA 4PP0A 3Q27A 4R2FA 4ZDMA 4Z7EA 4ZEIA 2HFBA 3R6UA 4KCCA 4DDDA 1A40A 1MM6A 5KZTA 1IZ1A 3UIFA 3RNNA 3QXMA 3T9VA 4ZZEA 1POTA 3DM0A 3E3KA 4U23A 1POY1 1WDNA 1JW4A 3IR1A 1S9TA 3TKDA 4JWXA 4XKQA 2F7AA 2GRVA 2H99A 2OCUA 3MWBA 1URGA 3Q25A 2ZNTA 5H8FB 4WEPA 1QKAA 2Z8DA 1SBPA 3K4UA 2UVIA 1B5HA 3SDFA 2LAOA 1MDP1 4I8CA 3PU5A 2DWHA 2P1SA 4QSEA 3LSWA 3O97A 4R75A 4QRZA 3USDA 4F18A 4KCDA 2QL3A 4KYSA 4N13A 3VVDA 1FTMA 1QUIA 1Y3PA 4ZE8A 2XXPA 4JWYA 1S50A 1URSA 3TELA 2ZYKA 3KG2A 3S9LC 4FEDA 1S7YA 2R9JA 4RA1A 1M5DA 3S9EA 1WODA 2QMXA 3ZS6A 3I5OA 2E0SA 3IJXB 3SEXA 1N84A 5I58B 5AA3A 4H0WA 4LUBA 2X7PA 4NEDA 3HV1A 2IEEA 1VFEA 1ZJLA 3GBAA 3LSFB 1JW1A 1B4ZA 5CMBA 4F2OA 4NWCA 3O29A 4OMBA 5DYHA 4BDMA 3ILTB 3V5AA 4FAJA 3FV2A 3GBBA 4PFTA 4ESXA 4NF5B 5JTYA 1N76A 4QHQA 1ANFA 1PB7A 4OEUA 5A5XB 5JEIA 2HXWA 2YJPA 5DVFA 1SYIA 4F1VA 3FUZA 3DLNA 1XC1A 2DXRA 2YPNA 4G77A 3VVEA 3E4RA 1VSOA 4LP2B 1OVTA 3CFLA 1HSEA 1NKXA 2NWJA 3EHSA 1MQJA 4DCXA 2QPQA 3RGYA 4BDLA 1JQFA 1B0HA 4WEDA 2B65A 1CB6A 2OK2A 2QRYA 5FHMA 3K1MA 4YKIA 1Y3QA 3C34A 3A3UA 2M8CA 4FE8A 3CSGA 3CR9A 4X1BA 2QS1A 1LFIA 3D4CA 3MAMA 1MXVA 1P99A 4UACA 2F34A 4UA8A 5AE4A 1NFTA 1SW4A 3B6WA 1IXIA 4G2ZA 1M5BA 2O68A 2AYSA 3KGCA 4N6PA 5DEXA 3JZJA 2XXWA 5I56B 4R9FA 2Y84A 3IL1B 4YKPA 3RQTA 2D3IA 4I1DA 1B32A 3FVGA 5TPAB 3OO7A 5FTIA 5CBRA 2GHAA 1VR5A 1H3DA 3CVGA 4IO2A 3ZSFA 1O64A 2ZMBA 3HO7A 3IJOB 1MM7A 2H5YA 5CC2A 4JXIA 4BDRA 1UQWA 2AL5A 1B1XA 3EF7A 3A09A 3IX1A 4JSDA 4QSDA 3SERA 4LZ8A 4NF6B 5BUUA 1B58A 1J1NA 3RTFB 4E0XA 2HZKA 1I6QA 4IO7A 3QUJA 1Q1KA 2Y7PA 4ZE9A 2B3FA 1MQDA 3OENA 1LCFA 3UK4A 2I4BA 3K01A 5I58A 3WAFA 1UTHB 3G3IA 3U8QA 1MDQA 3U92A 1MY1A 3GZGA 4F2QA 1DSNA 4YMAA 3ILUB 4F29A 3K0VA 3VV5A 4Q5TA 3I6VA 3Q26A 3IB1A 4AQ4A 3CG1A 3RN8A 3MP6A 5DVIA 4H67A 1I6BA 3SESA 2HAUA 2F97A 1MXWA 1F9BA 1TFAA 4RY1A 1P1NA 3LC8A 3PPQA 2Q2AA 2ZNSA 2QMWA 2NUVA 1H45A 1SW5A 1YPNA 3QYTA 3OD7A 1QUKA 4YB7A 1B7HA 1B3HA 3PGFA 4ZEKA 1MQHA 1LLSA 4G8HA 4PFWA 3F11A 1DMBA 3H6WA 3PD8A 3PUVE 4U2RA 1GV8A 4H6DA 3C32A 2IA4A 4ISUA 5AA1A 3K6VA 3V8XB 2NXOA 1BIYA 3G3JA 3K1NA 3VXBA 1GTKA 3KFMA 4XXUA 2XXRA 2PVUA 5H8QB 3BBRA 3T22A 4OQOA 2VOZA 4G8MA 3Q29A 4ELPA 4EQ7A 3LSLA 3OXNA 1TFDA 4NWDA 3FATA 1N04A 1P1WA 1I69A 2FYIA 3G3KA 2V3TA 4K3FA 1N3WA 1MXUA 2Q9TA 4XTCQ 4ELRA 1QVSA 2XX7A 3FVKA 2THIA 4FECA 1B2HA 3FD3A 4ESWA 1JEUA 3OEMA 4X9TA 2ANJA 4M4GA 1MY2A 1OVBA 2Y7WA 4O3CA 4RPNA 4TQUQ 5ELVA 3C4MA 1PDAA 1XT8A 2REGA 5H8SA 3SEYA 2F6GA 2ONKE 2V93A 4HTGA 2R71A 2XD3A 1B4HA 4IB2A 1ELJA 3K6UA 1B1HA 3QUFA 2O1MA 4POXA 3RT6B 3W15C 2ONSA 4PQJA 5ITPA 4BDNA 5B7DA 5H8HA 1N7WA 4LQ2A 3B7DA 5L9MA 2OJTA 3D4GA 1GR2A 1IITA 4ZS9A 4OENA 4U4XA 4DIGA 5I2KA 2QS4A 3UORA 1LAGE 2GFEA 1M5EA 1NNKA 3IAZA 4NF8B 3B6QA 1JW5A 1XVXA 3MUQA 1M5CA 3VVFA 4E0WA 2QJEA 4ELOA 3TCHA 3K00A 1LFGA 2DQVA 1P1OA 3IOTA 5CMMA 2GHBA 4EF1A 2B3BA 3OSQA 1Y4CA 1DOTA 2F7CA 2F6PA 4YAHX 2I48A 3QK6A 3PV0E 3T96B 1AMFA 1MY3A 4XKPA 3W9WA 3ZKLA 1B3GA 1DPEA 3MZBA 1I6AA 4KHZE 1B5IA 2CZLA 2OWSA 5I56A 2QS3A 5H8NB 3THIA 5HPQA 5AA4B 5I59A 1D4NA 2F78A 1IXCA 2P0SA 2I0CA 4FJPA 1KWHA 3TAJA 4U4SA 5CM6A 5DT6A 3MVWA 4TOZA 4U1OA 1B7UA 3U72A 4BLAA 2DWJA 1MH3A 5ICQA 3EPEA 3BFUA 4XKRA 1MPCA 3CI8A 2RC9A 3ECRA 1OLCA 2AIXA 3PD9A 1ZU0A 1ZLQA 4G68C 1Y1MA 1LGBC 4EUOA 1II5A 1NNPA 2RCAA 1OMPA 2VD2A 4JB7A 2NVUB 3O66A 1A55A 1LAXA 1LCTA 2UXAA 4O3BA 3VLUA 3TEPA 3H6VA 4F1YA 4H65A 3HHGA 4KYEA 2OZZA 1MY0A 2UVJA 3H06B 4U1ZA 1MPDA 1O7TA 2F36A 3IOUA 1B7ZA 4Z0IA 3LSXA 1SYHA 1XS5A 2DYXA 3CIJA 2XXQA 1YAEA 2O84X 2VD3A 3LR1A 1HSLA 2XX8A 3KSJA 5H8HB 3RPWA 5LOMA 3S9MC 1URDA 5KDTA 3O6GA 4QFOA 3QAXA 1HSJA 3KSXA 2X7QA 4R72A 2O1LA 3JYRA 1FTJA 4ZECA 4C1TA 3V83A 1B3FA 1B52A 1SQYA 2HZLA 2RF1A 4HW8A 5AA2A 3MPLA 4L17A 2XHDA 4OFOA 5I2KB 1MH4A 3W9VA 2UYEA 2XD2A 1Y3NA 4H5FA 1QW0A 1DTZA 1VFDA 4RK9A 1GVCA 2H98A 3UA8A 4DZ1A 2HAVA 5DVJA 1XHYA 1MPBA 1PBQA 5AA2B 2REJA 4LA9A 4OVJA 1ATGA 2GH9A 4I9DA 1USYH 4QSCA 1EH3A 2PYYA 4JDFA 3O9PA 1LBBA 4OYVA 3SETA 3T9UA 5IAIA 1P1UA 2DWIA 5DEXB 4ONYA 1EZPA 3PMVA 1A8EA 3C33A 4GL0A 4YKJA 3R26A 4G68B 4GOTA 5H8QA 3R7XA 3Q28A 1R1NA 4GWOA 1FQBA 4R9GA 4KQPA 3L6HA 3K02A 3N26A 4JBZA 1AIVA 3TMGA 4MLQA 5AA4A 4NF4A 4G8NA 2D5WA 3M8UA 2A5TB 4YICA 3V89B 4GFRA 5TP9A 1MRPA 4Q8RA 3HHFA 2ABHA 3OELA 4PFYA 3PUWE 1MY4A 2DP8A 3PUXE 4OETA 4TLMB 3TTRA 5HBCA 1JVYA 1D9YA 2PBWA 4QFPA 4LATA 2DXYA 4F3PA 1QKBA 1B5JA 2DE3A 4MBPA 1DPPA 2V25A 4OTEA 3PUYE 1JVXA 4LQ5A 4P11A 3HPIA 3OOAA 1FTOA 4RPOA 1R9QA 4ZEFA 3TUSA 2DOJA 2XXUA 1IXGA 2Q89A 4GXSB 2WKYA 3DP4A 3KBRA 1QJMA 3ODBA 3UGWA 3RUMA 2V3UA 3TFLA 1JEVA 1EU8A 3RT8A 3VE1B 3KEIA 4EXKA 1A54A 2O6AA 5I84A 1QULA 4QFKA 4RNSA 2O7UA 5M2VA 4XIGQ 3MP8A 4THIA 1M5FA 3FVNA 4FATA 1FCKA 2R6GE 3FVOA 4GLIA 3EQ1A 1MXZA 3GLBA 5I2NA 1XVYA 2Z8EA 4F19A 4IO6A 1NMUA 2V84A 2DVZA 3HN0A 1JETA 2BJJX 3KN3A 4ECFA 1MQGA 4NE4A 4TLLB 3S2VA 1P1QA 2F5XA 5JTYB 1L5TA 1N3XA 3FXQA 3KJ7A 3EN3A 3VXCA 4H8IA 1OQGA 3RLFE 5K2YA 4PFUA 3O6HA 3SEWA 3EHUA 1TT1A 1MQIA 3CG3A 3MP1A 1SI0A 2PX1A 5ISUA 4FORA 4NTLA 3MJNA 4YMBA 2ZNUA 2Y7IA 4GRKA 1FTKA 1AOVA 1VE4A 3CRBA 3KOSA 5K2XA 2Y7RA 3IORA 3IOVA 3N94A 3WAEA 1ZKBA 5KCJA 5H8NA 2RKMA 1UTBB 2XXXA 4RXLA 5I59B 3IOWA 2I49A 1JNFA 4IY6A 1XOCA 4LONB 4QFNA 4EDPA 4QF9A 4RJZA 4OEVA 1LB9A 2H4IA 3B6TA 1B46A 1B51A 3H7MA 4MFIA 1MXXA 1SW2A 3FJ7A 1QUJA 2W7YA 3SKPA 3FXRA 2FNCA 3G3GA 4G68A 3TZAA 1DTGA 4C0RA
chains in the Genus database with same CATH superfamily
5CBSA 4GD5A 5FTHA 2CZKA 2XX9A 4DI3D 3E79A 2ZXTA 3TODA 1R9LA 1ZMGA 1SW1A 4ZZAA 1H43A 1YCJA 3K6WA 1RYOA 4ZEBA 1OLAA 4I40A 2OBGA 1BLFA 5ICTA 4M1VA 2DE2A 5HM4B 1T0KA 2Z23A 3HSTA 3RPLB 3H4ZA 2A5SA 2FA7A 4LZ7A 1B0LA 3K6XA 1FBFA 1UTBA 4NMYA 1B05A 2YLNA 1LB8A 1TWYA 4C1UA 1IMFA 2HHMA 1RYXA 1Q35A 2I6EA 4R6YA 4KI0E 1UIVA 4AB6A 4DXCA 4PFIA 4F22A 4I62A 3KOTA 2Q88A 4OHNA 1DBZA 3PPNA 5FBPA 3CHGA 2QSXA 5J1DA 1OIBA 1EYKA 3MZ1A 3TQWA 4OVSA 3PMWA 3P7IA 3L6GA 1SD3A 4YKKA 5LOMA 2DWAA 1NV6A 4HCYA 3H6TA 4GIZA 1PB9A 1N0TA 3QIMA 3FZVA 3KZGA 4PBHA 3IK6B 3AXFA 2F7BA 2F8DA 4PAFA 3MVXA 1MG1A 4GQOA 3TYHA 4N17A 1AL3A 1LBWA 4R73A 3O6IA 1G0HA 3A3CA 4X48A 4GBWA 3T93B 4ZEDA 3H03A 4R74A 4IO4A 4MH5A 4DXBA 3GYYA 1UTHA 2ZYNA 1IIWA 4EXLA 1PC3A 5BWJA 1Y9UA 2PMSA 4F3SA 3HFUA 1PB8A 2DE4A 3C35A 4O3AA 4Z7EA 2OWZA 4ZDMA 3R6UA 4DDDA 5A5LA 1POTA 3E3KA 4U23A 3IR1A 3TKDA 5IZ1A 2H99A 3Q25A 1QKAA 3MYUA 4P56A 1DCUA 4JWYA 3TELA 1S7YA 3S9EA 2E0SA 3SEXA 4NEDA 5JEIA 3GBAA 1NV2A 1JW1A 5DYHA 4PFTA 4ESXA 4QHQA 1PB7A 5A5XB 2HXWA 1VSOA 3EHSA 3RGYA 4UABA 1JQFA 4NAPA 4P3LA 1FPFA 3K1MA 3C34A 5ESYA 4FE8A 4X1BA 5AE4A 1SW4A 1M5BA 4XFEA 5DEXA 2Y84A 3RQTA 2D3IA 3OO7A 5FTIA 5CBRA 2GHAA 1VR5A 4JXIA 3A09A 3IX1A 2XXKA 2P3VA 4LZ8A 1B58A 3QUJA 1Q1KA 2CZHA 4ZE9A 2B3FA 3OENA 1FPBA 1K9YA 3WAFA 3U92A 4YMAA 3ILUB 1QGXA 3CG1A 1AWBA 5DVIA 5EYGA 1I6BA 4OVQA 4RY1A 2Q2AA 2QMWA 2NUVA 4YB7A 3OD7A 1MQHA 2XWOA 3F11A 4H6DA 5AA1A 3K6VA 1GTKA 3KFMA 3A29A 3T22A 5EQ8A 4OQOA 4MHFA 2VOZA 4G8MA 4ELPA 1I69A 2WYPA 2THIA 1B2HA 2ANJA 4M4GA 1OVBA 4TQUQ 2Y7WA 4PCDA 3C4MA 1PDAA 2REGA 3SEYA 2R71A 3QUFA 3K6UA 3W15C 4POXA 3RT6B 2ONSA 1N7WA 4LQ2A 3B7DA 2OJTA 4U4XA 5I2KA 1RDYA 1M5EA 3MUQA 2DQVA 5CMMA 3OSQA 1NV4A 1IMCA 1AMFA 3W9WA 5IM2A 2OWSA 5H8NB 1SPIA 1FPKA 2P0SA 2I0CA 4FJPA 1KWHA 5CM6A 4U1OA 3EPEA 3IFAA 1Y1MA 1II5A 4F1YA 4H65A 3HHGA 4MNCA 2UVJA 2MKZA 3H06B 3IFCA 4Z0IA 2XXQA 3LR1A 3KSJA 2DDKA 4H45A 4QFOA 1VDWA 4L17A 2UYEA 1QW0A 1VFDA 2HAVA 1XHYA 4XEQA 2REJA 3EKIA 4OYVA 1LBBA 3SETA 3T9UA 4YKJA 1EYIA 1FQBA 3L6HA 1KA1A 4JBZA 3TMGA 3V89B 4GFRA 4Q8RA 2ZZVA 2PBWA 2DE3A 3PTYA 4P11A 4RPOA 1R9QA 4MIJA 4ZEFA 2DOJA 1NV5A 3TFLA 1JEVA 5I84A 3KEIA 4IR8A 4THIA 2Z8EA 4IO6A 3KN3A 1JETA 1P1QA 5JTYB 3EN3A 4MMPA 1OQGA 3RLFE 4LN5A 3O6HA 3SEWA 3CG3A 2PX1A 4FORA 4NTLA 2ZNUA 4GRKA 3CRBA 3WAEA 4RXLA 4PF6A 4IY6A 1XOCA 4LONB 4QFNA 2H4IA 1B46A 2XWVA 1QUJA 3G3GA 2FNCA 3QMFA 3OO9A 4QXDA 1NH7A 3OO6A 1FBHA 2V4CA 3FXBA 1FQDA 2HCAA 4N07A 2V3QA 1SI1A 2HEUA 3CFZA 2XXYA 1OQHA 3DELB 4OESA 4PBQA 3E9XA 5ITOA 2ZYOA 3FXUA 5I57B 3EHTA 3VDFA 4H8JA 4IO5A 4OVPA 3S9NC 1Q9DA 1USYE 3IB0A 4HE0A 3VFJA 2E1SA 2UYFA 3M3KA 4P0GA 5B70A 3PPOA 3M3FA 3DP6A 1SDXA 4O7IA 3RY3A 1B40A 3MQ9A 4PE5B 4N15A 3ROJA 2I3WA 2XXVA 4Q30B 4MEVA 2QFLA 3G3HA 4YB6A 1LAHE 4KYDA 1NH8A 3PMXA 3UP9A 4XF5A 3FJGA 5CRYA 4NG7A 1SVXB 4DCYA 1EZOA 4F1UA 2DSFA 4R6KA 5L8DA 3ZKKA 2RCBA 2CEXA 1FQFA 1IQ7A 2I0BA 3M3LA 5FHNA 5EHMA 2X26A 4GX4A 3CFXA 4R2BA 2H9BA 4OERA 4P8BA 1GGGA 4U22A 4KR5A 2O69A 1FQEA 5TP9B 1FQAA 2RINA 4PDHA 2CMOA 4FEBA 5I56A 4GWSA 2ZZWA 3U1OA 2ESNA 1AH5A 3LBSA 5LTCA 3TTNA 4OZ9A 4BDQA 3MZ9A 3ONMA 1IMAA 3N6TA 4MLVA 3OO8A 4WKMA 1PBPA 4LVQA 4EQ9A 1INPA 1LSTA 2NOOA 2ONRA 2ALUA 3OEKA 1FQCA 5CMCA 3C36A 2I3VA 3FASA 3TCFA 5I2NB 2PT1A 4H46A 4OFLA 4PF8A 3U65A 3U94A 5L9OA 1PEBA 4KPTA 1KA0A 2O7IA 3PPPA 5F1QA 2RC7A 4HS7A 3T9HB 4R2FA 3KC1A 1B3EA 4ZEIA 5KZTA 3UIFA 5EQ9A 5ET6A 4ZZEA 1JW4A 2Y5KA 4XKQA 2F7AA 2GRVA 3MWBA 1URGA 4WEPA 1SBPA 4HE2A 3SDFA 1MDP1 4R75A 3LSWA 3O97A 3USDA 4F18A 4KCDA 4PGNA 1QUIA 1Y3PA 1S50A 2ZYKA 3KG2A 2FVZA 2WBBA 4G61A 3ZS6A 3I5OA 3IJXB 1N84A 5I58B 2X7PA 3LSFB 1B4ZA 4N8GA 4F2OA 4NWCA 2YJPA 4F1VA 3FUZA 1XC1A 2DXRA 3VVEA 4LP2B 1NKXA 4DCXA 2QPQA 1B0HA 2QRYA 3A3UA 4X04A 3CSGA 1P99A 4JVCA 4UACA 3B6WA 1FPJA 2AYSA 2XA5A 4I1DA 3FVGA 1H3DA 3CVGA 1O64A 2ZMBA 3HO7A 4NHBA 2AL5A 4JSDA 3SERA 4NF6B 4E0XA 3RTFB 1I6QA 4MNIA 2Y7PA 4P1LA 1UTHB 3GZGA 4F29A 3RN8A 2HAUA 4PGPA 2F97A 2CEYA 1MXWA 1F9BA 1TFAA 2Y5LA 3PPQA 1H45A 1SW5A 1LLSA 4PFWA 3V8XB 5AA3A 4ISUA 2IA4A 2NXOA 3K1NA 3VXBA 4XXUA 2PVUA 5H8QB 3Q29A 1FBPA 3OXNA 1N04A 1P1WA 2FYIA 4K3FA 1QVSA 1D9QA 3FVKA 4ESWA 1JEUA 3OEMA 5ELVA 4O3CA 2F6GA 2V93A 4N91A 4PQJA 5L9MA 5I3SA 1IITA 4OENA 1LAGE 2GFEA 2HPGA 3VVFA 4ELOA 3TCHA 1LFGA 1P1OA 1Y4CA 1DOTA 2I48A 3ZKLA 3B8BA 2FBPA 3MZBA 1I6AA 4KHZE 2CZLA 2QS3A 5HPQA 5AA4B 1D4NA 2F78A 3MVWA 1B7UA 2DWJA 3CI8A 1OLCA 3NOHA 2AIXA 1ZLQA 2NVUB 2VD2A 3O66A 1A55A 1LAXA 1LCTA 2UXAA 5EQAA 3H6VA 2OZZA 4GWWA 1MPDA 2F36A 1B7ZA 4PAIA 1YAEA 3S9MC 5H8HB 4GX3A 3QAXA 3V83A 1B3FA 2RF1A 4HW8A 3MPLA 2XHDA 4OFOA 5I2KB 1MH4A 1GVCA 1DTZA 3UA8A 2H98A 4PE3A 4LA9A 2GH9A 4I9DA 1USYH 4ONYA 3R7XA 3C33A 4GL0A 4R9GA 1FJ9A 3K02A 3N26A 4GWXA 2A5TB 2VPOA 5TP9A 1NV7A 3OELA 4PFYA 3TTRA 1MY4A 1JVYA 4QFPA 4LATA 4F3PA 1QKBA 1B5JA 2WBDA 5IGAA 2V25A 4LQ5A 1JVXA 3OOAA 3TUSA 2WKYA 3DP4A 3UGWA 3VE1B 4EXKA 4QFKA 2O7UA 1M5FA 2R6GE 5I2NA 1XVYA 4QBAA 2V84A 2BJJX 4TLLB 5EQ7A 2F5XA 3VXCA 5K2YA 1NUXA 3MP1A 3MJNA 2Y7IA 1BK4A 1FTKA 3KOSA 3IOVA 1YYZA 5H8NA 1UTBB 1FPGA 4OANA 3H7MA 1MXXA 1NUZA 4G68A 4FATA 4IGRA 3K1PA 4DXUA 1O63A 3IB2A 5EYHA 4DLDA 2XXTA 5EYFA 1BKAA 4NX1A 2XXHA 3C31A 3FIRA 5T3JA 4KD5A 2F3DA 4I3EA 4AS4A 1Z7NE 1A8FA 1US4A 4HCWA 3PUZE 5LDZA 3DP8A 1WVJA 4F31B 5IKBA 4OXVA 1Y20A 3IO6A 4F3GA 3GXAA 4BDOA 1B3LA 3TTKA 5H8FA 3MW0A 3G7WA 4GWYA 4JWOA 4YB5A 2PT2A 2P3NA 3VLWA 4YZZA 5J16A 4MX6A 3LUYA 1H76A 3TPAA 1IUDA 3O28A 1D9VA 3FV1A 4N8YA 4IY5A 2KLFA 2DVCA 2L5VA 4EQBA 5AA2D 4MF3A 3MVYA 1YXIA 2OX3A 3E13X 4NF5A 2I4CA 4MNPA 4NF6A 1BP5A 5TU0A 4Q0CA 1LBCA 4O94A 1NV1A 1MXYA 1LBYA 1LEVA 1RKMA 4RK2A 4IO3A 2B4LA 4X1DA 2JJKA 3S4UA 3C9HA 2OWTA 2H25A 3TTLA 5KCJB 2HQ0A 1ZBMA 5EHSA 4NF4B 2FIXA 3G3FA 1FBDA 4OWDA 4GVOA 4PETA 2UVHA 1LBVA 4HXVA 3FGSA 1N7XA 4G4PA 1NNTA 3TDJA 5CI5A 4H1XA 1A7LA 4O8MA 2VGQA 4GL8A 4FBPA 3TQLA 1YTVA 2QVRA 1ZIUA 2ZYMA 1NI9A 3CSBA 5F7VA 3JV9A 1Y1ZA 4KXPA 1IEJA 2WEFA 2XXIA 2WX9A 4KFQA 4N81A 4R6HA 2Q2CA 3MBPA 1TXFA 4GF8A 2I58A 2P2AA 1US5A 4ND9A 4PP0A 3Q27A 2HFBA 1MM6A 1IMEA 1S9TA 4JWXA 3T0JA 2OCUA 5H8FB 3K4UA 2UVIA 4I8CA 2DWHA 2P1SA 4QRZA 2QL3A 4N13A 3VVDA 1FTMA 1URSA 3S9LC 4FEDA 2R9JA 4RA1A 1WODA 4LUBA 3HV1A 2IEEA 1ZJLA 5CMBA 3FV2A 4NF5B 1ANFA 5DVFA 4G77A 3E4RA 1FRPA 1OVTA 3CFLA 1HSEA 2NWJA 1MQJA 4BDLA 2B65A 1CB6A 2OK2A 1FTAA 1Y3QA 2M8CA 2PFYA 1LFIA 3MAMA 2F34A 1NFTA 1IXIA 2KR0A 1LBZA 2O68A 5I56B 4R9FA 4I3YA 3BIGA 5TPAB 4JVIA 4IO2A 3RYDA 3IJOB 1MM7A 1FPDA 4BDRA 1UQWA 3EF7A 1B1XA 5BUUA 1J1NA 1FPEA 1MQDA 1LCFA 3UK4A 2I4BA 3K01A 5I58A 1MY1A 4F2QA 3IB1A 4AQ4A 4OVRA 4H67A 3SESA 1YZ0A 2ZNSA 1LBXA 3QYTA 1B7HA 1B3HA 4BDNA 5B7DA 1DMBA 3H6WA 1GV8A 4DI4B 1BIYA 1G0IA 3G3JA 5I5PA 3BBRA 3RPLA 1IMDA 1RDZA 2V3TA 1N3WA 2Q9TA 4XTCQ 3FD3A 1MY2A 4RPNA 1XT8A 2WYKA 1B4HA 4IB2A 1ELJA 1B1HA 1FSAA 2O1MA 5ET8A 3LV0A 5ITPA 3ISPA 3D4GA 4ZS9A 1NNKA 3IAZA 4NF8B 3B6QA 1JW5A 1M5CA 3K00A 3IOTA 2GHBA 1IMBA 2B3BA 2Q74A 2F6PA 3QK6A 3PV0E 1B3GA 1B5IA 5I59A 1IXCA 4PC9A 4U4SA 5DT6A 4TOZA 3U72A 4NGUA 5ICQA 3BFUA 1MPCA 3SZPA 3ECRA 3PD9A 1ZU0A 1K9ZA 2Q8MA 4G68C 1LGBC 1NNPA 4O3BA 3VLUA 4KYEA 1MY0A 1XS5A 3CIJA 2PFZA 4NQ8A 5KDTA 3O6GA 2O1LA 4AS5A 1FTJA 4ZECA 3W9VA 5DVJA 1MPBA 4HE1A 1ATGA 4QSCA 4JDFA 5IAIA 2DWIA 1EZPA 3PMVA 1A8EA 5H8QA 3R26A 2BJIA 3Q28A 4GX6A 1AIVA 5AA4A 4NF4A 4G8NA 2D5WA 1MRPA 2ABHA 3PUWE 4TLMB 5HBCA 1D9YA 2DXYA 4OTEA 4MBPA 1DPPA 3PUYE 3HPIA 2CZIA 2PCRA 2XXUA 2Q89A 1FPLA 3KBRA 3ODBA 3RUMA 2V3UA 1EU8A 3RT8A 1A54A 2O6AA 4RNSA 1FCKA 1NUYA 3FVOA 4NE4A 3S2VA 1L5TA 3KJ7A 5ISUA 1SI0A 1FBGA 1AOVA 2Y7RA 3IORA 3N94A 1ZKBA 5I59B 2I49A 4EDPA 4QF9A 4RJZA 4OEVA 1LB9A 3B6TA 4MFIA 2W7YA 4C0RA 1FTLA 5JK4A 4YU0A 1EZ9A 4DE8A 4PDDA 2G93A 3O2AA 1FPIA 3BKIB 3OSRA 1XI6A 3RTWB 4H5GA 4NF8A 4WXJA 3MC2A 1NNFA 2QS2A 5CMKA 5KDTB 4F39A 3VLVA 4FIMA 1IXHA 4POWA 4U21A 3QSLA 3BFTA 5IZ3B 1R6ZA 3H6UA 1Z7ME 4GXAA 5FHOA 2GQ1A 3SEUA 1CE2A 3H3GA 4N4UA 4ELQA 2A5TA 3KN7A 2RC8A 4AB5A 3TTMA 3IO4A 1UIUA 4MAGA 2Z22A 3N5LA 2UVGA 3PPRA 5TPAA 3K2DA 2VHAA 1H44A 2DS9A 3N6UA 4N6DA 5A5XA 1B9JA 1LAFE 3HCQA 2O51A 5I57A 4IGTA 1MS7A 2AL4A 4JSOA 3TCGA 2Q8JA 4RYAA 2F35A 5DTBA 3KJTA 3SEVA 4XKNA 2D21A 1Y4TA 3I3VA 2FIEA 2Z8FA 3T66A 3U93A 3UN6A 1LFHA 2VPNA 3MPKA 1NV3A 1NL5A 3OMBA 2VP1A 1BTJA 1A99A 3MVZA 2OLBA 2Y7KA 2F3BA 4LZ5A 4QFLA 4OFJA 3FJMA 4F3BA 3T9XB 1EYJA 3D1RA 5ET5A 1NUWA 3KN8A 3B50A 1ZTYA 1B6HA 2R8TA 1D3KA 4EF2A 2G29A 1FW0A 4P0IA 5I7IA 4KCCA 1A40A 1IZ1A 3RNNA 3QXMA 3T9VA 3DM0A 1POY1 1WDNA 2ZNTA 2Z8DA 1B5HA 2LAOA 3PU5A 4QSEA 4KYSA 4ZE8A 2XXPA 4JVDA 1M5DA 2QMXA 4GBVA 4H0WA 1VFEA 3O29A 4OMBA 4P1EA 4BDMA 3ILTB 3V5AA 4FAJA 3GBBA 5JTYA 1N76A 3E78A 4OEUA 5F24A 1SYIA 3DLNA 2YPNA 3KBZA 3KC0A 4WEDA 5FHMA 4YKIA 3CR9A 4UA8A 2QS1A 3D4CA 1MXVA 2VT5A 4G2ZA 1NV0A 3KGCA 4N6PA 3JZJA 2XXWA 3IL1B 4YKPA 4NF0A 1B32A 3T1BA 3ZSFA 3LUZA 2H5YA 5CC2A 4QSDA 4OA4A 2HZKA 2KQZA 4IO7A 3G3IA 3U8QA 1MDQA 1DSNA 3K0VA 3VV5A 4Q5TA 3I6VA 3Q26A 1CNQA 3MP6A 4GWUA 1P1NA 3LC8A 1YPNA 5DW8A 1QUKA 3PGFA 4ZEKA 4G8HA 4U2RA 3PD8A 3PUVE 4O7MA 3C32A 2XXRA 4EQ7A 3LSLA 4N6KA 1TFDA 4NWDA 3FATA 2FHYA 3G3KA 1MXUA 2XX7A 4FECA 4X9TA 5H8SA 2ONKE 4HTGA 2XD3A 5H8HA 4PFRA 1GR2A 4DIGA 2QS4A 3UORA 1FBCA 1XVXA 4OVTA 4E0WA 4MJOA 2QJEA 4EF1A 2F7CA 4YAHX 1DK4A 3T96B 1MY3A 4XKPA 5ET7A 1DPEA 3MSTA 5IZ3A 3THIA 4P9KA 4PAKA 3TAJA 2XWKA 4BLAA 4PFBA 1MH3A 4XKRA 2RC9A 3FBPA 4EUOA 2RCAA 4JB7A 1OMPA 2ZZXA 3TEPA 4X8RA 2QVVA 4U1ZA 5IZZA 1O7TA 3IOUA 3LSXA 1SYHA 2DYXA 3BIHA 2B4MA 2O84X 2VD3A 4PTKA 1HSLA 2XX8A 3RPWA 1URDA 1JP4A 1HSJA 3KSXA 2X7QA 4R72A 3JYRA 4C1TA 1B52A 1SQYA 2HZLA 5AA2A 2XD2A 1Y3NA 4H5FA 4RK9A 4DZ1A 1PBQA 5AA2B 4OVJA 1KZ8A 1RDXA 1EH3A 2PYYA 4NN3A 3O9PA 1P1UA 5DEXB 4P47A 4G68B 4GOTA 4GWOA 1R1NA 4KQPA 4MLQA 2HXRA 3M8UA 4YICA 3HHFA 4MCOA 2DP8A 3PUXE 4OETA 1FTOA 1IXGA 4GXSB 1FJ6A 4ELRA 1QJMA 4GWZA 2QVUA 1QULA 5M2VA 4XIGQ 3MP8A 3FVNA 4GLIA 3EQ1A 1MXZA 3GLBA 4F19A 1NMUA 3HN0A 2DVZA 4ECFA 1MQGA 1N3XA 3FXQA 4H8IA 4PFUA 3EHUA 1TT1A 1MQIA 4YMBA 1FBEA 1VE4A 5K2XA 5KCJA 2XWIA 2RKMA 2XXXA 3IOWA 1JNFA 1B51A 3FJ7A 1SW2A 3SKPA 5L9SA 3TZAA 3FXRA 1DTGA
chains in the Genus database with same CATH topology
5CBSA 4IGRA 3K1PA 4DXUA 4GD5A 5FTHA 1FTLA 5JK4A 1O63A 3OO9A 1NH7A 3IB2A 3OO6A 4YU0A 4DLDA 2XXTA 2XX9A 5EYFA 1BKAA 1FQDA 2HCAA 4N07A 1EZ9A 1SI1A 2HEUA 2V3QA 3CFZA 2XXYA 4DE8A 2G93A 1OQHA 2XXHA 2ZXTA 3O2AA 3C31A 3TODA 1R9LA 1ZMGA 1SW1A 3FIRA 4ZZAA 3DELB 4KD5A 4OESA 3BKIB 1H43A 3OSRA 1YCJA 3K6WA 3RTWB 4H5GA 4NF8A 4WXJA 1RYOA 4ZEBA 3MC2A 1NNFA 2QS2A 1Z7NE 3E9XA 5CMKA 5KDTB 4F39A 5ITOA 3VLVA 1OLAA 2ZYOA 1A8FA 4FIMA 1IXHA 1US4A 3FXUA 5I57B 4POWA 4HCWA 2OBGA 3EHTA 3PUZE 3VDFA 1BLFA 4U21A 5ICTA 4H8JA 3QSLA 4IO5A 3DP8A 1WVJA 3BFTA 4F31B 4M1VA 5IKBA 1USYE 3S9NC 2DE2A 1R6ZA 3H6UA 3IB0A 4OXVA 5HM4B 1T0KA 1Z7ME 3VFJA 1Y20A 2E1SA 2UYFA 2Z23A 3IO6A 3M3KA 4GXAA 4P0GA 4F3GA 5B70A 5L9SA 5FHOA 3HSTA 3GXAA 3SEUA 1CE2A 3PPOA 4BDOA 3H4ZA 3DP6A 3M3FA 1B3LA 3H3GA 3TTKA 1SDXA 2A5SA 2FA7A 4LZ7A 3MW0A 5H8FA 3G7WA 3RY3A 4ELQA 1B40A 3MQ9A 4PE5B 1B0LA 4JWOA 4YB5A 2A5TA 2PT2A 3K6XA 3KN7A 3VLWA 2RC8A 4YZZA 3LUYA 1UTBA 4NMYA 1H76A 3TPAA 2I3WA 2XXVA 1IUDA 1B05A 4Q30B 3TTMA 2YLNA 1LB8A 3IO4A 3O28A 1TWYA 1D9VA 4AB5A 3FV1A 1UIUA 4IY5A 3G3HA 4YB6A 4C1UA 2Z22A 1LAHE 2KLFA 2DVCA 3N5LA 2UVGA 3PPRA 1NH8A 4KYDA 5TPAA 3K2DA 4EQBA 2VHAA 3PMXA 3UP9A 1RYXA 1Q35A 2I6EA 4R6YA 3TTNA 5AA2D 4KI0E 1UIVA 4AB6A 3FJGA 4MF3A 5CRYA 3MVYA 4DXCA 1SVXB 4DCYA 4F22A 1EZOA 4F1UA 4I62A 3E13X 2DSFA 3KOTA 4NF5A 4R6KA 2I4CA 2Q88A 4OHNA 5L8DA 1H44A 4NF6A 2DS9A 3ZKKA 1BP5A 3N6UA 5TU0A 4Q0CA 1LBCA 3PPNA 2RCBA 1MXYA 2QSXA 5A5XA 1FQFA 1B9JA 1IQ7A 1LAFE 3HCQA 5J1DA 2I0BA 1OIBA 3M3LA 1RKMA 2O51A 4RK2A 5FHNA 5I57A 4IGTA 1MS7A 5EHMA 2X26A 4IO3A 2AL4A 3CFXA 4JSOA 4R2BA 4X1DA 2H9BA 3MZ1A 4OERA 3S4UA 3C9HA 3TCGA 3TQWA 1GGGA 2OWTA 2Q8JA 4RYAA 2H25A 3PMWA 4U22A 3P7IA 2F35A 3TTLA 5KCJB 2HQ0A 1ZBMA 4KR5A 4NF4B 2O69A 5DTBA 1FQEA 5EHSA 3L6GA 3KJTA 1SD3A 3G3FA 4YKKA 1FQAA 5TP9B 2RINA 3SEVA 4OWDA 4GVOA 2D21A 2DWAA 2CMOA 2UVHA 4HCYA 1Y4TA 4PETA 4FEBA 3H6TA 3I3VA 4GIZA 3U1OA 1PB9A 2ESNA 1AH5A 1N7XA 2Z8FA 3FGSA 3T66A 3U93A 1N0TA 3QIMA 3LBSA 3UN6A 1LFHA 3FZVA 3KZGA 4G4PA 1NNTA 3IK6B 3MPKA 4OZ9A 3TDJA 3MZ9A 3ONMA 3N6TA 4MLVA 4BDQA 1NL5A 4H1XA 3OO8A 1A7LA 3AXFA 2F7BA 2F8DA 4WKMA 5CI5A 3MVXA 1MG1A 1PBPA 4GQOA 3TYHA 4XKNA 4LVQA 3OMBA 4EQ9A 1AL3A 2VGQA 1LSTA 4R73A 4GL8A 3TQLA 2NOOA 2VP1A 2ONRA 2ALUA 1BTJA 3O6IA 3OEKA 1FQCA 3A3CA 1A99A 4X48A 5CMCA 3C36A 2OLBA 1YTVA 3MVZA 3T93B 2Y7KA 1ZIUA 2I3VA 3FASA 3TCFA 4ZEDA 3H03A 4R74A 5I2NB 4LZ5A 4IO4A 2ZYMA 4MH5A 4QFLA 2PT1A 4OFLA 4OFJA 3FJMA 3U94A 3T9XB 4DXBA 4F3BA 3CSBA 5L9OA 5F7VA 3JV9A 1PEBA 1Y1ZA 4KPTA 1UTHA 2ZYNA 1IIWA 3KN8A 1IEJA 1PC3A 4EXLA 1ZTYA 2XXIA 2O7IA 3PPPA 4KFQA 4R6HA 1B6HA 2Q2CA 5BWJA 3MBPA 1TXFA 1D3KA 4GF8A 5F1QA 4EF2A 2G29A 2I58A 2P2AA 1Y9UA 1FW0A 1US5A 2PMSA 4F3SA 2RC7A 4HS7A 4P0IA 3T9HB 1PB8A 2DE4A 3C35A 4ND9A 1B3EA 4O3AA 4PP0A 3Q27A 4R2FA 4ZDMA 4Z7EA 4ZEIA 2HFBA 3R6UA 4KCCA 4DDDA 1A40A 1MM6A 5KZTA 1IZ1A 3UIFA 3RNNA 3QXMA 3T9VA 4ZZEA 1POTA 3DM0A 3E3KA 4U23A 1POY1 1WDNA 1JW4A 3IR1A 1S9TA 3TKDA 4JWXA 4XKQA 2F7AA 2GRVA 2H99A 2OCUA 3MWBA 1URGA 3Q25A 2ZNTA 5H8FB 4WEPA 1QKAA 2Z8DA 1SBPA 3K4UA 2UVIA 1B5HA 3SDFA 2LAOA 1MDP1 4I8CA 3PU5A 2DWHA 2P1SA 4QSEA 3LSWA 3O97A 4R75A 4QRZA 3USDA 4F18A 4KCDA 2QL3A 4KYSA 4N13A 3VVDA 1FTMA 1QUIA 1Y3PA 4ZE8A 2XXPA 4JWYA 1S50A 1URSA 3TELA 2ZYKA 3KG2A 3S9LC 4FEDA 1S7YA 2R9JA 4RA1A 1M5DA 3S9EA 1WODA 2QMXA 3ZS6A 3I5OA 2E0SA 3IJXB 3SEXA 1N84A 5I58B 5AA3A 4H0WA 4LUBA 2X7PA 4NEDA 3HV1A 2IEEA 1VFEA 1ZJLA 3GBAA 3LSFB 1JW1A 1B4ZA 5CMBA 4F2OA 4NWCA 3O29A 4OMBA 5DYHA 4BDMA 3ILTB 3V5AA 4FAJA 3FV2A 3GBBA 4PFTA 4ESXA 4NF5B 5JTYA 1N76A 4QHQA 1ANFA 1PB7A 4OEUA 5A5XB 5JEIA 2HXWA 2YJPA 5DVFA 1SYIA 4F1VA 3FUZA 3DLNA 1XC1A 2DXRA 2YPNA 4G77A 3VVEA 3E4RA 1VSOA 4LP2B 1OVTA 3CFLA 1HSEA 1NKXA 2NWJA 3EHSA 1MQJA 4DCXA 2QPQA 3RGYA 4BDLA 1JQFA 1B0HA 4WEDA 2B65A 1CB6A 2OK2A 2QRYA 5FHMA 3K1MA 4YKIA 1Y3QA 3C34A 3A3UA 2M8CA 4FE8A 3CSGA 3CR9A 4X1BA 2QS1A 1LFIA 3D4CA 3MAMA 1MXVA 1P99A 4UACA 2F34A 4UA8A 5AE4A 1NFTA 1SW4A 3B6WA 1IXIA 4G2ZA 1M5BA 2O68A 2AYSA 3KGCA 4N6PA 5DEXA 3JZJA 2XXWA 5I56B 4R9FA 2Y84A 3IL1B 4YKPA 3RQTA 2D3IA 4I1DA 1B32A 3FVGA 5TPAB 3OO7A 5FTIA 5CBRA 2GHAA 1VR5A 1H3DA 3CVGA 4IO2A 3ZSFA 1O64A 2ZMBA 3HO7A 3IJOB 1MM7A 2H5YA 5CC2A 4JXIA 4BDRA 1UQWA 2AL5A 1B1XA 3EF7A 3A09A 3IX1A 4JSDA 4QSDA 3SERA 4LZ8A 4NF6B 5BUUA 1B58A 1J1NA 3RTFB 4E0XA 2HZKA 1I6QA 4IO7A 3QUJA 1Q1KA 2Y7PA 4ZE9A 2B3FA 1MQDA 3OENA 1LCFA 3UK4A 2I4BA 3K01A 5I58A 3WAFA 1UTHB 3G3IA 3U8QA 1MDQA 3U92A 1MY1A 3GZGA 4F2QA 1DSNA 4YMAA 3ILUB 4F29A 3K0VA 3VV5A 4Q5TA 3I6VA 3Q26A 3IB1A 4AQ4A 3CG1A 3RN8A 3MP6A 5DVIA 4H67A 1I6BA 3SESA 2HAUA 2F97A 1MXWA 1F9BA 1TFAA 4RY1A 1P1NA 3LC8A 3PPQA 2Q2AA 2ZNSA 2QMWA 2NUVA 1H45A 1SW5A 1YPNA 3QYTA 3OD7A 1QUKA 4YB7A 1B7HA 1B3HA 3PGFA 4ZEKA 1MQHA 1LLSA 4G8HA 4PFWA 3F11A 1DMBA 3H6WA 3PD8A 3PUVE 4U2RA 1GV8A 4H6DA 3C32A 2IA4A 4ISUA 5AA1A 3K6VA 3V8XB 2NXOA 1BIYA 3G3JA 3K1NA 3VXBA 1GTKA 3KFMA 4XXUA 2XXRA 2PVUA 5H8QB 3BBRA 3T22A 4OQOA 2VOZA 4G8MA 3Q29A 4ELPA 4EQ7A 3LSLA 3OXNA 1TFDA 4NWDA 3FATA 1N04A 1P1WA 1I69A 2FYIA 3G3KA 2V3TA 4K3FA 1N3WA 1MXUA 2Q9TA 4XTCQ 4ELRA 1QVSA 2XX7A 3FVKA 2THIA 4FECA 1B2HA 3FD3A 4ESWA 1JEUA 3OEMA 4X9TA 2ANJA 4M4GA 1MY2A 1OVBA 2Y7WA 4O3CA 4RPNA 4TQUQ 5ELVA 3C4MA 1PDAA 1XT8A 2REGA 5H8SA 3SEYA 2F6GA 2ONKE 2V93A 4HTGA 2R71A 2XD3A 1B4HA 4IB2A 1ELJA 3K6UA 1B1HA 3QUFA 2O1MA 4POXA 3RT6B 3W15C 2ONSA 4PQJA 5ITPA 4BDNA 5B7DA 5H8HA 1N7WA 4LQ2A 3B7DA 5L9MA 2OJTA 3D4GA 1GR2A 1IITA 4ZS9A 4OENA 4U4XA 4DIGA 5I2KA 2QS4A 3UORA 1LAGE 2GFEA 1M5EA 1NNKA 3IAZA 4NF8B 3B6QA 1JW5A 1XVXA 3MUQA 1M5CA 3VVFA 4E0WA 2QJEA 4ELOA 3TCHA 3K00A 1LFGA 2DQVA 1P1OA 3IOTA 5CMMA 2GHBA 4EF1A 2B3BA 3OSQA 1Y4CA 1DOTA 2F7CA 2F6PA 4YAHX 2I48A 3QK6A 3PV0E 3T96B 1AMFA 1MY3A 4XKPA 3W9WA 3ZKLA 1B3GA 1DPEA 3MZBA 1I6AA 4KHZE 1B5IA 2CZLA 2OWSA 5I56A 2QS3A 5H8NB 3THIA 5HPQA 5AA4B 5I59A 1D4NA 2F78A 1IXCA 2P0SA 2I0CA 4FJPA 1KWHA 3TAJA 4U4SA 5CM6A 5DT6A 3MVWA 4TOZA 4U1OA 1B7UA 3U72A 4BLAA 2DWJA 1MH3A 5ICQA 3EPEA 3BFUA 4XKRA 1MPCA 3CI8A 2RC9A 3ECRA 1OLCA 2AIXA 3PD9A 1ZU0A 1ZLQA 4G68C 1Y1MA 1LGBC 4EUOA 1II5A 1NNPA 2RCAA 1OMPA 2VD2A 4JB7A 2NVUB 3O66A 1A55A 1LAXA 1LCTA 2UXAA 4O3BA 3VLUA 3TEPA 3H6VA 4F1YA 4H65A 3HHGA 4KYEA 2OZZA 1MY0A 2UVJA 3H06B 4U1ZA 1MPDA 1O7TA 2F36A 3IOUA 1B7ZA 4Z0IA 3LSXA 1SYHA 1XS5A 2DYXA 3CIJA 2XXQA 1YAEA 2O84X 2VD3A 3LR1A 1HSLA 2XX8A 3KSJA 5H8HB 3RPWA 5LOMA 3S9MC 1URDA 5KDTA 3O6GA 4QFOA 3QAXA 1HSJA 3KSXA 2X7QA 4R72A 2O1LA 3JYRA 1FTJA 4ZECA 4C1TA 3V83A 1B3FA 1B52A 1SQYA 2HZLA 2RF1A 4HW8A 5AA2A 3MPLA 4L17A 2XHDA 4OFOA 5I2KB 1MH4A 3W9VA 2UYEA 2XD2A 1Y3NA 4H5FA 1QW0A 1DTZA 1VFDA 4RK9A 1GVCA 2H98A 3UA8A 4DZ1A 2HAVA 5DVJA 1XHYA 1MPBA 1PBQA 5AA2B 2REJA 4LA9A 4OVJA 1ATGA 2GH9A 4I9DA 1USYH 4QSCA 1EH3A 2PYYA 4JDFA 3O9PA 1LBBA 4OYVA 3SETA 3T9UA 5IAIA 1P1UA 2DWIA 5DEXB 4ONYA 1EZPA 3PMVA 1A8EA 3C33A 4GL0A 4YKJA 3R26A 4G68B 4GOTA 5H8QA 3R7XA 3Q28A 1R1NA 4GWOA 1FQBA 4R9GA 4KQPA 3L6HA 3K02A 3N26A 4JBZA 1AIVA 3TMGA 4MLQA 5AA4A 4NF4A 4G8NA 2D5WA 3M8UA 2A5TB 4YICA 3V89B 4GFRA 5TP9A 1MRPA 4Q8RA 3HHFA 2ABHA 3OELA 4PFYA 3PUWE 1MY4A 2DP8A 3PUXE 4OETA 4TLMB 3TTRA 5HBCA 1JVYA 1D9YA 2PBWA 4QFPA 4LATA 2DXYA 4F3PA 1QKBA 1B5JA 2DE3A 4MBPA 1DPPA 2V25A 4OTEA 3PUYE 1JVXA 4LQ5A 4P11A 3HPIA 3OOAA 1FTOA 4RPOA 1R9QA 4ZEFA 3TUSA 2DOJA 2XXUA 1IXGA 2Q89A 4GXSB 2WKYA 3DP4A 3KBRA 1QJMA 3ODBA 3UGWA 3RUMA 2V3UA 3TFLA 1JEVA 1EU8A 3RT8A 3VE1B 3KEIA 4EXKA 1A54A 2O6AA 5I84A 1QULA 4QFKA 4RNSA 2O7UA 5M2VA 4XIGQ 3MP8A 4THIA 1M5FA 3FVNA 4FATA 1FCKA 2R6GE 3FVOA 4GLIA 3EQ1A 1MXZA 3GLBA 5I2NA 1XVYA 2Z8EA 4F19A 4IO6A 1NMUA 2V84A 2DVZA 3HN0A 1JETA 2BJJX 3KN3A 4ECFA 1MQGA 4NE4A 4TLLB 3S2VA 1P1QA 2F5XA 5JTYB 1L5TA 1N3XA 3FXQA 3KJ7A 3EN3A 3VXCA 4H8IA 1OQGA 3RLFE 5K2YA 4PFUA 3O6HA 3SEWA 3EHUA 1TT1A 1MQIA 3CG3A 3MP1A 1SI0A 2PX1A 5ISUA 4FORA 4NTLA 3MJNA 4YMBA 2ZNUA 2Y7IA 4GRKA 1FTKA 1AOVA 1VE4A 3CRBA 3KOSA 5K2XA 2Y7RA 3IORA 3IOVA 3N94A 3WAEA 1ZKBA 5KCJA 5H8NA 2RKMA 1UTBB 2XXXA 4RXLA 5I59B 3IOWA 2I49A 1JNFA 4IY6A 1XOCA 4LONB 4QFNA 4EDPA 4QF9A 4RJZA 4OEVA 1LB9A 2H4IA 3B6TA 1B46A 1B51A 3H7MA 4MFIA 1MXXA 1SW2A 3FJ7A 1QUJA 2W7YA 3SKPA 3FXRA 2FNCA 3G3GA 4G68A 3TZAA 1DTGA 4C0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBS A;  4IGR A;  3K1P A;  4DXU A;  4GD5 A;  5FTH A;  1FTL A;  5JK4 A;  1O63 A;  3OO9 A;  1NH7 A;  3IB2 A;  3OO6 A;  4YU0 A;  4DLD A;  2XXT A;  2XX9 A;  5EYF A;  1BKA A;  1FQD A;  2HCA A;  4N07 A;  1EZ9 A;  1SI1 A;  2HEU A;  2V3Q A;  3CFZ A;  2XXY A;  4DE8 A;  2G93 A;  1OQH A;  2XXH A;  2ZXT A;  3O2A A;  3C31 A;  3TOD A;  1R9L A;  1ZMG A;  1SW1 A;  3FIR A;  4ZZA A;  3DEL B;  4KD5 A;  4OES A;  3BKI B;  1H43 A;  3OSR A;  1YCJ A;  3K6W A;  3RTW B;  4H5G A;  4NF8 A;  4WXJ A;  1RYO A;  4ZEB A;  3MC2 A;  1NNF A;  2QS2 A;  1Z7N E;  3E9X A;  5CMK A;  5KDT B;  4F39 A;  5ITO A;  3VLV A;  1OLA A;  2ZYO A;  1A8F A;  4FIM A;  1IXH A;  1US4 A;  3FXU A;  5I57 B;  4POW A;  4HCW A;  2OBG A;  3EHT A;  3PUZ E;  3VDF A;  1BLF A;  4U21 A;  5ICT A;  4H8J A;  3QSL A;  4IO5 A;  3DP8 A;  1WVJ A;  3BFT A;  4F31 B;  4M1V A;  5IKB A;  1USY E;  3S9N C;  2DE2 A;  1R6Z A;  3H6U A;  3IB0 A;  4OXV A;  5HM4 B;  1T0K A;  1Z7M E;  3VFJ A;  1Y20 A;  2E1S A;  2UYF A;  2Z23 A;  3IO6 A;  3M3K A;  4GXA A;  4P0G A;  4F3G A;  5B70 A;  5L9S A;  5FHO A;  3HST A;  3GXA A;  3SEU A;  1CE2 A;  3PPO A;  4BDO A;  3H4Z A;  3DP6 A;  3M3F A;  1B3L A;  3H3G A;  3TTK A;  1SDX A;  2A5S A;  2FA7 A;  4LZ7 A;  3MW0 A;  5H8F A;  3G7W A;  3RY3 A;  4ELQ A;  1B40 A;  3MQ9 A;  4PE5 B;  1B0L A;  4JWO A;  4YB5 A;  2A5T A;  2PT2 A;  3K6X A;  3KN7 A;  3VLW A;  2RC8 A;  4YZZ A;  3LUY A;  1UTB A;  4NMY A;  1H76 A;  3TPA A;  2I3W A;  2XXV A;  1IUD A;  1B05 A;  4Q30 B;  3TTM A;  2YLN A;  1LB8 A;  3IO4 A;  3O28 A;  1TWY A;  1D9V A;  4AB5 A;  3FV1 A;  1UIU A;  4IY5 A;  3G3H A;  4YB6 A;  4C1U A;  2Z22 A;  1LAH E;  2KLF A;  2DVC A;  3N5L A;  2UVG A;  3PPR A;  1NH8 A;  4KYD A;  5TPA A;  3K2D A;  4EQB A;  2VHA A;  3PMX A;  3UP9 A;  1RYX A;  1Q35 A;  2I6E A;  4R6Y A;  3TTN A;  5AA2 D;  4KI0 E;  1UIV A;  4AB6 A;  3FJG A;  4MF3 A;  5CRY A;  3MVY A;  4DXC A;  1SVX B;  4DCY A;  4F22 A;  1EZO A;  4F1U A;  4I62 A;  3E13 X;  2DSF A;  3KOT A;  4NF5 A;  4R6K A;  2I4C A;  2Q88 A;  4OHN A;  5L8D A;  1H44 A;  4NF6 A;  2DS9 A;  3ZKK A;  1BP5 A;  3N6U A;  5TU0 A;  4Q0C A;  1LBC A;  3PPN A;  2RCB A;  1MXY A;  2QSX A;  5A5X A;  1FQF A;  1B9J A;  1IQ7 A;  1LAF E;  3HCQ A;  5J1D A;  2I0B A;  1OIB A;  3M3L A;  1RKM A;  2O51 A;  4RK2 A;  5FHN A;  5I57 A;  4IGT A;  1MS7 A;  5EHM A;  2X26 A;  4IO3 A;  2AL4 A;  3CFX A;  4JSO A;  4R2B A;  4X1D A;  2H9B A;  3MZ1 A;  4OER A;  3S4U A;  3C9H A;  3TCG A;  3TQW A;  1GGG A;  2OWT A;  2Q8J A;  4RYA A;  2H25 A;  3PMW A;  4U22 A;  3P7I A;  2F35 A;  3TTL A;  5KCJ B;  2HQ0 A;  1ZBM A;  4KR5 A;  4NF4 B;  2O69 A;  5DTB A;  1FQE A;  5EHS A;  3L6G A;  3KJT A;  1SD3 A;  3G3F A;  4YKK A;  1FQA A;  5TP9 B;  2RIN A;  3SEV A;  4OWD A;  4GVO A;  2D21 A;  2DWA A;  2CMO A;  2UVH A;  4HCY A;  1Y4T A;  4PET A;  4FEB A;  3H6T A;  3I3V A;  4GIZ A;  3U1O A;  1PB9 A;  2ESN A;  1AH5 A;  1N7X A;  2Z8F A;  3FGS A;  3T66 A;  3U93 A;  1N0T A;  3QIM A;  3LBS A;  3UN6 A;  1LFH A;  3FZV A;  3KZG A;  4G4P A;  1NNT A;  3IK6 B;  3MPK A;  4OZ9 A;  3TDJ A;  3MZ9 A;  3ONM A;  3N6T A;  4MLV A;  4BDQ A;  1NL5 A;  4H1X A;  3OO8 A;  1A7L A;  3AXF A;  2F7B A;  2F8D A;  4WKM A;  5CI5 A;  3MVX A;  1MG1 A;  1PBP A;  4GQO A;  3TYH A;  4XKN A;  4LVQ A;  3OMB A;  4EQ9 A;  1AL3 A;  2VGQ A;  1LST A;  4R73 A;  4GL8 A;  3TQL A;  2NOO A;  2VP1 A;  2ONR A;  2ALU A;  1BTJ A;  3O6I A;  3OEK A;  1FQC A;  3A3C A;  1A99 A;  4X48 A;  5CMC A;  3C36 A;  2OLB A;  1YTV A;  3MVZ A;  3T93 B;  2Y7K A;  1ZIU A;  2I3V A;  3FAS A;  3TCF A;  4ZED A;  3H03 A;  4R74 A;  5I2N B;  4LZ5 A;  4IO4 A;  2ZYM A;  4MH5 A;  4QFL A;  2PT1 A;  4OFL A;  4OFJ A;  3FJM A;  3U94 A;  3T9X B;  4DXB A;  4F3B A;  3CSB A;  5L9O A;  5F7V A;  3JV9 A;  1PEB A;  1Y1Z A;  4KPT A;  1UTH A;  2ZYN A;  1IIW A;  3KN8 A;  1IEJ A;  1PC3 A;  4EXL A;  1ZTY A;  2XXI A;  2O7I A;  3PPP A;  4KFQ A;  4R6H A;  1B6H A;  2Q2C A;  5BWJ A;  3MBP A;  1TXF A;  1D3K A;  4GF8 A;  5F1Q A;  4EF2 A;  2G29 A;  2I58 A;  2P2A A;  1Y9U A;  1FW0 A;  1US5 A;  2PMS A;  4F3S A;  2RC7 A;  4HS7 A;  4P0I A;  3T9H B;  1PB8 A;  2DE4 A;  3C35 A;  4ND9 A;  1B3E A;  4O3A A;  4PP0 A;  3Q27 A;  4R2F A;  4ZDM A;  4Z7E A;  4ZEI A;  2HFB A;  3R6U A;  4KCC A;  4DDD A;  1A40 A;  1MM6 A;  5KZT A;  1IZ1 A;  3UIF A;  3RNN A;  3QXM A;  3T9V A;  4ZZE A;  1POT A;  3DM0 A;  3E3K A;  4U23 A;  1POY 1;  1WDN A;  1JW4 A;  3IR1 A;  1S9T A;  3TKD A;  4JWX A;  4XKQ A;  2F7A A;  2GRV A;  2H99 A;  2OCU A;  3MWB A;  1URG A;  3Q25 A;  2ZNT A;  5H8F B;  4WEP A;  1QKA A;  2Z8D A;  1SBP A;  3K4U A;  2UVI A;  1B5H A;  3SDF A;  2LAO A;  1MDP 1;  4I8C A;  3PU5 A;  2DWH A;  2P1S A;  4QSE A;  3LSW A;  3O97 A;  4R75 A;  4QRZ A;  3USD A;  4F18 A;  4KCD A;  2QL3 A;  4KYS A;  4N13 A;  3VVD A;  1FTM A;  1QUI A;  1Y3P A;  4ZE8 A;  2XXP A;  4JWY A;  1S50 A;  1URS A;  3TEL A;  2ZYK A;  3KG2 A;  3S9L C;  4FED A;  1S7Y A;  2R9J A;  4RA1 A;  1M5D A;  3S9E A;  1WOD A;  2QMX A;  3ZS6 A;  3I5O A;  2E0S A;  3IJX B;  3SEX A;  1N84 A;  5I58 B;  5AA3 A;  4H0W A;  4LUB A;  2X7P A;  4NED A;  3HV1 A;  2IEE A;  1VFE A;  1ZJL A;  3GBA A;  3LSF B;  1JW1 A;  1B4Z A;  5CMB A;  4F2O A;  4NWC A;  3O29 A;  4OMB A;  5DYH A;  4BDM A;  3ILT B;  3V5A A;  4FAJ A;  3FV2 A;  3GBB A;  4PFT A;  4ESX A;  4NF5 B;  5JTY A;  1N76 A;  4QHQ A;  1ANF A;  1PB7 A;  4OEU A;  5A5X B;  5JEI A;  2HXW A;  2YJP A;  5DVF A;  1SYI A;  4F1V A;  3FUZ A;  3DLN A;  1XC1 A;  2DXR A;  2YPN A;  4G77 A;  3VVE A;  3E4R A;  1VSO A;  4LP2 B;  1OVT A;  3CFL A;  1HSE A;  1NKX A;  2NWJ A;  3EHS A;  1MQJ A;  4DCX A;  2QPQ A;  3RGY A;  4BDL A;  1JQF A;  1B0H A;  4WED A;  2B65 A;  1CB6 A;  2OK2 A;  2QRY A;  5FHM A;  3K1M A;  4YKI A;  1Y3Q A;  3C34 A;  3A3U A;  2M8C A;  4FE8 A;  3CSG A;  3CR9 A;  4X1B A;  2QS1 A;  1LFI A;  3D4C A;  3MAM A;  1MXV A;  1P99 A;  4UAC A;  2F34 A;  4UA8 A;  5AE4 A;  1NFT A;  1SW4 A;  3B6W A;  1IXI A;  4G2Z A;  1M5B A;  2O68 A;  2AYS A;  3KGC A;  4N6P A;  5DEX A;  3JZJ A;  2XXW A;  5I56 B;  4R9F A;  2Y84 A;  3IL1 B;  4YKP A;  3RQT A;  2D3I A;  4I1D A;  1B32 A;  3FVG A;  5TPA B;  3OO7 A;  5FTI A;  5CBR A;  2GHA A;  1VR5 A;  1H3D A;  3CVG A;  4IO2 A;  3ZSF A;  1O64 A;  2ZMB A;  3HO7 A;  3IJO B;  1MM7 A;  2H5Y A;  5CC2 A;  4JXI A;  4BDR A;  1UQW A;  2AL5 A;  1B1X A;  3EF7 A;  3A09 A;  3IX1 A;  4JSD A;  4QSD A;  3SER A;  4LZ8 A;  4NF6 B;  5BUU A;  1B58 A;  1J1N A;  3RTF B;  4E0X A;  2HZK A;  1I6Q A;  4IO7 A;  3QUJ A;  1Q1K A;  2Y7P A;  4ZE9 A;  2B3F A;  1MQD A;  3OEN A;  1LCF A;  3UK4 A;  2I4B A;  3K01 A;  5I58 A;  3WAF A;  1UTH B;  3G3I A;  3U8Q A;  1MDQ A;  3U92 A;  1MY1 A;  3GZG A;  4F2Q A;  1DSN A;  4YMA A;  3ILU B;  4F29 A;  3K0V A;  3VV5 A;  4Q5T A;  3I6V A;  3Q26 A;  3IB1 A;  4AQ4 A;  3CG1 A;  3RN8 A;  3MP6 A;  5DVI A;  4H67 A;  1I6B A;  3SES A;  2HAU A;  2F97 A;  1MXW A;  1F9B A;  1TFA A;  4RY1 A;  1P1N A;  3LC8 A;  3PPQ A;  2Q2A A;  2ZNS A;  2QMW A;  2NUV A;  1H45 A;  1SW5 A;  1YPN A;  3QYT A;  3OD7 A;  1QUK A;  4YB7 A;  1B7H A;  1B3H A;  3PGF A;  4ZEK A;  1MQH A;  1LLS A;  4G8H A;  4PFW A;  3F11 A;  1DMB A;  3H6W A;  3PD8 A;  3PUV E;  4U2R A;  1GV8 A;  4H6D A;  3C32 A;  2IA4 A;  4ISU A;  5AA1 A;  3K6V A;  3V8X B;  2NXO A;  1BIY A;  3G3J A;  3K1N A;  3VXB A;  1GTK A;  3KFM A;  4XXU A;  2XXR A;  2PVU A;  5H8Q B;  3BBR A;  3T22 A;  4OQO A;  2VOZ A;  4G8M A;  3Q29 A;  4ELP A;  4EQ7 A;  3LSL A;  3OXN A;  1TFD A;  4NWD A;  3FAT A;  1N04 A;  1P1W A;  1I69 A;  2FYI A;  3G3K A;  2V3T A;  4K3F A;  1N3W A;  1MXU A;  2Q9T A;  4XTC Q;  4ELR A;  1QVS A;  2XX7 A;  3FVK A;  2THI A;  4FEC A;  1B2H A;  3FD3 A;  4ESW A;  1JEU A;  3OEM A;  4X9T A;  2ANJ A;  4M4G A;  1MY2 A;  1OVB A;  2Y7W A;  4O3C A;  4RPN A;  4TQU Q;  5ELV A;  3C4M A;  1PDA A;  1XT8 A;  2REG A;  5H8S A;  3SEY A;  2F6G A;  2ONK E;  2V93 A;  4HTG A;  2R71 A;  2XD3 A;  1B4H A;  4IB2 A;  1ELJ A;  3K6U A;  1B1H A;  3QUF A;  2O1M A;  4POX A;  3RT6 B;  3W15 C;  2ONS A;  4PQJ A;  5ITP A;  4BDN A;  5B7D A;  5H8H A;  1N7W A;  4LQ2 A;  3B7D A;  5L9M A;  2OJT A;  3D4G A;  1GR2 A;  1IIT A;  4ZS9 A;  4OEN A;  4U4X A;  4DIG A;  5I2K A;  2QS4 A;  3UOR A;  1LAG E;  2GFE A;  1M5E A;  1NNK A;  3IAZ A;  4NF8 B;  3B6Q A;  1JW5 A;  1XVX A;  3MUQ A;  1M5C A;  3VVF A;  4E0W A;  2QJE A;  4ELO A;  3TCH A;  3K00 A;  1LFG A;  2DQV A;  1P1O A;  3IOT A;  5CMM A;  2GHB A;  4EF1 A;  2B3B A;  3OSQ A;  1Y4C A;  1DOT A;  2F7C A;  2F6P A;  4YAH X;  2I48 A;  3QK6 A;  3PV0 E;  3T96 B;  1AMF A;  1MY3 A;  4XKP A;  3W9W A;  3ZKL A;  1B3G A;  1DPE A;  3MZB A;  1I6A A;  4KHZ E;  1B5I A;  2CZL A;  2OWS A;  5I56 A;  2QS3 A;  5H8N B;  3THI A;  5HPQ A;  5AA4 B;  5I59 A;  1D4N A;  2F78 A;  1IXC A;  2P0S A;  2I0C A;  4FJP A;  1KWH A;  3TAJ A;  4U4S A;  5CM6 A;  5DT6 A;  3MVW A;  4TOZ A;  4U1O A;  1B7U A;  3U72 A;  4BLA A;  2DWJ A;  1MH3 A;  5ICQ A;  3EPE A;  3BFU A;  4XKR A;  1MPC A;  3CI8 A;  2RC9 A;  3ECR A;  1OLC A;  2AIX A;  3PD9 A;  1ZU0 A;  1ZLQ A;  4G68 C;  1Y1M A;  1LGB C;  4EUO A;  1II5 A;  1NNP A;  2RCA A;  1OMP A;  2VD2 A;  4JB7 A;  2NVU B;  3O66 A;  1A55 A;  1LAX A;  1LCT A;  2UXA A;  4O3B A;  3VLU A;  3TEP A;  3H6V A;  4F1Y A;  4H65 A;  3HHG A;  4KYE A;  2OZZ A;  1MY0 A;  2UVJ A;  3H06 B;  4U1Z A;  1MPD A;  1O7T A;  2F36 A;  3IOU A;  1B7Z A;  4Z0I A;  3LSX A;  1SYH A;  1XS5 A;  2DYX A;  3CIJ A;  2XXQ A;  1YAE A;  2O84 X;  2VD3 A;  3LR1 A;  1HSL A;  2XX8 A;  3KSJ A;  5H8H B;  3RPW A;  5LOM A;  3S9M C;  1URD A;  5KDT A;  3O6G A;  4QFO A;  3QAX A;  1HSJ A;  3KSX A;  2X7Q A;  4R72 A;  2O1L A;  3JYR A;  1FTJ A;  4ZEC A;  4C1T A;  3V83 A;  1B3F A;  1B52 A;  1SQY A;  2HZL A;  2RF1 A;  4HW8 A;  5AA2 A;  3MPL A;  4L17 A;  2XHD A;  4OFO A;  5I2K B;  1MH4 A;  3W9V A;  2UYE A;  2XD2 A;  1Y3N A;  4H5F A;  1QW0 A;  1DTZ A;  1VFD A;  4RK9 A;  1GVC A;  2H98 A;  3UA8 A;  4DZ1 A;  2HAV A;  5DVJ A;  1XHY A;  1MPB A;  1PBQ A;  5AA2 B;  2REJ A;  4LA9 A;  4OVJ A;  1ATG A;  2GH9 A;  4I9D A;  1USY H;  4QSC A;  1EH3 A;  2PYY A;  4JDF A;  3O9P A;  1LBB A;  4OYV A;  3SET A;  3T9U A;  5IAI A;  1P1U A;  2DWI A;  5DEX B;  4ONY A;  1EZP A;  3PMV A;  1A8E A;  3C33 A;  4GL0 A;  4YKJ A;  3R26 A;  4G68 B;  4GOT A;  5H8Q A;  3R7X A;  3Q28 A;  1R1N A;  4GWO A;  1FQB A;  4R9G A;  4KQP A;  3L6H A;  3K02 A;  3N26 A;  4JBZ A;  1AIV A;  3TMG A;  4MLQ A;  5AA4 A;  4NF4 A;  4G8N A;  2D5W A;  3M8U A;  2A5T B;  4YIC A;  3V89 B;  4GFR A;  5TP9 A;  1MRP A;  4Q8R A;  3HHF A;  2ABH A;  3OEL A;  4PFY A;  3PUW E;  1MY4 A;  2DP8 A;  3PUX E;  4OET A;  4TLM B;  3TTR A;  5HBC A;  1JVY A;  1D9Y A;  2PBW A;  4QFP A;  4LAT A;  2DXY A;  4F3P A;  1QKB A;  1B5J A;  2DE3 A;  4MBP A;  1DPP A;  2V25 A;  4OTE A;  3PUY E;  1JVX A;  4LQ5 A;  4P11 A;  3HPI A;  3OOA A;  1FTO A;  4RPO A;  1R9Q A;  4ZEF A;  3TUS A;  2DOJ A;  2XXU A;  1IXG A;  2Q89 A;  4GXS B;  2WKY A;  3DP4 A;  3KBR A;  1QJM A;  3ODB A;  3UGW A;  3RUM A;  2V3U A;  3TFL A;  1JEV A;  1EU8 A;  3RT8 A;  3VE1 B;  3KEI A;  4EXK A;  1A54 A;  2O6A A;  5I84 A;  1QUL A;  4QFK A;  4RNS A;  2O7U A;  5M2V A;  4XIG Q;  3MP8 A;  4THI A;  1M5F A;  3FVN A;  4FAT A;  1FCK A;  2R6G E;  3FVO A;  4GLI A;  3EQ1 A;  1MXZ A;  3GLB A;  5I2N A;  1XVY A;  2Z8E A;  4F19 A;  4IO6 A;  1NMU A;  2V84 A;  2DVZ A;  3HN0 A;  1JET A;  2BJJ X;  3KN3 A;  4ECF A;  1MQG A;  4NE4 A;  4TLL B;  3S2V A;  1P1Q A;  2F5X A;  5JTY B;  1L5T A;  1N3X A;  3FXQ A;  3KJ7 A;  3EN3 A;  3VXC A;  4H8I A;  1OQG A;  3RLF E;  5K2Y A;  4PFU A;  3O6H A;  3SEW A;  3EHU A;  1TT1 A;  1MQI A;  3CG3 A;  3MP1 A;  1SI0 A;  2PX1 A;  5ISU A;  4FOR A;  4NTL A;  3MJN A;  4YMB A;  2ZNU A;  2Y7I A;  4GRK A;  1FTK A;  1AOV A;  1VE4 A;  3CRB A;  3KOS A;  5K2X A;  2Y7R A;  3IOR A;  3IOV A;  3N94 A;  3WAE A;  1ZKB A;  5KCJ A;  5H8N A;  2RKM A;  1UTB B;  2XXX A;  4RXL A;  5I59 B;  3IOW A;  2I49 A;  1JNF A;  4IY6 A;  1XOC A;  4LON B;  4QFN A;  4EDP A;  4QF9 A;  4RJZ A;  4OEV A;  1LB9 A;  2H4I A;  3B6T A;  1B46 A;  1B51 A;  3H7M A;  4MFI A;  1MXX A;  1SW2 A;  3FJ7 A;  1QUJ A;  2W7Y A;  3SKP A;  3FXR A;  2FNC A;  3G3G A;  4G68 A;  3TZA A;  1DTG A;  4C0R A; 
#chains in the Genus database with same CATH topology
 5CBS A;  4GD5 A;  5FTH A;  2CZK A;  2XX9 A;  4DI3 D;  3E79 A;  2ZXT A;  3TOD A;  1R9L A;  1ZMG A;  1SW1 A;  4ZZA A;  1H43 A;  1YCJ A;  3K6W A;  1RYO A;  4ZEB A;  1OLA A;  4I40 A;  2OBG A;  1BLF A;  5ICT A;  4M1V A;  2DE2 A;  5HM4 B;  1T0K A;  2Z23 A;  3HST A;  3RPL B;  3H4Z A;  2A5S A;  2FA7 A;  4LZ7 A;  1B0L A;  3K6X A;  1FBF A;  1UTB A;  4NMY A;  1B05 A;  2YLN A;  1LB8 A;  1TWY A;  4C1U A;  1IMF A;  2HHM A;  1RYX A;  1Q35 A;  2I6E A;  4R6Y A;  4KI0 E;  1UIV A;  4AB6 A;  4DXC A;  4PFI A;  4F22 A;  4I62 A;  3KOT A;  2Q88 A;  4OHN A;  1DBZ A;  3PPN A;  5FBP A;  3CHG A;  2QSX A;  5J1D A;  1OIB A;  1EYK A;  3MZ1 A;  3TQW A;  4OVS A;  3PMW A;  3P7I A;  3L6G A;  1SD3 A;  4YKK A;  5LOM A;  2DWA A;  1NV6 A;  4HCY A;  3H6T A;  4GIZ A;  1PB9 A;  1N0T A;  3QIM A;  3FZV A;  3KZG A;  4PBH A;  3IK6 B;  3AXF A;  2F7B A;  2F8D A;  4PAF A;  3MVX A;  1MG1 A;  4GQO A;  3TYH A;  4N17 A;  1AL3 A;  1LBW A;  4R73 A;  3O6I A;  1G0H A;  3A3C A;  4X48 A;  4GBW A;  3T93 B;  4ZED A;  3H03 A;  4R74 A;  4IO4 A;  4MH5 A;  4DXB A;  3GYY A;  1UTH A;  2ZYN A;  1IIW A;  4EXL A;  1PC3 A;  5BWJ A;  1Y9U A;  2PMS A;  4F3S A;  3HFU A;  1PB8 A;  2DE4 A;  3C35 A;  4O3A A;  4Z7E A;  2OWZ A;  4ZDM A;  3R6U A;  4DDD A;  5A5L A;  1POT A;  3E3K A;  4U23 A;  3IR1 A;  3TKD A;  5IZ1 A;  2H99 A;  3Q25 A;  1QKA A;  3MYU A;  4P56 A;  1DCU A;  4JWY A;  3TEL A;  1S7Y A;  3S9E A;  2E0S A;  3SEX A;  4NED A;  5JEI A;  3GBA A;  1NV2 A;  1JW1 A;  5DYH A;  4PFT A;  4ESX A;  4QHQ A;  1PB7 A;  5A5X B;  2HXW A;  1VSO A;  3EHS A;  3RGY A;  4UAB A;  1JQF A;  4NAP A;  4P3L A;  1FPF A;  3K1M A;  3C34 A;  5ESY A;  4FE8 A;  4X1B A;  5AE4 A;  1SW4 A;  1M5B A;  4XFE A;  5DEX A;  2Y84 A;  3RQT A;  2D3I A;  3OO7 A;  5FTI A;  5CBR A;  2GHA A;  1VR5 A;  4JXI A;  3A09 A;  3IX1 A;  2XXK A;  2P3V A;  4LZ8 A;  1B58 A;  3QUJ A;  1Q1K A;  2CZH A;  4ZE9 A;  2B3F A;  3OEN A;  1FPB A;  1K9Y A;  3WAF A;  3U92 A;  4YMA A;  3ILU B;  1QGX A;  3CG1 A;  1AWB A;  5DVI A;  5EYG A;  1I6B A;  4OVQ A;  4RY1 A;  2Q2A A;  2QMW A;  2NUV A;  4YB7 A;  3OD7 A;  1MQH A;  2XWO A;  3F11 A;  4H6D A;  5AA1 A;  3K6V A;  1GTK A;  3KFM A;  3A29 A;  3T22 A;  5EQ8 A;  4OQO A;  4MHF A;  2VOZ A;  4G8M A;  4ELP A;  1I69 A;  2WYP A;  2THI A;  1B2H A;  2ANJ A;  4M4G A;  1OVB A;  4TQU Q;  2Y7W A;  4PCD A;  3C4M A;  1PDA A;  2REG A;  3SEY A;  2R71 A;  3QUF A;  3K6U A;  3W15 C;  4POX A;  3RT6 B;  2ONS A;  1N7W A;  4LQ2 A;  3B7D A;  2OJT A;  4U4X A;  5I2K A;  1RDY A;  1M5E A;  3MUQ A;  2DQV A;  5CMM A;  3OSQ A;  1NV4 A;  1IMC A;  1AMF A;  3W9W A;  5IM2 A;  2OWS A;  5H8N B;  1SPI A;  1FPK A;  2P0S A;  2I0C A;  4FJP A;  1KWH A;  5CM6 A;  4U1O A;  3EPE A;  3IFA A;  1Y1M A;  1II5 A;  4F1Y A;  4H65 A;  3HHG A;  4MNC A;  2UVJ A;  2MKZ A;  3H06 B;  3IFC A;  4Z0I A;  2XXQ A;  3LR1 A;  3KSJ A;  2DDK A;  4H45 A;  4QFO A;  1VDW A;  4L17 A;  2UYE A;  1QW0 A;  1VFD A;  2HAV A;  1XHY A;  4XEQ A;  2REJ A;  3EKI A;  4OYV A;  1LBB A;  3SET A;  3T9U A;  4YKJ A;  1EYI A;  1FQB A;  3L6H A;  1KA1 A;  4JBZ A;  3TMG A;  3V89 B;  4GFR A;  4Q8R A;  2ZZV A;  2PBW A;  2DE3 A;  3PTY A;  4P11 A;  4RPO A;  1R9Q A;  4MIJ A;  4ZEF A;  2DOJ A;  1NV5 A;  3TFL A;  1JEV A;  5I84 A;  3KEI A;  4IR8 A;  4THI A;  2Z8E A;  4IO6 A;  3KN3 A;  1JET A;  1P1Q A;  5JTY B;  3EN3 A;  4MMP A;  1OQG A;  3RLF E;  4LN5 A;  3O6H A;  3SEW A;  3CG3 A;  2PX1 A;  4FOR A;  4NTL A;  2ZNU A;  4GRK A;  3CRB A;  3WAE A;  4RXL A;  4PF6 A;  4IY6 A;  1XOC A;  4LON B;  4QFN A;  2H4I A;  1B46 A;  2XWV A;  1QUJ A;  3G3G A;  2FNC A;  3QMF A;  3OO9 A;  4QXD A;  1NH7 A;  3OO6 A;  1FBH A;  2V4C A;  3FXB A;  1FQD A;  2HCA A;  4N07 A;  2V3Q A;  1SI1 A;  2HEU A;  3CFZ A;  2XXY A;  1OQH A;  3DEL B;  4OES A;  4PBQ A;  3E9X A;  5ITO A;  2ZYO A;  3FXU A;  5I57 B;  3EHT A;  3VDF A;  4H8J A;  4IO5 A;  4OVP A;  3S9N C;  1Q9D A;  1USY E;  3IB0 A;  4HE0 A;  3VFJ A;  2E1S A;  2UYF A;  3M3K A;  4P0G A;  5B70 A;  3PPO A;  3M3F A;  3DP6 A;  1SDX A;  4O7I A;  3RY3 A;  1B40 A;  3MQ9 A;  4PE5 B;  4N15 A;  3ROJ A;  2I3W A;  2XXV A;  4Q30 B;  4MEV A;  2QFL A;  3G3H A;  4YB6 A;  1LAH E;  4KYD A;  1NH8 A;  3PMX A;  3UP9 A;  4XF5 A;  3FJG A;  5CRY A;  4NG7 A;  1SVX B;  4DCY A;  1EZO A;  4F1U A;  2DSF A;  4R6K A;  5L8D A;  3ZKK A;  2RCB A;  2CEX A;  1FQF A;  1IQ7 A;  2I0B A;  3M3L A;  5FHN A;  5EHM A;  2X26 A;  4GX4 A;  3CFX A;  4R2B A;  2H9B A;  4OER A;  4P8B A;  1GGG A;  4U22 A;  4KR5 A;  2O69 A;  1FQE A;  5TP9 B;  1FQA A;  2RIN A;  4PDH A;  2CMO A;  4FEB A;  5I56 A;  4GWS A;  2ZZW A;  3U1O A;  2ESN A;  1AH5 A;  3LBS A;  5LTC A;  3TTN A;  4OZ9 A;  4BDQ A;  3MZ9 A;  3ONM A;  1IMA A;  3N6T A;  4MLV A;  3OO8 A;  4WKM A;  1PBP A;  4LVQ A;  4EQ9 A;  1INP A;  1LST A;  2NOO A;  2ONR A;  2ALU A;  3OEK A;  1FQC A;  5CMC A;  3C36 A;  2I3V A;  3FAS A;  3TCF A;  5I2N B;  2PT1 A;  4H46 A;  4OFL A;  4PF8 A;  3U65 A;  3U94 A;  5L9O A;  1PEB A;  4KPT A;  1KA0 A;  2O7I A;  3PPP A;  5F1Q A;  2RC7 A;  4HS7 A;  3T9H B;  4R2F A;  3KC1 A;  1B3E A;  4ZEI A;  5KZT A;  3UIF A;  5EQ9 A;  5ET6 A;  4ZZE A;  1JW4 A;  2Y5K A;  4XKQ A;  2F7A A;  2GRV A;  3MWB A;  1URG A;  4WEP A;  1SBP A;  4HE2 A;  3SDF A;  1MDP 1;  4R75 A;  3LSW A;  3O97 A;  3USD A;  4F18 A;  4KCD A;  4PGN A;  1QUI A;  1Y3P A;  1S50 A;  2ZYK A;  3KG2 A;  2FVZ A;  2WBB A;  4G61 A;  3ZS6 A;  3I5O A;  3IJX B;  1N84 A;  5I58 B;  2X7P A;  3LSF B;  1B4Z A;  4N8G A;  4F2O A;  4NWC A;  2YJP A;  4F1V A;  3FUZ A;  1XC1 A;  2DXR A;  3VVE A;  4LP2 B;  1NKX A;  4DCX A;  2QPQ A;  1B0H A;  2QRY A;  3A3U A;  4X04 A;  3CSG A;  1P99 A;  4JVC A;  4UAC A;  3B6W A;  1FPJ A;  2AYS A;  2XA5 A;  4I1D A;  3FVG A;  1H3D A;  3CVG A;  1O64 A;  2ZMB A;  3HO7 A;  4NHB A;  2AL5 A;  4JSD A;  3SER A;  4NF6 B;  4E0X A;  3RTF B;  1I6Q A;  4MNI A;  2Y7P A;  4P1L A;  1UTH B;  3GZG A;  4F29 A;  3RN8 A;  2HAU A;  4PGP A;  2F97 A;  2CEY A;  1MXW A;  1F9B A;  1TFA A;  2Y5L A;  3PPQ A;  1H45 A;  1SW5 A;  1LLS A;  4PFW A;  3V8X B;  5AA3 A;  4ISU A;  2IA4 A;  2NXO A;  3K1N A;  3VXB A;  4XXU A;  2PVU A;  5H8Q B;  3Q29 A;  1FBP A;  3OXN A;  1N04 A;  1P1W A;  2FYI A;  4K3F A;  1QVS A;  1D9Q A;  3FVK A;  4ESW A;  1JEU A;  3OEM A;  5ELV A;  4O3C A;  2F6G A;  2V93 A;  4N91 A;  4PQJ A;  5L9M A;  5I3S A;  1IIT A;  4OEN A;  1LAG E;  2GFE A;  2HPG A;  3VVF A;  4ELO A;  3TCH A;  1LFG A;  1P1O A;  1Y4C A;  1DOT A;  2I48 A;  3ZKL A;  3B8B A;  2FBP A;  3MZB A;  1I6A A;  4KHZ E;  2CZL A;  2QS3 A;  5HPQ A;  5AA4 B;  1D4N A;  2F78 A;  3MVW A;  1B7U A;  2DWJ A;  3CI8 A;  1OLC A;  3NOH A;  2AIX A;  1ZLQ A;  2NVU B;  2VD2 A;  3O66 A;  1A55 A;  1LAX A;  1LCT A;  2UXA A;  5EQA A;  3H6V A;  2OZZ A;  4GWW A;  1MPD A;  2F36 A;  1B7Z A;  4PAI A;  1YAE A;  3S9M C;  5H8H B;  4GX3 A;  3QAX A;  3V83 A;  1B3F A;  2RF1 A;  4HW8 A;  3MPL A;  2XHD A;  4OFO A;  5I2K B;  1MH4 A;  1GVC A;  1DTZ A;  3UA8 A;  2H98 A;  4PE3 A;  4LA9 A;  2GH9 A;  4I9D A;  1USY H;  4ONY A;  3R7X A;  3C33 A;  4GL0 A;  4R9G A;  1FJ9 A;  3K02 A;  3N26 A;  4GWX A;  2A5T B;  2VPO A;  5TP9 A;  1NV7 A;  3OEL A;  4PFY A;  3TTR A;  1MY4 A;  1JVY A;  4QFP A;  4LAT A;  4F3P A;  1QKB A;  1B5J A;  2WBD A;  5IGA A;  2V25 A;  4LQ5 A;  1JVX A;  3OOA A;  3TUS A;  2WKY A;  3DP4 A;  3UGW A;  3VE1 B;  4EXK A;  4QFK A;  2O7U A;  1M5F A;  2R6G E;  5I2N A;  1XVY A;  4QBA A;  2V84 A;  2BJJ X;  4TLL B;  5EQ7 A;  2F5X A;  3VXC A;  5K2Y A;  1NUX A;  3MP1 A;  3MJN A;  2Y7I A;  1BK4 A;  1FTK A;  3KOS A;  3IOV A;  1YYZ A;  5H8N A;  1UTB B;  1FPG A;  4OAN A;  3H7M A;  1MXX A;  1NUZ A;  4G68 A;  4FAT A;  4IGR A;  3K1P A;  4DXU A;  1O63 A;  3IB2 A;  5EYH A;  4DLD A;  2XXT A;  5EYF A;  1BKA A;  4NX1 A;  2XXH A;  3C31 A;  3FIR A;  5T3J A;  4KD5 A;  2F3D A;  4I3E A;  4AS4 A;  1Z7N E;  1A8F A;  1US4 A;  4HCW A;  3PUZ E;  5LDZ A;  3DP8 A;  1WVJ A;  4F31 B;  5IKB A;  4OXV A;  1Y20 A;  3IO6 A;  4F3G A;  3GXA A;  4BDO A;  1B3L A;  3TTK A;  5H8F A;  3MW0 A;  3G7W A;  4GWY A;  4JWO A;  4YB5 A;  2PT2 A;  2P3N A;  3VLW A;  4YZZ A;  5J16 A;  4MX6 A;  3LUY A;  1H76 A;  3TPA A;  1IUD A;  3O28 A;  1D9V A;  3FV1 A;  4N8Y A;  4IY5 A;  2KLF A;  2DVC A;  2L5V A;  4EQB A;  5AA2 D;  4MF3 A;  3MVY A;  1YXI A;  2OX3 A;  3E13 X;  4NF5 A;  2I4C A;  4MNP A;  4NF6 A;  1BP5 A;  5TU0 A;  4Q0C A;  1LBC A;  4O94 A;  1NV1 A;  1MXY A;  1LBY A;  1LEV A;  1RKM A;  4RK2 A;  4IO3 A;  2B4L A;  4X1D A;  2JJK A;  3S4U A;  3C9H A;  2OWT A;  2H25 A;  3TTL A;  5KCJ B;  2HQ0 A;  1ZBM A;  5EHS A;  4NF4 B;  2FIX A;  3G3F A;  1FBD A;  4OWD A;  4GVO A;  4PET A;  2UVH A;  1LBV A;  4HXV A;  3FGS A;  1N7X A;  4G4P A;  1NNT A;  3TDJ A;  5CI5 A;  4H1X A;  1A7L A;  4O8M A;  2VGQ A;  4GL8 A;  4FBP A;  3TQL A;  1YTV A;  2QVR A;  1ZIU A;  2ZYM A;  1NI9 A;  3CSB A;  5F7V A;  3JV9 A;  1Y1Z A;  4KXP A;  1IEJ A;  2WEF A;  2XXI A;  2WX9 A;  4KFQ A;  4N81 A;  4R6H A;  2Q2C A;  3MBP A;  1TXF A;  4GF8 A;  2I58 A;  2P2A A;  1US5 A;  4ND9 A;  4PP0 A;  3Q27 A;  2HFB A;  1MM6 A;  1IME A;  1S9T A;  4JWX A;  3T0J A;  2OCU A;  5H8F B;  3K4U A;  2UVI A;  4I8C A;  2DWH A;  2P1S A;  4QRZ A;  2QL3 A;  4N13 A;  3VVD A;  1FTM A;  1URS A;  3S9L C;  4FED A;  2R9J A;  4RA1 A;  1WOD A;  4LUB A;  3HV1 A;  2IEE A;  1ZJL A;  5CMB A;  3FV2 A;  4NF5 B;  1ANF A;  5DVF A;  4G77 A;  3E4R A;  1FRP A;  1OVT A;  3CFL A;  1HSE A;  2NWJ A;  1MQJ A;  4BDL A;  2B65 A;  1CB6 A;  2OK2 A;  1FTA A;  1Y3Q A;  2M8C A;  2PFY A;  1LFI A;  3MAM A;  2F34 A;  1NFT A;  1IXI A;  2KR0 A;  1LBZ A;  2O68 A;  5I56 B;  4R9F A;  4I3Y A;  3BIG A;  5TPA B;  4JVI A;  4IO2 A;  3RYD A;  3IJO B;  1MM7 A;  1FPD A;  4BDR A;  1UQW A;  3EF7 A;  1B1X A;  5BUU A;  1J1N A;  1FPE A;  1MQD A;  1LCF A;  3UK4 A;  2I4B A;  3K01 A;  5I58 A;  1MY1 A;  4F2Q A;  3IB1 A;  4AQ4 A;  4OVR A;  4H67 A;  3SES A;  1YZ0 A;  2ZNS A;  1LBX A;  3QYT A;  1B7H A;  1B3H A;  4BDN A;  5B7D A;  1DMB A;  3H6W A;  1GV8 A;  4DI4 B;  1BIY A;  1G0I A;  3G3J A;  5I5P A;  3BBR A;  3RPL A;  1IMD A;  1RDZ A;  2V3T A;  1N3W A;  2Q9T A;  4XTC Q;  3FD3 A;  1MY2 A;  4RPN A;  1XT8 A;  2WYK A;  1B4H A;  4IB2 A;  1ELJ A;  1B1H A;  1FSA A;  2O1M A;  5ET8 A;  3LV0 A;  5ITP A;  3ISP A;  3D4G A;  4ZS9 A;  1NNK A;  3IAZ A;  4NF8 B;  3B6Q A;  1JW5 A;  1M5C A;  3K00 A;  3IOT A;  2GHB A;  1IMB A;  2B3B A;  2Q74 A;  2F6P A;  3QK6 A;  3PV0 E;  1B3G A;  1B5I A;  5I59 A;  1IXC A;  4PC9 A;  4U4S A;  5DT6 A;  4TOZ A;  3U72 A;  4NGU A;  5ICQ A;  3BFU A;  1MPC A;  3SZP A;  3ECR A;  3PD9 A;  1ZU0 A;  1K9Z A;  2Q8M A;  4G68 C;  1LGB C;  1NNP A;  4O3B A;  3VLU A;  4KYE A;  1MY0 A;  1XS5 A;  3CIJ A;  2PFZ A;  4NQ8 A;  5KDT A;  3O6G A;  2O1L A;  4AS5 A;  1FTJ A;  4ZEC A;  3W9V A;  5DVJ A;  1MPB A;  4HE1 A;  1ATG A;  4QSC A;  4JDF A;  5IAI A;  2DWI A;  1EZP A;  3PMV A;  1A8E A;  5H8Q A;  3R26 A;  2BJI A;  3Q28 A;  4GX6 A;  1AIV A;  5AA4 A;  4NF4 A;  4G8N A;  2D5W A;  1MRP A;  2ABH A;  3PUW E;  4TLM B;  5HBC A;  1D9Y A;  2DXY A;  4OTE A;  4MBP A;  1DPP A;  3PUY E;  3HPI A;  2CZI A;  2PCR A;  2XXU A;  2Q89 A;  1FPL A;  3KBR A;  3ODB A;  3RUM A;  2V3U A;  1EU8 A;  3RT8 A;  1A54 A;  2O6A A;  4RNS A;  1FCK A;  1NUY A;  3FVO A;  4NE4 A;  3S2V A;  1L5T A;  3KJ7 A;  5ISU A;  1SI0 A;  1FBG A;  1AOV A;  2Y7R A;  3IOR A;  3N94 A;  1ZKB A;  5I59 B;  2I49 A;  4EDP A;  4QF9 A;  4RJZ A;  4OEV A;  1LB9 A;  3B6T A;  4MFI A;  2W7Y A;  4C0R A;  1FTL A;  5JK4 A;  4YU0 A;  1EZ9 A;  4DE8 A;  4PDD A;  2G93 A;  3O2A A;  1FPI A;  3BKI B;  3OSR A;  1XI6 A;  3RTW B;  4H5G A;  4NF8 A;  4WXJ A;  3MC2 A;  1NNF A;  2QS2 A;  5CMK A;  5KDT B;  4F39 A;  3VLV A;  4FIM A;  1IXH A;  4POW A;  4U21 A;  3QSL A;  3BFT A;  5IZ3 B;  1R6Z A;  3H6U A;  1Z7M E;  4GXA A;  5FHO A;  2GQ1 A;  3SEU A;  1CE2 A;  3H3G A;  4N4U A;  4ELQ A;  2A5T A;  3KN7 A;  2RC8 A;  4AB5 A;  3TTM A;  3IO4 A;  1UIU A;  4MAG A;  2Z22 A;  3N5L A;  2UVG A;  3PPR A;  5TPA A;  3K2D A;  2VHA A;  1H44 A;  2DS9 A;  3N6U A;  4N6D A;  5A5X A;  1B9J A;  1LAF E;  3HCQ A;  2O51 A;  5I57 A;  4IGT A;  1MS7 A;  2AL4 A;  4JSO A;  3TCG A;  2Q8J A;  4RYA A;  2F35 A;  5DTB A;  3KJT A;  3SEV A;  4XKN A;  2D21 A;  1Y4T A;  3I3V A;  2FIE A;  2Z8F A;  3T66 A;  3U93 A;  3UN6 A;  1LFH A;  2VPN A;  3MPK A;  1NV3 A;  1NL5 A;  3OMB A;  2VP1 A;  1BTJ A;  1A99 A;  3MVZ A;  2OLB A;  2Y7K A;  2F3B A;  4LZ5 A;  4QFL A;  4OFJ A;  3FJM A;  4F3B A;  3T9X B;  1EYJ A;  3D1R A;  5ET5 A;  1NUW A;  3KN8 A;  3B50 A;  1ZTY A;  1B6H A;  2R8T A;  1D3K A;  4EF2 A;  2G29 A;  1FW0 A;  4P0I A;  5I7I A;  4KCC A;  1A40 A;  1IZ1 A;  3RNN A;  3QXM A;  3T9V A;  3DM0 A;  1POY 1;  1WDN A;  2ZNT A;  2Z8D A;  1B5H A;  2LAO A;  3PU5 A;  4QSE A;  4KYS A;  4ZE8 A;  2XXP A;  4JVD A;  1M5D A;  2QMX A;  4GBV A;  4H0W A;  1VFE A;  3O29 A;  4OMB A;  4P1E A;  4BDM A;  3ILT B;  3V5A A;  4FAJ A;  3GBB A;  5JTY A;  1N76 A;  3E78 A;  4OEU A;  5F24 A;  1SYI A;  3DLN A;  2YPN A;  3KBZ A;  3KC0 A;  4WED A;  5FHM A;  4YKI A;  3CR9 A;  4UA8 A;  2QS1 A;  3D4C A;  1MXV A;  2VT5 A;  4G2Z A;  1NV0 A;  3KGC A;  4N6P A;  3JZJ A;  2XXW A;  3IL1 B;  4YKP A;  4NF0 A;  1B32 A;  3T1B A;  3ZSF A;  3LUZ A;  2H5Y A;  5CC2 A;  4QSD A;  4OA4 A;  2HZK A;  2KQZ A;  4IO7 A;  3G3I A;  3U8Q A;  1MDQ A;  1DSN A;  3K0V A;  3VV5 A;  4Q5T A;  3I6V A;  3Q26 A;  1CNQ A;  3MP6 A;  4GWU A;  1P1N A;  3LC8 A;  1YPN A;  5DW8 A;  1QUK A;  3PGF A;  4ZEK A;  4G8H A;  4U2R A;  3PD8 A;  3PUV E;  4O7M A;  3C32 A;  2XXR A;  4EQ7 A;  3LSL A;  4N6K A;  1TFD A;  4NWD A;  3FAT A;  2FHY A;  3G3K A;  1MXU A;  2XX7 A;  4FEC A;  4X9T A;  5H8S A;  2ONK E;  4HTG A;  2XD3 A;  5H8H A;  4PFR A;  1GR2 A;  4DIG A;  2QS4 A;  3UOR A;  1FBC A;  1XVX A;  4OVT A;  4E0W A;  4MJO A;  2QJE A;  4EF1 A;  2F7C A;  4YAH X;  1DK4 A;  3T96 B;  1MY3 A;  4XKP A;  5ET7 A;  1DPE A;  3MST A;  5IZ3 A;  3THI A;  4P9K A;  4PAK A;  3TAJ A;  2XWK A;  4BLA A;  4PFB A;  1MH3 A;  4XKR A;  2RC9 A;  3FBP A;  4EUO A;  2RCA A;  4JB7 A;  1OMP A;  2ZZX A;  3TEP A;  4X8R A;  2QVV A;  4U1Z A;  5IZZ A;  1O7T A;  3IOU A;  3LSX A;  1SYH A;  2DYX A;  3BIH A;  2B4M A;  2O84 X;  2VD3 A;  4PTK A;  1HSL A;  2XX8 A;  3RPW A;  1URD A;  1JP4 A;  1HSJ A;  3KSX A;  2X7Q A;  4R72 A;  3JYR A;  4C1T A;  1B52 A;  1SQY A;  2HZL A;  5AA2 A;  2XD2 A;  1Y3N A;  4H5F A;  4RK9 A;  4DZ1 A;  1PBQ A;  5AA2 B;  4OVJ A;  1KZ8 A;  1RDX A;  1EH3 A;  2PYY A;  4NN3 A;  3O9P A;  1P1U A;  5DEX B;  4P47 A;  4G68 B;  4GOT A;  4GWO A;  1R1N A;  4KQP A;  4MLQ A;  2HXR A;  3M8U A;  4YIC A;  3HHF A;  4MCO A;  2DP8 A;  3PUX E;  4OET A;  1FTO A;  1IXG A;  4GXS B;  1FJ6 A;  4ELR A;  1QJM A;  4GWZ A;  2QVU A;  1QUL A;  5M2V A;  4XIG Q;  3MP8 A;  3FVN A;  4GLI A;  3EQ1 A;  1MXZ A;  3GLB A;  4F19 A;  1NMU A;  3HN0 A;  2DVZ A;  4ECF A;  1MQG A;  1N3X A;  3FXQ A;  4H8I A;  4PFU A;  3EHU A;  1TT1 A;  1MQI A;  4YMB A;  1FBE A;  1VE4 A;  5K2X A;  5KCJ A;  2XWI A;  2RKM A;  2XXX A;  3IOW A;  1JNF A;  1B51 A;  3FJ7 A;  1SW2 A;  3SKP A;  5L9S A;  3TZA A;  3FXR A;  1DTG A; 
#chains in the Genus database with same CATH homology
 5CBS A;  4IGR A;  3K1P A;  4DXU A;  4GD5 A;  5FTH A;  1FTL A;  5JK4 A;  1O63 A;  3OO9 A;  1NH7 A;  3IB2 A;  3OO6 A;  4YU0 A;  4DLD A;  2XXT A;  2XX9 A;  5EYF A;  1BKA A;  1FQD A;  2HCA A;  4N07 A;  1EZ9 A;  1SI1 A;  2HEU A;  2V3Q A;  3CFZ A;  2XXY A;  4DE8 A;  2G93 A;  1OQH A;  2XXH A;  2ZXT A;  3O2A A;  3C31 A;  3TOD A;  1R9L A;  1ZMG A;  1SW1 A;  3FIR A;  4ZZA A;  3DEL B;  4KD5 A;  4OES A;  3BKI B;  1H43 A;  3OSR A;  1YCJ A;  3K6W A;  3RTW B;  4H5G A;  4NF8 A;  4WXJ A;  1RYO A;  4ZEB A;  3MC2 A;  1NNF A;  2QS2 A;  1Z7N E;  3E9X A;  5CMK A;  5KDT B;  4F39 A;  5ITO A;  3VLV A;  1OLA A;  2ZYO A;  1A8F A;  4FIM A;  1IXH A;  1US4 A;  3FXU A;  5I57 B;  4POW A;  4HCW A;  2OBG A;  3EHT A;  3PUZ E;  3VDF A;  1BLF A;  4U21 A;  5ICT A;  4H8J A;  3QSL A;  4IO5 A;  3DP8 A;  1WVJ A;  3BFT A;  4F31 B;  4M1V A;  5IKB A;  1USY E;  3S9N C;  2DE2 A;  1R6Z A;  3H6U A;  3IB0 A;  4OXV A;  5HM4 B;  1T0K A;  1Z7M E;  3VFJ A;  1Y20 A;  2E1S A;  2UYF A;  2Z23 A;  3IO6 A;  3M3K A;  4GXA A;  4P0G A;  4F3G A;  5B70 A;  5L9S A;  5FHO A;  3HST A;  3GXA A;  3SEU A;  1CE2 A;  3PPO A;  4BDO A;  3H4Z A;  3DP6 A;  3M3F A;  1B3L A;  3H3G A;  3TTK A;  1SDX A;  2A5S A;  2FA7 A;  4LZ7 A;  3MW0 A;  5H8F A;  3G7W A;  3RY3 A;  4ELQ A;  1B40 A;  3MQ9 A;  4PE5 B;  1B0L A;  4JWO A;  4YB5 A;  2A5T A;  2PT2 A;  3K6X A;  3KN7 A;  3VLW A;  2RC8 A;  4YZZ A;  3LUY A;  1UTB A;  4NMY A;  1H76 A;  3TPA A;  2I3W A;  2XXV A;  1IUD A;  1B05 A;  4Q30 B;  3TTM A;  2YLN A;  1LB8 A;  3IO4 A;  3O28 A;  1TWY A;  1D9V A;  4AB5 A;  3FV1 A;  1UIU A;  4IY5 A;  3G3H A;  4YB6 A;  4C1U A;  2Z22 A;  1LAH E;  2KLF A;  2DVC A;  3N5L A;  2UVG A;  3PPR A;  1NH8 A;  4KYD A;  5TPA A;  3K2D A;  4EQB A;  2VHA A;  3PMX A;  3UP9 A;  1RYX A;  1Q35 A;  2I6E A;  4R6Y A;  3TTN A;  5AA2 D;  4KI0 E;  1UIV A;  4AB6 A;  3FJG A;  4MF3 A;  5CRY A;  3MVY A;  4DXC A;  1SVX B;  4DCY A;  4F22 A;  1EZO A;  4F1U A;  4I62 A;  3E13 X;  2DSF A;  3KOT A;  4NF5 A;  4R6K A;  2I4C A;  2Q88 A;  4OHN A;  5L8D A;  1H44 A;  4NF6 A;  2DS9 A;  3ZKK A;  1BP5 A;  3N6U A;  5TU0 A;  4Q0C A;  1LBC A;  3PPN A;  2RCB A;  1MXY A;  2QSX A;  5A5X A;  1FQF A;  1B9J A;  1IQ7 A;  1LAF E;  3HCQ A;  5J1D A;  2I0B A;  1OIB A;  3M3L A;  1RKM A;  2O51 A;  4RK2 A;  5FHN A;  5I57 A;  4IGT A;  1MS7 A;  5EHM A;  2X26 A;  4IO3 A;  2AL4 A;  3CFX A;  4JSO A;  4R2B A;  4X1D A;  2H9B A;  3MZ1 A;  4OER A;  3S4U A;  3C9H A;  3TCG A;  3TQW A;  1GGG A;  2OWT A;  2Q8J A;  4RYA A;  2H25 A;  3PMW A;  4U22 A;  3P7I A;  2F35 A;  3TTL A;  5KCJ B;  2HQ0 A;  1ZBM A;  4KR5 A;  4NF4 B;  2O69 A;  5DTB A;  1FQE A;  5EHS A;  3L6G A;  3KJT A;  1SD3 A;  3G3F A;  4YKK A;  1FQA A;  5TP9 B;  2RIN A;  3SEV A;  4OWD A;  4GVO A;  2D21 A;  2DWA A;  2CMO A;  2UVH A;  4HCY A;  1Y4T A;  4PET A;  4FEB A;  3H6T A;  3I3V A;  4GIZ A;  3U1O A;  1PB9 A;  2ESN A;  1AH5 A;  1N7X A;  2Z8F A;  3FGS A;  3T66 A;  3U93 A;  1N0T A;  3QIM A;  3LBS A;  3UN6 A;  1LFH A;  3FZV A;  3KZG A;  4G4P A;  1NNT A;  3IK6 B;  3MPK A;  4OZ9 A;  3TDJ A;  3MZ9 A;  3ONM A;  3N6T A;  4MLV A;  4BDQ A;  1NL5 A;  4H1X A;  3OO8 A;  1A7L A;  3AXF A;  2F7B A;  2F8D A;  4WKM A;  5CI5 A;  3MVX A;  1MG1 A;  1PBP A;  4GQO A;  3TYH A;  4XKN A;  4LVQ A;  3OMB A;  4EQ9 A;  1AL3 A;  2VGQ A;  1LST A;  4R73 A;  4GL8 A;  3TQL A;  2NOO A;  2VP1 A;  2ONR A;  2ALU A;  1BTJ A;  3O6I A;  3OEK A;  1FQC A;  3A3C A;  1A99 A;  4X48 A;  5CMC A;  3C36 A;  2OLB A;  1YTV A;  3MVZ A;  3T93 B;  2Y7K A;  1ZIU A;  2I3V A;  3FAS A;  3TCF A;  4ZED A;  3H03 A;  4R74 A;  5I2N B;  4LZ5 A;  4IO4 A;  2ZYM A;  4MH5 A;  4QFL A;  2PT1 A;  4OFL A;  4OFJ A;  3FJM A;  3U94 A;  3T9X B;  4DXB A;  4F3B A;  3CSB A;  5L9O A;  5F7V A;  3JV9 A;  1PEB A;  1Y1Z A;  4KPT A;  1UTH A;  2ZYN A;  1IIW A;  3KN8 A;  1IEJ A;  1PC3 A;  4EXL A;  1ZTY A;  2XXI A;  2O7I A;  3PPP A;  4KFQ A;  4R6H A;  1B6H A;  2Q2C A;  5BWJ A;  3MBP A;  1TXF A;  1D3K A;  4GF8 A;  5F1Q A;  4EF2 A;  2G29 A;  2I58 A;  2P2A A;  1Y9U A;  1FW0 A;  1US5 A;  2PMS A;  4F3S A;  2RC7 A;  4HS7 A;  4P0I A;  3T9H B;  1PB8 A;  2DE4 A;  3C35 A;  4ND9 A;  1B3E A;  4O3A A;  4PP0 A;  3Q27 A;  4R2F A;  4ZDM A;  4Z7E A;  4ZEI A;  2HFB A;  3R6U A;  4KCC A;  4DDD A;  1A40 A;  1MM6 A;  5KZT A;  1IZ1 A;  3UIF A;  3RNN A;  3QXM A;  3T9V A;  4ZZE A;  1POT A;  3DM0 A;  3E3K A;  4U23 A;  1POY 1;  1WDN A;  1JW4 A;  3IR1 A;  1S9T A;  3TKD A;  4JWX A;  4XKQ A;  2F7A A;  2GRV A;  2H99 A;  2OCU A;  3MWB A;  1URG A;  3Q25 A;  2ZNT A;  5H8F B;  4WEP A;  1QKA A;  2Z8D A;  1SBP A;  3K4U A;  2UVI A;  1B5H A;  3SDF A;  2LAO A;  1MDP 1;  4I8C A;  3PU5 A;  2DWH A;  2P1S A;  4QSE A;  3LSW A;  3O97 A;  4R75 A;  4QRZ A;  3USD A;  4F18 A;  4KCD A;  2QL3 A;  4KYS A;  4N13 A;  3VVD A;  1FTM A;  1QUI A;  1Y3P A;  4ZE8 A;  2XXP A;  4JWY A;  1S50 A;  1URS A;  3TEL A;  2ZYK A;  3KG2 A;  3S9L C;  4FED A;  1S7Y A;  2R9J A;  4RA1 A;  1M5D A;  3S9E A;  1WOD A;  2QMX A;  3ZS6 A;  3I5O A;  2E0S A;  3IJX B;  3SEX A;  1N84 A;  5I58 B;  5AA3 A;  4H0W A;  4LUB A;  2X7P A;  4NED A;  3HV1 A;  2IEE A;  1VFE A;  1ZJL A;  3GBA A;  3LSF B;  1JW1 A;  1B4Z A;  5CMB A;  4F2O A;  4NWC A;  3O29 A;  4OMB A;  5DYH A;  4BDM A;  3ILT B;  3V5A A;  4FAJ A;  3FV2 A;  3GBB A;  4PFT A;  4ESX A;  4NF5 B;  5JTY A;  1N76 A;  4QHQ A;  1ANF A;  1PB7 A;  4OEU A;  5A5X B;  5JEI A;  2HXW A;  2YJP A;  5DVF A;  1SYI A;  4F1V A;  3FUZ A;  3DLN A;  1XC1 A;  2DXR A;  2YPN A;  4G77 A;  3VVE A;  3E4R A;  1VSO A;  4LP2 B;  1OVT A;  3CFL A;  1HSE A;  1NKX A;  2NWJ A;  3EHS A;  1MQJ A;  4DCX A;  2QPQ A;  3RGY A;  4BDL A;  1JQF A;  1B0H A;  4WED A;  2B65 A;  1CB6 A;  2OK2 A;  2QRY A;  5FHM A;  3K1M A;  4YKI A;  1Y3Q A;  3C34 A;  3A3U A;  2M8C A;  4FE8 A;  3CSG A;  3CR9 A;  4X1B A;  2QS1 A;  1LFI A;  3D4C A;  3MAM A;  1MXV A;  1P99 A;  4UAC A;  2F34 A;  4UA8 A;  5AE4 A;  1NFT A;  1SW4 A;  3B6W A;  1IXI A;  4G2Z A;  1M5B A;  2O68 A;  2AYS A;  3KGC A;  4N6P A;  5DEX A;  3JZJ A;  2XXW A;  5I56 B;  4R9F A;  2Y84 A;  3IL1 B;  4YKP A;  3RQT A;  2D3I A;  4I1D A;  1B32 A;  3FVG A;  5TPA B;  3OO7 A;  5FTI A;  5CBR A;  2GHA A;  1VR5 A;  1H3D A;  3CVG A;  4IO2 A;  3ZSF A;  1O64 A;  2ZMB A;  3HO7 A;  3IJO B;  1MM7 A;  2H5Y A;  5CC2 A;  4JXI A;  4BDR A;  1UQW A;  2AL5 A;  1B1X A;  3EF7 A;  3A09 A;  3IX1 A;  4JSD A;  4QSD A;  3SER A;  4LZ8 A;  4NF6 B;  5BUU A;  1B58 A;  1J1N A;  3RTF B;  4E0X A;  2HZK A;  1I6Q A;  4IO7 A;  3QUJ A;  1Q1K A;  2Y7P A;  4ZE9 A;  2B3F A;  1MQD A;  3OEN A;  1LCF A;  3UK4 A;  2I4B A;  3K01 A;  5I58 A;  3WAF A;  1UTH B;  3G3I A;  3U8Q A;  1MDQ A;  3U92 A;  1MY1 A;  3GZG A;  4F2Q A;  1DSN A;  4YMA A;  3ILU B;  4F29 A;  3K0V A;  3VV5 A;  4Q5T A;  3I6V A;  3Q26 A;  3IB1 A;  4AQ4 A;  3CG1 A;  3RN8 A;  3MP6 A;  5DVI A;  4H67 A;  1I6B A;  3SES A;  2HAU A;  2F97 A;  1MXW A;  1F9B A;  1TFA A;  4RY1 A;  1P1N A;  3LC8 A;  3PPQ A;  2Q2A A;  2ZNS A;  2QMW A;  2NUV A;  1H45 A;  1SW5 A;  1YPN A;  3QYT A;  3OD7 A;  1QUK A;  4YB7 A;  1B7H A;  1B3H A;  3PGF A;  4ZEK A;  1MQH A;  1LLS A;  4G8H A;  4PFW A;  3F11 A;  1DMB A;  3H6W A;  3PD8 A;  3PUV E;  4U2R A;  1GV8 A;  4H6D A;  3C32 A;  2IA4 A;  4ISU A;  5AA1 A;  3K6V A;  3V8X B;  2NXO A;  1BIY A;  3G3J A;  3K1N A;  3VXB A;  1GTK A;  3KFM A;  4XXU A;  2XXR A;  2PVU A;  5H8Q B;  3BBR A;  3T22 A;  4OQO A;  2VOZ A;  4G8M A;  3Q29 A;  4ELP A;  4EQ7 A;  3LSL A;  3OXN A;  1TFD A;  4NWD A;  3FAT A;  1N04 A;  1P1W A;  1I69 A;  2FYI A;  3G3K A;  2V3T A;  4K3F A;  1N3W A;  1MXU A;  2Q9T A;  4XTC Q;  4ELR A;  1QVS A;  2XX7 A;  3FVK A;  2THI A;  4FEC A;  1B2H A;  3FD3 A;  4ESW A;  1JEU A;  3OEM A;  4X9T A;  2ANJ A;  4M4G A;  1MY2 A;  1OVB A;  2Y7W A;  4O3C A;  4RPN A;  4TQU Q;  5ELV A;  3C4M A;  1PDA A;  1XT8 A;  2REG A;  5H8S A;  3SEY A;  2F6G A;  2ONK E;  2V93 A;  4HTG A;  2R71 A;  2XD3 A;  1B4H A;  4IB2 A;  1ELJ A;  3K6U A;  1B1H A;  3QUF A;  2O1M A;  4POX A;  3RT6 B;  3W15 C;  2ONS A;  4PQJ A;  5ITP A;  4BDN A;  5B7D A;  5H8H A;  1N7W A;  4LQ2 A;  3B7D A;  5L9M A;  2OJT A;  3D4G A;  1GR2 A;  1IIT A;  4ZS9 A;  4OEN A;  4U4X A;  4DIG A;  5I2K A;  2QS4 A;  3UOR A;  1LAG E;  2GFE A;  1M5E A;  1NNK A;  3IAZ A;  4NF8 B;  3B6Q A;  1JW5 A;  1XVX A;  3MUQ A;  1M5C A;  3VVF A;  4E0W A;  2QJE A;  4ELO A;  3TCH A;  3K00 A;  1LFG A;  2DQV A;  1P1O A;  3IOT A;  5CMM A;  2GHB A;  4EF1 A;  2B3B A;  3OSQ A;  1Y4C A;  1DOT A;  2F7C A;  2F6P A;  4YAH X;  2I48 A;  3QK6 A;  3PV0 E;  3T96 B;  1AMF A;  1MY3 A;  4XKP A;  3W9W A;  3ZKL A;  1B3G A;  1DPE A;  3MZB A;  1I6A A;  4KHZ E;  1B5I A;  2CZL A;  2OWS A;  5I56 A;  2QS3 A;  5H8N B;  3THI A;  5HPQ A;  5AA4 B;  5I59 A;  1D4N A;  2F78 A;  1IXC A;  2P0S A;  2I0C A;  4FJP A;  1KWH A;  3TAJ A;  4U4S A;  5CM6 A;  5DT6 A;  3MVW A;  4TOZ A;  4U1O A;  1B7U A;  3U72 A;  4BLA A;  2DWJ A;  1MH3 A;  5ICQ A;  3EPE A;  3BFU A;  4XKR A;  1MPC A;  3CI8 A;  2RC9 A;  3ECR A;  1OLC A;  2AIX A;  3PD9 A;  1ZU0 A;  1ZLQ A;  4G68 C;  1Y1M A;  1LGB C;  4EUO A;  1II5 A;  1NNP A;  2RCA A;  1OMP A;  2VD2 A;  4JB7 A;  2NVU B;  3O66 A;  1A55 A;  1LAX A;  1LCT A;  2UXA A;  4O3B A;  3VLU A;  3TEP A;  3H6V A;  4F1Y A;  4H65 A;  3HHG A;  4KYE A;  2OZZ A;  1MY0 A;  2UVJ A;  3H06 B;  4U1Z A;  1MPD A;  1O7T A;  2F36 A;  3IOU A;  1B7Z A;  4Z0I A;  3LSX A;  1SYH A;  1XS5 A;  2DYX A;  3CIJ A;  2XXQ A;  1YAE A;  2O84 X;  2VD3 A;  3LR1 A;  1HSL A;  2XX8 A;  3KSJ A;  5H8H B;  3RPW A;  5LOM A;  3S9M C;  1URD A;  5KDT A;  3O6G A;  4QFO A;  3QAX A;  1HSJ A;  3KSX A;  2X7Q A;  4R72 A;  2O1L A;  3JYR A;  1FTJ A;  4ZEC A;  4C1T A;  3V83 A;  1B3F A;  1B52 A;  1SQY A;  2HZL A;  2RF1 A;  4HW8 A;  5AA2 A;  3MPL A;  4L17 A;  2XHD A;  4OFO A;  5I2K B;  1MH4 A;  3W9V A;  2UYE A;  2XD2 A;  1Y3N A;  4H5F A;  1QW0 A;  1DTZ A;  1VFD A;  4RK9 A;  1GVC A;  2H98 A;  3UA8 A;  4DZ1 A;  2HAV A;  5DVJ A;  1XHY A;  1MPB A;  1PBQ A;  5AA2 B;  2REJ A;  4LA9 A;  4OVJ A;  1ATG A;  2GH9 A;  4I9D A;  1USY H;  4QSC A;  1EH3 A;  2PYY A;  4JDF A;  3O9P A;  1LBB A;  4OYV A;  3SET A;  3T9U A;  5IAI A;  1P1U A;  2DWI A;  5DEX B;  4ONY A;  1EZP A;  3PMV A;  1A8E A;  3C33 A;  4GL0 A;  4YKJ A;  3R26 A;  4G68 B;  4GOT A;  5H8Q A;  3R7X A;  3Q28 A;  1R1N A;  4GWO A;  1FQB A;  4R9G A;  4KQP A;  3L6H A;  3K02 A;  3N26 A;  4JBZ A;  1AIV A;  3TMG A;  4MLQ A;  5AA4 A;  4NF4 A;  4G8N A;  2D5W A;  3M8U A;  2A5T B;  4YIC A;  3V89 B;  4GFR A;  5TP9 A;  1MRP A;  4Q8R A;  3HHF A;  2ABH A;  3OEL A;  4PFY A;  3PUW E;  1MY4 A;  2DP8 A;  3PUX E;  4OET A;  4TLM B;  3TTR A;  5HBC A;  1JVY A;  1D9Y A;  2PBW A;  4QFP A;  4LAT A;  2DXY A;  4F3P A;  1QKB A;  1B5J A;  2DE3 A;  4MBP A;  1DPP A;  2V25 A;  4OTE A;  3PUY E;  1JVX A;  4LQ5 A;  4P11 A;  3HPI A;  3OOA A;  1FTO A;  4RPO A;  1R9Q A;  4ZEF A;  3TUS A;  2DOJ A;  2XXU A;  1IXG A;  2Q89 A;  4GXS B;  2WKY A;  3DP4 A;  3KBR A;  1QJM A;  3ODB A;  3UGW A;  3RUM A;  2V3U A;  3TFL A;  1JEV A;  1EU8 A;  3RT8 A;  3VE1 B;  3KEI A;  4EXK A;  1A54 A;  2O6A A;  5I84 A;  1QUL A;  4QFK A;  4RNS A;  2O7U A;  5M2V A;  4XIG Q;  3MP8 A;  4THI A;  1M5F A;  3FVN A;  4FAT A;  1FCK A;  2R6G E;  3FVO A;  4GLI A;  3EQ1 A;  1MXZ A;  3GLB A;  5I2N A;  1XVY A;  2Z8E A;  4F19 A;  4IO6 A;  1NMU A;  2V84 A;  2DVZ A;  3HN0 A;  1JET A;  2BJJ X;  3KN3 A;  4ECF A;  1MQG A;  4NE4 A;  4TLL B;  3S2V A;  1P1Q A;  2F5X A;  5JTY B;  1L5T A;  1N3X A;  3FXQ A;  3KJ7 A;  3EN3 A;  3VXC A;  4H8I A;  1OQG A;  3RLF E;  5K2Y A;  4PFU A;  3O6H A;  3SEW A;  3EHU A;  1TT1 A;  1MQI A;  3CG3 A;  3MP1 A;  1SI0 A;  2PX1 A;  5ISU A;  4FOR A;  4NTL A;  3MJN A;  4YMB A;  2ZNU A;  2Y7I A;  4GRK A;  1FTK A;  1AOV A;  1VE4 A;  3CRB A;  3KOS A;  5K2X A;  2Y7R A;  3IOR A;  3IOV A;  3N94 A;  3WAE A;  1ZKB A;  5KCJ A;  5H8N A;  2RKM A;  1UTB B;  2XXX A;  4RXL A;  5I59 B;  3IOW A;  2I49 A;  1JNF A;  4IY6 A;  1XOC A;  4LON B;  4QFN A;  4EDP A;  4QF9 A;  4RJZ A;  4OEV A;  1LB9 A;  2H4I A;  3B6T A;  1B46 A;  1B51 A;  3H7M A;  4MFI A;  1MXX A;  1SW2 A;  3FJ7 A;  1QUJ A;  2W7Y A;  3SKP A;  3FXR A;  2FNC A;  3G3G A;  4G68 A;  3TZA A;  1DTG A;  4C0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...