3LCNA

Nab2:gfd1 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
96
structure length
96
Chain Sequence
QYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVSRDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear polyadenylated RNA-binding protein NAB2
publication title Structural basis for the function of the Saccharomyces cerevisiae Gfd1 protein in mRNA nuclear export.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Nuclear protein
total genus 34
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11517 Nab2 Nuclear abundant poly(A) RNA-bind protein 2 (Nab2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.40 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3lcnA00
2JPSA 2V75A 3LCNA
chains in the Genus database with same CATH superfamily
3FHGA 4AI4A 1PVSA 3FSPA 4OFEA 3OYEA 4YPHA 4OFHA 4B23A 1ORNA 1ORPA 3OH6A 4E7JA 3F10A 2W04A 1LWWA 1KO9A 4HSBA 1MUNA 1VRLA 1XQOA 4EJYA 1WEIA 1KG2A 2ABKA 3FHFA 3CVSA 2V75A 4AI5A 3N5NX 3KTUA 1P7MA 1HU0A 4BDYA 2NOHA 3I0WA 3L2VA 3OS0A 3S3MA 4EJZA 2H56A 4NZGA 1XQPA 4UNFA 4B24A 1KG5A 5CHZA 3OYKA 4EA4A 3N0UA 3NNQA 4E7KA 4E7HA 3OYIA 1PU8A 4E7IA 3R2XC 3L2UA 1U84A 3OY9A 4E9EA 3OGDA 4E9HA 1LMZA 1FN7A 2YG8A 3OYLA 3CWUA 2W03A 1KG7A 4E9FA 1M3QA 3OYCA 2NOLA 1N3AA 3I0XA 3CWAA 1WEFA 1MPGA 3OYMA 2YG9A 4E7LA 3S6IA 2I5WA 3S3NA 3CWTA 4BDZA 3OYFA 3OYHA 3CW7A 3OYDA 4PIIA 1KG3A 1NGNA 4ZTFA 3IH7A 2OFIA 3G0QA 4IKFA 1PU6A 2NOZA 4B22A 1LWVA 3OS1A 3OH9A 1MUDA 5KN8A 5FRMA 4AIAA 3CWSA 3OYGA 4B21A 1YQLA 1KG4A 4YPRA 1YQMA 3IHOA 4EW4A 1YQKA 4BE1A 5FRNA 2JHJA 3OS2A 3KNTA 3VW4A 1YQRA 4EVVA 5AN4A 1KQJA 4OFAA 3CVTA 3L2QA 1KEAA 1N3CA 4UOBA 1N39A 1XG7A 5KN9A 4EW0A 4BACA 1PU7A 3LCNA 1NKUA 1RRQA 2NOEA 2NOFA 4BE2A 1MUYA 2JPSA 2OFKA 1EBMA 4YOQA 4BE0A 3S3OA 1KG6A 3OYJA 3D4VA 4EA5A 3OYAA 2NOIA 4DK9A 2XHIA 1RRSA 2JG6A 3OYNA 3OYBA 4ZTJA 1LWYA 2NOBA 3F0ZA 1M3HA 4E9GA 1DIZA 2JHNA 5FROA 5DPKA 1P59A 1WEGA 3L2RA 3L2WA
chains in the Genus database with same CATH topology
4E7HA 3OYIA 4BACA 4E7IA 3LCNA 3OYEA 4IKFA 4BE2A 3L2UA 3OY9A 3OS1A 2JPSA 4E7JA 2W04A 5FRMA 4BE0A 3OYLA 3OYGA 2W03A 2V75A 3OYJA 3S3OA 3OYCA 3OYAA 4BE1A 5FRNA 4BDYA 3OYMA 3OS2A 3L2VA 3OYNA 3OYBA 3VW4A 4ZTJA 4E7LA 3OS0A 3S3MA 4NZGA 3S3NA 5FROA 3L2WA 3L2RA 4BDZA 3OYFA 3OYHA 3L2QA 3OYKA 3OYDA 3NNQA 4E7KA 4ZTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPS A;  2V75 A;  3LCN A; 
#chains in the Genus database with same CATH topology
 3FHG A;  4AI4 A;  1PVS A;  3FSP A;  4OFE A;  3OYE A;  4YPH A;  4OFH A;  4B23 A;  1ORN A;  1ORP A;  3OH6 A;  4E7J A;  3F10 A;  2W04 A;  1LWW A;  1KO9 A;  4HSB A;  1MUN A;  1VRL A;  1XQO A;  4EJY A;  1WEI A;  1KG2 A;  2ABK A;  3FHF A;  3CVS A;  2V75 A;  4AI5 A;  3N5N X;  3KTU A;  1P7M A;  1HU0 A;  4BDY A;  2NOH A;  3I0W A;  3L2V A;  3OS0 A;  3S3M A;  4EJZ A;  2H56 A;  4NZG A;  1XQP A;  4UNF A;  4B24 A;  1KG5 A;  5CHZ A;  3OYK A;  4EA4 A;  3N0U A;  3NNQ A;  4E7K A;  4E7H A;  3OYI A;  1PU8 A;  4E7I A;  3R2X C;  3L2U A;  1U84 A;  3OY9 A;  4E9E A;  3OGD A;  4E9H A;  1LMZ A;  1FN7 A;  2YG8 A;  3OYL A;  3CWU A;  2W03 A;  1KG7 A;  4E9F A;  1M3Q A;  3OYC A;  2NOL A;  1N3A A;  3I0X A;  3CWA A;  1WEF A;  1MPG A;  3OYM A;  2YG9 A;  4E7L A;  3S6I A;  2I5W A;  3S3N A;  3CWT A;  4BDZ A;  3OYF A;  3OYH A;  3CW7 A;  3OYD A;  4PII A;  1KG3 A;  1NGN A;  4ZTF A;  3IH7 A;  2OFI A;  3G0Q A;  4IKF A;  1PU6 A;  2NOZ A;  4B22 A;  1LWV A;  3OS1 A;  3OH9 A;  1MUD A;  5KN8 A;  5FRM A;  4AIA A;  3CWS A;  3OYG A;  4B21 A;  1YQL A;  1KG4 A;  4YPR A;  1YQM A;  3IHO A;  4EW4 A;  1YQK A;  4BE1 A;  5FRN A;  2JHJ A;  3OS2 A;  3KNT A;  3VW4 A;  1YQR A;  4EVV A;  5AN4 A;  1KQJ A;  4OFA A;  3CVT A;  3L2Q A;  1KEA A;  1N3C A;  4UOB A;  1N39 A;  1XG7 A;  5KN9 A;  4EW0 A;  4BAC A;  1PU7 A;  3LCN A;  1NKU A;  1RRQ A;  2NOE A;  2NOF A;  4BE2 A;  1MUY A;  2JPS A;  2OFK A;  1EBM A;  4YOQ A;  4BE0 A;  3S3O A;  1KG6 A;  3OYJ A;  3D4V A;  4EA5 A;  3OYA A;  2NOI A;  4DK9 A;  2XHI A;  1RRS A;  2JG6 A;  3OYN A;  3OYB A;  4ZTJ A;  1LWY A;  2NOB A;  3F0Z A;  1M3H A;  4E9G A;  1DIZ A;  2JHN A;  5FRO A;  5DPK A;  1P59 A;  1WEG A;  3L2R A;  3L2W A; 
#chains in the Genus database with same CATH homology
 4E7H A;  3OYI A;  4BAC A;  4E7I A;  3LCN A;  3OYE A;  4IKF A;  4BE2 A;  3L2U A;  3OY9 A;  3OS1 A;  2JPS A;  4E7J A;  2W04 A;  5FRM A;  4BE0 A;  3OYL A;  3OYG A;  2W03 A;  2V75 A;  3OYJ A;  3S3O A;  3OYC A;  3OYA A;  4BE1 A;  5FRN A;  4BDY A;  3OYM A;  3OS2 A;  3L2V A;  3OYN A;  3OYB A;  3VW4 A;  4ZTJ A;  4E7L A;  3OS0 A;  3S3M A;  4NZG A;  3S3N A;  5FRO A;  3L2W A;  3L2R A;  4BDZ A;  3OYF A;  3OYH A;  3L2Q A;  3OYK A;  3OYD A;  3NNQ A;  4E7K A;  4ZTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...